3ETAA

Kinase domain of insulin receptor complexed with a pyrrolo pyridine inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
293
Chain Sequence
EVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords insulin receptor, kinase domain
publication title Discovery of 3,5-disubstituted-1H-pyrrolo[2,3-b]pyridines as potent inhibitors of the insulin-like growth factor-1 receptor (IGF-1R) tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 97
structure length 293
sequence length 294
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3etaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3etaA01
4LV8A 4AN3A 2ERZE 5B0XA 2WU6A 4EK4A 3UG2A 3KRWA 3TI1A 3OT8A 3R1YA 1V0OA 5AIKA 4ZLZA 5H8EA 3VUTA 3CJFA 3EHAA 4FSZA 1OKVA 2ZOQA 3G9LX 4ANMA 2UZBA 4UMQA 5C4KA 2J90A 3Q4CA 3F3WA 4FSNA 5CI6A 4RWJA 3D94A 3NR9A 4PTCA 1YOLA 1XBBA 3V51A 4O0WA 5D11A 4BZNA 3WZEA 3MVLA 4CV9A 3WF7A 5A3XA 1H25A 4QYEA 3BE2A 3KXXA 2VWBA 5ANGA 5H8BA 4M84A 4XLIA 5ANDA 4F7LA 5JGDA 5TF9A 4ACGA 3PY0A 3ZRLA 5FBNC 4ACHA 3QHWA 4QMTA 4BIDA 3KB7A 4TXCA 4Y83A 3MY5A 4MXXA 5K5XA 2YCQA 3QLGA 1J1CA 2OJ9A 2WMSA 3ATSA 3OW4A 4ITJA 1RJBA 4WA9A 5DFPA 4F1TA 4II5A 1A48A 2Q83A 3D2KA 3Q2JA 2HZNA 4USEA 5FRIA 3EFKA 2V22A 3BU3A 3IDPA 5HCYA 3KCFA 4WBOA 3HV6A 4APPA 1XH5A 5JN2A 2CGWA 3GNIB 2BIYA 5CI7A 4CD0A 2BRNA 5JFSA 3V6RA 1H4LA 5IUGA 3MESA 3SLSA 4F0FA 2IW8A 4BGHA 4CCBA 4U43A 4KIKB 4E73A 4HW7A 4FEWA 2V7AA 3MFUA 3FZ1A 4A4OA 3NNWA 4ASZA 2HWOA 2PVJA 2LGCA 3A4PA 3KULB 4TT7A 2YIQA 3KMMA 2VAGA 3Q6WA 5HE2A 3CTQA 3QQLA 2XZSA 3R9OA 4U0IA 4NM7A 3PXZA 1H1RA 2OXYA 4DGGA 4TYEA 3F2RA 4U42A 4XHKB 3O8TA 3L1SA 3ZUVA 2E9UA 5ITAA 4PPAA 3NIEA 4XG7A 4QQ5A 3BV2A 3LQ5A 4P7EA 1UA2A 3U9NA 3ZEWA 4OAVB 2IZUA 3E7VA 2ZAZA 1PXIA 3FLSA 3P79A 4IZ5A 4IM0A 3G0EA 5AR5A 5EQYA 4ERWA 