3ETAA

Kinase domain of insulin receptor complexed with a pyrrolo pyridine inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
293
Chain Sequence
EVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, transferase
molecule keywords insulin receptor, kinase domain
publication title Discovery of 3,5-disubstituted-1H-pyrrolo[2,3-b]pyridines as potent inhibitors of the insulin-like growth factor-1 receptor (IGF-1R) tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 293
sequence length 294
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3etaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3etaA01
4AZEA 2C6DA 5EDQA 2F57A 3NUPA 1LP4A 4XG7A 2GNFA 5FLFA 4CXAA 2PUNA 2AC3A 3NWWA 4IACA 4X3FC 5L8KA 2VU3A 4OUCA 3GCSA 3R30A 2VWIA 4C4HA 2WTDA 4OTWA 1KE7A 2CDZA 2GSFA 5LVPA 3PVWA 2UZBA 4PP7A 4XV3A 4J96A 3E88A 4PL3A 2F7ZE 4V04A 3W55A 3WIGA 5ETCA 3H3CA 4L45A 4I5HA 4C36A 3HLLA 2XKEA 4G17A 4IAIA 4JIAA 4Q2AA 1XBAA 3QF9A 5C8MA 3V5LA 4TYIA 3MA3A 4L67A 5DE2A 4AXAA 3HZTA 3GU6A 4GW8A 1UKHA 4ONAA 5HESA 3NUSA 4RC4A 3TDWA 3GQLA 3FXZA 2YCSA 4R77A 2VN9A 1ZZLA 1MRYA 3RCJA 2R4BA 2O8YA 2VNYA 5KMLA 4BHZA 2IPXA 4TRLA 1F3MC 2CN8A 4FA2A 2F9GA 3C0IA 2OH4A 2BR1A 4MX9A 5GJFA 3FZTA 4GMYA 2VTHA 4I22A 5EKOA 3QRIA 3LMGA 2H9VA 5CX9A 4ZSGA 1G8SA 2HW6A 3DXPA 1PRYA 3PTGA 5CNNA 2CNUA 2VTJA 4YSJA 5HIBA 3FXWA 2WHBA 1JSVA 3V5WA 3TUBA 3QCQA 4MXYA 3EOCA 4R78A 3FZSA 2QG5A 3KF7A 4I6BA 3KF4A 2QCSA 3Q9WA 4LMUA 1XR1A 4ZSEA 5HLWA 1SNUA 3LFFA 4E93A 2XRUA 3AMYA 3Q6WA 4PTGA 4ZTLA 4HGSA 2Z60A 4FKWA 2B4SB 5JN2A 3V8TA 3U6JA 1YDRE 5BYLA 4PP9A 3ZTXA 4I0RA 5CAUA 3FEGA 2OZOA 1REKA 1T45A 3RNIA 3ZLXA 3SOAA 4FKUA 4X0MA 5E92A 4AACA 2BAKA 2WOUA 3GQIA 4QRCA 3D5WA 4S2ZA 4U7ZA 1GOLA 3OROA 5A3XA 4BWXA 4AP7A 2X7OA 2XEYA 2C0IA 4JG7A 3SG8A 4BTFA 4R6VA 4G9RA 1S9IA 1UKIA 2EB3A 2XYUA 3DBQA 3FXXA 4FV5A 5JGAA 5IQCA 2QLUA 2PU8A 3UO6A 3IQ7A 5CF5A 4ZP5A 1M17A 2HENA 4D5HA 4FOCA 2PVRA 2EXCX 5AAEA 3ORKA 4GSBA 3V01A 1EH4A 4E5AX 2XK6A 3F61A 2BILB 3PXQA 3QTXA 5J9YA 5LVNA 2P4IA 4I5MA 3I60A 4IX5A 2NRYA 3GB2A 3UQGA 3PSDA 2RG5A 5A4LA 4NFMA 4BGGA 4CFUA 5BVNA 1CMKE 2FYSA 2X9FA 4UZHA 1IRKA 2E9PA 2V62A 3GXLA 4FTQA 4RX9A 5HKMA 4BCQA 5DT3A 5A4TA 3PIXA 3Q2JA 2WFYA 1DAWA 4QOXA 3QD0A 4KUJA 3MY0A 5HBJA 1CKIA 5CZHA 4RIYB 4IX4A 5FRIA 4RLLA 4HNFA 2X2LA 3ULIA 4I23A 4AGUA 3Q5ZA 4TNDA 5FM3A 4CMUA 3BKBA 1J7IA 1UVRA 2RFNA 3ZMMA 4ZAUA 1RDQE 4EKKA 4BKYA 3ZM9A 1OIQA 3HRBA 4GIHA 4WD5A 5KZIA 1UU7A 4XMOA 3R7VA 3MVMA 3C4XA 2PYWA 1AQ1A 3U6HA 3EYGA 4C35A 2WMBA 3TM0A 5C4LA 3QXOA 2H6DA 5ANJA 3OTVA 2C1BA 4EJ7A 5DI1A 2C3KA 3R8ZA 5DLSA 1OPKA 2CLQA 5AV3A 1JBPE 2XJ1A 3BHTA 3EKKA 4R3PA 3ZUVA 3VUIA 4F9CA 5A54A 5I9ZA 3NNWA 1B39A 4G6NA 4YJSA 4C4FA 5DRDA 1O6LA 2JDVA 4BTMA 2OO8X 5KBQA 3VW8A 3R22A 1Q3DA 2ZOQA 4IDTA 1JKTA 2PK9A 3O96A 5EDPA 3IDPA 2G01A 4RQVA 4J7BA 4OT5A 3R63A 4WO5A 4DN5A 2GQSA 3UOKA 4LRMA 1M7NA 2YM5A 4TWPA 2R3QA 3BHUA 3RAHA 5C1QB 3UMXA 4PTEA 5HTIA 3ZDIA 3EQDA 3OXZA 3NVMB 3E92A 3PUPA 4CSVA 2ITTA 2OFVA 4I6QA 4DGLC 2XA4A 2GS6A 3PPZA 4IBMA 3EN5A 4U79A 5ANGA 1Q4LA 5G6VA 1GZ8A 2ZV8A 3D83A 5LCKA 5CY3A 3KQ7A 4I0TA 4C34A 3RTPA 2YDIA 1OMWA 4XG9A 3S0OA 3QZIA 2XRWA 3SV0A 2EWAA 4IB3A 4FX3A 4WNKA 4Q5HA 2PWLA 5EQPA 5M09A 4ANQA 4USFA 1DI9A 4M8TA 2ZDTA 5AV1A 2CHLA 4O82A 4MF1A 3V5TA 4L68A 3GGFA 2P2HA 3LJ0A 1FMOE 3FL5A 3VULA 3LFQA 4E6QA 3MS9A 4ALUA 4ZJVA 5BYYA 3I4BA 4WRSA 4D2PA 1CDKA 2EU9A 3QCYA 3D94A 1YRPA 2ZV2A 4MTAA 2X9EA 3PE1A 4TYJA 3SX9A 3VC4A 4EYJA 1YWVA 3MB6A 4ZSJA 1BLXA 4FR4A 4NUSA 2XK9A 3N9XA 4U9AA 1Q41A 2ESMA 4OLIA 3GT8A 5IG1A 4EHGA 2PUPA 1DAYA 5A4CA 3P08A 4DYMA 5HLNA 3NYVA 4EEVA 3BYUA 2XM8A 3MH3A 4Y46A 4EHZA 4EQCA 2GNGA 4AA4A 4FTIA 2XJ0A 4PTCA 4GT3A 2ITQA 3UYTA 2Y9QA 3ORPA 4LFIA 4WIHA 4X3FA 2P3GX 3FI4A 1MQ4A 2X8IA 1M7QA 3KA0A 5FDPA 4CFFA 3D2KA 3E3PA 3GCQA 4RWKA 4QT1A 2C68A 4JQEA 4ACCA 4FV4A 2UW8A 4XLVA 3VRZA 1ZMUA 3CY2A 1ZY5A 5J8IA 2KTYA 4ZY6A 1LR4A 3KULB 4ANBA 4N57A 4JOAA 4N70A 3RM7A 3SC1A 2R3GA 4IMYA 3G5DA 3KEXA 4RVMA 5FG8A 2J5FA 1GZOA 3DB8A 3DKCA 3AC2A 3UGCA 2XUUA 1URCA 2ITNA 4DFZE 3IECA 5ICPA 2HXLA 3FI2A 1U54B 3QTQA 1Z5MA 3FMLA 2CKEA 5CALA 4QMPA 2CNVA 3FPMA 3KVXA 4GG5A 3ZSHA 5KHXA 4KSQA 3QHRA 4O6LA 4NW5A 4ANLA 3U54A 4UXQA 2C3LA 5DBXA 5F94A 3SXSA 4DFNA 1P4FA 4N6YA 4ZZNA 5IQDA 4U3ZA 1OGUA 1DM2A 4OTFA 4AG8A 4HOKA 1KE6A 5EQEA 5BUEA 4FKPA 3UO5A 2RIOA 1KV1A 4O81A 3VUDA 4YHJA 2OSCA 5D7AA 3LHJA 4FKOA 2QG7A 3BI6A 2B7AA 4WBBB 2F4JA 4CTCA 3LXLA 4O0UA 2IW9A 2CPKE 3RZFA 3D0EA 4NM3A 5HGIA 5HQ0A 4GIIA 2VGPA 1UWJA 4NKSA 5BX0A 1YOJA 4KINA 5KUPA 4I93A 4GCJA 4ANNA 4YUQA 3JY0A 1R39A 2E9UA 5K0KA 4EH3A 4OTQA 5HE2A 3PG3A 2WMTA 4MCVA 4NTTA 1OB3A 4HCTA 4XJ0A 1GNGA 4NIFA 2PMOX 3FQSA 3PZHA 4DHFA 4MYGA 4QMVA 4XYFA 3ET7A 3P7CA 4B6LA 5L2WA 2IZRA 3DBEA 2PVKA 3D7TB 4PUZA 5EM7A 4F7JA 4G16A 3RPYA 4YTHA 4YJRA 4EOKA 2WMSA 4CRSA 1Y6BA 4M69B 1AD5A 2HY81 1H24A 2UZWE 4LI5A 3W10A 1Q24A 1JVPP 4XP0A 3WYXA 5LVOA 5E8VA 3FHRA 2YM6A 4Q5EA 4Y83A 4OBPA 3KGAA 3RJCA 4EORA 1H01A 1J3HA 1LEWA 2JC6A 1JKSA 3AMBA 2R3RA 4BDGA 5IF1A 5IMXA 1A9UA 3CSVA 3FC2A 3RALA 4JQ7A 1W84A 3HV5A 2W1IA 4FEQA 5HIEA 3SA0A 2Q0NA 