3ETAA

Kinase domain of insulin receptor complexed with a pyrrolo pyridine inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
293
Chain Sequence
EVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of 3,5-disubstituted-1H-pyrrolo[2,3-b]pyridines as potent inhibitors of the insulin-like growth factor-1 receptor (IGF-1R) tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
molecule keywords insulin receptor, kinase domain
total genus 97
structure length 293
sequence length 294
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3etaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3etaA01
3LFBA 4AWIA 2PVRA 3BYUA 4BF2A 3SG8A 2ZV9A 4JQ7A 2ITVA 4J52A 1OI9A 3A62A 4V0GA 4YJOA 4O7WA 4UMRA 1HCLA 1REKA 3Q52A 4GT4A 4E5BA 3DDPA 2OZAA 4KBKA 3KK8A 2YWPA 5A4EA 4KKGA 4QMTA 5HD7A 1H8FA 2EWAA 2BROA 3PPZA 4S32A 5C01A 4DG0E 1Y57A 5I4NA 3ENHA 3D9VA 1MP8A 3BHHA 3GXLA 4NK9A 4CKRA 4R3PA 3IW6A 2ITXA 2CMWA 3R1NA 2C0TA 4MTAA 3UPZA 4I0SA 3ORNA 2OO8X 4KS8A 4H05A 5AR3A 4FR4A 4YMJA 2C30A 2C5XA 5JRQA 2ITUA 5IQIA 5L6OA 3RAHA 4BDFA 4E1ZA 2OFVA 3UYSA 4ANBA 4M68A 4RFMA 4RC3A 4L3PA 2PUIA 4O0WA 3R7YA 2YCRA 5HORA 5KMNA 4W4VA 2VTMA 4FX3A 4FT9A 3PDTA 3TIZA 2Z2WA 3R7EA 4EOOA 3AT3A 3QTRA 4FNXA 4CFXA 2WMRA 1UVRA 5DGZA 2ITYA 2W1IA 4G9CA 4J71A 4Q9ZA 4EH2A 5KKRB 4FV0A 1YI4A 3MTFA 4G17A 4C4FA 5BUEA 4BIEA 2F49A 4FTOA 4FYNA 4QP9A 2YM4A 3MSSA 4ZZNA 2W9ZB 3PIXA 4MD9E 4U44A 2XB7A 2BCJA 4L01A 4L67A 4D0WA 4RMZA 5EOBA 4WT6A 4IAKA 5AP6A 5AR4A 4EBWA 3PWYA 1Z57A 4R77A 5GZAA 4XH6A 3SXRA 3OY3A 4FIFA 3VS7A 4CQEA 3P23A 5TO8A 3ZRMA 4CV8A 1FOTA 3WF6A 4I22A 4EWHA 2C6MA 5FEDA 3BQRA 2WEIA 4ZS4A 3H9FA 4FUYA 4JRVA 4IM3A 1UWHA 3MBLA 5CF4A 3MVMA 3R1QA 3OOMA 3NWWA 2OKRA 1UU7A 3QD3A 2W05A 1KE8A 1Q3DA 1OIUA 4D4RA 2VN9A 3E3PA 2HELA 3BHUA 3V8TA 4BYIA 5AEPA 1H25A 4XMOA 1JSTA 3FKNA 1SVHA 5CXZA 2B9JA 2XEZA 2RL5A 2WQMA 4S33A 5L8KA 4GV1A 4PMSA 4CFMA 5CSPA 3WBLA 5JFVA 5BNJA 5HX6A 4I93A 2CGUA 3E3BX 1OUYA 1ZYSA 2XKCA 4JI9A 2YFXA 4OR5A 4YTIA 3BHVA 3R7IA 1U54B 3RNIA 2XZSA 3NUXA 3FMMA 1ZYCA 5KZIA 1ZLTA 1OITA 4BDCA 1M2PA 3W10A 4X3JA 4ZJIA 3V6SA 3MGYA 2WIHA 2RFNA 3FMDA 3RHKA 3R21A 4RIYA 2XH5A 3W55A 5IH6A 3OFMA 5E90A 1A06A 5TE0A 5KMKA 2UVZA 2Y6MA 2WNTA 4I0TA 3EFLA 3CPCA 4CKJA 3CPBA 2E9PA 2UVYA 3WZKA 4J8NA 3A8XA 4UZHA 5IQCA 4R7BA 5EKOA 4ITJA 4DEBA 3OXIA 3ZU7A 4QPMA 3I7BA 2WQNA 3O51A 2IZTA 3GQLA 2X2LA 2PZPA 3E63A 3GCVA 3LVPA 5KNJA 1M7NA 3HMPA 4YUQA 2O5KA 3QHRA 5EYDA 4W9XA 2RG6A 2IPXA 1WBVA 4CTCA 3R71A 5DR9A 3R9DA 3EQDA 1CM8A 4JRNA 5JQ5A 2XNOA 5L6WL 2J0LA 3TACA 2WEVA 3MTLA 4PWNA 5TR6A 4TYHB 2UW7A 4FV7A 3OC1A 4KINA 4FGRA 4YZ9A 3ULZA 5BYZA 4MH7A 5EM6A 4DN5A 4GFGA 2X7FA 2BUJA 4GRBA 2KULA 1M2RA 2ZM3A 3FV8A 3R7VA 3C13A 4AZTA 4JVGA 2QOBA 3TL8A 5CNNA 4AP7A 1PY5A 4X21A 2P3GX 4NTTA 3CBLA 4IAYA 4FV6A 2UW8A 4JQEA 4ZSLA 2C6KA 5AR7A 2PMLX 1CSNA 1OL7A 4ERWA 2R3MA 3HDMA 3TN8A 2ACXA 2GDOA 3C4CA 4FSTA 2HIWA 3L1SA 4Q2AA 4PL3A 3O2MA 3DPKA 4I6HA 3HAVA 4IX6A 5D10A 1TVOA 3D0EA 2PU8A 3V5PA 3HUCA 3UMXA 4ACHA 3RNYA 2FA2A 1V0OA 3R0TA 4AGCA 5JFXA 3DY7A 2VV9A 3DU8A 4FEXA 3KCKA 4L46A 3G2FA 3ERKA 4BZNA 3MFSA 3CKWA 4O81A 5CF8A 3R6XA 4OT5A 1ZMWA 4L44A 4TT7A 1U59A 2YITA 4QPSA 3MPTA 4LGHA 3D94A 4WBOA 1WZYA 4AUAA 3R01A 4D1ZA 4Q5EA 1STCE 1K2PA 1Q8UA 3JYAA 3WZDA 1XQZA 4GFOA 2J7TA 2CNUA 3SVVA 4DITA 4RWJA 4FKRA 4HPTE 3HV5A 2PK9A 5G6VA 2J2IB 4AE9A 2JEDA 2A27A 3BKBA 4GMYA 4P2KA 3R1YA 4QMUA 4EOKA 1ZOEA 5M06A 1Y6BA 3DTCA 2UZTA 4C2WA 4TKSA 3SOAA 4IVCA 2R7BA 2I0VA 4BDKA 2OF4A 3QYZA 3HKOA 4GIIA 4PMMA 2C4GA 1Y8GA 1SMHA 3ORIA 5JT2A 2HZIA 3A99A 1WVWA 4L00A 5AWMA 2WMBA 4F70A 3QXPA 4ORKA 2VTTA 4B6LA 3G15A 3NVKI 3RINA 3OUKA 4BDDA 3C4ZA 3IOPA 4HYHA 1IG1A 5ETIA 5HTIA 1ZMUA 4EI4A 5KMLA 3E87A 5KX8A 2PMIA 3ZCLA 3COIA 4HVSA 2X2MA 2ZV2A 2Y0AA 2CN5A 2WTVA 3KXZA 5BVWA 4R1YA 3R9NA 3OTUA 3ULIA 1Q8ZA 4UMUA 3TI1A 5AV4A 4DGLC 4ASZA 4A4LA 2IZUA 4MK0A 4EOMA 3OWLA 1Q61A 4I6FA 3CEKA 4EK5A 4JS8A 4EZ7A 1XH6A 1FVVA 4A06A 5AUUA 2AC3A 4D9UA 4O91A 1CTPE 4O27B 3H0YA 4TL0A 4E20A 1R0EA 1R3CA 4C34A 1YWRA 4F6UA 4ZLZA 1VJYA 3DKCA 1WBOA 4DFYA 2WMAA 5L2QA 4WG5A 4KRCA 3RALA 4CYJA 4LMNA 4EZ5A 5K0KA 3ATTA 4TYGA 3OOGA 2XNPA 1GJOA 4FK3A 4BHNA 1UWJA 2W99B 4QO9A 5HBJA 4I21A 1V1KA 4NJ3A 5E1EA 3OXZA 3UC3A 4YSMA 2XRUA 4H3PA 2OFUA 4XV9A 4YJTA 2YCQA 3LOKA 4QMOA 5M4UA 3SW4A 2ZYBA 2VU3A 2IVSA 3NUNA 4IJPA 4DINA 4FTQA 2XCHA 3NNXA 4ASEA 3EFWA 4X3FB 2R4BA 4NFNA 4D2WA 2W4OA 4EL9A 4PUZA 1Q8TA 4F9AA 5BPYA 2UW3A 1WBSA 3AC8A 5LMAA 2IO6A 2RGPA 4ZTHA 5KMIA 2JKOA 4PV0A 2WMSA 4F7JA 1HOWA 2WAJA 3C5UA 3ORXA 2UZOA 3DAEA 3MH3A 2Y8OA 3P7CA 3PA5A 4WA9A 3QU0A 4ZK5A 4BB4A 4BYJA 5CAVA 4RBLA 5I9VA 1GZNA 5IU2A 2Z7SA 5LCJA 2ITTA 4QP4A 3SRVA 3V04A 4DGGA 5L2IA 5K4IA 2CKOA 2EB2A 1R39A 2R3PA 5EYKA 3LCDA 3UODA 1OKZA 4O2ZA 5H3QA 1PJKA 4ZTQA 5FXSA 4ZAUA 1W98A 2A2AA 3R22A 5F94A 5HOAA 3DFAA 4FTNA 4L3JA 4ONAA 3BQCA 4W4WA 3V5WA 2W96B 2CPKE 3V51A 3W16A 3ZXZA 3QUEA 2OLCA 4L8MA 3BEAA 3TJDA 3EB0A 3FQEA 3VQUA 4AN2A 4E6QA 3KULB 3GGFA 4X3FC 1P2AA 3R2YA 5BQ0A 3SGCA 3FC1X 5TKDA 1PMUA 5A46A 3EL7A 5ANEA 2IW8A 4N57A 2XIXA 4OBPA 4JIAA 5AAEA 3NX8A 2Y6OA 3TNWA 3D4QA 