5CSXA 4LFIA 4N4SA 4LL5A 5CNOA 2B53A 2YM5A 4A9UA 5EOLA 5IA4A 3R73A 5HLWA 4FKIA 3FI8A 2BZKB 4DBXA 3BI6A 3ZFYA 3SRVA 2C6KA 2OIDA 2ETRA 2YWPA 2PMLX 4CRSA 4CT1A 1H1WA 2WOUA 3PA5A 3PG1A 4FT7A 3UQFA 5AFVA 5DHJA 3DBEA 2XS0A 2WGJA 3FMLA 5EQPA 2UW4A 5KUPA 3JPVA 2C4GA 4PF4A 2PULA 5JFWA 4X21A 1H26A 2I0EA 3C4FA 3L8VA 4C2VA 2OXXA 2X81A 5E8UA 2Z7QA 5EKOA 4RIXA 3IQ7A 3UC3A 1OPLA 2BTRA 2HWPA 2ITTA 2RG6A 3LFBA 4FIHA 5AV2A 4WNOA 3GCSA 4AW0A 2YN8A 3BYOA 3C4EA 4C37A 4TWOA 2R3KA 4I5HA 4BDIA 3AC4A 3MH0A 3FLQA 5ANJA 4ZZOA 5IEXA 3SD0A 3VJOA 3TUDA 5DGZA 4WKQA 4C0TA 4D1SA 2R2PA 2QR8A 3PXYA 2CJMA 3W8LA 3RPYA 3O0GA 5AUYA 3MH3A 4L8MA 2KTYA 4FV7A 1YXXA 4D9TA 3E88A 3R01A 4BCNA 3MFSA 4FV4A 2WIPA 3TNIA 4ZTLA 2Y4PA 3D7ZA 1YI6A 2RFNA 2X6EA 3QRTA 3PG3A 2QO9A 1YXUA 2JAVA 4QP6A 1YWNA 4JG6A 4PL4A 4XOZA 1GZOA 2B52A 3MA6A 4XCUA 5AIRA 3HX4A 4AA5A 5KCVA 2AUHA 5CVFA 4D2VA 3HECA 3QZHA 3LZBA 4UB7A 5ANIA 3R83A 4I94A 4D1ZA 5IA0A 4QTAA 3DXQA 3FLZA 1UNHA 1BL7A 2IWIA 3LMHA 4RFZA 2JDTA 3GFEA 4TPTA 3A7JA 2CN8A 2EU9A 2PZIA 3IG7A 3NWWA 4I5CA 5HG5A 4DITA 3VBTA 3W2CA 3FMMA 3FJQE 3Q53A 4YP8A 5AAFA 4C4FA 4QMPA 3OCBA 3PFQA 2YAKA 4M12A 3EQPA 3FZPA 5LOHA 4O7WA 4BDEA 3R6XA 1M14A 4CKRA 4GJ2A 4FF8A 3VHEA 5LMAA 4BCGA 2W1ZA 4FEQA 2G15A 2J50A 3B8RA 4ANOA 4C57A 3TDWA 3TXOA 4UX9A 4YLJA 4IX4A 2ITZA 1URWA 2QHMA 3KRLA 4O0VA 4BDBA 4OTGA 4GCJA 4EOJA 3CY2A 4EHEA 4HPTE 3AD6A 5CAVA 2PVMA 4IVCA 1URCA 3FYJX 3I6UA 4MXYA 4R3PA 4AT3A 4EJ7A 3R7GA 2B9FA 3PSDA 4NH1A 1MP8A 2W1HA 4FTMA 2PMIA 3P7CA 2UZTA 2Y9QA 4EHGA 5IQFA 4AZFA 4JR3A 3PXRA 1OPKA 2C1AA 4G31A 4XRLA 3RJCA 4IMYA 2UW5A 3HV3A 3IONA 4USFA 4JX7A 2C3KA 4FKOA 3R8PA 3KY2A 4EHZA 1BI8A 4NSTA 3K3IA 3ZSIA 4AZSA 4TNBA 3HKOA 2PPQA 3ZDUA 4FOCA 4QYGA 3CC6A 3QD3A 4OTDA 5D10A 4HYSA 2W1DA 4KWPA 3WIKA 5IZFA 3LHJA 4D9UA 4IAZA 