3VS5A 1Q97A 1PYEA 2Y4PA 5LMAA 2IZSA 4EC8A 5GNKA 4QTAA 5HIDA 4C4GA 1OPLA 5C01A 4EH7A 3OHTA 3QX2A 3FSFA 2W1DA 4DFUA 4YTFA 4CZTA 1PXKA 2C6TA 1FMKA 2WEIA 1SYKA 3VUKA 4FT3A 4CRLA 4WNPA 4BTJA 3DNEA 3UPZA 4C4IA 5I9WA 2PMLX 3BBWA 5T6KA 5I9VA 2YZLA 3HVCA 3Q32A 4U5JA 1WZYA 5E8YA 1PXIA 5CU4A 4D0WA 3VS2A 4G3CA 4I6FA 3SGCA 3W18A 5GJDA 1A06A 2XF0A 1YXTA 1KV2A 4FMQA 4BDHA 4OAVB 3E87A 3QRUA 4BDEA 5CF4A 4M66A 3UQFA 5L6WL 3QQJA 2UW6A 4XG6A 3TKHA 1J1CA 4I21A 4J8MA 3JXWA 3I5ZA 3SDJA 4EQUA 3BV3A 3EQRA 5HTBA 3M1SA 5I9XA 4WBOA 5CAPA 3JYAA 2BHEA 4BKJA 4XLIA 3OT8A 4Y5QA 5CI6A 5DOSA 3UOHA 3JPVA 4DEIA 3NNXA 5HCXA 3CQEA 1WBVA 1STCE 5HEZA 3DK3A 4CD0A 4YC3A 4I41A 4RSSA 4IM0A 5FTQA 4DAWA 4QMUA 3L8SA 1Q61A 3BIZA 4TNBA 2Z7RA 2BIKB 3EWHA 3I5NA 2OF2A 3SQQA 2IWIA 3TXOA 5AA8A 5CAOA 2IZTA 3P5KA 4QQCA 2C6LA 3L8PA 4C38A 4J8NA 3EN7A 4M84A 5AX3A 4F0FA 3KXGA 5A4QA 5M08A 3DA6A 4K6ZA 3NSZA 3HV4A 3DAKA 3ANRA 1W83A 4LGDA 4M0ZA 3CQWA 4BCPA 4YZCA 5IQBA 3G9LX 2IN6A 2RFDA 2SRCA 3KRWA 2ITZA 5C27A 4DT8A 2IO6A 2HIWA 1YQJA 4JQ8A 2PE0A 2A19B 4ZOGA 3ULZA 5JSMA 4QO9A 1M52A 1F5QA 4R5SA 4BCFA 2FSOX 1BL7A 2W4KA 3ZFMA 4I3ZA 3QAME 5LXMA 3MVHA 4J97A 1TQPA 1T46A 4WSQA 5KHWA 2H34A 4FTNA 2HZ4A 3IOPA 5J9ZA 3KCFA 2VX1A 2XVDA 3TNWA 4QP2A 5IZFA 4CNHA 2WQMA 4IXPA 3A4PA 2JAMA 3RNYA 2YM8A 3E7OA 4CKIA 4TL0A 3W2PA 4L3PA 1KE5A 4BDFA 4EOLA 3PP1A 2XKCA 1TQMA 1WBSA 1Q5KA 2PVYA 2ZMCA 3PVBA 2BPMA 4IAYA 4U81A 3TWJA 1KUTA 4UYAA 5JRQA 4YNEA 5EM6A 2WTVA 3Q04A 2ZV9A 3MV5A 4W4WA 2Y6OA 4HPUE 4DH5A 1WBOA 5GIOE 4MNEA 3PY3A 4CKJA 4AS0A 1SMHA 4LQMA 2Z02A 2EVAA 2VWUA 3VS4A 2DYLA 3TNQB 2WOTA 4FYOA 3UG1A 4ZTNA 2FGIA 2GTMA 3I7CA 5CVHA 1XQZA 2OJGA 4DITA 4PPBA 3QCXA 5I5ZA 3ERKA 4JR3A 5E8WA 1SZMA 3R8MA 4ZLOA 1G8AA 4OR5A 2BHHA 1QPEA 5E8XA 4QQTA 5AA9A 4IHPA 4XG8A 3A99A 3QTSA 4JI9A 3W16A 3R6XA 4BYJA 5JFSA 4HNIA 4JXFA 3LFSA 2Q83A 4Y73A 1APME 5AP4A 2WELA 2C3IB 2JIVA 1UNLA 2UZOA 3C0HA 3K5UA 3OCSA 3PWYA 1K9AA 4FC0A 4GU6A 4KD1A 3CD8A 1AGWA 3V04A 1VEBA 4FKJA 4BN1A 1Z57A 5CU3A 3NW5A 2Z7QA 3IW7A 2XEZA 4HVHA 5HX8A 2CKOA 4IM3A 1ATPE 3E8EA 1GAGA 3R7YA 1PHKA 4I24A 4EOSA 3TZ8A 5ETAA 5LVLA 5EG3A 3CCNA 3GC0A 3IS5A 2JITA 3KRRA 5GZ9A 4EL9A 3FLYA 3U55A 4FV2A 2PVFA 2B1PA 4K8AA 3TTIA 4PF4A 4AN3A 1FPUA 4V0GA 4YZNA 1MP8A 4C59A 2C0TA 2VO3A 5H8BA 4HW7A 3VS1A 4HCUA 5AR2A 3DB6A 3GUBA 5C03A 5KMIA 4DCAA 1PW2A 2AYPA 3BWJA 2X8EA 5AP6A 5FEQA 1L8TA 4FTMA 1WVWA 4S34A 5HCYA 3F5GA 4IW0A 4FTAA 5HBHA 3SOCA 1BX6A 2QU6A 4E4NA 5CI7A 4EH6A 4IDVA 3R83A 4ID7A 4W4XA 2OWBA 5TT7A 1XO2B 4XRJA 3DFCB 4ZZMA 2GTNA 4FTOA 4L6QA 4YLKA 1O9UA 3FZOA 4K11A 1SNXA 3F7WA 3ZOSA 4L01A 3VUGA 1MRVA 2J6MA 3EQHA 3OS3A 3FLSA 3P7BA 4FE2A 2JDRA 2BUJA 5D41A 5EQYA 1XHAA 5BMMA 4F0GA 4LUEA 2WKMA 5AX9A 3R7GA 4OTHA 4AOTA 1Q62A 1YI6A 2VWWA 1OBDA 4PL4A 4KIQA 4DT9A 5HU3A 4E73A 1YWRA 3FDNA 5J87A 4QYHA 2YN8A 3FMJA 2GMXA 3QRTA 3VW6A 4UMTA 1ZXEA 3QUEA 3P9JA 5A9UA 3GFWA 2R0IA 3HA8A 3F66A 4YZMA 5IEVA 2OIDA 2YLEA 3M2WA 2J90A 2GDOA 1U46A 4RLKA 3E8DA 4GFOA 5FWKK 4AOJA 3SHEA 4EONA 4IQ6A 2ZAZA 2IW6A 2UZDA 2R2PA 3NUYA 3FKOA 4FL3A 4N4SA 4DF3A 2XK8A 3LKMA 2VWYA 3F5PA 3RBWA 4WSYA 2OBJA 3M42A 3L8XA 4AW1A 2WQBA 3R73A 4AZSA 2H96A 4GYIA 3NX8A 4D2WA 4NKAA 4QTBA 1SVEA 2J9MA 1OKWA 2OW3A 4JBPA 5L3AA 4HJOA 2JIIA 3NUUA 2UW7A 4V05A 2BRGA 2XB7A 3BLQA 4K0YA 5HTCA 4NL0A 3HAMA 2ZM3A 2J0MB 4WHZA 1Z9XA 3WF8A 5AUUA 2ITOA 3VQHA 4FF8A 4M7IA 3TZ7A 4F70A 1ZY4A 4UN0C 4NW6A 5EYDA 3LMHA 4XV9A 3PP0A 3ZLWA 2QOQA 4WG4A 4FUYA 5IA5A 4EI4A 3G0EA 1WFCA 3ZUUA 4AFJA 5BPYA 2JFMA 4JX3A 2VTOA 3C13A 3EFLA 3GP0A 2B9FA 4ZY5A 4MNFA 2X1NA 3COKA 4EK4A 3HV7A 3UE4A 4AZFA 4BDKA 4BL1A 5EOBA 4CT2A 2VGOA 2JKMA 1JWHA 3O17A 3P0MA 3F5UA 3LM0A 2CCHA 4FT5A 2RSVA 3BEAA 3UVRA 2W0JA 3MY1A 2C5NA 4IVDA 3LM5A 5ANEA 2XK7A 4C57A 3A2CA 3PSBA 4USEA 3CIKA 1BKXA 3IW6A 5IA1A 4XUFA 3HMIA 5LARA 4IX6A 3H0ZA 3Q3BA 5JGBA 1GIHA 2FH9A 4MXCA 2J5EA 4E7WA 2PUIA 3A60A 4Z7HA 3O2MA 1XKKA 4G6OA 4L53A 1BI8A 3RKBA 5CVGA 4BYIA 3LQ8A 3V51A 5BVFA 4O7TA 3O50A 4LRJA 1LPUA 2JKOA 3MJ1A 4X2KA 2YERA 3VVHA 4BWPA 1P5EA 4D2TA 3D5VA 2NO3A 3K3IA 4X2JA 4NYEA 5M06A 4OGRA 5K9IA 3I6UA 5EI6A 5CEQA 1CKJA 3KXNA 4ANMA 3VF9A 5C26A 3U87A 3IG7A 4J99A 3UTOA 4QPAA 2XIRA 4FICA 4GG7A 3KB7A 5DR2A 4C61A 5JQ5A 3L9LA 3RWPA 3EKNA 4IVAA 3ACKA 1NVSA 4OTDA 5K5XA 1IAHA 3MB7A 4QP9A 4RFZA 4TY1A 4IB5A 3BV2A 2YDKA 3FMDA 2XS0A 3S2PA 3VN9A 3LLTA 2XNPA 5JZNA 4O7SA 1CSNA 2OZAB 3CGFA 1OL7A 3QKLA 4EZ5A 1ZLTA 4QMYA 2OK1A 1FQ1B 3Q4TA 4E4XA 4C3RA 4U44A 5CAVA 5BYZA 3ACJA 4TKSA 4RFYA 2WQEA 4D4SA 3D14A 4F65A 5BVKA 3PYYA 5FDXA 4MD9E 3NPCA 4EUTA 4O1OA 4PY1A 2J4ZA 4WOVA 4F64A 5CEOA 5EYMA 1ZOEA 2O2UA 2WPAA 3FBVA 4D1SA 3NYXA 3SRVA 3OCTA 5FBNC 3V6SA 3FZRA 1I44A 2O3PA 4TYHB 4D5KA 4DLIA 5JKGA 5M4UA 3ZRMA 3AGMA 4MEDA 5E7RA 5GJGA 4TYGA 5T3QA 3RK5A 3S00A 3QZFA 5HE1A 1W82A 2F49A 2FVDA 4H3QA 4G5PA 2QKWB 3VIDA 4Z3VA 1WVXA 3HRCA 3ZDUA 4QMTA 1GZNA 4JIKA 4FGBA 4FKGA 1E9HA 1OI9A 3HNGA 4PQNA 2R3NA 5D11A 4DC2A 1H0VA 3O8TA 5G1XA 4O7RA 5EKNA 4BY9E 5GINE 5HVKA 2YITA 3NRMA 4FV3A 4G3EA 3ODZX 4J71A 4S30A 2ETRA 3TZMA 2XIZA 1YI3A 4KS8A 4OTGA 3D5XA 2YAKA 4N0SA 5HNBA 3QKMA 4DFYA 3F2AA 2UW3A 3ZO2A 5FTGA 