3MJ2A 4NKSA 5CVFA 3K5UA 5HVYA 4FT0A 3LPBA 5HZNA 1BL6A 3C0IA 4QYYA 2LAVA 5I0BA 3RM7A 5LCKA 3CJGA 4M69B 4HJOA 3KRWA 3TKUA 3IW7A 4U43A 3FZRA 4KA3A 4JG6A 4PX6A 2J5EA 1PMNA 2OJGA 2UW9A 5HU9A 1PYXA 4O0UA 3H0ZA 2PSQA 4RPVA 4L68A 4YLKA 2YISA 1UNGA 2ZVAA 4L7FA 4MD7E 5HBEA 2JKMA 4RIWB 4ZSAA 3K2LA 4XCUA 1JKKA 1H01A 4FKUA 4OTHA 4O7LA 2ITWA 4UBAA 4XHKB 4XBUA 2B9IA 4USEA 4H36A 4MXXA 4JIKA 4ANMA 3OEFX 5HE2A 3ZZEA 1QPJA 4QYEA 1UNLA 4FIHA 4MX9A 4ACMA 3CY3A 4NT4A 3QRJA 3UNJA 3MI9A 2ITPA 3LZBA 4FIIA 5HIEA 4EUUA 3TM0A 2QONA 3HMNA 2QOFA 4GCJA 3G6GA 3IPHA 3F7WA 5CSXA 1MQ4A 5GZ9A 3ZC5A 2ITNA 4FBXA 3I4BA 3QCQA 3RGFA 2F7XE 3FZ1A 2X4FA 3EZRA 2GNGA 2OJ9A 3JY9A 4AACA 4IADA 1U46A 3RWQA 1QL6A 1WBNA 5AP4A 2JFLA 2R3JA 2WU7A 3QTWA 5E1SA 4QP6A 4E3CA 1H0WA 1WCCA 1MRYA 2YIWA 3Q3BA 1RW8A 1PXJA 2FSMX 4BCOA 5ANGA 3P4KA 2DUVA 5LARA 4U42A 2CKPA 4O0TA 5FXRA 1TQPA 3MY5A 4II5A 4MHAA 3R28A 5I5ZA 2BZKB 4LUDA 2VRXA 3GU8A 5K3YA 4BC6A 5F20A 4FKOA 3F5XA 1Z5MA 2VTSA 1OKVA 2YACA 4ZTSA 3TZ9A 3HV3A 3MFTA 3BCEA 4X2JA 2F7EE 3BGZA 3H4JA 3TNHA 5CT7A 5AV3A 3CQUA 3NUPA 3L8XA 4OW8A 5CAPA 3W1FA 3C7QA 3R8VA 3F3TA 2QOLA 3S4QA 1H07A 4RIXB 1H28A 5ANKA 4FSZA 3NRMA 4EC8A 4YTCA 4O84A 4NW6A 1Q97A 5HG9A 1W0XC 2YWVA 3ZRKA 3ZEWA 3H9RA 2GQRA 3CJFA 3CGFA 4FT5A 5IQDA 2O63A 3PA4A 4F9BA 1U54A 4QRCA 3VQHA 3LE6A 5EKNA 4QMQA 4FSWA 2A19B 4IB3A 4XG2A 4R3RA 4BZDA 4NU1A 1E1VA 3G9LX 3RHXA 4APCA 3D7TB 4FZFB 4G3FA 3KVXA 5A4CA 3BBWA 3B2WA 3PE2A 4K33A 1I44A 4AW2A 2OBJA 3D5WA 3PXQA 2BTRA 1JVPP 3G6HA 3EMGA 4A9UA 4YJUA 3UMWA 4A7CA 4EC9A 1XJDA 3IW5A 2XS0A 5CZHA 3G0EA 3LFAA 4H1JA 4HZSA 3FI3A 3FY0A 3QCYA 2F9GA 3II5A 1P5EA 4BI2A 5ACBC 1GOLA 4IE9A 3MA6A 1K3AA 2C5OA 2XNBA 5EYMA 4C8BA 3CCNA 4DGNA 5DG5A 3P78A 2GSFA 4G5PA 4GK4A 2SRCA 4FNZA 5FBNC 5EI6A 3HGKA 5AV1A 3LLAA 4ZMFA 3C0HA 4YBKA 3D83A 4HCTA 4QTDA 4CEGA 5CX9A 4ZSJA 2F7ZE 1XBAA 3E8EA 3V5JA 3DS6A 3SKCA 4DEIA 4RJ7A 4KSPA 4Y73A 5CT0A 3CIKA 3KGAA 5CALA 4M0YA 1WBTA 2BDFA 5JK3A 3PRIA 3QX2A 5FTQA 3GB2A 1ZXEA 3F3WA 4BCIA 2J4ZA 2YAAA 4BI0A 5M56A 4RT7A 3HUBA 4E93A 3IGOA 4ZTNA 5FXQA 5KCVA 3S00A 4FVQA 4ZEGA 4NKAA 3IKAA 3NR9A 2ERZE 1GZ8A 4DH1A 3NUSA 4AA4A 4PL5A 4BVUA 2YABA 2F2CB 4G2FA 2R0UA 5GZ8A 2BAKA 3A7FA 2W1HA 5HG5A 4IMYA 3RVGA 3NW5A 3WYYA 3ZEPA 4G6LA 5EQPA 1KE5A 2W5HA 3IONA 2XYUA 3NNUA 4IB0A 4FKQA 4MAOA 3W18A 2C1BA 5GJDA 3LKMA 1APME 5I3OA 3F7ZA 2PUUA 4MBLA 1OGUA 4QYGA 4RRVA 3LFCA 1XO2B 5CEIA 5LVNA 3MIYA 3QC9A 2PYWA 3EL8A 4EYJA 2YM6A 4X0MA 3VJOA 4E7WA 4LL0A 4CFNA 3BHTA 2XIKA 2Z7RA 4GL9A 4GT3A 4P90A 4EKKA 4QT1A 4I3ZA 3UOHA 5C8NA 5CY3A 4F1TA 1DS5A 1FMOE 3FXWA 3UVRA 4RFYA 4IWPA 4RWIA 1UKIA 4FTCA 5EH0A 3N9XA 1PMVA 3KC3A 5DT3A 5DRDA 3ACJA 2BFYA 3O17A 5CU2A 3PUPA 4G5JA 2ETKA 2R3RA 3O7LD 3F9NA 4NM3A 4CMOA 1K9AA 1W8CA 1P4FA 3D2IA 5IEVA 3R02A 2G9XA 3EFJA 3F69A 3EQPA 3GCQA 3PZEA 3QQJA 4PY1A 3WF8A 2IG7A 1YRPA 4FTKA 2JDOA 3U55A 3NSZA 2ITZA 5JFSA 1BX6A 4M84A 1ZWSA 3P7BA 2RG5A 3PIZA 3ZSGA 2B54A 3EN7A 4O7VA 5GIOE 4CSVA 3FZOA 3KULA 4X6RA 2E9UA 1LPUA 1H27A 3DNDA 3EIDA 3PXYA 4ZY4A 4AFJA 2BZHB 2RSVA 4O96A 4ZY5A 3BI6A 3Q04A 2YM3A 4APPA 4ERKA 1WBPA 1IASA 4C02A 1RQQA 4YP8A 3BWFA 5DMZA 3M1SA 4G6OA 2W4JA 3DDQA 1U5RA 3KA0A 2VWZA 4G16A 4UXQA 5AFVA 2X39A 4N6YA 4S31A 4DE4A 4LRJA 4XLIA 2Y4IC 3UZRA 5EI2A 4I94A 2BRMA 4J7BA 3IO7A 3RJCA 5CQUA 5ANOA 4C3RA 4GK2A 3HRCA 4R3CA 3TNPC 1ZRZA 5EW9A 3QKMA 2OH0E 5CEQA 3OF0A 4F9WA 4RX5A 3UOLA 4BTJA 5BVDA 2HOGA 4CCUA 3KRLA 3KMWA 4FNYA 1W82A 3GC0A 4QQTA 5AR5A 2CNVA 5ANJA 5KBRA 2Q83A 1Q99A 3BV2A 4E5WA 2IVVA 3VBQA 3ENMA 4NFMA 5CI6A 2XNEA 3I60A 4AW5A 4L52A 4ZMEA 3QHWA 2B53A 3F2AA 5L8JA 5LVOA 1YXTA 4FOBA 2JC6A 4PPBA 4QNAA 3NIEA 2Y9QA 3E7OA 2XIZA 3Q4UA 3QQGA 2XJ1A 3E5AA 4HGEA 1SZMA 3ZO2A 3V5QA 3OROA 2OXYA 2B9HA 4TYJA 4O0RA 3EQIA 1ZMVA 3RK9A 5LWMA 4UXLA 4D28A 2JFMA 4RJ3A 4XS2A 4YR8A 3AC4A 4EOQA 1SVGA 4L43A 4NCTC 4XV2A 5E8YA 4AE6A 1H0VA 4RX8A 3ZBFA 5D7VA 3R8LA 5IZFA 3MH1A 2PZYA 2HY81 2VTAA 4J96A 4WNMA 5F95A 3TIYA 4BDHA 1P14A 3EQRA 3IW8A 5DRBA 3S95A 2AYPA 2WQOA 4D0XA 1YW2A 3LXLA 3I0OA 3O8TA 3V8SA 4E4NA 4DC2A 3DJ7A 1OUKA 2B0QA 4MXCA 1OPKA 4GS6A 4XG8A 4NWMA 1NVSA 4EYMA 5KUPA 4N70A 3MPMA 5EYCA 5JFWA 2YERA 4M69A 4DEAA 4R6VA 3KL8A 2ZB0A 4QQ5A 3OMVA 2Z8CA 3KF7A 3W2PA 5JGBA 1BLXA 3PY3A 4DG3E 5F4NA 4QP3A 5AMNA 3G90X 1XR1A 2JDRA 4O6EA 2HAKA 4ANOA 1UNHA 3QLGA 5FWKK 1JLUE 3MPAA 4YHJA 4YHFA 4WNOA 5EDQA 5C1QB 5AUWA 5G1XA 5FLFA 1YVJA 2QG5A 1UKHA 3F6XA 4PNIA 4QMZA 4RWLA 2XBJA 4FF8A 5ANIA 5GJFA 5HG8A 4TXCA 2FUMA 3ZLWA 4C38A 5ICPA 3FXXA 5L6PA 4NW5A 3L9LA 5J95A 2VD5A 4ZZOA 3D5UA 3FYJX 2ZMDA 3NNVA 3QRUA 4LOQA 3BV3A 2X9FA 4NL0A 2BALA 4IX5A 3QYWA 4IM2A 2E9NA 3CQEA 1RJBA 2DS1A 1B38A 2HW6A 2PVKA 3F5UA 3NIZA 4FZ6A 4EQCA 4BY9E 4N6ZA 4BR3A 4U45A 5FDPA 1Z9XA 4G9RA 4BCGA 4GK3A 3H3CA 3ZXTA 4IAZA 5CI7A 4IDVA 5A4LA 3DKFA 4BIBA 2GHGA 2GNLA 4BKJA 5IPJA 3ETAA 3F88A 1OBDA 3TNQB 4L45A 1CKJA 1H1WA 3A7JA 3VIDA 4NTSA 3OBGA 3HRFA 4AZEA 4M67A 3TTJA 2W1EA 1RE8A 3BE2A 2VWUA 1Q8WA 4IC8A 3KN5A 1SM2A 4FK6A 3C4EA 3AT2A 2R64A 3CTHA 4F7LA 1T45A 5CAOA 4R7IA 4QTBA 4O7ZA 2J0MB 2C6LA 3Q53A 2XCKA 3L9PA 1AQ1A 3SX9A 4F09A 5DEWA 4BCPA 5HNGA 4F6WA 4W8DA 