3OWLA 3LJ1A 4EK6A 5I5ZA 3LFNA 3QTZA 4CEGA 4Q5EA 3I7CA 5M4FA 4BDAA 3QQFA 1BL6A 2IW6A 3FMHA 2PE1A 5AX9A 3TNWA 2VTNA 4TW9A 4EC9A 4EH9A 4D2TA 2JKKA 4YLLA 1WBTA 4N6ZA 2UZWE 1WMKA 4QMVA 4LYNA 4OT5A 2WB8A 3ZONA 3PPZA 2UW0A 2VO3A 2FSMX 4DYMA 5EHLA 4RIWB 3QUEA 3EN7A 4MYGA 4U6RA 2VGOA 1PF8A 5HG9A 3CSVA 4BC6A 2JKQA 3LCTA 1NW1A 3VF8A 1H8FA 3DK7A 3E8DA 2UZNA 4QTCA 3PZEA 2FUMA 3ZRKA 5BVNA 3H30A 3RKBA 3R7VA 5CENA 4G3FA 4FTAA 4NFMA 4DF3A 1JNKA 3VS0A 5EW3A 5L4QA 3K5VA 4IZAA 4C36A 3UOHA 2XJ1A 4MXOA 5FTOA 3QZGA 4OR5A 3E8CA 3LM5A 3PJ1A 1JKTA 2VTIA 3MBLA 3O7LB 4PMSA 3HV4A 3UO4A 2VWVA 1XWSA 4TZRA 4UYAA 4BIBA 4KSQA 4H58A 5AUWA 4MF1A 2GDOA 3E7OA 3KF7A 3I5ZA 5AEPA 4FTRA 4F65A 4U79A 5JGBA 2CGXA 4GFOA 4B6LA 5I9YA 5L6OA 4PV0A 4OTPA 5ETAA 3GU7A 2VX1A 5A14A 4BBFA 5BVOA 4UN0C 2CNQA 3K5UA 4MD9E 3FZTA 3DPKA 3U55A 2WTWA 2BDFA 4FZ7A 1JKKA 2QLQA 2BDJA 3PPJA 2Z7SA 4QMZA 4WO5A 3WYXA 1IG1A 2WQEA 4LI5A 4G6LA 4C02A 4O6LA 5AMNA 4R1VA 4EOPA 4YBJA 1UU7A 4ZTSA 2HW6A 3ANRA 2PWLA 3ZO1A 4AA0A 3MVMA 4WG4A 3VWAA 2YISA 4FNWA 4LQMA 5I3OA 3HMOA 5KZIA 2GMXA 3V8WA 2FYSA 3PIZA 5C4LA 1SVGA 3OCGA 2B55A 3OMVA 3UZTA 3EQIA 3R7YA 1OVEA 4F9CA 5I9ZA 5I9VA 3F5GA 2Y4IB 2WELA 1H08A 1GZ8A 3Q4TA 2E9VA 4FVQA 4FV2A 5AUZA 4CFNA 1M2QA 2DWBA 4F9AA 1OBDA 2VTHA 2WMBA 4FTQA 1ZYSA 3R7EA 2ONLC 3FC1X 4IX5A 4C34A 4EH7A 4HCVA 3WF8A 2J0MB 4ZSLA 4M69A 3BELA 4LGDA 4CFUA 3LKMA 3FSKA 2X8DA 3HP2A 3HZTA 2PUIA 1KV1A 5IG1A 1Q8WA 3R71A 2YCSA 5HX6A 4QPMA 2VTMA 1WBWA 3A2CA 5HG7A 5FXRA 4H3QA 3FSFA 2Z8CA 2JAMA 4YHJA 1OKZA 1ZWSA 5JZJA 4ZXTA 2BDWA 4IWPA 3N4TA 4R5YA 4GYGA 3RAWA 2OK1A 2G2HA 4XOYA 5CU6A 3JS2A 3MY1A 4QMOA 4RQKA 4IJ9A 3VVHA 2G1TA 1JQHA 3EL7A 2DQ7X 3W32A 4CSVA 4DEHA 2X7OA 3GC7A 3NCZA 1BI7A 5DT4A 1FBNA 3DQXA 4O96A 1J7IA 3A7HA 2WZJA 2NP8A 4IJPA 3QLFA 4Y85A 4DAWA 4ZK5A 2WIHA 