1M2QA 3U4UA 3SW7A 1W7HA 5EW9A 4GVAA 5KBRA 4DBNA 2ZB0A 3CPCA 3DV3A 2QI8A 4R7HA 4E6AA 5JEBA 2ZYBA 3GC8A 5M4CA 5F9EA 3NUNA 4GJ2A 3GVUA 3V5PA 4A4LA 3HGKA 2ZMDA 4FKLA 4PMSA 5KMKA 2PMIA 5JK3A 2QHMA 2QOKA 3GC9A 3PSCA 4EBVA 1NW1A 2ZDUA 3RPSA 2X2KA 4UB7A 2JAVA 5EFQA 2OFUA 5AR4A 2HW7A 4I5CA 5DYJA 3R2YA 2PE2A 4C2WA 2IZUA 2W1EA 3R7OA 2VZ6A 3FMMA 3MI9A 1U5QA 4XG3A 4DEAA 3DK6A 3EYHA 4UV0A 4D2RA 3OW3A 3I1AA 4W4YA 4JR7A 3OWLA 3SXRA 3HEGA 2YZAA 3NCZA 4BBFA 5JMSA 1PMEA 3R7EA 3G2FA 4R7BA 3KN5A 4ARKA 4WUNA 3PXRA 3AQVA 5IUHA 2CNQA 3KREA 3FHIA 4ZJIA 2IVUA 4ZLYA 5GHVA 4DGOA 5E1SA 4XHKB 3REPA 4ZZOA 3DQXA 4QMXA 3UG2A 1KE9A 3ZC6A 3CEKA 3UNJA 4S31A 2C5YA 4F63A 4FUXA 4UBAA 1PXNA 1OKZA 3MGYA 4MBJA 5DR9A 3KXZA 5AP5A 3LCSA 3V3VA 3FLZA 4B7TA 2VTRA 4UWBA 5EOLA 3WF5A 1WMKA 4QMOA 3VS3A 3MBLA 1J1BA 2RKUA 2YCFA 4KS7A 3BYMA 5IH5A 4OTPA 3KKVA 4LOQA 2YA9A 3VBTA 4YJOA 1KE8A 5LCJA 5AV2A 5KMJA 2YM3A 4MXZA 4LYNA 5H8GA 4BCNA 3QX4A 4L7SA 4C02A 5HICA 3RGFA 1Y8GA 3PIZA 4RVTA 3ROYA 2AC5A 4AW0A 1J7UA 3DT1A 3V8SA 2ETMA 1O6YA 3OUKA 2YIWA 3NYOA 3ORTA 4U97A 2QOBA 2FO0A 2XNMA 5EW3A 4HVIA 1OL2A 2R7BA 3DAJA 3PFQA 1PXMA 1JKKA 3AOXA 4L00A 4RJ5A 4RX8A 1J91A 3OTUA 5IA3A 4DFXE 3EN9A 3PE2A 5AV4A 2A1AB 3VBXA 4F9AA 1KOBA 3QL8A 3DKOA 3PY1A 4AA0A 3N4UA 2W06A 4ITHA 3ZO1A 2B9HA 2UUEA 4BIDA 3ZBXA 3BHHA 4L7FA 2GNLA 3DJ6A 4L8MA 3S3IA 3TACA 3VBQA 1FVRA 2CCIA 4TXCA 2BZJA 3QCSA 3UYSA 4CZYB 1PXLA 2CLXA 3FSKA 3F7ZA 4C33A 3Q60A 4QQ5A 1PF8A 4FK6A 5TR6A 1QPDA 4EK6A 1V1KA 3I81A 3EN4A 2E9OA 5ACBC 2BFYA 1Q3WA 5HLPA 3OMVA 2NPQA 4OAUC 5ITAA 3EN6A 4D2SA 5L8LA 3KMWA 4PV0A 4JAIA 4DFLA 3KCKA 4FODA 4W9XA 3TV4A 5A14A 5IEXA 3A8XA 3LCDA 3BHVA 2B53A 5H9BA 2Y6MA 3HMMA 4UMQA 3NAXA 1Q8WA 4L46A 2UZUE 4GK4A 4BDBA 3ALOA 3PJ8A 3ELJA 4TW9A 3Q9ZA 4RT7A 4XBUA 2DQ7X 5FTOA 5AUXA 2GHMA 3EFKA 3THBA 1HCKA 4YTIA 1VZOA 2VTSA 4QMLA 1WCCA 2GNHA 3LQ5A 4ACHA 3OF0A 5EHYA 2XYNA 2OXYA 3DU8A 4AOIA 1H26A 2JLDA 3E8NA 3EIDA 2VTPA 3PRFA 5A6OA 1OBGA 4JT3A 3DLZA 5CQUA 4AT3A 1Y57A 4YTCA 4DH3A 2R5TA 3MPTA 4JL9A 4Y72A 2WMUA 4EK5A 2W9FB 3R28A 1H25A 1MQBA 5CVFA 3CE3A 4LOPA 4YC8A 3TJDA 4A7CA 3OFMA 3QTWA 3IKAA 3ORLA 4IM2A 4F7NA 4IH8A 4K1BA 3WBLA 2PHKA 3P79A 4AAAA 4KBAA 5AIKA 4HYHA 4XCUA 4H05A 2I6LA 4O7VA 4QP8A 4U42A 2WB8A 3F69A 4D1XA 2E9VA 2C6KA 4FKVA 4BRXA 4MQ1A 4JG6A 4R1VA 2ITVA 2G15A 3C4ZA 2W96B 3AGLA 4IFCA 2CJMA 1F0QA 3LMIA 4HGEA 2WO6A 4FTRA 3L9NA 3HP2A 3QQFA 4MWIA 2PPQA 5IDPA 1P2AA 4IZYA 4AQCA 4CMTA 2C0OA 2I1MA 4FG7A 5BQ0A 2UZLA 5BNJA 1RQQA 2UZTA 4X3FB 4BF2A 4Z55A 4Q9SA 2WMQA 4FT7A 4UZDA 3H4JA 1YHWA 4PPCA 3UPXA 5ANIA 4R8QA 2QODA 4FSYA 1YXUA 3CP9A 3QU0A 4YPDA 4A9YA 4ENYA 5EI8A 2R3HA 3MH2A 4QTDA 2G1TA 3EJ1A 4AA5A 4DLJA 4X6RA 4ZIMA 2FUMA 4A9SA 3F3ZA 4EH8A 4JJRA 4LRKA 4K33A 4C4JA 3UNKA 3K5VA 5CSVA 4O0WA 3A7GA 2BDWA 3Q9YA 4FKIA 3W2QA 2WIHA 3UO4A 3VRYA 3ZONA 3K2LA 4AZTA 4RWLA 4FTJA 5K4JA 1DS5A 5T68A 2RFSA 3HV3A 1JSUA 4NU1A 2RG6A 4E6CA 4QNYA 1IG1A 4ZTMA 2ONLC 2P2IA 3R00A 2YIRA 3FJQE 4J1RA 5HI2A 3LCOA 3I0OA 4WKQA 4MXOA 1PJKA 1WBWA 3QBNA 3U6IA 4O7YA 1NXKA 5K4IA 4BI2A 4WA9A 3BYOA 4C7TA 1IA8A 3CKWA 5AIRA 4FZDB 4FSTA 4GRBA 4UXLA 3OY3A 3G51A 3OW4A 3QHWA 3DZQA 4KIPA 5D10A 5HCZA 3RWQA 4CLJA 4FSZA 1UA2A 3BCEA 4O7NA 2QOHA 4XP2A 4NM7A 1I09A 4GKHA 1OVEA 3BE2A 1XH5A 4RVLA 3VUMA 4FZAB 3P23A 1A48A 4QQJA 4CYIA 5FBOA 1Q99A 5TE0A 3ZC5A 5BVOA 2BVAA 2DWBA 3OEZA 1UU3A 2W05A 4QPSA 3T8OA 2WU6A 4FBXA 4UMRA 4AZWA 3HMNA 4KKEA 3ORMA 4QPMA 3BYSA 3OWKA 5DIAA 3C4WA 3CC6A 3FMKA 2LAVA 5M44A 4OBQA 3SKCA 4IJ9A 3UNZA 4CFNA 4XEYA 3EFJA 4FL1A 2QOFA 3IW5A 4AE6A 4BCKA 5JFXA 4ZMEA 2J0IA 4XV2A 2EXEA 4RC2A 4NIFB 3GENA 5DNRA 3BRBA 4RBLA 3BWFA 2IW8A 3LW0A 1ZYLA 4B99A 1BYGA 1WAKA 5B2MA 3PY0A 4RA4A 4AF3A 3R1YA 4YLLA 3FZ1A 1U4DA 2VNWA 4M0YA 3G6GA 3MPAA 4GFMA 5CZIA 1ZYDA 3MJ2A 2VUWA 5CS6A 4RIXA 5AJQA 4JRVA 4KABA 4IC8A 2C4GA 2CGVA 3QYWA 5KE0A 5J5TA 4GT4A 3UDBA 3UIXA 4EC9A 2Q0BA 4U80A 3T3UA 5AP2A 4DA5A 3BGQA 4NCTC 1B38A 4UYNA 3ZEPA 3FY0A 5HO6A 4ZTQA 3R9OA 4R7IA 3AC5A 4YNOA 5E9EA 4QP7A 5AFVA 2VTAA 4X7QA 2YM4A 3NZ0A 3V6RA 5FXSA 2UZVA 3EQGA 3N4VA 4ASXA 4MHAA 4FSNA 3FZPA 2YWPA 4FV6A 5CSWA 2E9NA 1ND4A 2OH0E 4DEEA 2R3JA 3TV7A 5M4IA 4PL5A 2BZHB 2IVSA 4FNZA 4GK3A 4JS8A 5E1EA 5AUVA 4HVGA 3QA0A 3DTCA 3F3TA 3R02A 3RAKA 2UVYA 3QTZA 4CFMA 4MBIA 5LMKC 3VHKA 2J51A 4FZ6A 5CENA 4H36A 4FT9A 4XG4A 3ORIA 3R8PA 3SXFA 2R3FA 3DGKA 3GU7A 3IDBA 4I4FA 2HOGA 1OKVA 2XM9A 3HV6A 4Z16A 4WG3A 3R71A 3LAUA 3EQFA 3FQHA 2FA2A 4L44A 3MW1A 2VD5A 1B6CB 2XCKA 4AX8A 3RINA 4PDYA 2FB8A 1XH8A 2BIYA 3PXFA 5A46A 2PY3A 4EKLA 4IVBA 1NT2A 4FVQA 3D7ZA 4MK0A 2B52A 3WF7A 4C37A 3GOKA 3PJCA 4E8AA 2R3OA 1K3AA 3DQWA 3ZBFA 3R1NA 2ERZE 3NNUA 4L3LA 4R3CA 1W98A 5TF9A 2OU7A 2PZRA 3GC7A 2BMCA 1H00A 4GUEA 5AUTA 5CF8A 3PXYA 3R0TA 4AN9A 5EW8A 3DXNA 1OIUA 3QQLA 2I0HA 3R7UA 3KC3A 3DK7A 2X2MA 3ZLSA 4YU2A 1MUOA 3P78A 3QQGA 5JFVA 3L8VA 5CEIA 1G3NA 1RJBA 2A27A 3R1SA 4BDDA 3DZOA 4FSQA 4FV0A 4D2VA 4DH1A 5AR3A 5IMEA 5H2UA 5KCVA 3PJ1A 2VWVA 3DOGA 4JDHA 3ZH8A 4S33A 3BGZA 3TNHA 4F1MA 3F3VA 2W1ZA 4XG2A 3H10A 3I7BA 3JY9A 2WD1A 5EDRA 4HVDA 3CGOA 3B8QA 4KAOA 4ASDA 4EWQA 3QUPA 2C1AA 2WNTA 3MIYA 4O2PA 