1PXLA 4ENYA 4IH8A 4DBXA 5HNIX 2FGIA 5DEYA 3GT8A 1W83A 3DK3A 3HL7A 2OICA 2UUEA 3WI6A 5J1WA 3BLQA 3U87A 4IM0A 5EQEA 4ITHA 4CTBA 1DAYA 4D2VA 3FPMA 3QL8A 4GSBA 3SV0A 3ITZA 3NYXA 4YO4A 3DBEA 3MIAA 1KV2A 2W1DA 3RPVA 5K4JA 1ZZLA 2WMTA 4BTMA 2IVTA 1FVRA 4JDHA 2WB8A 4AA0A 4WRGA 1XH5A 4QMVA 4EHEA 4DGOA 4DFBA 4C4EA 4EK6A 2R5TA 4Y85A 4B8MA 4FEUA 5HX8A 3UIXA 2VTNA 3PTGA 2C6IA 4HNFA 1E1XA 3N4UA 4JG8A 4QTCA 3KXNA 4K11A 1RDQE 2W7XA 4O2PA 5EHYA 3N51A 3ZFXA 3PVWA 4XRJA 3GCPA 1BKXA 1OPLA 4IB5A 3NNWA 2H34A 3FLSA 3DJ5A 3QZGA 1X8BA 2REIA 3MFRA 5LMKC 1LP4A 4B4LA 2BAJA 2BZJA 4E6DA 4F0FA 4GH2A 2VUWA 2JKQA 3FHRA 2WTCA 3ZLSA 3KEXA 4IANA 2KTYA 4OAVB 3PY1A 3V01A 1GZKA 4MYGA 3AOXA 4FE2A 2QOKA 3OS3A 4A4OA 3WIGA 5AX3A 5CYIA 4X6QC 3DBCA 5E8WA 4ZZMA 3BGQA 2BHHA 3KKVA 4O22A 2HZ4A 3RAIA 2XP2A 4DF3A 1J91A 2R3OA 4FSQA 2O65A 3G33A 4BCFA 5CTPA 3QZHA 3GBZA 5HGIA 4FKJA 4B8LA 4JAIA 2G2FA 3CTJA 3DAJA 1YXVA 3MYGA 3QKLA 1ZARA 4AGDA 4D2SA 4EH4A 3W8QA 4ACGA 3GOPA 2C3KA 4FSMA 3OVVA 4O1PA 4S30A 3L9MA 3LMHA 3LM0A 2YIRA 3P79A 3IGGA 3PP1A 5L3AA 3QUPA 3VW8A 4O7RA 4J99A 3A60A 2X8DA 3O71A 2HY0A 5ETAA 5GNKA 1L8TA 2PTKA 4RA5A 4FSUA 2OSCA 1XWSA 5KMMA 2QG7A 3KU2A 3TCPA 3NGAA 3LW0A 3R30A 4YJSA 5CSWA 2PVHA 2YIQA 2OG8A 3Q60A 3U54A 1XH9A 4IQ6A 4IIRA 4A4XA 4XV1A 2R3GA 3CQWA 4QMXA 1V0PA 2XF0A 4UEUA 3SD0A 4MXYA 4I5PA 2JD5A 4M66A 3IW4A 2GNIA 3FLQA 3VBYA 3EJ1A 4AT4A 2Z7QA 4WO5A 4YZCA 4IXPA 3RPRA 5BVEA 5M57A 3HYHA 4G3EA 4JAJA 4YZNA 3UP2A 4WUAA 3PXKA 4R1VA 2C6EA 3G51A 5LVLA 2YZAA 2R3QA 4JBPA 3DXNA 4EBVA 4YC3A 5JZJA 1FVTA 3FSKA 3FZTA 2GS2A 3Q96A 4FGBA 4JNWA 3UVQA 3VS4A 3LMIA 2UW0A 3ORPA 3R8ZA 3PJ1A 5T68A 3FC2A 5AJQA 2V62A 2W9FB 4NEUA 2HWOA 4PRJA 4UMTA 4NM0A 5D11A 3KQ7A 5DBXA 5HBHA 2CKEA 5IUIA 3FE3A 4DH8A 5E8ZA 5LVPA 1PXIA 2Z60A 1DI8A 3MN3A 3Q5IA 5HE1A 1JKSA 4PDYA 3F82A 3QTZA 3IOKA 4UMQA 1HCKA 3E64A 2V55A 4ID7A 4XBRA 4EOPA 1OKYA 3DXQA 4JQ8A 1H4LA 4GUEA 2WKMA 3FJQE 1CKIA 3UPXA 5ETCA 5BVNA 1ZOGA 3Q4ZA 5EOLA 3Q9XA 4UX9A 2J50A 4OGRA 1KE9A 2Z02A 2QOHA 4BFMA 4QMNA 2WU6A 1IR3A 3OD6X 4IVDA 4MQ1A 1YQJA 3ANRA 4GYIA 4IAIA 4P7EA 3AXWA 4RIYB 4FIEA 5CVGA 4AT3A 4QQCA 4GUBA 4YO6A 2VTRA 3LJ2A 3I5NA 2Y4PA 3ACKA 4DEEA 2CKQA 4QTAA 4QQJA 4MXOA 4EOIA 2C5YA 4CFUA 1BMKA 3QRTA 4DTAA 2CCHA 3MVLA 3R8PA 3U9NA 4FSRA 4FEQA 3QQFA 3BHYA 3RM6A 3MW1A 3NCZA 4EHZA 4QMLA 2XIRA 3C5IA 3SA0A 4F1OA 2OWBA 3VNTA 4MXAA 3V5TA 5AV0A 4MWIA 4KIQA 2J0JA 3BU5A 4U79A 4ZP5A 4D4YA 1ZZ2A 2WMVA 1LUFA 2WTJA 4L53A 5HO8A 4AFEA 1JAMA 3AC5A 3D14A 3OT8A 1ZYDA 1YHSA 2UZEA 3QFVA 4IACA 2WELA 4IWDA 1KOAA 4YLLA 5EQYA 1F3MC 5ITAA 1LEWA 2XNMA 1UU8A 1H08A 1PXPA 4RZVA 3JS2A 2B55A 2IW9A 3LCOA 3M42A 4LRKA 1IAHA 5M55A 2X7GA 3MVJA 4U81A 4PTEA 4ANQA 3VF9A 3OWJA 3KMUA 3BRBA 2CN8A 1OIYA 2ZM1A 3EN9A 3RK5A 1L3RE 4JX3A 2BRBA 3RAWA 3UIMA 3U6JA 2JDSA 2YDIA 3TZ7A 4YJNA 4YPSA 3VVHA 3FLYA 4KB8A 4KWPA 5CSVA 2W17A 3W2SA 4F99A 2PZRA 4G3GA 3OHTA 3K3JA 4QOXA 5FD2A 3PLSA 4PL4A 3T9TA 3DGKA 2XRWA 2BVAA 4D1XA 1CKPA 2V7AA 4FTRA 4GFMA 1J1CA 5E92A 5FTOA 4HZRA 1XHAA 2ITQA 4OBQA 4MWHA 3ZHPC 5DYJA 5J87A 4Z55A 5DT0A 5C03A 2QR7A 3OT3A 3TUBA 3WZEA 5DHJA 2XYNA 3HV4A 4CCBA 5HNBA 3HMMA 3QLFA 3EN6A 4C61A 4Z16A 4PDPA 1ZY4A 4I6BA 3P7AA 2X81A 3I1AA 3WF7A 4M15A 4C36A 3QQHA 3EH9A 5CEPA 2NP8A 3RK7A 2X0GA 3NUAA 4RSSA 4BN1A 2P2IA 4K8AA 4BZOA 3JUHA 4F6SA 1YOLA 1ZYLA 2V5QA 3QA8A 4QP7A 3TV7A 2YM5A 5CEKA 5HE0A 4DA5A 1SNXA 1VR2A 2B7AA 2G2HA 1JSVA 3OBJA 3OTVA 4I5MA 4FVRA 1XBCA 4A9RA 2IN6A 4XP3A 3NVMB 4YJQA 2FSLX 4YNEA 3FPQA 3BU6A 4UZDA 4BDEA 4FV3A 2PUPA 5KHXA 5HI2A 4FTAA 4O82A 2OZAB 4GU6A 3DAKA 5I9UA 3LCKA 3C4XA 5HTCA 3VBVA 4M97A 2X2KA 5AUXA 3VULA 4ZJJA 1H00A 4MQ2A 5GIPE 4QP1A 1J3HA 2GMXA 4FKIA 4DBNA 5I9WA 4EOJA 3ZRLA 3ZLYA 2WMXA 2ZDTA 3GI3A 4N4SA 3QKKA 5IEYA 1JBPE 4IDTA 2YEXA 1GIJA 1YOJA 5HO7A 4YC6A 4FKTA 2R0IA 5B0XA 1U5QA 4C4JA 1XH7A 2Y4IB 4Z7HA 5IMEA 2XEYA 4YZBA 1M7QA 5FTGA 1JNKA 2ZM4A 4TNDA 4EONA 5CANA 4CV9A 3ZSHA 4FKPA 4AW1A 4U97A 5IQEA 5KMJA 2Q0BA 3DB8A 2PY3A 5CF6A 3FLZA 2OW3A 4ZLOA 3GUBA 1A48A 3HDNA 4ANSA 3UJGA 3MDYA 2YDKA 5KE0A 3WOWA 4C7TA 4CQGA 3VW6A 2ESMA 5IA4A 5AP0A 1Q24A 4QP2A 3LFSA 4UB7A 4IAFA 2C6OA 3EQBA 3CP9A 2VZ6A 4CLJA 3COHA 4NJDA 4FTLA 3E92A 2ZMCA 4FYOA 3TWJA 2Y7JA 5J1VA 1Q3WA 4BRXA 5AM7A 3ET7A 1NY3A 4F9CA 1P4OA 1PXKA 2YIYA 3ANQA 3MB6A 4NUSA 3AGMA 4Y5HA 4FV1A 4GVJA 1CMKE 5HESA 3ODZX 4O7TA 4BTFA 4F63A 4MVFA 5C26A 3LLTA 4OTWA 2ITOA 4EH6A 5IISA 2OJFE 3QCSA 2UZDA 1KE6A 4FL2A 5AP1A 2C47A 4OTFA 3GU5A 3VS0A 4D2PA 4GT5A 3MVHA 5DPVA 3MH2A 4F0IA 5I3RA 3AQVA 2VO3A 4KUJA 4BDIA 3GEQA 4XG4A 2WZJA 2JAVA 3G5DA 4UYNA 3G9NA 4Y5QA 2BIYA 2OJIA 3E8CA 4UY9A 4ZLYA 4LV5A 2AC5A 3O96A 5IUHA 4FV9A 4IZYA 4I0RA 1Q4LA 5DWRA 5D9HA 2WTDA 4CMTA 3RPYA 4RA4A 3BX5A 2I1MA 4DAWA 3PZHA 3QBNA 3FAAA 1ZAOA 3AT4A 4A9YA 4U9AA 5AR2A 2Q0NA 2PZ5A 3DK6A 2PE1A 1PRYA 2PULA 4E4LA 3KXMA 5FUTA 1PW2A 2XKFA 4C57A 2C69A 2GS6A 2PE2A 3WZJA 2WXVA 4RIWA 2VO7A 4ZTMA 2YAKA 2XNNA 5CAUA 2X8IA 3LJ0A 2XK3A 2W06A 5GINE 3QZFA 1OECA 3QQUA 4AG8A 1H1RA 4ASXA 2ZOQA 3R73A 3R9OA 3V8WA 3FHIA 3C0GA 2YJSA 1S9JA 3HLLA 4XV3A 5L2TA 5BMSA 2CHLA 3F66A 2VTQA 1PF8A 3MV5A 4EOSA 4FL1A 2O3PA 4L6QA 