3W2SA 2IVVA 3F2NA 4CYJA 4DGNA 4M8TA 3S2PA 3GVUA 4FK6A 2ZDTA 4RRVA 3DDQA 2I0VA 2WNTA 2QOQA 2C6LA 3S3IA 3QTIA 3RBWA 1PXOA 3MJ1A 3ZZEA 2OWBA 2J9MA 4NM0A 4XV2A 4R3CA 4U3ZA 3QCQA 5HU9A 5BYLA 1AGWA 2W5BA 3COHA 2R4BA 1VJYA 3QD0A 4CG8A 4QP7A 4E6AA 2QO7A 1ZYDA 2YLFA 5A4CA 3ID6C 3KC3A 3HAVA 3HRCA 5HNBA 2RFEA 3O23A 4YJPA 4YU2A 4GEOA 2E9NA 5AP4A 3LJ2A 5FP5A 3UVQA 3QTXA 2GTNA 5AR2A 4RC3A 3VO3A 4D58A 3TKIA 4ZS4A 4G5PA 4TKSA 2HZIA 3DBFA 4YHFA 1PHKA 4CMUA 4FI1A 4TL0A 1JKSA 5IDNA 4O7NA 1K3AA 3C13A 3DFAA 4IM2A 4XG2A 3UYTA 1SZMA 4IB0A 2GFCA 4S33A 4NTTA 4ZP5A 5CVHA 5HTIA 3GOKA 4UBAA 4APCA 2Q0NA 1LEZA 4FG8A 1KV2A 3PA4A 5IQAA 1WVYA 3KFAA 3JVSA 3GP0A 3GU5A 3SV0A 4A9RA 5LWNA 4Y72A 3MB6A 2PUPA 1APME 2R3MA 5L3AA 3EQRA 3BGPA 2PZYA 5FQDC 1ZYLA 2W0JA 3G9NA 3LXNA 5EI2A 4ZZNA 3R63A 3SXFA 1K9AA 2OG8A 2BR1A 2ZVAA 4QMUA 3NUSA 4NFNA 3F2AA 3H4JA 4I3ZA 3QD2B 4KSPA 1K2PA 1ZZ2A 4IQ6A 5L2SA 4IWOA 3O71A 3FZRA 4KIQA 4X6QC 4ZLYA 4CMTA 4JAJA 4EKLA 3RTPA 4R7HA 1MRUA 4JX3A 1OBGA 3WYYA 2ZM4A 3BPRA 4XG3A 3UIXA 3IECA 4DEIA 2BALA 3CLYA 3ULIA 2HIWA 2PMNX 4LRJA 3P5KA 3FY2A 1JLUE 5IQCA 3OCSA 3QTRA 1FMKA 3P4KA 4HVIA 3ROCA 2W4KA 4D4VA 2I40A 3A7FA 4RVLA 4EOOA 1VYZA 4EOIA 4YJVA 1PYXA 2C6OA 3LFEA 5FTQA 3RK9A 5AA8A 3FMKA 2WEIA 2XIYA 4I22A 2WXVA 3QGYA 5CZHA 5GZ8A 4EH5A 2GS7A 5CT7A 3KQ7A 3MJ2A 3MH2A 4QQJA 3S00A 4BCMA 4CFXA 3ENHA 4FL3A 3F3TA 1W98A 4MAOA 5IA2A 2PE2A 4D4RA 4S2ZA 4BGQA 4RX5A 1PXMA 2F2UA 2J4ZA 3B2WA 4MNEB 4QPSA 3ZOSA 3IKAA 4XMOA 3I5NA 3FI3A 1Q62A 1YXTA 2J51A 3Q9YA 4XG4A 4QQTA 3RI1A 4IVDA 3QHRA 2VTPA 3SW7A 2JD5A 1Q41A 3D14A 5KMJA 4O7RA 1YHWA 4UYNA 3TM0A 5CSVA 3QTUA 4FSQA 1TQIA 2C47A 2W9ZB 1JPAA 1PXJA 1PXNA 5EFQA 5ANOA 3MV5A 5AR8A 1V1KA 3PWDA 3ZYAA 2HOGA 3HEGA 4JRNA 4YTIA 4PP7A 2VWIA 1R1WA 3OOMA 3O50A 4AGUA 3TG1A 4TN6A 5HICA 4QP3A 