4CT1A 1QMZA 4EOQA 5DWRA 4QYGA 2JBPA 4U45A 5HVJA 4BVUA 4PNIA 4Y95A 4DEBA 1YHSA 5D9HA 4NM0A 5L2QA 4M15A 2BRNA 2P33A 3BEGA 3L9PA 3LJ1A 3NLBA 3OBGA 5J9LA 5LWNA 3BU5A 3PJ3A 4JX7A 4P4CA 2RF9A 3R1QA 1R78A 2O63A 4Z9LA 2RFEA 2QC6A 2E2BA 3NAYA 1X8BA 4IWQA 3POZA 1V0PA 4U0IA 4BZOA 5IDNA 4RA5A 2OGVA 5KZ0A 5FEEA 2R7IA 3D15A 2OJFE 3QQHA 3QUDA 4FL2A 5C8NA 4N6ZA 3ZHPC 3EH9A 2Z7SA 3SG9A 3OD6X 4CYJA 1UNHA 2ITPA 3TL8A 4HYSA 5KKRB 2BRHA 2VO6A 3E7VA 1H1WA 4FGRA 3C4EA 4ZSLA 4EZ7A 3F5XA 3KRJA 4TWNA 4APPA 5FXRA 4GU9A 3DJ7A 4MNEB 5ACKA 3U9NA 3JVRA 5EK7A 5E8SA 3CJGA 4CCBA 4FK3A 4ACGA 4JDIA 3CTJA 4IAZA 1XH4A 4V01A 2XNOA 3MESA 1QL6A 2YDJA 3WE4A 1KWPA 3DS6A 4O84A 2ITXA 3Q4CA 4FSUA 3MTLA 5AP7A 3BBTB 3COIA 4QP1A 4FKRA 2UW0A 5AP0A 4AU8A 4YC6A 4MVFA 2BCJA 3VWAA 2JD5A 3TCPA 4GEOA 5HD7A 3TNIA 4EH5A 4BCJA 4AFEA 5CAQA 4O38A 4CV9A 3PA3A 2ONLA 2VWXA 3PXKA 4CFVA 3EL7A 1YDTE 4IIRA 4P5QA 4NH1A 3RPRA 5BVDA 2W1HA 2W1GA 3SVVA 4UMUA 4WUAA 4QYYA 3LLAA 3RZBA 3OZ6A 3QQKA 4IZ5A 4DINA 4XRLA 3GEQA 2VV9A 3I0QA 5E8ZA 4JG8A 3CR0A 2QD9A 4IX3A 3QLFA 3MFTA 4HZRA 3TIZA 2XIYA 1R1WA 4PWNA 3QD2B 3QRKA 3Q9XA 3FKNA 2IJMA 5LVMA 3ZM4A 4OT6A 1JQHA 2CN5A 3OWJA 1OIRA 3RCDA 5BVEA 3E64A 2X4ZA 3K3JA 3G15A 4IJPA 4V0GB 3RK7A 1H1RA 1Y6AA 4KSPA 4QP3A 5LMBA 3AMAA 4R5YA 3ZFXA 4MD8E 2I7QA 3A8WA 3DBDA 4YSMA 4A4OA 2VTLA 4DG2E 3IPHA 4F7SA 4RIWB 3IO7A 1UV5A 4TN6A 3G90X 2OIBA 5E4HA 1ZMWA 2CGWA 3FE3A 3MWUA 4BKZA 1CKPA 4E4LA 1ZZ2A 2JGZA 4XV1A 4BI1A 3ORZA 3R8VA 1YWNA 3DJ5A 2JFLA 3TN8A 3RK9A 3FLWA 2WTIA 5CU6A 2QR8A 4AT5A 1BUHA 4F1TA 3AC3A 3AD6A 2JIUA 4O22A 4KIKB 5CSXA 3G9NA 4USDA 2WTKB 1M14A 3HUBA 4LL5A 4UEUA 3WZDA 1ZYJA 3LFBA 3QZGA 1UWHA 2JDTA 3D5UA 4NCTA 4YJUA 3EFWA 3AD5A 5HE3A 5EM5A 3E63A 5E8TA 4JLCA 3PZEA 4O83A 4RJ3A 1FVTA 1XH7A 3IW8A 4FV7A 4NTSA 5I9YA 3LVPA 1GIJA 5D7VA 3HP5A 3PPKA 3EQCA 3RI1A 3NEWA 5IQIA 3FY2A 2F2UA 2HXQA 3ZZWA 2UZNA 2W1FA 3HAVA 3IOKA 2P55A 3Q52A 4F1OA 2GS2A 3KXXA 2PULA 5M07A 3F6XA 3QLGA 4F9BA 3IGOA 4DGNA 5LMKA 4YJVA 1FBNA 3VO3A 2VTQA 3AC8A 2YEXA 4W4VA 1JAMA 2WMRA 3TNPC 4JRNA 4BCMA 4DGGA 4ZTRA 5CQWA 1ZARA 3C4FA 3RAIA 4FEVA 4GUBA 4CTBA 4KBCA 1M2PA 3C1XA 2UZEA 3FUPA 5IUGA 2R3PA 4ITIA 5L6PA 1PY5A 3BZ3A 4E3CA 3FV8A 2A2AA 2BDFA 4MKCA 4I94A 3I79A 5DH3A 5I3OA 3F82A 4LV8A 1FGKA 2PZ5A 5IKWA 2PVHA 1JLUE 3TG1A 2WTJA 3P7AA 4QP4A 2PZPA 4BZDA 4F4PA 3C7QA 2PVJA 4M97A 3S95A 3OXIA 3F2RA 4BB4A 5M4FA 2JEDA 3AT2A 3GBZA 4LM5A 3H30A 5E91A 2OICA 3FI8A 3ZLYA 4GK2A 5JRSA 3S1HA 3PA5A 2OZAA 4BDIA 3QTRA 4ZY4A 4KRDA 5IA4A 4E4MA 2YJRA 4O0SA 3R04A 1H1PA 3H9RA 5DFPA 4DTAA 3JVSA 2F7EE 1OIYA 2YJSA 3MFRA 2V7AA 5AP3A 4AWIA 2HWPA 1OL1A 5JFWA 3CJFA 4IWOA 5H3QA 4U3YA 4C62A 1BI7A 4AN2A 4C8BA 4RQKA 4EYMA 3VS0A 2DS1A 4O7WA 2X4FA 3NUAA 4YJQA 4QD6A 3A4OX 1H07A 2BKKA 4G31A 2BTRA 4JNWA 3PA4A 4QMMA 2YM7A 4GL9A 3VBVA 3W2SA 4XS2A 2FSTX 2ZB1A 3KY2A 4EH4A 3FYKX 1IAJA 4RJ8A 3G0FA 3N51A 4D9TA 3F88A 3QTIA 3VAPA 3CBLA 2OLCA 4GH2A 5DPVA 3R9HA 3MY5A 4NFNA 3LCKA 2XK4A 4E5BA 2UW5A 2QKRA 3V8WA 1OECA 2J7TA 4CFWA 4QP6A 4YO4A 5KO1A 4CCUA 1G5SA 1L3RE 1Q8ZA 3OC1A 3FAAA 4DBXA 4DG3E 4BCHA 2R9SA 4ZTHA 3ZZEA 3Q53A 3QA8A 4IADA 4RZWA 2XBJA 4RVKA 3WZEA 4B0GA 4IB1A 4AE9A 3P86A 3MTFA 3O23A 5B2KA 2XH5A 4YJPA 1VJYA 3GU8A 3O51A 4I4EA 1R0PA 4FKSA 3Q6UA 1KOAA 3DDPA 5ETIA 5EYKA 3SW4A 4E5WA 3GCPA 3LXKA 4X2FA 4YGAA 3KFAA 3QYZA 2VTIA 3AG9A 2GFCA 2YAAA 4BFMA 4YMJA 1GIIA 2ETKA 4MAOA 3VUTA 5CSPA 5IA0A 3SAYA 4EZ3A 5IA2A 4KKHA 3EQBA 5CYIA 3WF9A 3PLSA 4DEGA 2VX0A 5IPJA 5AMNA 5IU2A 4KB8A 3CTHA 3OCBA 3PRIA 5JZJA 5BVWA 1YDSE 5EH0A 2PZIA 3W2RA 1LUFA 3CXWA 4GS6A 1FGIA 3LXPA 4UX9A 4IC7A 5IQHA 1URWA 5L2IA 1S9JA 2PE1A 4TWOA 5HG5A 3SRVB 4B8MA 4BBEA 3AXWA 4YBJA 4KRCA 3FWQA 3NR9A 3R9RA 2XIKA 4D55A 4O7LA 3NW6A 5BMSA 5IQFA 2YWVA 4WNMA 2V55A 1IASA 2CMWA 4RIYA 3BPRA 5FUTA 4BR3A 1DI8A 2XKFA 2Y4IB 4O1PA 5EHLA 1Q8TA 2GPHA 3QTUA 4KA3A 4IZ7A 5IH6A 2ZM4A 5AUWA 4G3FA 3V5JA 4X3JA 4F08A 3WARA 4LMNA 2WXVA 2OKRA 3RMFA 3E93A 2C30A 3B2WA 3UBDA 3T9TA 1XBCA 5HO7A 5K5NA 2W5BA 4FKTA 4QMWA 5DT4A 2QR7A 3LOKA 2WU7A 5CU2A 3OOGA 2O64A 4II5A 2W17A 4YZDA 5LQFA 4C3FA 2UW9A 1U59A 1ZYSA 3KK9A 1OUYA 3AT4A 2BAJA 2VO7A 2W5AA 3U8WA 3AT3A 1ZOGA 3FLQA 5HORA 4KKGA 2Z8CA 4H1MA 2PL0A 1HCLA 2OF4A 3MDYA 5D1JA 2CSNA 2RGPA 4FIIA 3P1AA 2ZJWA 5J1VA 3NDMA 3EQIA 5BUJA 3HX4A 5HE0A 1PMNA 5L2TA 3JR1A 2CGXA 4CLIA 3QC4A 4JVGA 4M14A 5JQ8A 5EHOA 1R3CA 2W4OA 2WGJA 4R1YA 5E90A 3W33A 2J0KA 2QOLA 3ALNA 4FKQA 2DUVA 3COHA 4A06A 2BFXA 3IONA 3OWPA 5HX6A 4C3PA 3ZRLA 5HHWA 1YOLA 4L43A 4LGHA 1H08A 3QALE 4D0XA 2J0JA 3LZBA 3OY1A 4RZVA 3TTJA 2EXMA 3C5UA 3Q4ZA 4BIEA 4AW5A 4QMSA 3QRJA 2WEVA 3TEIA 3C4CA 1NA7A 2Z2WA 2HZIA 4I20A 4F0IA 4JBVA 2OG8A 5KX8A 2OJ9A 5AM7A 2W5HA 4RGJA 2UV2A 3LPBA 3Q96A 4W9WA 4BZNA 3F2NA 3TI1A 3QFVA 3FQEA 2X81A 2GNIA 4ITJA 1FOTA 3L1SA 3FYJX 4Z7GA 4O0YA 5AR7A 5HG8A 3UP2A 5M56A 5IUIA 4FSRA 3KXHA 2YIXA 3ZS5A 2R3MA 3MH1A 3ZEWA 3ETAA 5CLPA 5FM2A 4CZUA 3O7LD 2X39A 4K77A 4S32A 2PVMA 4QTCA 3VBYA 3MN3A 3A61A 5F1ZA 2BRBA 4FZFB 1JNKA 3CS9A 4D4RA 2BALA 4EOJA 4P90A 4BC6A 1SVGA 2V22A 2I0VA 2WTCA 3ITZA 4G6LA 3NNVA 3LFCA 2HWOA 4XP3A 5IH4A 5JT2A 2BRMA 5DVRA 4KNBA 2QHNA 