4ACCA 4AT5A 2WIPA 1B6CB 4C3PA 1PXMA 5IQFA 1ERKA 2BR1A 4RG0A 3P9JA 4UWBA 4CT1A 5L2SA 2A0CX 1TKIA 2I0EA 3KY2A 1IA8A 2VNYA 3HMIA 4KS7A 2GQGA 4AZVA 1YI6A 4YURA 3EFKA 4YHTA 3ZM9A 5EW3A 4G1WA 4EQUA 4A07A 4WOVA 3R8UA 5KKRC 2XM9A 1YXUA 1QCFA 3UZPA 4DH7A 1S9IA 3FUPA 1W84A 2ZV8A 3QXOA 2CNQA 3PFQA 3KXHA 5HLPA 4WNKA 1UA2A 3VS6A 3RCJA 4P4CA 3E93A 5E91A 3U6HA 4LGGA 4EQMA 3LIJA 4UWYA 4QMWA 3ZSIA 4PP7A 2CJMA 4OLIA 3VO3A 3TV4A 5LWNA 2PVYA 3H30A 3THBA 4BCMA 4X3FA 3UO5A 2WOTA 2EU9A 4NZWB 3AD6A 4GU9A 5DR6A 3ZTXA 3FQSA 4U7ZA 3I5ZA 3NUUA 2XVDA 4YTHA 5ACKA 3LJ1A 5T6KA 3R7OA 3RI1A 4JBVA 3PSBA 2PVNA 5EHOA 4DFUA 2ZDUA 4OT6A 3DQXA 4L42A 4U5JA 5HLNA 5HEZA 4GKIA 3R63A 3ZZWA 5AUZA 3QD4A 5JZNA 2PE0A 2WPAA 4WRSA 4BGHA 4LYNA 5M4IA 4O6LA 4TZRA 5EDRA 2YJRA 4O0SA 2CLXA 4FZDB 2WGJA 4IBMA 1Y6AA 4NIFA 5KO1A 4FEVA 2GTMA 4NYEA 5E4HA 4TYEA 4BCJA 3AC1A 4AOTA 4C4GA 1SNUA 2YN8A 5CEOA 2OH4A 3PVGA 3ZUVA 4ZOGA 5BMMA 5J7HA 4XG9A 4QMPA 3PWDA 5H8EA 3DV3A 5K9IA 3QTXA 4IWOA 4K0YA 4WNPA 1J1BA 4D55A 4MBIA 2RFSA 2EB3A 2UVXA 4BICA 4D2RA 5C4KA 2GHMA 4LM5A 5EDPA 4YJRA 5CXHA 2HW7A 4L7SA 3W33A 2FO0A 3A4OX 3R2BA 2XK4A 5HU3A 3FMJA 1BUHA 3U9CA 3W32A 3F3ZA 5AR8A 2XK7A 4AGUA 3L8PA 1OBGA 2QD9A 2ETMA 2VWBA 4L9IA 1GZOA 4V01A 3OEZA 3E88A 3H10A 5A54A 1R0PA 1ZYJA 3NYOA 3ROYA 3ZDIA 4RC4A 4Z7GA 4YGAA 5E8UA 4KKHA 4AOJA 2C6DA 1REJA 5JQ8A 3PXRA 1PKGA 3LHJA 5A6NA 3OP5A 3SDJA 3TNIA 3NYNA 4NIFB 2FYSA 2BTSA 2EXEA 3QQLA 5KBQA 1Q8YA 2H96A 3F2RA 2R3KA 3VUMA 3GU7A 4CYIA 4WBBB 3V6RA 3EZVA 4IB1A 5IQHA 4JJRA 5AAFA 2EXCX 2W1ZA 2XUUA 2B9FA 1FMKA 4ITIA 3UDBA 1BYGA 4DTKA 4F0GA 3MJ1A 1ND4A 4CG9A 3TT0A 1V0BA 4XOZA 3CGOA 4B7TA 4KNBA 3EYGA 5J5TA 4F1MA 3D5XA 2GQSA 3ODYX 3SXSA 3JXWA 1KWPA 4IZ5A 5ETFA 2VTPA 3HV7A 3N4VA 4YBJA 4JX7A 4KRDA 3POZA 5CU4A 2NPQA 4BHZA 2B4SB 3VRYA 2JKKA 3PRFA 3AD5A 5CAQA 2O8YA 2XMYA 5EM7A 3IS5A 5IDNA 1VYZA 3D7ZA 2WO6A 3NDMA 4R5YA 2NRUA 5B2KA 3VF8A 3MB7A 2GTNA 4EZ3A 2BRHA 4Q9SA 1J7IA 2RFDA 4F08A 2ZAZA 4KSQA 4TWNA 3U6IA 2P33A 2BDJA 4QTEA 4J8MA 2WMQA 2J5FA 1G8AA 3VBWA 5C9CA 2BMCA 2QOQA 2QI8A 2ZB1A 4QMSA 5K0XA 5BVOA 4RVMA 1JWHA 3VUIA 4FOCA 4I41A 4I92A 4Z9LA 1Y91A 3OWKA 4EH8A 1OMWA 3CC6A 3GNIB 3CSVA 3MFUA 3DZQA 3VHKA 4DCAA 3A4PA 3OZ6A 3QWJA 5EHLA 5EM5A 3BELA 4I6QA 4RVKA 3GU6A 4I20A 4RVTA 1YDRE 2UZBA 4O0XA 3UC4A 4F9YA 3TV6A 2P2HA 4HYIA 5ANDA 2XNGA 3AC2A 3HVCA 3HAMA 2G1TA 2ZV7A 3CR0A 5E9EA 4BCNA 2GPHA 3F61A 5B2MA 3OW4A 2HZ0A 4DFLA 3D5VA 2QOCA 3UYTA 5LXMA 3UNZA 5C8MA 4CT2A 4I4EA 4W4YA 5D1JA 4IW0A 2DYLA 3DOGA 5HLWA 5HVKA 1G5SA 1LEZA 2YIXA 4HCUA 4J95A 4JDKA 5K5NA 1PYEA 2QU5A 5JRSA 4R78A 2HYYA 3FBVA 4FV5A 4C62A 4S2ZA 5AP3A 3FKOA 2F57A 3TXOA 4G3DA 3PJ3A 1JPAA 2VX1A 5M4FA 1E9HA 2XIYA 2JGZA 3DKGA 3E8DA 3KFAA 2XK8A 3NAYA 3OCSA 2JBPA 4JOAA 2OXXA 2UV2A 3DA6A 3QAME 3BYVA 4OTRA 2WTKC 4OTDA 2F4JA 3NZ0A 3VUDA 4AX8A 3HRBA 3I6WA 4CKIA 4D5HA 5M08A 2VWYA 3WARA 2CGWA 3Q2MA 3FL5A 4W4XA 4U41A 1YHWA 3FXZA 4W9WA 4TYIA 4JT3A 4C0TA 3UG1A 3TZMA 4YTFA 3Q9YA 1Q5KA 4V0GB 4O7NA 2QOOA 3BYSA 5HKMA 3DCVA 5IUGA 1MRVA 4QMYA 4DLJA 2BDWA 4Q5HA 3BZ3A 2BFXA 3BBTB 4TTHB 4M13A 4KKEA 2PVLA 3OWPA 4L3LA 4U8ZA 3ALNA 2BHEA 5BYLA 2VWVA 1YDTE 3DNEA 1WVYA 3BLRA 2C5VA 4KIOA 3PG1A 5IQGA 2UW5A 4XP0A 4JR3A 3C9WA 2J90A 2O0UA 3KF4A 2XBAA 4ALUA 3VUTA 3IECA 5T3QA 2R9SA 4ZSEA 4RLLA 3WIKA 4KD1A 4EH9A 4EK4A 1J7UA 3A7HA 5IG1A 2B1PA 2BIKB 3G0FA 5DIAA 5HO6A 1XBBA 4O86A 4LL5A 3U8WA 4M0ZA 4RZWA 3ZFYA 3L8VA 4BCHA 5IA1A 5J79A 2YA9A 5M07A 3EOCA 4HPUE 1MRUA 3SLSA 3OG7A 4O1OA 5DFPA 1U4DA 2FB8A 5M4CA 4RJ8A 2QO9A 4U0IA 4D5KA 2XJ2A 2UW4A 1YXSA 2G2IA 4FVPA 4QMMA 4AXAA 3GQIA 5JGAA 4RVLA 3LMGA 3V5LA 4RX7A 2OZOA 2VAGA 4EH7A 4Z3VA 2C68A 4RJ6A 4GW8A 2QQ7A 4DH5A 4FZ7A 1ATPE 3ALOA 5HTBA 3R9HA 1O6KA 2GNHA 1FINA 4H3QA 5LMBA 4G31A 3WILA 2GCDA 5DNRA 4UN0C 2YDJA 3BWJA 3MA3A 5HCZA 3DFCB 4J97A 5AAGA 4QPAA 3U4WA 4BDBA 4J98A 4JR7A 2VTIA 4DH3A 2C6TA 4YZDA 5AP7A 4YNOA 3UTOA 3S2PA 4Y8DA 5HVJA 3UBDA 4IZ7A 2X9EA 4CNHA 3PVBA 4PMPA 4I1ZA 1NVQA 1MQBA 2QLQA 3JY0A 3MY1A 4AN3A 1JOWB 2J0IA 4ZTRA 4LQMA 3DZOA 3DQWA 4HNIA 3SOCA 3C4WA 2HZNA 2ERKA 2PMNX 4FZAB 1H1QA 2GFCA 3SHEA 2XKDA 5IF1A 3W2QA 3TKHA 2W1CA 3DT1A 4GVAA 2IJMA 5CVHA 5A14A 5LVMA 1H24A 2EUFB 4GEOA 5IQBA 4WD5A 3UG2A 4TWPA 3BIZA 4FG7A 3IK3A 5GHVA 3TEIA 5IA2A 3FDNA 2X6DA 1FPUA 5EW8A 1QPCA 2F2UA 3PG3A 4P5QA 4PDSA 4BCKA 2YLEA 5JGDA 5E8XA 2OXDA 5FDXA 3SRVB 1YHVA 3LQ3A 4PF4A 2PL0A 3RKBA 3I6UA 2JDVA 2UZNA 3LCSA 4K6ZA 5DN3A 3DJ6A 2J6MA 5K5XA 2IZSA 4K2RA 3ORKA 3VN9A 2ONLA 3GENA 5DR2A 5FEQA 2OIQA 4EKLA 5DVRA 1NVRA 3C4FA 4JL9A 2CCIA 1DM2A 2H9VA 4HW7A 2O64A 4TNBA 3ORMA 3FI4A 3LM5A 4JLCA 3R7UA 5CU3A 3RAKA 3NW7A 2XK6A 4XEYA 5FP6A 1TQMA 3F3VA 3FMHA 3DBQA 4H1MA 4ZTLA 5TOZA 2HWPA 3MH0A 3T8OA 4BWXA 4CG8A 3FKLA 5B7VA 3JVRA 2BKKA 5AADA 5AP5A 4AW0A 3FY2A 1OL6A 2C3IB 4YZMA 2BILB 4FC0A 3Q9ZA 4LUEA 5E7RA 4WSYA 1H1PA 2H6DA 1OL2A 4YLJA 5EM8A 3V3VA 1NT2A 5HIDA 3MESA 4AZFA 2YM7A 4R7HA 3ZH8A 3QRIA 4FI1A 4MXZA 1ZY5A 2C3JA 5EFQA 2IVUA 1WFCA 5CENA 4ZS0A 4XRLA 2OJJA 2PWLA 3HA6A 3FSFA 3Q4CA 4O21A 5AP2A 3HMOA 4D4VA 5JEBA 5AX9A 2W1GA 3ZUTA 5TT7A 5CU0A 2GU8A 1GAGA 1VYWA 2GS7A 3CY2A 4JDIA 4FKLA 3ORZA 