4U97A 4XBUA 1QCFA 3T9IA 5HD7A 5K9IA 4F4PA 3O96A 5IQIA 4O0SA 5KMMA 4R78A 3BU6A 2VTQA 4ONAA 3ORPA 4FTLA 2XCKA 4E3CA 5FXSA 2C6EA 1GZNA 4FIFA 2ITVA 4FIGA 1Q24A 4F1MA 3BGQA 3FMNA 4OT6A 4X2GA 4DHFA 4YJOA 3BYSA 1HOWA 3DNDA 1J7UA 3LE6A 3NNVA 1F5QA 4I6BA 3U87A 4EH4A 1NVSA 4FKRA 5B7VA 3FZSA 4I0SA 3DKOA 3W55A 4A9SA 3OW3A 4L3PA 1O6LA 4C8BA 5CNNA 4JRVA 3NVMB 3ORTA 2J0LA 2B4SB 2HAKA 5D12A 4FZAB 5DN3A 2QD9A 3ENMA 4EI4A 3MFRA 3RWPA 4JIAA 4LOPA 4PTGA 2G2IA 5E92A 3V5LA 4QMNA 5CQUA 2B9HA 2YDKA 3T8OA 4FEVA 2UVYA 4D55A 1RDQE 5KBRA 1A06A 2XYUA 4C2WA 1ZOHA 2WFYA 2UW6A 3CY3A 4A06A 3PZHA 3FPQA 3QYZA 3F9NA 5EDPA 5DH3A 3UVRA 2VO7A 4O7LA 3BBWA 5EYMA 2PUUA 4C59A 4BBMA 5J9LA 3GOPA 2Z02A 5CS6A 3EB0A 3TJDA 4AS0A 5A4TA 1ZLTA 3ODZX 5IH4A 3W2QA 1XH9A 4RQVA 5JEBA 2Z7LA 3NYXA 4JOAA 4WIHA 4RIYB 4RWIA 4RJ7A 5AP2A 5ANKA 4ITHA 1W82A 5A6OA 3N9XA 3R1SA 4JXFA 4GG5A 3V04A 4AFEA 3O51A 5J1VA 4PWNA 1PMVA 4UY9A 4D2PA 4FNXA 1ERKA 2PVKA 3D83A 3QTQA 2X7FA 3R1NA 4GFMA 3RPSA 3WOWA 4FGRA 3A61A 4G16A 3PY3A 1R0EA 5JFXA 4TRLA 2XK8A 3V5WA 4H1MA 4L46A 3NAYA 4YJTA 5KBQA 3V5JA 2PU8A 2ITPA 3ORIA 3EFLA 2VZ6A 5K0KA 4GH2A 4BB4A 4DEGA 4OGRA 4NIFB 2JITA 4KBCA 3BYVA 3JYAA 3PE1A 5J95A 5C8KA 4Z16A 4DH3A 4EK5A 5AM6A 5HD4A 3KULA 1FVTA 5AX3A 4EOMA 2B54A 2R0UA 3NGAA 4IAKA 3UIUA 4YSJA 4L53A 4MK0A 1BMKA 2XCHA 4L6QA 2WQNA 3VW6A 4B8MA 4GYIA 5GJFA 4UMUA 5F9EA 3QKLA 3HDMA 3BGZA 4MWIA 3RINA 4ANBA 1OKYA 4QP9A 4GU9A 4R6VA 4RFYA 3NPCA 3RWQA 5L8JA 1X8BA 4FSWA 1A9UA 2BMCA 4HZRA 3FL4A 4PX6A 3R9DA 3P08A 4X3JA 3BWFA 5J9ZA 4GRBA 3MYGA 1PXPA 3DDPA 4OTWA 4RG0A 4AE6A 5DPVA 4QMXA 3CE3A 4BDDA 4FA2A 1KWPA 1F3MC 4FKJA 4K6ZA 2NRYA 5F95A 1Q8ZA 3GCVA 3UBDA 3EQFA 3CPBA 2PUNA 5M07A 1R3CA 4FODA 1CKJA 4AT5A 4NM5A 4ZJIA 3FAAA 3VBYA 4E4NA 3TNQB 2XNPA 3MPMA 1J7LA 2YM4A 3D0EA 1DI9A 2X4ZA 4M68A 