3GU4A 3A62A 2YIQA 3QKKA 4O0TA 3OP5A 1WVYA 5E8UA 3CTQA 3Q2MA 3ZO4A 3OBJA 4TZRA 4EH2A 4L42A 4O0XA 4OW8A 5HD4A 3QGWA 1NY3A 2J0LA 5ANOA 2YFXA 2C5OA 4NT4A 3UVQA 4BGQA 3MFUA 2G2HA 3MPMA 4HYUA 2GS7A 2VO0A 4FV8A 4RFMA 3RAWA 2ITWA 3DLSA 2HCKA 4I92A 4A9RA 3E5AA 3QGYA 4NSTA 3POOA 5L8JA 3RP9A 4EK3A 5DMZA 4ZMFA 2YACA 3HECA 3E8CA 4ALWA 3U4WA 2G2IA 3LXNA 3NYNA 4BICA 3ID6C 4UMPA 3KULA 1BL6A 4QMQA 1XJDA 3W8QA 3ROCA 5AV0A 3VNTA 3UODA 5GZ8A 3FLNC 2GU8A 4BGHA 3WIKA 2JDOA 2C6MA 2C5VA 2OIQA 1U54A 4IEBA 2OXXA 5HOAA 4BTKA 3B8RA 4ZEGA 5IQGA 2WMVA 1PXJA 4TT7A 3FC1X 3R9NA 4EH9A 3CKXA 4LG4A 3RHKA 5AADA 4NJDA 4F9YA 5KKRC 3CY3A 2HELA 4ASEA 4D58A 2FSLX 4H1JA 3PDTA 2VTMA 2BZKB 2GHGA 5DG5A 4HPTE 3UZRA 4FI1A 4BCIA 3MYGA 2ZVAA 2VTTA 2F2CB 4FIFA 4FYNA 4RWIA 3ZXTA 3A7IA 3WE8A 5L4QA 3W32A 2C6EA 3O7LB 4YBKA 2AUHA 5F20A 5JH6A 2PVNA 4LUDA 3VS6A 3W1FA 4JBOA 4L52A 3PXZA 5CXHA 3WF6A 5J7HA 4FNWA 4FZ7A 5B7VA 4L9IA 1U5RA 3MA6A 3DPKA 3TV6A 4M67A 3LJ2A 5HNIX 2YLFA 2NNWB 3UJGA 2C69A 2XMYA 4QMZA 2QOIA 3HRFA 4ZSAA 3Q5IA 4X2GA 4XX9A 2KULA 4R3RA 2B9IA 3NGAA 3O8UA 4PDOA 4AUAA 3O71A 1ERKA 3VF8A 5CANA 4NK9A 2QO9A 3KRXA 4A07A 2IG7A 3VS7A 4RC3A 3II5A 4AGCA 1IEPA 2XNEA 2W4JA 4YJNA 3LE6A 1Q8UA 3AC4A 3R01A 4TWCA 3UVPA 3D7TA 5M53A 3HMOA 4KBKA 2QLQA 3F3UA 4IVCA 4JBQA 3C9WA 4NZWB 3WZUA 3EB0A 3FKLA 4PDPA 4M69A 5GZAA 3RVGA 4EJNA 2XCHA 3HA6A 2GFSA 5IISA 4D4YA 5AR5A 1PMVA 4FIGA 2X7FA 4B4LA 3ATTA 1R0EA 2J2IB 1H0WA 2PUUA 3KXMA 2QQ7A 4I1ZA 5LWMA 3RHXA 2WMXA 2QOCA 2V0DA 2B54A 2WMAA 4CQGA 4X2NA 3AC1A 4MBLA 4MQ2A 4CKRA 3NCGA 4DH7A 1ZOHA 3KVWA 2VWZA 5C4KA 4YO6A 4G9CA 4IZAA 4ERKA 4YZ9A 5CSHA 4BCOA 3DXQA 3UP7A 4B8LA 4FV1A 5DEWA 3RPOA 4XOZA 4IANA 4IAKA 4BHNA 3W2OA 5LJJA 1FINA 1WBNA 4I6HA 4ANSA 5HBEA 2PVLA 2CKQA 1TVOA 4GVJA 4AZVA 2CGUA 4FTCA 2IVVA 3ZU7A 5I0BA 4G34A 3QXPA 5HZNA 4F6SA 1XH6A 4K9YA 2O5KA 4O7ZA 2WQOA 3B2TA 4P2KA 4WRGA 5TKDA 3G6HA 4EOMA 4E26A 3WZJA 5J7BA 1XH9A 1ZMVA 4W8EA 3DY7A 4GJ3A 1ZAOA 4IFGA 3IK3A 5AUZA 3QQUA 4GT5A 3DBCA 4QYEA 3PVGA 4ZJJA 2WTKC 4M3QA 5FD2A 3JS2A 4A9TA 2JBOA 4HGLA 2PZYA 2BROA 3FI3A 3V5QA 3ZFYA 1YXVA 3UIMA 2JDSA 5HO8A 4J53A 4WNOA 2VRXA 1Y91A 1OL5A 3GCUA 3HUCA 3TDVA 3PG1A 4HVSA 4FEWA 3NIEA 4MXAA 3UIUA 2ZV7A 2XKDA 4RG0A 1QCFA 4ZS4A 4KIOA 3FMEA 3QZHA 2GQRA 3BLRA 4FVRA 2P0CA 5FQDC 2FSMX 3ZYAA 4A9UA 2WAJA 2R64A 3IGGA 4WT6A 2R3KA 1FVVA 4DCEA 4ERWA 4FTTA 1MRUA 4FG8A 3TKUA 4BBMA 1VYWA 3BELA 4PMPA 4PX6A 1QPCA 5J1WA 4OTRA 3UZPA 4EOIA 4M12A 4HCVA 4ZS0A 5DHJA 1OUKA 3OUNB 2G9XA 3PIYA 1Y8YA 5ETFA 1ZWSA 3TKIA 1XBBA 2NP8A 3HMPA 3UIBA 4FTLA 3R2BA 1GZKA 4DFBA 5GIPE 1OPJA 1JSTA 5CWZA 3SD0A 4DH8A 2PSQA 3CD3A 4E1ZA 4CGAA 4BCGA 4EHEA 4D1ZA 5CF6A 2OJIA 4BDJA 2OXDA 1GJOA 3ZSIA 3ZRKA 4UWCA 4RMZA 4O96A 4XOYA 4PRJA 3S4QA 4QTEA 2C6IA 4EBWA 2O65A 4K2RA 4ZK5A 2ITYA 4FTKA 5EM8A 4FV9A 3UQCA 1OM1A 5CNOA 3WILA 4B9DA 2X0GA 3W8LA 2WIPA 3QC9A 3KK8A 4RX7A 2BTSA 4RIXB 2X6DA 2UVXA 3U51A 3O0GA 2VWBA 3VUHA 1RW8A 1V0OA 4FNXA 4YR8A 3DBFA 5DRBA 5F4NA 4BDCA 4MF0A 3H9FA 4PNKA 4YURA 2V7OA 5CEPA 2G2FA 5CTPA 3VBWA 1E1VA 2YCRA 3HYHA 3KN6A 3LFEA 1NVRA 1JKLA 1RE8A 4EHVA 4JDKA 1H8FA 3TT0A 3CQUA 5FP6A 4BIBA 2VAGA 3K54A 5DT0A 3LFAA 4Y5HA 3LFNA 4ORKA 4CFXA 4PMTA 5CT7A 2X8DA 4OTIA 3PPJA 1JPAA 2REIA 4CQEA 5CXZA 3A7HA 1Q8YA 2WZJA 2EB2A 2Y8OA 3W2CA 4EWHA 3UC3A 3PWDA 3BQCA 1OL6A 4C58A 3H9OA 1VR2A 4J95A 4LGGA 4YHTA 1H4LA 3PJ2A 5DA3A 3BX5A 4OBOA 4MH7A 2A0CX 2YISA 3HDMA 3OXTA 1PXPA 3H0YA 3OEFX 4IAFA 3ORXA 4LOOA 4MXXA 3HDNA 3CLYA 1PKDA 4EQMA 4RWJA 4RJ4A 2YABA 1KSWA 3BQRA 4EOPA 2XP2A 5HVYA 2I0EA 2R0UA 3QWJA 2QNJA 4O86A 3C51A 3OOMA 2C6OA 5AAGA 3FMHA 3IDCA 1BMKA 2R3LA 5DR6A 3GI3A 4Y8DA 4MWHA 5CEKA 3LIJA 3MH0A 3HL7A 4QYFA 5KMNA 4AT4A 3ATSA 3MFSA 3DDQA 4O2ZA 4PMMA 4H39A 5A4EA 4FEXA 4U6RA 4JAJA 3OVVA 5M55A 5I9UA 2Z7LA 4QMNA 2XIXA 4UALA 3EHAA 2X7GA 4W8DA 4ASZA 3KRLA 2GCDA 3GOPA 4ACMA 4E20A 2HZNA 1YHVA 2YIYA 4RPVA 3N4TA 5KNJA 5FP5A 4UWYA 3PVUA 3COMA 3ZCLA 3R7IA 3WZKA 4D4VA 3CPBA 1YVJA 2Y7JA 4O0RA 5B0XA 3WOWA 2V5QA 1M2RA 3A7FA 3QD4A 4O21A 3AD4A 3FMNA 1NVQA 1TKIA 3BYVA 4CMOA 5HNGA 2WTWA 1LEZA 3FL4A 4YLJA 4L3JA 4ACDA 4U8ZA 2YCQA 1WBTA 2YHVA 1PKGA 3BE9A 3VQUA 1OITA 4D28A 3F9NA 5J95A 2GQGA 2PMNX 2OI4X 3I6WA 3O8PA 4P7EA 1XWSA 4O0VA 3PLAE 4F7LA 1YXSA 3C0GA 4IE9A 3TJCA 2RL5A 4C0TA 2CKPA 1YOMA 3MVLA 2GNJA 4ZLZA 5F95A 4RJ6A 3DFAA 4GFGA 4O6EA 5FXQA 5I3RA 3ANQA 1YW2A 1UU8A 4J98A 4BI0A 2XBAA 5HG7A 1W8CA 2VX3A 4FG9A 1H27A 4H3BA 4TYEA 4E6DA 4J52A 1PYXA 4HGTA 4TTHB 4ZTSA 5HG9A 3QD3A 2Y4IC 2VTNA 2W1CA 2WQNA 4I5PA 4TPTA 3C50A 3UOJA 4YZBA 3NW7A 4IWDA 3DKGA 3G33A 2HYYA 4IB0A 2BZIB 4U43A 3DCVA 4AGWA 2WMWA 4CG8A 4NWMA 4BDAA 1H1SA 4GYGA 3UC4A 4BWKA 2HAKA 5AEPA 1JOWB 3QWKA 2I0YA 4M13A 5D12A 4DEDA 4U40A 3BGPA 3EL8A 4YHFA 5C9CA 4RIWA 3KMMA 1YKRA 4O91A 3EZRA 5IQAA 4FVPA 5AAFA 4CG9A 2BKZA 4K18A 4YP8A 3DNDA 5I4NA 5IQEA 2QONA 2UVZA 5H8EA 3ENHA 4O27B 2QO2A 4LV5A 1OZ1A 2UW4A 3WI6A 3TZ9A 5HU9A 5TOZA 4ZXTA 1O6KA 5AUYA 3RPVA 5K3YA 3TIYA 1CTPE 4C2VA 1ZYCA 5AR8A 2ZM1A 5FGKA 3T3VA 2QURA 1V0BA 4KIKA 3UMWA 3NMUF 4M68A 4H58A 2R3IA 5L2SA 1P14A 5CEMA 5C8KA 4G3GA 4DE4A 2EUFB 4APCA 4NJ3A 4FSWA 3VJOA 3BU6A 1OKYA 