5LOHA 3RWPA 1WMKA 1Y8YA 3UZTA 3QTIA 4CMUA 3LFFA 3ORTA 4O7SA 4IX3A 4LV8A 3LFQA 3Q2JA 3UOKA 2BAQA 3F5GA 2YCSA 4V04A 4DT8A 3KRXA 4XYFA 1GIHA 1G8SA 4WHZA 3UP7A 5BVKA 4I4FA 5IQAA 4IX4A 3VBTA 3C50A 4U80A 4HVHA 4X2KA 2OU7A 1ZOHA 3DBFA 3IDBA 3PSDA 4FT3A 5FP5A 1BI7A 1T46A 4EK3A 2R2PA 3LFDA 4BDAA 3NMUF 3KREA 5DA3A 2ONLC 5FG8A 3EYHA 1TQIA 3QC4A 3KRJA 2R3LA 4XP2A 5D7AA 4FT7A 5BUJA 5L2WA 3TDWA 1GY3A 1BL7A 2IW6A 2G01A 4JXFA 1DI9A 4E6AA 1R78A 1SYKA 3CE3A 5IDPA 3QALE 3TJCA 4BBFA 2X7OA 4OAUC 2I7QA 4IAAA 3S0OA 5DH3A 3SQQA 4Y72A 4J53A 4FSYA 1VZOA 2FSOX 2P55A 3A7GA 3ORLA 4FG9A 3E8NA 3GC7A 5CSHA 5D41A 3O7LB 3QCXA 5EK7A 3EQCA 3RBWA 4D9TA 5AA9A 5TF9A 4BIDA 3EWHA 3SAYA 4XG3A 2V22A 2OF2A 4LMUA 4RGJA 3KXGA 4IEBA 4JBQA 2QO2A 2PVMA 3OY1A 4U3YA 1AD5A 4EEVA 5E8SA 3UQCA 4CGAA 4A9TA 1H1SA 4GIHA 3P86A 3KCFA 4FV8A 3A61A 2PVJA 3O8UA 4PDOA 4EOLA 3A7IA 1KUTA 4LOPA 1YI3A 3VRZA 4LG4A 2QOIA 4AGWA 2WHBA 4PTGA 1FBNA 4ALVA 5JN2A 5DOSA 4IJ9A 2GNFA 2JDTA 2V7OA 4YJVA 4FL3A 1OB3A 2I6LA 2QU6A 3EQFA 2DQ7X 3QQKA 5AV2A 2XK9A 5BUIA 2X4ZA 1B39A 2WTKB 3VUGA 4D4SA 4JG7A 4PPAA 2E9VA 2RKUA 4U6RA 4HGSA 1J7LA 1AGWA 3R00A 4PP9A 5HCYA 2FSTX 2VX0A 4BL1A 2JIUA 3GFEA 2HXQA 3QD2B 2OI4X 4G34A 5HE3A 4KABA 3QGWA 3QZIA 3BGPA 4MF0A 4RJ5A 3RP9A 4G3CA 3PSCA 5AIRA 3TG1A 3K3IA 4XLVA 4QP8A 3FMEA 2P0CA 4B99A 4O7YA 3RZBA 2W4KA 1O9UA 3POOA 2CGXA 2HXLA 4ACDA 3WZUA 5LMKA 3ZLXA 3GP0A 3QD0A 3PJ2A 2PVFA 4ANNA 3EQHA 4FKVA 1CDKA 3IQ7A 4Y46A 3N4TA 4KBAA 3NS9A 3NYVA 4H3BA 4RQKA 5CNOA 3GU4A 4GJ3A 5H9BA 2BZIB 1OIQA 4IWQA 4HCVA 3MS9A 2QLUA 1FQ1B 1QPEA 2VWWA 2G15A 1F5QA 4HGTA 4X2GA 1M2QA 4BGQA 3R7GA 2JIVA 2X8EA 3VS2A 4CRSA 4U3ZA 4FIGA 2R3NA 4JBOA 4MF1A 5CZIA 5EG3A 1M52A 3UQFA 4TW9A 4LRMA 3PE1A 2J9MA 3HZTA 4UV0A 5CASA 2PZIA 4EJ7A 2ZJWA 5C8KA 4CRLA 3EHAA 5IEXA 1Q62A 3C1XA 3GC8A 1OVEA 4KIPA 3S3IA 2PPQA 5A4QA 4USFA 2CGVA 4PQNA 2VTHA 2H8HA 5M09A 5JH6A 2A1AB 4FTMA 4KIKA 4TPTA 3ZFMA 5J8IA 4IFCA 1MUOA 3DB6A 2R7IA 3SG9A 4D2TA 2W0JA 5FRIA 3F5PA 4CFWA 3RTPA 1VEBA 4KBCA 2R3HA 4LFIA 1OM1A 5HQ0A 2DWBA 2VGPA 3FEGA 1OIRA 1IRKA 3AC3A 2RF9A 3Q32A 4QD6A 4RQVA 4RIXA 2B52A 2VWIA 4FKGA 3R83A 2JLDA 3WE8A 4FICA 4DT9A 5F9EA 2PUNA 4UWCA 1JKTA 2PMOX 4I23A 2QO7A 3P0MA 1M17A 1URWA 3BYOA 3BYMA 4LI5A 4V05A 4FTUA 2EXMA 4M12A 4XJ0A 4CZYB 4ENXA 4O38A 3TTIA 3FI2A 2CLQA 2E2BA 2VWXA 3R04A 4AAAA 3RCDA 4HVDA 3FYKX 1URCA 4AZSA 3QWKA 4GG7A 3OUNB 3ZOSA 4AQCA 3LCTA 2Z7LA 4LOOA 4IHPA 3HP5A 2XKEA 3D2KA 3LXKA 4FG8A 4RC2A 3IDPA 4WG4A 5DT4A 2HENA 3W2OA 1O6YA 3L8SA 1YKRA 5H8BA 5HICA 4AN9A 4AF3A 4DFNA 3A8WA 2QVSE 1OPJA 1R1WA 4FV2A 1QPDA 5KZ0A 3VS1A 3EN4A 3T3VA 4I5CA 2GHLA 1NA7A 2UZUE 4AA5A 3AMAA 5FM2A 3BPRA 3VWAA 1WAKA 5BYYA 3REPA 5A9UA 2BKZA 3VUHA 3ZMMA 1PXOA 4O0YA 5J7BA 4XNEA 3CD8A 4XG6A 4ANLA 5L4QA 4AOIA 3Q5ZA 5LQFA 3RPOA 3K5VA 3PJ8A 3NEWA 4GG5A 4RWKA 3OXTA 2YCFA 4C58A 2QKWB 4RJ4A 4O83A 4FODA 4C2VA 2JAMA 4MEDA 3W8LA 3B8RA 4W8EA 3CXWA 4X2FA 3ZM4A 4BKZA 4MNEB 4XOYA 2RFEA 3LQ5A 5FQDC 4TY1A 4BWPA 4E5AX 4EH3A 1H26A 5C27A 4DEDA 4MNEA 3ATSA 1EH4A 3GVUA 3UE4A 3NLBA 2CDZA 4YU2A 3PVUA 4D1SA 2W5BA 4HGLA 2RIOA 5HCXA 3ZS5A 4N0SA 4OTIA 3HNGA 2JIIA 3E7VA 3COKA 4FKSA 3WF9A 4PPCA 3LAUA 3F3UA 4F64A 3UVPA 4MBJA 5L8LA 1XH8A 4R5SA 2IWIA 4RFZA 2J0KA 5DI1A 3O0GA 4BBMA 3IG7A 4F7SA 4C37A 3WE4A 1Q41A 4A9SA 2ETRA 2NNWB 4OBOA 4NM7A 5HG7A 4FUXA 4C4HA 3TDVA 5JMSA 2C1AA 3W2RA 5CS6A 3VJNA 2O2UA 3D7TA 2A4LA 3FMKA 1JQHA 3ZO1A 4C35A 4I5HA 4K77A 5DE2A 3ZC6A 4YSJA 5IH4A 3U51A 5IA5A 5KMOA 5BX0A 3E62A 3M11A 2VO0A 4Y83A 3ELJA 4TYHA 5CWZA 4DFXE 3RPSA 4QYFA 4FTJA 2C3LA 1UU9A 2QHNA 3EKKA 4EH5A 1FGKA 4UALA 4OTQA 4EWQA 5IH5A 4NSTA 3TUCA 2OIBA 5J9LA 4OTGA 3PY0A 2QNJA 2W5AA 3HA8A 4X2NA 4M7IA 3FZPA 4E8AA 2YZLA 5EI8A 3KK9A 3R8MA 4YJPA 4MNFA 3JVSA 4K9YA 4NCTA 5CLPA 5E8VA 4C4IA 3UIBA 4HYSA 2JITA 3GCSA 4KIKB 4CZUA 4KAOA 2I0YA 2XJ0A 1PKDA 3DLSA 1PMEA 3FWQA 4WKQA 5J9YA 4F65A 5HD4A 5CQWA 2WOUA 3MY0A 4EK8A 5C4LA 4E4XA 3O23A 4IZAA 2UZWE 2YLFA 4XX9A 5IKWA 4D58A 5I9XA 3S1HA 5IMXA 3WYXA 1NXKA 3EQGA 1I09A 2I40A 4M8TA 3BE9A 4BCQA 3KB7A 2VX3A 3PJCA 3B2TA 1XKKA 3ZYAA 4WUNA 5FGKA 4CZTA 4PTCA 3UO4A 4BKYA 4DFZE 4GKHA 4ZJVA 4G6NA 3D15A 5J9ZA 5M44A 1KOBA 2PHKA 3KXXA 1SVEA 2NO3A 3HECA 4XUFA 4E26A 4FKWA 1JSUA 2QODA 2VTJA 5AA8A 2QURA 1YOMA 3T9IA 5JKGA 3ZDUA 2FH9A 1OL5A 3R9RA 4ZXTA 4EHVA 2VNWA 2IZRA 1IEPA 3ID6C 2VGOA 3O50A 4GYGA 2C0IA 2CSNA 1KE7A 3RZFA 3JPVA 3WF5A 4M3QA 3Q6WA 5F1ZA 4FIJA 4MCVA 1KV1A 3QTSA 4DHFA 4WG3A 3HV6A 4TN6A 4CXAA 3UNKA 1F0QA 1KSWA 4DEHA 2OGVA 4IFGA 3O8PA 4HYUA 4NM5A 3UIUA 5CEMA 3SW7A 5FEEA 2UW6A 3NCGA 4MKCA 1PXNA 5LJJA 3QRKA 4F4PA 1OZ1A 3OCGA 5IA0A 2GNJA 1BI8A 2QKRA 3L9NA 2X6EA 4EHGA 2UZLA 4PMTA 1WVXA 2JBOA 4TWCA 4Y95A 3VHEA 4AZWA 4DCEA 4HOKA 3AMBA 3HEGA 1GNGA 4P5ZA 2C0OA 1G3NA 4DG2E 2HK5A 3AD4A 3NUYA 4MD8E 4R8QA 5AUYA 3FQHA 5M53A 2YHVA 5JSMA 4CD0A 5H2UA 3ZO4A 2XA4A 4AS0A 2BPMA 1O6LA 3KVWA 3TKIA 1JKLA 4EJNA 3PXFA 2C5NA 3DK7A 3QUDA 2VO6A 4C3FA 3I79A 3F2NA 2I0HA 3R1SA 4FTTA 4DLIA 5A6OA 3BLHA 2HCKA 3LFNA 5A3XA 4EORA 1FGIA 2WFYA 3CLYA 3MWUA 1UU3A 3FZSA 4GJ2A 4K1BA 4BWKA 4TRLA 4FMQA 3DKOA 3ZBXA 4LGDA 2BRGA 3IDCA 4ZY6A 3SC1A 3QA0A 3Q9WA 