4ZTQA 4ZY6A 4NKSA 1YQJA 3T3VA 3QUDA 4I4FA 5TT7A 3DKFA 3PA3A 4K8AA 5HI2A 3WZKA 4BYIA 5I9WA 1ND4A 3SG8A 2QCSA 2CGVA 3CQUA 3HA6A 4E6QA 1CKIA 3EZVA 3DJ5A 3ELJA 4H1JA 3VUIA 3AMAA 4H3PA 3V8TA 4FGBA 4D2SA 4FTOA 3IO7A 3KKVA 4P5ZA 3NYVA 2V7OA 3ZTXA 1OIUA 3GT8A 4AOIA 3KF4A 2V62A 3C1XA 4IH8A 3IW5A 3RCJA 3QRJA 3HVCA 4C4JA 5FEDA 5H3QA 3F66A 3QBNA 4U9AA 1ZMVA 3U4UA 2R3PA 3LVPA 4X3FB 4AZTA 4BCJA 5DWRA 5J1WA 2FSTX 4USDA 2JIVA 4O0YA 4Y5QA 2OH4A 4I24A 1FGKA 1XR1A 3PSBA 3QA8A 4P2KA 4CVAA 1UWJA 3KRRA 2W5HA 3ALNA 4H05A 2XB7A 2WMXA 2A1AB 3EOCA 1OMWA 2PTKA 5DRBA 5GZ9A 2C5VA 2QQ7A 2QOFA 4DFBA 2QHNA 1FMOE 4BICA 3VBQA 3KL8A 2OGVA 3CTHA 1XBCA 4JR7A 2OU7A 3NUNA 4CRLA 3C0GA 2YJRA 4ZTHA 3W16A 4I5PA 1G8SA 5E90A 5DI1A 4MHAA 2J0JA 4RWKA 1FOTA 3UZRA 1KE9A 1JBPE 4EEVA 3KXNA 4WOVA 5CAOA 3FLNC 4GS6A 1H1PA 3E64A 3UE4A 4CNHA 4QD6A 4RX9A 4YMJA 4O7VA 2ERKA 1ZAOA 4YGAA 5ICPA 4O1PA 4N70A 3IDCA 1UWHA 1DM2A 1NXKA 4K18A 2ACXA 4MF0A 2J0IA 3WF6A 3ZUTA 1FPUA 3MPAA 2GNGA 4UWYA 1KE5A 2CKEA 3FEGA 2J5FA 4QPAA 3V8SA 3BYUA 2W4JA 5CU4A 1UVRA 2WKMA 4HGSA 3HAMA 3OS3A 2RSVA 4NEUA 5HG8A 3R2BA 4BCQA 5JMSA 4IW0A 2I1MA 4RC2A 4YTHA 5JFVA 3UTOA 4QYFA 3PIXA 2UZDA 4BI2A 3GC9A 4ZZMA 3UYSA 4DGOA 3GENA 4E5WA 3P0MA 4WSYA 3SXRA 4Q9ZA 3GXLA 3TJCA 1FINA 1PW2A 2VWWA 4XLVA 2ITXA 4AGCA 3FZOA 3QYWA 5FP6A 3R2YA 1JSTA 3D5XA 3DXNA 1V0PA 3DV3A 1WZYA 3KRJA 5AP3A 2JFLA 4E4XA 5K4JA 2IVSA 3CGFA 3QCSA 4YHTA 4EONA 4WNKA 3ZM9A 2W7XA 4KBAA 3ZHPC 4YZBA 5LVNA 2DUVA 3ZSGA 4DCAA 4W4YA 4KNBA 1UKIA 3OWJA 3PIYA 4TYIA 5DVRA 4EH3A 2CDZA 4U40A 5IA5A 5HKMA 2CCHA 3PJ8A 3ZM4A 4BFMA 4PMMA 4D5KA 3VBXA 1Q3WA 4M67A 2O65A 5M06A 2R0IA 3FWQA 3GI3A 4IWQA 3ZBFA 2H96A 3VBWA 4M0YA 4CQGA 4IFGA 2YACA 4U44A 2ZV2A 4MX9A 3CD8A 4DEBA 2UW7A 3RZFA 4O1OA 4V05A 3DKGA 4F99A 1FGIA 2JGZA 3DAKA 1REJA 2KULA 3FLWA 