3NS9A 3EZVA 4RRVA 2QVSE 3R21A 4JDJA 5KMOA 4WG5A 3ZSGA 4IWPA 3D9VA 3MIAA 2XNBA 1WBPA 3ZXZA 3Q4UA 5FEDA 2H8HA 3SLSA 4AW2A 5B2LA 3GCVA 4FOBA 3OG7A 3KU2A 1PMUA 4KWPA 4RIOA 2JKQA 3EMGA 4YJTA 5EYCA 3T9IA 1IA9A 4FIJA 3HKOA 4A4XA 5M51A 4AGDA 2XNNA 3EQPA 4G5JA 4DTKA 2IVTA 4F99A 2LGCA 1E1XA 4G2FA 4CVAA 4DGMA 4RJ7A 4UY9A 3UZTA 5CT0A 4FT0A 4FSMA 3BLHA 5K0XA 3C5IA 3P4KA 4P5ZA 5AWMA 3DTWA 3MSSA 4DTBA 5ANDA 1IR3A 1HOWA 2C47A 4ALVA 4Q9ZA 3R8LA 5TO8A 5LOHA 4EOOA 3WYYA 3TUDA 3NUXA 3RM6A 1PXOA 2JKKA 2OJJA 2BAQA 2HK5A 2XNGA 1YXXA 4X6QC 4DG0E 1P4OA 4FIHA 4F6UA 2X6EA 5DEYA 1H28A 2B9JA 3NIZA 4Y85A 3LCTA 1CM8A 3UOLA 3R8UA 1ZRZA 3M11A 5A6NA 5CASA 2I40A 4CV8A 1GY3A 2GHLA 2QOOA 2B55A 4GKIA 3ODYX 5JGDA 2W9ZB 3VJNA 5J79A 1UNGA 4X21A 4XNEA 4F9WA 1J7LA 1YI4A 4QNAA 3D2IA 2XZSA 3L9MA 2XK3A 1SM2A 3OT3A 1H1QA 4XBRA 3ZUTA 4C4EA 4RX5A 5CU0A 5KMMA 3U9CA 4FEUA 1VYZA 2HZ0A 4LL0A 5ANKA 5J5SA 4DEHA 1W0XC 2ITUA 4G1WA 3ORNA 4IAAA 3FPQA 3LQ3A 1REJA 2J50A 2PTKA 2Y0AA 5DGZA 4GV1A 4F6WA 5BUIA 3D4QA 3DAEA 4FNYA 3F3WA 3LFDA 4NEUA 3R9DA 4F09A 2BDJA 3E3BX 4D9UA 3TUCA 4ENXA 4XH6A 1TQIA 2XJ2A 4U41A 5EI2A 3JUHA 3VHEA 1QPJA 3IW4A 1K2PA 2HY0A 2C3JA 3GFEA 4G3DA 2B0QA 4FTUA 4HYIA 2C5XA 2W7XA 4H3PA 5M57A 3A7JA 4MD7E 1SVHA 2NRUA 3GU5A 3OCGA 5AP1A 3ZO3A 4EUUA 2QO7A 2ACXA 3NVKI 3KL8A 4ANOA 4HZSA 2ERKA 5DN3A 2QU5A 3BU3A 3DKFA 3ENMA 3GNIB 3E62A 3KMUA 4I0SA 1UU9A 4PDSA 4CEGA 4TYHA 4YPSA 4NM5A 5AM6A 2O0UA 2W99B 4PPAA 2A4LA 3MVJA 2F7XE 5IEYA 4EK8A 3BHYA 5L6OA 4FIEA
chains in the Genus database with same CATH superfamily
4AZEA 2C6DA 5EDQA 2F57A 3NUPA 1LP4A 4XG7A 2GNFA 5FLFA 4CXAA 2PUNA 2AC3A 3NWWA 4IACA 4X3FC 5L8KA 2VU3A 4OUCA 3GCSA 3R30A 2VWIA 4C4HA 2WTDA 4OTWA 1KE7A 2CDZA 2GSFA 5LVPA 3PVWA 2UZBA 4PP7A 4XV3A 4J96A 3E88A 4PL3A 2F7ZE 4V04A 3W55A 3WIGA 5ETCA 3H3CA 4L45A 4I5HA 4C36A 3ML1A 3HLLA 2XKEA 4G17A 4IAIA 4JIAA 4Q2AA 1XBAA 3QF9A 5C8MA 3V5LA 4TYIA 3MA3A 4L67A 5DE2A 4AXAA 3HZTA 3BL9A 3GU6A 4GW8A 1UKHA 4ONAA 5HESA 3NUSA 4RC4A 3TDWA 3GQLA 3FXZA 2YCSA 4R77A 2VN9A 1ZZLA 1MRYA 3RCJA 2R4BA 2O8YA 2VNYA 5KMLA 4BHZA 2IPXA 4TRLA 1F3MC 2CN8A 4FA2A 2F9GA 3C0IA 2OH4A 2BR1A 4MX9A 5GJFA 3FZTA 4GMYA 2VTHA 4I22A 5EKOA 3QRIA 3LMGA 2H9VA 5CX9A 4ZSGA 1G8SA 2HW6A 3DXPA 1PRYA 3PTGA 5CNNA 2CNUA 2VTJA 4YSJA 5HIBA 3FXWA 2WHBA 1JSVA 3V5WA 3TUBA 3QCQA 4MXYA 3EOCA 3PUFC 4R78A 3FZSA 2QG5A 3KF7A 4I6BA 3KF4A 2QCSA 3Q9WA 4LMUA 1XR1A 4ZSEA 5HLWA 1SNUA 3LFFA 4E93A 2XRUA 3AMYA 3Q6WA 4PTGA 4ZTLA 4QDEA 4HGSA 2Z60A 4FKWA 2B4SB 5JN2A 3V8TA 3U6JA 1YDRE 5BYLA 4PP9A 3ZTXA 4MUQA 4I0RA 5CAUA 3FEGA 2OZOA 1REKA 1T45A 3RNIA 3ZLXA 3SOAA 4FKUA 4X0MA 5E92A 4AACA 2BAKA 2WOUA 3GQIA 4QRCA 3D5WA 4S2ZA 4U7ZA 1GOLA 3OROA 5A3XA 4BWXA 4AP7A 2X7OA 2XEYA 2C0IA 4JG7A 3SG8A 4BTFA 4R6VA 4G9RA 1S9IA 1UKIA 2EB3A 2XYUA 3DBQA 3FXXA 4FV5A 5JGAA 5IQCA 2QLUA 2PU8A 3UO6A 3IQ7A 5CF5A 4ZP5A 1M17A 2HENA 4D5HA 4FOCA 2PVRA 2EXCX 5AAEA 3ORKA 4GSBA 3V01A 1EH4A 4E5AX 2XK6A 3F61A 2BILB 3PXQA 3QTXA 5J9YA 5LVNA 2P4IA 4I5MA 3I60A 4IX5A 2NRYA 3GB2A 3UQGA 3PSDA 2RG5A 5A4LA 4NFMA 4BGGA 4CFUA 5BVNA 1CMKE 2FYSA 2X9FA 4UZHA 1IRKA 2E9PA 2V62A 3GXLA 4FTQA 4RX9A 5HKMA 4BCQA 5DT3A 5A4TA 3PIXA 3Q2JA 2WFYA 1DAWA 4QOXA 3UDSA 3QD0A 4KUJA 3MY0A 5HBJA 1CKIA 5CZHA 4RIYB 4IX4A 5FRIA 4RLLA 4HNFA 2X2LA 3ULIA 4I23A 4LV7A 4AGUA 3Q5ZA 4TNDA 5FM3A 4CMUA 3BKBA 1J7IA 1UVRA 2RFNA 3ZMMA 4ZAUA 1RDQE 4EKKA 4BKYA 3ZM9A 1OIQA 3HRBA 4GIHA 4WD5A 5KZIA 1UU7A 4XMOA 3R7VA 3MVMA 3C4XA 2PYWA 1AQ1A 3U6HA 3EYGA 4C35A 2WMBA 3TM0A 5C4LA 3QXOA 2H6DA 5ANJA 3OTVA 2C1BA 4EJ7A 5DI1A 2C3KA 3R8ZA 5DLSA 1OPKA 2CLQA 5AV3A 1JBPE 2XJ1A 3BHTA 3EKKA 4R3PA 3ZUVA 3VUIA 4F9CA 5A54A 5I9ZA 3NNWA 1B39A 4G6NA 4YJSA 4C4FA 5DRDA 1O6LA 2JDVA 4BTMA 2OO8X 5KBQA 3VW8A 3R22A 1Q3DA 2ZOQA 4IDTA 1JKTA 2PK9A 3O96A 5EDPA 3IDPA 2G01A 4RQVA 4J7BA 4OT5A 3R63A 4WO5A 4DN5A 2GQSA 3UOKA 4LRMA 1M7NA 2YM5A 4TWPA 2R3QA 3BHUA 3RAHA 5C1QB 3UMXA 4PTEA 5HTIA 3ZDIA 3EQDA 3OXZA 3NVMB 3E92A 3PUPA 4CSVA 2ITTA 2OFVA 4I6QA 4DGLC 2XA4A 2GS6A 3PPZA 4IBMA 3EN5A 4U79A 5ANGA 1Q4LA 5G6VA 1GZ8A 2ZV8A 3D83A 5LCKA 5CY3A 3KQ7A 4I0TA 4O4DA 4C34A 3RTPA 2YDIA 1OMWA 4XG9A 3S0OA 3QZIA 2XRWA 3SV0A 2EWAA 4IB3A 4FX3A 4WNKA 4Q5HA 2PWLA 5EQPA 5M09A 4ANQA 4USFA 1DI9A 4M8TA 2ZDTA 5AV1A 2CHLA 4O82A 4MF1A 3V5TA 4L68A 3GGFA 2P2HA 3LJ0A 1FMOE 3FL5A 3KIOC 3VULA 3LFQA 4E6QA 3MS9A 4ALUA 4ZJVA 5BYYA 3I4BA 4WRSA 4D2PA 1CDKA 2EU9A 3QCYA 3D94A 1YRPA 2ZV2A 4MTAA 2X9EA 3PE1A 4TYJA 3SX9A 3VC4A 4EYJA 1YWVA 3MB6A 4ZSJA 1BLXA 4FR4A 4NUSA 2XK9A 3N9XA 4U9AA 1Q41A 2ESMA 4OLIA 3GT8A 5IG1A 4EHGA 2PUPA 1DAYA 5A4CA 3P08A 4DYMA 5HLNA 3NYVA 4EEVA 3BYUA 2XM8A 3MH3A 4Y46A 4EHZA 4EQCA 2GNGA 4AA4A 4FTIA 2XJ0A 4PTCA 4GT3A 2ITQA 3UYTA 2Y9QA 3ORPA 4DHIB 4LFIA 4WIHA 4X3FA 2P3GX 3FI4A 1MQ4A 2X8IA 1M7QA 3KA0A 5FDPA 4CFFA 3D2KA 3E3PA 3GCQA 4RWKA 4QT1A 2C68A 4JQEA 4ACCA 3BL7A 4FV4A 2UW8A 4XLVA 3VRZA 1ZMUA 3CY2A 1ZY5A 5J8IA 2KTYA 4ZY6A 1LR4A 3KULB 4ANBA 4N57A 4JOAA 4N70A 3RM7A 3SC1A 2R3GA 4IMYA 3G5DA 3KEXA 4RVMA 5FG8A 2J5FA 1GZOA 3DB8A 3DKCA 3AC2A 3UGCA 2XUUA 1URCA 2ITNA 4DFZE 3IECA 5ICPA 2HXLA 3FI2A 1U54B 3QTQA 1Z5MA 3FMLA 2CKEA 5CALA 4QMPA 