1M14A 4M14A 2WMUA 3P08A 5AUVA 3QGYA 5CF5A 3BEGA 3UQGA 3AG9A 5A4TA 5I9YA 1YXXA 3OCBA 4IVAA 2WMWA 3KN6A 2R3FA 3QX4A 4UYAA 3CS9A 5AUTA 5B2LA 3UOJA 2XM8A 3ROCA 4FSNA 2OK1A 3DBDA 3DTWA 1DAWA 3W2CA 4E4MA 3NW6A 4TWOA 3UGCA 5I9ZA 3ZONA 4WSQA 1OKWA 4B0GA 3JR1A 1A9UA 1LR4A 4ALWA 3AMYA 4C59A 4OUCA 3PA3A 1YWNA 3CD3A 5IA3A 4AU8A 4CLIA 4HVIA 2QR8A 3TZ8A 4U40A 3VS3A 5GJGA 4B9DA 3M2WA 5BVFA 2VTOA 2WQEA 3AGLA 3I7CA 4ZIMA 3DXPA 5D12A 3PP0A 4EUTA 2E9OA 2VTLA 3CTQA 3P1AA 3H9OA 3FLWA 2EVAA 3K54A 5CU6A 4JDJA 3P5KA 4NH1A 3HX4A 3LXNA 2LGCA 3FL4A 2WTIA 5DLSA 5AM6A 4BTKA 3BU3A 2OIDA 5HIBA 3PLAE 3OCTA 3TUDA 4E73A 3VS5A 3VAPA 4XG7A 3CKXA 1WBWA 3Q6UA 2P4IA 3VC4A 4DTBA 4HVGA 3QTUA 5FM3A 3VBXA 4IVBA 4ASDA 4PNKA 3LQ8A 2X1NA 3PPKA 3ZO3A 3LXPA 4F7NA 5AIKA 3SXFA 4IC7A 2YM8A 2AUHA 3PPJA 2V0DA 2FVDA 4ARKA 3FI8A 3LFEA 3ZUUA 2BRNA 4CFVA 4UMPA 2W1FA 1YDSE 4YPDA 3B8QA 3I81A 4QNYA 4S34A 4DEGA 4USDA 3PIYA 3DLZA 3Q4TA 4H58A 3VUKA 3KRRA 2R3IA 4DYMA 5J5SA 4WIHA 4BI1A 2GFSA 2QHMA 4H39A 4O0VA 4QYHA 4RIOA 4J1RA 1XH4A 3GC9A 3OW3A 1QMZA 3FMLA 4FTIA 3RMFA 2UZVA 3NPCA 5FBOA 3GCUA 4E6CA 4FNWA 3I0QA 4I24A 5HHWA 4K18A 4BBEA 1IA9A 3FLNC 1OL1A 2WTWA 4BDGA 4X7QA 4FA2A 2QC6A 1PHKA 2WD1A 3QTQA 4BGGA 5E8TA 2J51A 5M51A 3GOKA 4ZSGA 1W7HA 3A2CA 4FEWA 4FV4A 3NAXA 4YC8A 1IAJA 2NRYA 1NW1A 3PXZA 5KHWA 4OTPA 4CFFA 3EKNA 3QF9A 4CVAA 3T3UA 3FMNA 3COMA 3PYYA 4RLKA 1GIIA 1YWVA 3U4UA 4DGMA 5H8GA 1UV5A 3HP2A 4RX9A 2WQBA 2QCSA 3GFWA 4C33A 3C51A 3UO6A 3EN5A 3KMMA 4BDJA
chains in the Genus database with same CATH superfamily
3LFBA 4AWIA 2PVRA 3BYUA 4BF2A 3SG8A 2ZV9A 4JQ7A 2ITVA 4J52A 1OI9A 3A62A 4V0GA 4YJOA 4O7WA 4UMRA 1HCLA 1REKA 3Q52A 4GT4A 4E5BA 3DDPA 2OZAA 4KBKA 3KK8A 2YWPA 5A4EA 4KKGA 4QMTA 5HD7A 1H8FA 2EWAA 2BROA 3PPZA 4S32A 5C01A 4DG0E 1Y57A 5I4NA 3ENHA 3D9VA 1MP8A 3BHHA 3GXLA 4NK9A 4CKRA 4R3PA 3IW6A 2ITXA 2CMWA 3R1NA 2C0TA 4MTAA 3UPZA 4I0SA 2XAMA 3ORNA 2OO8X 4KS8A 4H05A 5AR3A 4FR4A 4YMJA 2C30A 2C5XA 5JRQA 2ITUA 5IQIA 5L6OA 3RAHA 4BDFA 4E1ZA 2OFVA 3UYSA 4ANBA 4M68A 4RFMA 4RC3A 4L3PA 2PUIA 4O0WA 3R7YA 2YCRA 5HORA 5KMNA 4W4VA 2VTMA 4FX3A 4FT9A 3PDTA 3TIZA 2Z2WA 3R7EA 4EOOA 3AT3A 3QTRA 4FNXA 4CFXA 2WMRA 1UVRA 5DGZA 2ITYA 2W1IA 4G9CA 4J71A 4Q9ZA 4EH2A 5KKRB 4FV0A 1YI4A 3MTFA 4G17A 4C4FA 5BUEA 4BIEA 2F49A 4FTOA 4FYNA 4QP9A 2YM4A 3MSSA 4ZZNA 2W9ZB 3PIXA 4MD9E 4U44A 2XB7A 2BCJA 4L01A 4L67A 4D0WA 4RMZA 1ST0A 5EOBA 4WT6A 4IAKA 5AP6A 5AR4A 4EBWA 3PWYA 1Z57A 4R77A 5GZAA 4XH6A 3SXRA 3OY3A 4FIFA 3VS7A 4CQEA 3P23A 5TO8A 3ZRMA 4CV8A 1FOTA 4HVSA 3WF6A 4I22A 4EWHA 2C6MA 5FEDA 3BQRA 2WEIA 4ZS4A 3H9FA 4FUYA 4JRVA 4IM3A 1UWHA 3MBLA 5CF4A 3MVMA 3R1QA 3OOMA 3NWWA 2NYAA 2OKRA 1UU7A 3QD3A 2W05A 1KE8A 1Q3DA 1OIUA 4D4RA 2VN9A 3E3PA 2HELA 3BHUA 3V8TA 4BYIA 5AEPA 1H25A 4XMOA 1JSTA 3FKNA 1SVHA 5CXZA 2B9JA 4I6LA 2XEZA 2RL5A 2WQMA 4S33A 5L8KA 4GV1A 4PMSA 4CFMA 5CSPA 3WBLA 5JFVA 5BNJA 5HX6A 4I93A 2CGUA 3E3BX 1OUYA 1ZYSA 2XKCA 4JI9A 2YFXA 4OR5A 4YTIA 3BHVA 3R7IA 1U54B 3RNIA 2XZSA 3NUXA 3FMMA 1ZYCA 5KZIA 1ZLTA 1OITA 4BDCA 1M2PA 3W10A 4X3JA 4ZJIA 3V6SA 3MGYA 2WIHA 2RFNA 3FMDA 3RHKA 3R21A 4RIYA 2XH5A 3W55A 5IH6A 3OFMA 5E90A 1A06A 5TE0A 5KMKA 2UVZA 2Y6MA 2WNTA 4I0TA 3EFLA 3CPCA 4CKJA 3CPBA 2E9PA 2UVYA 3WZKA 4J8NA 3A8XA 4UZHA 5IQCA 4R7BA 5EKOA 4ITJA 4DEBA 3OXIA 3ZU7A 4QPMA 3I7BA 2WQNA 3O51A 2IZTA 3GQLA 2X2LA 2PZPA 3E63A 3GCVA 3LVPA 5KNJA 1M7NA 3HMPA 4YUQA 3AKLA 2O5KA 3QHRA 5EYDA 4W9XA 2RG6A 2IPXA 1WBVA 4CTCA 3R71A 5DR9A 3R9DA 3EQDA 1CM8A 4JRNA 5JQ5A 4AXFA 2XNOA 5L6WL 2J0LA 3TACA 2WEVA 3MTLA 4PWNA 5TR6A 4TYHB 2UW7A 4FV7A 3OC1A 4KINA 4FGRA 4YZ9A 3ULZA 5BYZA 4MH7A 5EM6A 4DN5A 4GFGA 2X7FA 2BUJA 4GRBA 2KULA 1M2RA 2ZM3A 3FV8A 3R7VA 3C13A 4AZTA 4JVGA 2QOBA 3TL8A 5CNNA 4AP7A 1PY5A 4X21A 2P3GX 4NTTA 3CBLA 4IAYA 4FV6A 2UW8A 4JQEA 4ZSLA 2C6KA 5AR7A 2PMLX 1CSNA 1OL7A 4ERWA 3UDSA 2R3MA 3HDMA 3TN8A 2ACXA 2GDOA 3C4CA 4FSTA 2HIWA 3L1SA 4Q2AA 4PL3A 3O2MA 3DPKA 4I6HA 3HAVA 4IX6A 5D10A 1TVOA 3D0EA 2PU8A 3V5PA 3HUCA 3UMXA 4ACHA 3RNYA 2FA2A 1V0OA 3R0TA 4AGCA 5JFXA 3DY7A 2VV9A 3DU8A 4FEXA 3KCKA 4L46A 3G2FA 3ERKA 4BZNA 3MFSA 3CKWA 4O81A 5CF8A 3R6XA 4OT5A 1ZMWA 4L44A 4TT7A 1U59A 2YITA 4QPSA 3MPTA 4LGHA 3D94A 4WBOA 1WZYA 4AUAA 3R01A 4D1ZA 4Q5EA 1STCE 1K2PA 1Q8UA 3JYAA 3WZDA 1XQZA 4GFOA 2J7TA 2CNUA 3SVVA 4DITA 4RWJA 4FKRA 4HPTE 3HV5A 2PK9A 5G6VA 2J2IB 4AE9A 2JEDA 2A27A 3BKBA 4GMYA 4P2KA 3R1YA 4QMUA 4EOKA 1ZOEA 5M06A 1Y6BA 3DTCA 2UZTA 4C2WA 4TKSA 3SOAA 4IVCA 2R7BA 2I0VA 4BDKA 2OF4A 3QYZA 3HKOA 4GIIA 4PMMA 2C4GA 1Y8GA 1SMHA 3ORIA 5JT2A 2HZIA 3A99A 1WVWA 4L00A 5AWMA 2WMBA 4F70A 3QXPA 4ORKA 2VTTA 4B6LA 3G15A 3NVKI 3RINA 3OUKA 4BDDA 3C4ZA 3IOPA 4HYHA 1IG1A 5ETIA 5HTIA 1ZMUA 4EI4A 5KMLA 3E87A 5KX8A 1W2FA 2PMIA 3COIA 3ZCLA 2X2MA 2ZV2A 2Y0AA 2CN5A 2WTVA 3KXZA 5BVWA 4R1YA 3R9NA 3OTUA 3ULIA 1Q8ZA 4UMUA 3TI1A 5AV4A 4DGLC 4ASZA 4A4LA 2IZUA 4MK0A 4EOMA 3OWLA 1Q61A 4I6FA 3CEKA 4EK5A 4JS8A 4EZ7A 1XH6A 1FVVA 4A06A 5AUUA 2AC3A 1G8JA 4D9UA 4O91A 1CTPE 4O27B 3H0YA 4TL0A 4E20A 1R0EA 1R3CA 4C34A 1YWRA 4F6UA 4ZLZA 1VJYA 3DKCA 1WBOA 4DFYA 2WMAA 5L2QA 4WG5A 4KRCA 3RALA 4CYJA 4LMNA 4EZ5A 5K0KA 