1DS5A 2ITWA 2SRCA 4K9YA 4WUNA 3TZMA 3U6IA 4ORKA 4MWHA 4DE4A 3F3ZA 3O8PA 4GK4A 4FNZA 4XBRA 5DT0A 3ZO2A 5FLFA 4FVPA 2C68A 3REPA 3A60A 3LAUA 2A19B 2GHLA 4D0XA 1Q8UA 1FQ1B 2JLDA 3HGKA 4NT4A 5CEMA 1XBAA 1P4OA 2BROA 2C0IA 2OIBA 2PZ5A 3PRFA 4V0GB 5BX0A 3BHTA 4O38A 1OZ1A 3ET7A 4N0SA 2R3QA 1ZOEA 3OXIA 4JL9A 3ORMA 2C3IB 3RP9A 4R1YA 2NRUA 4J8NA 2IZRA 4QTBA 1REKA 4MKCA 3TDVA 5CYIA 2F4JA 4JBVA 1WVXA 4O6EA 4AU8A 3RZBA 3TV7A 3ZXTA 5LMKC 3MVJA 4I21A 4LV5A 2VX0A 3NLBA 1XH6A 4RMZA 3FY0A 1YHVA 4FKLA 2BZIB 4KB8A 5LMKA 4PY1A 5CEOA 1B38A 1FVRA 4NUSA 3WARA 4CFVA 5TR6A 3I6WA 1UU8A 4PNIA 5CAQA 4WSQA 3R04A 3CP9A 3LOKA 1QPDA 4L01A 5FUTA 5BMSA 1VZOA 3PJCA 4HGEA 3R9HA 2PY3A 4M97A 3NW7A 2XBAA 3RPVA 3U4WA 3IW4A 2Y4IC 4CT2A 3GCPA 4IFCA 1YXSA 4GIHA 4LG4A 1S9IA 2YABA 4NTSA 4HNFA 3RM6A 2W5AA 3AC3A 2H34A 3W18A 2JDOA 3DNEA 4IAIA 5DR2A 4DINA 4EUTA 4O7SA 4FT3A 5CWZA 4WNMA 5AP7A 2VTJA 5EH0A 2OZAB 4D5HA 4FT0A 5K3YA 4HCTA 4DTBA 3EFJA 3I81A 4G3GA 2QOHA 5BUEA 4K0YA 1WFCA 2HXLA 3BYMA 4OBQA 2YLEA 2BPMA 2P2IA 4GMYA 3T3UA 4W9XA 1GOLA 3B8QA 4BTMA 2YJSA 5HORA 1OB3A 1YDSE 2P33A 2XRUA 3EYHA 3NIZA 4JT3A 4O7YA 1PKGA 3Q3BA 3CR0A 2A27A 2HW7A 4CXAA 4ANLA 1W8CA 4GT5A 2H9VA 4RZVA 5F94A 3TUBA 3Q2MA 5E8TA 3W33A 4QTEA 4EBWA 4M7IA 5A46A 1Q8YA 4F7NA 5ACBC 1OUYA 2JDSA 3Q60A 4G2FA 3MTLA 4FYOA 1PRYA 4RJ4A 3H9RA 3TV6A 1OPJA 3DTWA 5AP0A 4BR3A 2W1EA 1GNGA 3VW8A 4YURA 2W17A 3KCKA 2XK6A 3NUPA 3O8UA 3DB8A 5E7RA 3R8LA 4JDKA 4AT4A 5E4HA 2WMQA 3CS9A 2XBJA 3OVVA 1T46A 2IJMA 2JEDA 1XO2B 3G2FA 3OOGA 4FG9A 4P4CA 3Q9XA 3OY3A 4UALA 1OGUA 5ACKA 3Q5IA 4AW1A 5HLNA 3K54A 1E1XA 3ZO4A 4ARKA 4ZY4A 5BVEA 3TNPC 3FHRA 2GSFA 4UMPA 5BVDA 5G6VA 2XK3A 4LRKA 5AV4A 4LGGA 3GU8A 3SG9A 3WF9A 1H07A 3COMA 4QMWA 2GS6A 3LXPA 4WT6A 4BL1A 3KREA 5JQ8A 1PJKA 3OT3A 2PVRA 3SGCA 3GCUA 3QGWA 