2CNVA 3FPMA 3KVXA 4GG5A 3ZSHA 5KHXA 4KSQA 3QHRA 4O6LA 4NW5A 4ANLA 3U54A 4UXQA 2C3LA 5DBXA 5F94A 3SXSA 4DFNA 1P4FA 4N6YA 4ZZNA 5IQDA 4U3ZA 1OGUA 1DM2A 4OTFA 4AG8A 4HOKA 1KE6A 5EQEA 5BUEA 4FKPA 3UO5A 2RIOA 1KV1A 4O81A 3VUDA 4YHJA 2OSCA 5D7AA 3LHJA 4FKOA 2QG7A 3BI6A 2B7AA 4WBBB 2F4JA 4CTCA 3LXLA 4O0UA 2IW9A 2CPKE 3RZFA 3D0EA 4NM3A 5HGIA 5HQ0A 4GIIA 2VGPA 1UWJA 4NKSA 5BX0A 1VLRA 3UDTA 1YOJA 4KINA 5KUPA 4I93A 4O4CA 4GCJA 4ANNA 4YUQA 3JY0A 1R39A 2E9UA 5K0KA 4EH3A 4OTQA 5HE2A 3PG3A 2WMTA 4MCVA 4NTTA 1OB3A 4HCTA 4XJ0A 1GNGA 4NIFA 2PMOX 3FQSA 3PZHA 4DHFA 4MYGA 4QMVA 4XYFA 3ET7A 2AEGA 3P7CA 4B6LA 5L2WA 2IZRA 3DBEA 2PVKA 3D7TB 4PUZA 5EM7A 4F7JA 4G16A 3RPYA 4YTHA 4YJRA 4EOKA 2WMSA 4CRSA 1Y6BA 4M69B 1AD5A 2HY81 1H24A 2UZWE 4LI5A 3W10A 1Q24A 1JVPP 4XP0A 3WYXA 5LVOA 5E8VA 3FHRA 2YM6A 4Q5EA 4Y83A 4OBPA 3KGAA 3RJCA 4EORA 1H01A 1J3HA 1LEWA 2JC6A 1JKSA 3AMBA 2R3RA 4BDGA 5IF1A 5IMXA 1A9UA 3CSVA 3FC2A 3RALA 4JQ7A 1W84A 3HV5A 2W1IA 4FEQA 5HIEA 3SA0A 2Q0NA 3VS5A 3W0NA 1Q97A 1PYEA 2Y4PA 5LMAA 2IZSA 4EC8A 3BLAA 5GNKA 4QTAA 5HIDA 4C4GA 1OPLA 5C01A 4EH7A 3OHTA 3QX2A 3FSFA 2W1DA 4DFUA 4YTFA 4CZTA 1PXKA 2C6TA 1FMKA 2WEIA 1SYKA 3VUKA 4FT3A 4CRLA 2X0QA 4WNPA 4BTJA 3DNEA 3UPZA 4C4IA 5I9WA 2PMLX 3BBWA 5T6KA 5I9VA 2YZLA 3HVCA 3Q32A 4U5JA 1WZYA 5E8YA 1PXIA 5CU4A 4D0WA 3VS2A 4G3CA 4I6FA 3SGCA 3W18A 5GJDA 1A06A 2XF0A 1YXTA 1KV2A 4FMQA 4BDHA 4OAVB 3E87A 3QRUA 4BDEA 5CF4A 4M66A 3UQFA 5L6WL 3QQJA 2UW6A 4XG6A 3TKHA 1J1CA 4I21A 4J8MA 3JXWA 3I5ZA 3SDJA 4EQUA 3BV3A 3EQRA 5HTBA 3M1SA 5I9XA 4WBOA 5CAPA 3JYAA 2BHEA 4BKJA 4XLIA 3OT8A 4Y5QA 5CI6A 5DOSA 3UOHA 3JPVA 4DEIA 3NNXA 5HCXA 3CQEA 1WBVA 1STCE 5HEZA 3DK3A 4CD0A 4YC3A 4I41A 4RSSA 4IM0A 5FTQA 4LDTA 4DAWA 4QMUA 3L8SA 1Q61A 3BIZA 4TNBA 2Z7RA 2BIKB 3EWHA 3I5NA 2OF2A 3SQQA 2IWIA 3TXOA 5AA8A 5CAOA 2IZTA 2X0PA 3P5KA 4QQCA 2C6LA 3L8PA 4C38A 4J8NA 3EN7A 4M84A 5AX3A 4F0FA 3KXGA 5A4QA 5M08A 3DA6A 4K6ZA 3NSZA 3HV4A 3DAKA 1XMLA 3ANRA 1W83A 4LGDA 4M0ZA 3CQWA 4BCPA 4YZCA 5IQBA 3G9LX 2IN6A 2RFDA 2SRCA 3KRWA 2ITZA 5C27A 4DT8A 2IO6A 2HIWA 1YQJA 4JQ8A 2PE0A 2A19B 4ZOGA 3ULZA 5JSMA 4QO9A 1M52A 1F5QA 4R5SA 4BCFA 2FSOX 1BL7A 2W4KA 3ZFMA 4I3ZA 3QAME 5LXMA 3MVHA 4J97A 1TQPA 1T46A 4WSQA 5KHWA 2H34A 4FTNA 2HZ4A 3IOPA 5J9ZA 3KCFA 2VX1A 2XVDA 3TNWA 4QP2A 5IZFA 4CNHA 2WQMA 4IXPA 3A4PA 2JAMA 3RNYA 2YM8A 3E7OA 4CKIA 4TL0A 3NFGB 3W2PA 4L3PA 1KE5A 4BDFA 4EOLA 3PP1A 2XKCA 1TQMA 1WBSA 1Q5KA 2PVYA 2ZMCA 3PVBA 2BPMA 4IAYA 4U81A 3TWJA 1KUTA 4UYAA 5JRQA 4YNEA 5EM6A 2WTVA 3Q04A 2ZV9A 3MV5A 4W4WA 2Y6OA 4HPUE 4DH5A 2NYAA 1WBOA 5GIOE 4MNEA 3PY3A 4CKJA 4AS0A 1SMHA 4LQMA 2Z02A 2EVAA 2VWUA 3VS4A 2DYLA 3TNQB 2WOTA 4FYOA 3UG1A 4ZTNA 2FGIA 2GTMA 3I7CA 5CVHA 1XQZA 2OJGA 4DITA 4PPBA 3QCXA 5I5ZA 3ERKA 4JR3A 5E8WA 1SZMA 3R8MA 4ZLOA 1G8AA 4OR5A 2BHHA 1QPEA 5E8XA 4QQTA 5AA9A 4IHPA 4XG8A 3A99A 3QTSA 4JI9A 3W16A 3R6XA 4BYJA 5JFSA 4HNIA 4JXFA 3LFSA 2Q83A 4Y73A 1APME 5AP4A 2WELA 2C3IB 2JIVA 1UNLA 2UZOA 3C0HA 3K5UA 3OCSA 3PWYA 1K9AA 4FC0A 4GU6A 4KD1A 3CD8A 1AGWA 3V04A 1VEBA 4FKJA 4BN1A 1Z57A 5CU3A 3NW5A 2Z7QA 3IW7A 2XEZA 4HVHA 5HX8A 2CKOA 4IM3A 1ATPE 3E8EA 1GAGA 3R7YA 1PHKA 4I24A 4EOSA 3TZ8A 5ETAA 5LVLA 5EG3A 3CCNA 3GC0A 3IS5A 2JITA 3KRRA 5GZ9A 4EL9A 3FLYA 3U55A 4FV2A 2PVFA 2B1PA 4K8AA 3TTIA 4PF4A 4AN3A 1FPUA 4V0GA 4YZNA 1MP8A 4C59A 2C0TA 2VO3A 5H8BA 4HW7A 3VS1A 4HCUA 5AR2A 3DB6A 3GUBA 5C03A 5KMIA 4DCAA 1PW2A 2AYPA 3BWJA 2X8EA 5AP6A 5FEQA 1L8TA 4FTMA 1WVWA 4S34A 5HCYA 3F5GA 4IW0A 4FTAA 5HBHA 3SOCA 1BX6A 2QU6A 4E4NA 5CI7A 4EH6A 4IDVA 3R83A 4ID7A 4W4XA 2OWBA 5TT7A 1XO2B 4XRJA 3DFCB 4ZZMA 2GTNA 4FTOA 4L6QA 4YLKA 1O9UA 3FZOA 4K11A 1SNXA 3F7WA 3ZOSA 4L01A 3VUGA 1MRVA 2J6MA 3EQHA 3OS3A 3FLSA 3P7BA 4FE2A 2JDRA 2BUJA 5D41A 5EQYA 1XHAA 5BMMA 4F0GA 4LUEA 2WKMA 5AX9A 3R7GA 4OTHA 4AOTA 1Q62A 1YI6A 2VWWA 1OBDA 1W2FA 4PL4A 4KIQA 4DT9A 5HU3A 4E73A 1YWRA 3FDNA 5J87A 4QYHA 2YN8A 3FMJA 2GMXA 3QRTA 3VW6A 4UMTA 1ZXEA 3QUEA 3P9JA 5A9UA 3GFWA 2R0IA 3HA8A 3F66A 4YZMA 5IEVA 2OIDA 2YLEA 3M2WA 2J90A 2GDOA 1U46A 4RLKA 3E8DA 4GFOA 5FWKK 4AOJA 3SHEA 4EONA 4IQ6A 2ZAZA 2IW6A 2UZDA 2R2PA 3NUYA 3FKOA 4FL3A 4N4SA 4DF3A 2XK8A 3LKMA 2VWYA 3F5PA 3RBWA 4WSYA 2OBJA 3M42A 3L8XA 4AW1A 2WQBA 3R73A 4AZSA 2H96A 4GYIA 3NX8A 4D2WA 4NKAA 4QTBA 1SVEA 2J9MA 1OKWA 2OW3A 4JBPA 5L3AA 4HJOA 2JIIA 3NUUA 2UW7A 4V05A 2BRGA 2XB7A 3BLQA 4K0YA 5HTCA 4NL0A 3HAMA 2ZM3A 2J0MB 4DHJA 4WHZA 1Z9XA 3WF8A 5AUUA 2ITOA 3VQHA 4FF8A 4M7IA 3TZ7A 4F70A 1ZY4A 4UN0C 4NW6A 5EYDA 3LMHA 4XV9A 3PP0A 3ZLWA 2QOQA 4WG4A 4FUYA 5IA5A 4EI4A 3G0EA 1WFCA 3ZUUA 4AFJA 5BPYA 2JFMA 4JX3A 2VTOA 3C13A 3EFLA 3GP0A 2B9FA 4ZY5A 4MNFA 2X1NA 3COKA 4EK4A 3HV7A 3UE4A 4AZFA 4BDKA 4BL1A 5EOBA 4CT2A 2VGOA 2JKMA 1JWHA 3O17A 3P0MA 3F5UA 3LM0A 2CCHA 4FT5A 2RSVA 3BEAA 3UVRA 2W0JA 3MY1A 2C5NA 4IVDA 3LM5A 5ANEA 2XK7A 4C57A 3A2CA 3PSBA 4USEA 3CIKA 1BKXA 3IW6A 5IA1A 4XUFA 3HMIA 4AXFA 5LARA 4IX6A 3H0ZA 3Q3BA 5JGBA 1ST4A 1GIHA 2FH9A 4MXCA 2J5EA 4E7WA 2PUIA 3A60A 4Z7HA 3O2MA 1XKKA 4G6OA 4L53A 1BI8A 3RKBA 5CVGA 4BYIA 3LQ8A 3V51A 5BVFA 4O7TA 3O50A 4LRJA 1LPUA 2JKOA 3MJ1A 4X2KA 2YERA 3VVHA 4BWPA 1P5EA 4D2TA 