3ATTA 4TYGA 3OOGA 2XNPA 1GJOA 4FK3A 4BHNA 1UWJA 2W99B 4QO9A 5HBJA 4I21A 1V1KA 4NJ3A 5E1EA 3OXZA 3UC3A 4YSMA 2XRUA 4H3PA 2OFUA 4XV9A 4YJTA 2YCQA 3LOKA 4QMOA 5M4UA 3SW4A 2ZYBA 2VU3A 2IVSA 3NUNA 4IJPA 4DINA 4FTQA 2XCHA 3NNXA 4ASEA 3EFWA 4X3FB 2R4BA 4NFNA 4D2WA 2W4OA 4EL9A 4PUZA 1Q8TA 4F9AA 5BPYA 2UW3A 1WBSA 3AC8A 5LMAA 2IO6A 2RGPA 4ZTHA 5KMIA 2JKOA 4PV0A 2WMSA 4F7JA 1HOWA 2WAJA 3C5UA 3ORXA 2UZOA 3DAEA 3MH3A 2Y8OA 3P7CA 3PA5A 4WA9A 3QU0A 4ZK5A 4BB4A 4BYJA 5CAVA 4RBLA 5I9VA 1GZNA 5IU2A 2Z7SA 5LCJA 2ITTA 4QP4A 3SRVA 3V04A 4DGGA 5L2IA 5K4IA 2CKOA 2EB2A 1R39A 2R3PA 5EYKA 3LCDA 3UODA 1OKZA 4O2ZA 5H3QA 1PJKA 4ZTQA 5FXSA 4ZAUA 1W98A 2A2AA 3R22A 5F94A 5HOAA 3DFAA 4FTNA 4L3JA 4ONAA 3BQCA 4W4WA 3V5WA 2W96B 2CPKE 3V51A 3W16A 3ZXZA 3QUEA 2OLCA 4L8MA 3BEAA 3TJDA 2XANA 3EB0A 3FQEA 3VQUA 4AN2A 4E6QA 3KULB 3GGFA 4X3FC 1P2AA 3R2YA 5BQ0A 3SGCA 3FC1X 5TKDA 1PMUA 5A46A 3EL7A 5ANEA 2IW8A 4N57A 2XIXA 4OBPA 4JIAA 5AAEA 3NX8A 2Y6OA 3TNWA 3D4QA 3MJ2A 4NKSA 5CVFA 3K5UA 5HVYA 4FT0A 3LPBA 5HZNA 1BL6A 3C0IA 4QYYA 2LAVA 5I0BA 3RM7A 5LCKA 3CJGA 4M69B 4HJOA 3KRWA 3TKUA 3IW7A 4U43A 3FZRA 4KA3A 4JG6A 4PX6A 2J5EA 1PMNA 2OJGA 2UW9A 5HU9A 1PYXA 4O0UA 3H0ZA 2PSQA 4RPVA 4L68A 4YLKA 2YISA 1UNGA 2ZVAA 4L7FA 4MD7E 5HBEA 2JKMA 4RIWB 4ZSAA 3K2LA 4XCUA 1JKKA 1H01A 4FKUA 4OTHA 4O7LA 2ITWA 4UBAA 4XHKB 4XBUA 2B9IA 4USEA 4H36A 4MXXA 4JIKA 4ANMA 3OEFX 5HE2A 3ZZEA 1QPJA 4QYEA 1UNLA 4FIHA 4MX9A 4ACMA 3CY3A 4NT4A 3QRJA 3UNJA 3MI9A 2ITPA 3LZBA 4FIIA 5HIEA 4EUUA 3TM0A 2QONA 3HMNA 2QOFA 4GCJA 3G6GA 3IPHA 3F7WA 5CSXA 1MQ4A 5GZ9A 3ZC5A 2ITNA 4FBXA 3I4BA 3QCQA 3RGFA 2F7XE 3FZ1A 2X4FA 3EZRA 2GNGA 2OJ9A 3JY9A 4AACA 4IADA 1U46A 3RWQA 1QL6A 1WBNA 5AP4A 2JFLA 2R3JA 2WU7A 3QTWA 5E1SA 4QP6A 4E3CA 1H0WA 1WCCA 1MRYA 2YIWA 3Q3BA 1RW8A 1PXJA 2FSMX 4BCOA 5ANGA 3P4KA 2DUVA 5LARA 4U42A 2CKPA 4O0TA 5FXRA 1TQPA 3MY5A 4II5A 4MHAA 3R28A 5I5ZA 2BZKB 3PFYA 4LUDA 2VRXA 3GU8A 5K3YA 4BC6A 5F20A 4FKOA 3F5XA 1Z5MA 2VTSA 1OKVA 2YACA 4ZTSA 3TZ9A 3HV3A 3MFTA 3BCEA 4X2JA 2F7EE 3BGZA 3H4JA 3TNHA 5CT7A 5AV3A 3CQUA 3NUPA 3L8XA 4OW8A 3AKKA 5CAPA 3W1FA 3C7QA 3R8VA 3F3TA 2QOLA 3S4QA 1H07A 4RIXB 1H28A 5ANKA 4FSZA 3NRMA 4EC8A 4YTCA 4O84A 4NW6A 1Q97A 5HG9A 1W0XC 2YWVA 3ZRKA 3ZEWA 3H9RA 2GQRA 3CJFA 3CGFA 4FT5A 5IQDA 2O63A 3PA4A 4F9BA 1U54A 4QRCA 3VQHA 3LE6A 5EKNA 4QMQA 4FSWA 2A19B 4IB3A 4XG2A 4R3RA 4BZDA 4NU1A 1E1VA 3G9LX 3RHXA 4APCA 3D7TB 4FZFB 4G3FA 3KVXA 5A4CA 3BBWA 3B2WA 3PE2A 4K33A 1I44A 4AW2A 2OBJA 3D5WA 3PXQA 2BTRA 1JVPP 3G6HA 3EMGA 4A9UA 4YJUA 3UMWA 4A7CA 4EC9A 1XJDA 3IW5A 2XS0A 5CZHA 3G0EA 3LFAA 4H1JA 4HZSA 3FI3A 3FY0A 3QCYA 2F9GA 3II5A 1P5EA 4BI2A 5ACBC 1GOLA 4IE9A 3MA6A 1K3AA 2C5OA 2XNBA 5EYMA 4C8BA 3CCNA 4DGNA 5DG5A 3P78A 2GSFA 4G5PA 4GK4A 2SRCA 4FNZA 5FBNC 5EI6A 3HGKA 5AV1A 3LLAA 4ZMFA 3C0HA 4YBKA 3D83A 4HCTA 4QTDA 4CEGA 5CX9A 4ZSJA 2F7ZE 1XBAA 3E8EA 3V5JA 3DS6A 3SKCA 4DEIA 4RJ7A 4KSPA 4Y73A 5CT0A 3CIKA 3KGAA 2X0QA 5CALA 4M0YA 1WBTA 2BDFA 5JK3A 3PRIA 3QX2A 5FTQA 3GB2A 1ZXEA 3F3WA 4BCIA 2J4ZA 2YAAA 4BI0A 5M56A 4RT7A 3HUBA 4E93A 3IGOA 4ZTNA 5FXQA 5KCVA 3S00A 4FVQA 4ZEGA 4NKAA 3IKAA 3NR9A 2ERZE 1GZ8A 4DH1A 3NUSA 4AA4A 4PL5A 4BVUA 2YABA 2F2CB 4G2FA 2R0UA 5GZ8A 2BAKA 3A7FA 2W1HA 5HG5A 4IMYA 3RVGA 3NW5A 3WYYA 3ZEPA 4G6LA 5EQPA 1KE5A 2W5HA 3IONA 2XYUA 3NNUA 4IB0A 4FKQA 4MAOA 3W18A 2C1BA 5GJDA 3LKMA 1APME 5I3OA 3F7ZA 2PUUA 4MBLA 1OGUA 4QYGA 4RRVA 3LFCA 1XO2B 5CEIA 5LVNA 3MIYA 3QC9A 2PYWA 3EL8A 4EYJA 2YM6A 4X0MA 3UDZA 3VJOA 4E7WA 4LL0A 4CFNA 3BHTA 2XIKA 2Z7RA 4GL9A 4GT3A 4P90A 4EKKA 4QT1A 4I3ZA 3UOHA 5C8NA 5CY3A 4F1TA 1DS5A 1FMOE 3FXWA 3UVRA 4RFYA 4IWPA 4RWIA 1UKIA 4FTCA 5EH0A 3N9XA 1PMVA 3KC3A 5DT3A 5DRDA 3ACJA 2BFYA 3O17A 5CU2A 3PUPA 4G5JA 2ETKA 2R3RA 3O7LD 3F9NA 4NM3A 4CMOA 1K9AA 1W8CA 4MUQA 1P4FA 3D2IA 5IEVA 3R02A 2G9XA 3EFJA 3F69A 3EQPA 3GCQA 3PZEA 3QQJA 4PY1A 3WF8A 2IG7A 1YRPA 4FTKA 2JDOA 3U55A 3UDTA 3NSZA 2ITZA 5JFSA 1BX6A 4M84A 1ZWSA 3P7BA 2RG5A 3PIZA 3ZSGA 2B54A 3EN7A 4O7VA 5GIOE 4CSVA 3FZOA 3KULA 4X6RA 2E9UA 1LPUA 1H27A 3DNDA 3EIDA 3PXYA 4ZY4A 4AFJA 2BZHB 2RSVA 4O96A 4ZY5A 3BI6A 3Q04A 2YM3A 4APPA 4ERKA 1WBPA 1IASA 4C02A 1RQQA 4YP8A 3BWFA 5DMZA 3M1SA 3BL9A 4G6OA 2W4JA 3DDQA 1U5RA 3KA0A 2VWZA 4G16A 4UXQA 5AFVA 2X39A 4N6YA 4S31A 4DE4A 4LRJA 4XLIA 2Y4IC 3UZRA 5EI2A 4I94A 2BRMA 4J7BA 3IO7A 3RJCA 5CQUA 5ANOA 4C3RA 4GK2A 3HRCA 4R3CA 3TNPC 1ZRZA 5EW9A 4FJVA 3QKMA 2OH0E 5CEQA 3OF0A 4F9WA 3NFFB 4RX5A 3UOLA 4BTJA 3W0OA 5BVDA 2HOGA 4CCUA 3KRLA 3KMWA 4FNYA 1W82A 3GC0A 4QQTA 5AR5A 1XMLA 5ANJA 5KBRA 2CNVA 1Q99A 2Q83A 3BV2A 4E5WA 2IVVA 3VBQA 3ENMA 4NFMA 5CI6A 2XNEA 3I60A 4AW5A 4L52A 4ZMEA 3QHWA 2B53A 3F2AA 5L8JA 5LVOA 1YXTA 4FOBA 2JC6A 4PPBA 4QNAA 3NIEA 2Y9QA 3E7OA 2XIZA 3Q4UA 3QQGA 2XJ1A 3E5AA 4HGEA 1SZMA 3ZO2A 3V5QA 3OROA 2OXYA 2B9HA 4TYJA 4O0RA 3EQIA 1ZMVA 3RK9A 5LWMA 4UXLA 4D28A 2JFMA 4RJ3A 4XS2A 4YR8A 3AC4A 4EOQA 1SVGA 4L43A 4NCTC 4XV2A 5E8YA 4AE6A 1H0VA 4RX8A 3ZBFA 4O4EA 5D7VA 3R8LA 5IZFA 3MH1A 2PZYA 2HY81 2VTAA 4J96A 4WNMA 5F95A 3TIYA 3P5JC 4BDHA 1P14A 3EQRA 3IW8A 5DRBA 3S95A 2AYPA 2WQOA 4D0XA 1YW2A 3LXLA 3I0OA 3O8TA 3V8SA 4E4NA 4DC2A 3DJ7A 1OUKA 2B0QA 4MXCA 1OPKA 4GS6A 4XG8A 4NWMA 1NVSA 4EYMA 5KUPA 4N70A 3MPMA 5EYCA 5JFWA 2YERA 4M69A 4DEAA 4R6VA 3KL8A 2ZB0A 4QQ5A 3OMVA 2Z8CA 3KF7A 3W2PA 5JGBA 1BLXA 3PY3A 4DG3E 5F4NA 4QP3A 5AMNA 3G90X 1XR1A 2JDRA 4O6EA 2HAKA 4ANOA 1UNHA 3QLGA 5FWKK 1JLUE 3MPAA 4YHJA 4YHFA 4WNOA 5EDQA 5C1QB 5AUWA 5G1XA 5FLFA 1YVJA 2QG5A 1UKHA 3F6XA 4PNIA 4QMZA 4RWLA 2XBJA 4FF8A 5ANIA 5GJFA 5HG8A 4TXCA 2FUMA 3ZLWA 4C38A 5ICPA 3FXXA 5L6PA 4NW5A 3L9LA 5J95A 2VD5A 4ZZOA 3D5UA 3FYJX 2ZMDA 3NNVA 3QRUA 4LOQA 3BV3A 2X9FA 4NL0A 2BALA 4IX5A 3QYWA 4IM2A 2E9NA 3CQEA 1RJBA 2DS1A 1B38A 2HW6A 2PVKA 3F5UA 3NIZA 4FZ6A 4EQCA 4BY9E 4N6ZA 4BR3A 4U45A 5FDPA 1Z9XA 4G9RA 4BCGA 4GK3A 3H3CA 3ZXTA 4IAZA 5CI7A 4IDVA 5A4LA 3DKFA 4BIBA 2GHGA 2GNLA 3W0NA 4BKJA 5IPJA 3ETAA 3F88A 1OBDA 3TNQB 4L45A 1CKJA 1H1WA 3A7JA 3VIDA 4NTSA 3OBGA 3HRFA 4AZEA 4M67A 3TTJA 2W1EA 1RE8A 3BE2A 2VWUA 1Q8WA 4IC8A 3KN5A 1SM2A 4FK6A 3C4EA 3AT2A 2R64A 3CTHA 4F7LA 1T45A 5CAOA 4R7IA 4QTBA 4O7ZA 2J0MB 2C6LA 3Q53A 2XCKA 3L9PA 1AQ1A 3SX9A 4F09A 5DEWA 4BCPA 5HNGA 4F6WA 4W8DA 1PXLA 4ENYA 4IH8A 4DBXA 5HNIX 2FGIA 5DEYA 3GT8A 1W83A 3DK3A 3HL7A 4AXEA 2OICA 2UUEA 3WI6A 5J1WA 3BLQA 3U87A 4IM0A 5EQEA 4ITHA 4CTBA 1DAYA 4D2VA 3FPMA 3QL8A 4GSBA 3SV0A 2ZFYA 3ITZA 3NYXA 4YO4A 3DBEA 3MIAA 1KV2A 2W1DA 3RPVA 5K4JA 1ZZLA 2WMTA 4BTMA 2IVTA 1FVRA 4JDHA 2WB8A 4AA0A 4WRGA 1XH5A 4QMVA 4EHEA 4DGOA 4DFBA 4C4EA 4EK6A 2R5TA 4Y85A 4B8MA 4FEUA 5HX8A 3UIXA 2VTNA 3PTGA 2C6IA 4HNFA 1E1XA 3N4UA 4JG8A 4QTCA 3KXNA 4K11A 1RDQE 2W7XA 4O2PA 5EHYA 3N51A 3ZFXA 3W0PA 3PVWA 4XRJA 3GCPA 1BKXA 1OPLA 4IB5A 3NNWA 2H34A 3FLSA 3DJ5A 3QZGA 1X8BA 2REIA 3MFRA 5LMKC 1LP4A 4B4LA 2BAJA 2BZJA 4E6DA 4F0FA 4GH2A 2VUWA 2JKQA 3FHRA 2WTCA 3ZLSA 3KEXA 4IANA 2KTYA 4OAVB 3PY1A 3V01A 1GZKA 4MYGA 3AOXA 4FE2A 2QOKA 3OS3A 4A4OA 3WIGA 5AX3A 5CYIA 4X6QC 3DBCA 5E8WA 4ZZMA 3BGQA 2BHHA 3KKVA 4O22A 2HZ4A 3RAIA 2XP2A 4DF3A 1J91A 2R3OA 4LDTA 4FSQA 2O65A 3G33A 4BCFA 5CTPA 3QZHA 3GBZA 5HGIA 4FKJA 4B8LA 4JAIA 2G2FA 3CTJA 3DAJA 1YXVA 3MYGA 3QKLA 1ZARA 4AGDA 4D2SA 4EH4A 3W8QA 4ACGA 3GOPA 2C3KA 4FSMA 3OVVA 4O1PA 4S30A 3L9MA 3LMHA 3LM0A 2YIRA 3P79A 3IGGA 3PP1A 5L3AA 3QUPA 3VW8A 4O7RA 4J99A 3A60A 2X8DA 3O71A 2HY0A 5ETAA 5GNKA 1L8TA 2PTKA 4RA5A 4FSUA 2OSCA 1XWSA 5KMMA 2QG7A 3KU2A 3TCPA 3NGAA 3LW0A 3R30A 4YJSA 1VLRA 5CSWA 2PVHA 2YIQA 2OG8A 3Q60A 3U54A 1XH9A 4IQ6A 4IIRA 4A4XA 4XV1A 2R3GA 3CQWA 4QMXA 1V0PA 2XF0A 4UEUA 3SD0A 4MXYA 4I5PA 2JD5A 4M66A 3IW4A 2GNIA 3FLQA 3VBYA 3EJ1A 4AT4A 2Z7QA 4WO5A 4YZCA 4IXPA 3RPRA 5BVEA 5M57A 3W0MA 3HYHA 4G3EA 4JAJA 4YZNA 3UP2A 4WUAA 3PXKA 4R1VA 2C6EA 3G51A 5LVLA 2YZAA 2R3QA 4JBPA 3DXNA 4EBVA 4YC3A 5JZJA 1FVTA 3FSKA 3FZTA 2GS2A 3Q96A 4FGBA 4JNWA 3UVQA 3VS4A 4DHZA 3LMIA 2UW0A 3ORPA 3R8ZA 3PJ1A 5T68A 3FC2A 5AJQA 2V62A 2W9FB 4NEUA 2HWOA 4PRJA 4UMTA 4NM0A 5D11A 3KQ7A 3BL7A 5DBXA 5HBHA 2CKEA 5IUIA 3FE3A 4DH8A 5E8ZA 5LVPA 1PXIA 2Z60A 1DI8A 3MN3A 3Q5IA 5HE1A 1JKSA 4PDYA 3F82A 3QTZA 3IOKA 4UMQA 1HCKA 3E64A 2V55A 4ID7A 4XBRA 4EOPA 1OKYA 3DXQA 4JQ8A 1H4LA 4GUEA 2WKMA 3TYKA 3FJQE 1CKIA 3UPXA 5ETCA 5BVNA 1ZOGA 3Q4ZA 5EOLA 3Q9XA 4UX9A 2J50A 4OGRA 1KE9A 2Z02A 2QOHA 4BFMA 4QMNA 2WU6A 1IR3A 3OD6X 4IVDA 4MQ1A 1YQJA 3ANRA 4GYIA 4IAIA 4P7EA 3AXWA 4RIYB 4FIEA 5CVGA 4AT3A 4QQCA 4GUBA 4YO6A 2VTRA 3LJ2A 1TZDA 2Y4PA 3ACKA 3I5NA 4DEEA 4QTAA 2CKQA 4QQJA 4MXOA 4EOIA 2C5YA 4CFUA 1BMKA 3PUFC 3QRTA 4DTAA 2CCHA 3MVLA 3R8PA 3U9NA 4FSRA 4FEQA 3QQFA 3BHYA 3RM6A 3MW1A 3NCZA 4EHZA 4QMLA 2XIRA 3C5IA 3SA0A 4F1OA 2OWBA 3VNTA 4MXAA 3V5TA 5AV0A 4MWIA 4KIQA 2J0JA 3BU5A 4U79A 4ZP5A 4D4YA 1ZZ2A 2WMVA 1LUFA 2WTJA 4L53A 5HO8A 4AFEA 1JAMA 3AC5A 3D14A 3OT8A 1ZYDA 1YHSA 2UZEA 3QFVA 4IACA 2WELA 4IWDA 1KOAA 4YLLA 5EQYA 1F3MC 5ITAA 1LEWA 2XNMA 1UU8A 1H08A 1PXPA 4RZVA 3JS2A 2B55A 2IW9A 3LCOA 3M42A 4LRKA 1IAHA 5M55A 2X7GA 3MVJA 4U81A 4PTEA 4ANQA 3VF9A 3OWJA 3KMUA 3BRBA 2CN8A 1OIYA 2ZM1A 3EN9A 3RK5A 1L3RE 4JX3A 2BRBA 3RAWA 3UIMA 3U6JA 2JDSA 2YDIA 3TZ7A 4YJNA 4YPSA 3VVHA 3FLYA 4KB8A 4KWPA 5CSVA 2W17A 3W2SA 4F99A 2PZRA 4G3GA 1G8KA 3OHTA 3K3JA 4QOXA 5FD2A 3PLSA 4PL4A 3T9TA 3DGKA 2XRWA 2BVAA 4D1XA 1CKPA 2V7AA 4FTRA 4GFMA 1J1CA 5E92A 5FTOA 4HZRA 1XHAA 2ITQA 4OBQA 4MWHA 3ZHPC 1ST4A 5J87A 5DYJA 4Z55A 5DT0A 5C03A 2QR7A 3OT3A 3TUBA 3WZEA 5DHJA 2XYNA 3HV4A 4CCBA 5HNBA 3HMMA 3QLFA 3EN6A 4C61A 4Z16A 4PDPA 1ZY4A 4I6BA 3P7AA 2X81A 3I1AA 3WF7A 4M15A 4C36A 3QQHA 3EH9A 5CEPA 2NP8A 3RK7A 2X0GA 3NUAA 4RSSA 4BN1A 2P2IA 4K8AA 4BZOA 3JUHA 4F6SA 1YOLA 1ZYLA 2V5QA 3QA8A 4QP7A 3TV7A 2YM5A 5CEKA 5HE0A 4DA5A 1SNXA 1VR2A 2B7AA 2G2HA 1JSVA 3OBJA 3OTVA 4I5MA 4FVRA 1XBCA 4A9RA 2IN6A 4XP3A 3NVMB 4YJQA 2FSLX 4YNEA 3FPQA 4DHJA 3BU6A 1W2CA 4UZDA 4BDEA 4FV3A 2PUPA 5KHXA 5HI2A 4FTAA 4O82A 2OZAB 4GU6A 3DAKA 5I9UA 3LCKA 3C4XA 5HTCA 3VBVA 4M97A 2X2KA 5AUXA 3VULA 4ZJJA 1H00A 4MQ2A 5GIPE 4O4DA 4QP1A 4QDEA 1J3HA 2GMXA 4FKIA 4DBNA 5I9WA 4EOJA 3ZRLA 2AEGA 3ZLYA 2WMXA 2ZDTA 3GI3A 4N4SA 3QKKA 5IEYA 1JBPE 4IDTA 2YEXA 1GIJA 1YOJA 5HO7A 4YC6A 4FKTA 2R0IA 4O4CA 1U5QA 5B0XA 4C4JA 1XH7A 2Y4IB 4Z7HA 5IMEA 2XEYA 4YZBA 1M7QA 5FTGA 1TFFA 1JNKA 2ZM4A 4TNDA 4EONA 5CANA 4CV9A 3ZSHA 4FKPA