3D5VA 2NO3A 3K3IA 4X2JA 4NYEA 5M06A 4OGRA 5K9IA 3I6UA 5EI6A 5CEQA 1CKJA 3KXNA 4ANMA 3VF9A 5C26A 3U87A 3IG7A 4J99A 3UTOA 4QPAA 2XIRA 4FICA 4GG7A 3KB7A 5DR2A 4C61A 5JQ5A 3L9LA 3RWPA 3EKNA 4IVAA 3ACKA 1NVSA 4OTDA 5K5XA 1IAHA 3MB7A 4QP9A 4RFZA 4TY1A 4IB5A 3BV2A 2YDKA 3FMDA 2XS0A 3S2PA 3VN9A 3LLTA 2XNPA 5JZNA 4O7SA 3AKJA 1CSNA 2OZAB 3CGFA 1OL7A 3QKLA 4EZ5A 1ZLTA 4QMYA 2OK1A 1FQ1B 3Q4TA 4E4XA 4C3RA 4U44A 5CAVA 5BYZA 3ACJA 4TKSA 4RFYA 2WQEA 4D4SA 3D14A 4F65A 5BVKA 3PYYA 5FDXA 4MD9E 3NPCA 4EUTA 4O1OA 4PY1A 2J4ZA 4WOVA 4F64A 5CEOA 4I6LA 5EYMA 1ZOEA 2O2UA 2WPAA 3FBVA 4D1SA 3NYXA 3SRVA 3OCTA 5FBNC 3V6SA 3FZRA 1I44A 2O3PA 4TYHB 4D5KA 4DLIA 5JKGA 5M4UA 3ZRMA 3AGMA 4MEDA 5E7RA 5GJGA 4TYGA 5T3QA 3RK5A 3S00A 3QZFA 5HE1A 1W82A 2F49A 2FVDA 4H3QA 4G5PA 2QKWB 3VIDA 4Z3VA 1WVXA 3HRCA 3ZDUA 4QMTA 1GZNA 4JIKA 4FGBA 4FKGA 1E9HA 1OI9A 3HNGA 4PQNA 2R3NA 5D11A 4DC2A 1H0VA 3O8TA 5G1XA 4O7RA 5EKNA 4BY9E 5GINE 5HVKA 2YITA 3NRMA 4FV3A 4G3EA 3ODZX 4J71A 4S30A 2ETRA 3TZMA 2XIZA 1YI3A 4KS8A 4OTGA 3D5XA 2YAKA 4N0SA 5HNBA 3QKMA 4DFYA 3F2AA 2UW3A 3ZO2A 5FTGA 1M2QA 3U4UA 3SW7A 1W7HA 4DDGA 5EW9A 4GVAA 5KBRA 4DBNA 2ZB0A 3CPCA 3DV3A 2QI8A 4R7HA 4E6AA 5JEBA 2ZYBA 3GC8A 5M4CA 5F9EA 3NUNA 4GJ2A 3GVUA 3V5PA 4A4LA 3HGKA 2ZMDA 4FKLA 4PMSA 5KMKA 2PMIA 5JK3A 2QHMA 2QOKA 3GC9A 3PSCA 4EBVA 1NW1A 2ZDUA 3RPSA 2X2KA 4UB7A 2JAVA 4AAYA 5EFQA 2OFUA 5AR4A 2HW7A 4I5CA 5DYJA 3R2YA 2PE2A 4C2WA 2IZUA 2W1EA 3R7OA 2VZ6A 3FMMA 3MI9A 1U5QA 4XG3A 4DEAA 3DK6A 3EYHA 4UV0A 4D2RA 3OW3A 4BJJA 3I1AA 4W4YA 4JR7A 3OWLA 3SXRA 3HEGA 2YZAA 3NCZA 4BBFA 5JMSA 1PMEA 3R7EA 3G2FA 4R7BA 3KN5A 4ARKA 4WUNA 3PXRA 3AQVA 5IUHA 2CNQA 3KREA 3FHIA 4ZJIA 2IVUA 4ZLYA 5GHVA 4DGOA 5E1SA 4XHKB 3REPA 4ZZOA 3DQXA 4QMXA 3UG2A 1KE9A 3ZC6A 3CEKA 3UNJA 4S31A 2C5YA 4F63A 4FUXA 4UBAA 1PXNA 1OKZA 3MGYA 4MBJA 5DR9A 3KXZA 5AP5A 3LCSA 3V3VA 3FLZA 4B7TA 2VTRA 4UWBA 5EOLA 3WF5A 1WMKA 4QMOA 3VS3A 3MBLA 1J1BA 2RKUA 2YCFA 4KS7A 3BYMA 5IH5A 4OTPA 3KKVA 4LOQA 2YA9A 3VBTA 4YJOA 1KE8A 5LCJA 5AV2A 5KMJA 2YM3A 4MXZA 4LYNA 5H8GA 4BCNA 3QX4A 4L7SA 4C02A 5HICA 3RGFA 1Y8GA 1G8KA 3PIZA 4RVTA 3ROYA 2AC5A 4AW0A 1J7UA 3DT1A 3V8SA 2ETMA 1O6YA 3OUKA 2YIWA 3NYOA 3ORTA 4U97A 2QOBA 2FO0A 2XNMA 5EW3A 4HVIA 1OL2A 2R7BA 3DAJA 3PFQA 1PXMA 1JKKA 3AOXA 4L00A 4RJ5A 4RX8A 1J91A 3OTUA 5IA3A 4DFXE 3EN9A 3PE2A 5AV4A 2A1AB 3VBXA 4F9AA 1KOBA 3QL8A 3DKOA 3PY1A 4AA0A 3N4UA 2W06A 4ITHA 3ZO1A 2B9HA 2UUEA 4BIDA 3ZBXA 3BHHA 4L7FA 2GNLA 3DJ6A 4L8MA 3S3IA 3TACA 3VBQA 1FVRA 2CCIA 4TXCA 2BZJA 3QCSA 3UYSA 4CZYB 1PXLA 2CLXA 3FSKA 3F7ZA 4C33A 3Q60A 4QQ5A 1PF8A 4FK6A 5TR6A 1QPDA 4EK6A 1V1KA 3I81A 3EN4A 2E9OA 5ACBC 2BFYA 1Q3WA 5HLPA 3OMVA 2NPQA 4OAUC 5ITAA 3EN6A 4D2SA 5L8LA 3KMWA 4PV0A 4JAIA 4DFLA 3KCKA 4FODA 4W9XA 3TV4A 5A14A 5IEXA 3A8XA 3LCDA 3BHVA 2B53A 5H9BA 4JMQA 2Y6MA 3HMMA 4UMQA 3NAXA 1Q8WA 4L46A 2UZUE 4GK4A 4BDBA 3ALOA 3PJ8A 3ELJA 4TW9A 3Q9ZA 4RT7A 4XBUA 2DQ7X 5FTOA 5AUXA 2GHMA 3EFKA 3THBA 1HCKA 4YTIA 1VZOA 2VTSA 4QMLA 1WCCA 2GNHA 3LQ5A 4ACHA 3OF0A 5EHYA 3TYKA 2XYNA 2OXYA 3DU8A 4AOIA 1H26A 2JLDA 3E8NA 3EIDA 2VTPA 3PRFA 5A6OA 1OBGA 4JT3A 3DLZA 5CQUA 4AT3A 1Y57A 4YTCA 4DH3A 2R5TA 3MPTA 4JL9A 4Y72A 2WMUA 4EK5A 2W9FB 3R28A 1H25A 1MQBA 5CVFA 3CE3A 4LOPA 4YC8A 3TJDA 4A7CA 3OFMA 3QTWA 3IKAA 3ORLA 4IM2A 1G8JA 4F7NA 4IH8A 4K1BA 3WBLA 2PHKA 3P79A 4AAAA 4KBAA 5AIKA 4HYHA 4XCUA 4H05A 2I6LA 4O7VA 4QP8A 4U42A 2WB8A 3F69A 4D1XA 2E9VA 2C6KA 4FKVA 4BRXA 4MQ1A 4JG6A 4R1VA 2ITVA 2G15A 3C4ZA 3AGLA 2AQXA 2W96B 4IFCA 2CJMA 1F0QA 3LMIA 4HGEA 2WO6A 4FTRA 3L9NA 3HP2A 3QQFA 4MWIA 2PPQA 5IDPA 1P2AA 4IZYA 4AQCA 4CMTA 2C0OA 2I1MA 4FG7A 5BQ0A 2UZLA 5BNJA 1RQQA 2UZTA 4X3FB 4BF2A 4Z55A 4Q9SA 2WMQA 4FT7A 4UZDA 3H4JA 1YHWA 4PPCA 3UPXA 5ANIA 4R8QA 2QODA 4FSYA 1YXUA 3CP9A 3QU0A 4YPDA 4A9YA 4ENYA 5EI8A 2R3HA 3MH2A 4QTDA 2G1TA 3EJ1A 4AA5A 4DLJA 4X6RA 4ZIMA 2FUMA 4A9SA 3F3ZA 4EH8A 4JJRA 4LRKA 4K33A 4C4JA 3UNKA 3K5VA 5CSVA 4O0WA 3A7GA 2BDWA 3Q9YA 4FKIA 3W2QA 2WIHA 3UO4A 3VRYA 3ZONA 3K2LA 4AZTA 4RWLA 4FTJA 5K4JA 1DS5A 5T68A 2RFSA 3HV3A 1JSUA 4NU1A 2RG6A 4E6CA 4QNYA 1IG1A 4ZTMA 2ONLC 2P2IA 3R00A 2YIRA 3FJQE 4J1RA 5HI2A 2XANA 3LCOA 3I0OA 4WKQA 4MXOA 1PJKA 1WBWA 3QBNA 3U6IA 4O7YA 1NXKA 5K4IA 4BI2A 4WA9A 3BYOA 4C7TA 1IA8A 3CKWA 5AIRA 4FZDB 4FSTA 4GRBA 4UXLA 3OY3A 2XALA 3G51A 3OW4A 3QHWA 3DZQA 4KIPA 5D10A 5HCZA 3RWQA 4CLJA 4FSZA 1UA2A 3BCEA 4O7NA 2QOHA 4XP2A 4NM7A 1I09A 4GKHA 1OVEA 3BE2A 1XH5A 4RVLA 3VUMA 4FZAB 3P23A 1A48A 4QQJA 4CYIA 5FBOA 1Q99A 5TE0A 3ZC5A 5BVOA 2BVAA 2DWBA 3OEZA 1UU3A 2W05A 4QPSA 3T8OA 2WU6A 4FBXA 4UMRA 4AZWA 3HMNA 4KKEA 3ORMA 4QPMA 3BYSA 3OWKA 5DIAA 3C4WA 3CC6A 3FMKA 2LAVA 5M44A 4OBQA 3SKCA 4IJ9A 3UNZA 4CFNA 4XEYA 3EFJA 4FL1A 2QOFA 3IW5A 4AE6A 4BCKA 5JFXA 4ZMEA 2J0IA 4XV2A 2EXEA 4RC2A 4NIFB 3GENA 5DNRA 3BRBA 4FRFA 4RBLA 3BWFA 2IW8A 3LW0A 1ZYLA 4B99A 1BYGA 1WAKA 5B2MA 3PY0A 4RA4A 4AF3A 3R1YA 4YLLA 3FZ1A 1U4DA 2VNWA 4M0YA 3G6GA 3MPAA 4GFMA 5CZIA 1ZYDA 3MJ2A 2VUWA 5CS6A 4RIXA 5AJQA 4JRVA 4KABA 4IC8A 2C4GA 2CGVA 3QYWA 5KE0A 5J5TA 4GT4A 3UDBA 3UIXA 4EC9A 2Q0BA 4U80A 3T3UA 5AP2A 4DA5A 3BGQA 4NCTC 1B38A 4UYNA 3ZEPA 3FY0A 5H