2X2MA 5I9XA 5FWKK 5M4UA 3VS5A 5JRQA 3OTVA 5T6KA 3TTIA 2V5QA 5HO7A 2IVUA 2P4IA 3CGOA 5LMBA 1ZMWA 2HYYA 2Z7RA 5D41A 4PL3A 3DA6A 5C01A 2WTCA 3CEKA 3R8VA 3OC1A 2Y0AA 3PVWA 4FSRA 4ZIMA 3LFQA 4LL0A 4BI1A 4RVKA 4X6RA 1R78A 3KVXA 5D1JA 4PMPA 4XP2A 4E4MA 3BQCA 2JIUA 3TIZA 2VV9A 2OSCA 2W1IA 4OTQA 2XMYA 5E8WA 1OKWA 3AGMA 1ZYCA 2H6DA 4LUEA 3Q52A 3LM0A 1YOMA 4S32A 1XQZA 4IHPA 4FV8A 1CTPE 3DZQA 2R3HA 3SRVB 2BAJA 5FD2A 3W2OA 4JG7A 1PMUA 3GQLA 4H39A 3EWHA 1NY3A 1UKHA 2QONA 2BFXA 5AP6A 3RHXA 2GFSA 2DS1A 3EL8A 3HP5A 2VTLA 3RAHA 2CMWA 3TIYA 1Z5MA 5I0BA 5CT0A 1ZXEA 4NJ3A 1OL6A 2HY0A 1GZKA 3A4OX 4XV3A 2J6MA 2YM8A 5L2QA 3DB6A 4BVUA 4HYIA 1HCKA 1Q99A 4AGWA 2G9XA 1GIHA 2Y7JA 4BTFA 5K5NA 1ZY5A 5IQDA 4ZSEA 4KKGA 3U8WA 2I6LA 1W0XC 3PSCA 3PJ3A 1Y91A 3KXGA 5EYCA 5HTBA 3FQEA 3C5IA 4OTIA 4OTFA 5HE3A 5JZNA 3E5AA 4QNAA 3EQHA 2YIRA 3PJ2A 1TKIA 4ZSGA 4QP8A 4BBEA 4BCOA 4RA4A 4ASEA 4W8EA 3HRBA 4FKQA 2WQBA 5ETCA 4O0TA 4DEEA 3F7ZA 2ITNA 4DH7A 3D5UA 2XKEA 3GU4A 3UDBA 3UG1A 2R64A 1W83A 4L42A 2YA9A 5LVMA 4ZMFA 2YFXA 5DR6A 2XNMA 2ONLA 5CSWA 4U7ZA 4OW8A 4FUXA 4KD1A 3V5TA 4A07A 4EJNA 2C69A 2F2CB 3DLSA 3KEXA 4O0UA 3ITZA 4FR4A 3JY9A 3DOGA 3UPZA 3KXHA 2A4LA 2XM8A 4F0GA 2ITYA 4I4EA 3GCQA 3C7QA 2JC6A 1SYKA 2YIWA 2IZTA 4D28A 1G8AA 4GVJA 4YJNA 1I44A 4DEAA 2O3PA 4IXPA 1H0WA 3R02A 4QMYA 3Q9ZA 2VWYA 3LXKA 4J7BA 3SOCA 4FTNA 4DC2A 4EBVA 3RNYA 4BCPA 1NA7A 2VWXA 1KUTA 4C4IA 3C4XA 4O86A 4MXZA 4FIIA 1NVQA 1WBNA 4G6OA 4B9DA 4BI0A 4XP0A 4AG8A 3E62A 2J2IB 4GUEA 1JKLA 4PQNA 5T3QA 4AXAA 3AC1A 4YJUA 3RGFA 2QOCA 4CLIA 3ALOA 4J8MA 3EMGA 3SHEA 2UW9A 1IR3A 4Y73A 3Q04A 2B7AA 4YBKA 2X2LA 4MEDA 4RT7A 3T9TA 4QYYA 4DEDA 3E93A 4IX3A 2CNVA 1UV5A 4I23A 3ZEPA 1LUFA 2ZM3A 4OBPA 4PRJA 5CF5A 4PDSA 4IE9A 4FKSA 2QURA 2J7TA 4K11A 5E8VA 2FO0A 4WG3A 3V5PA 4E7WA 3DFCB 2G01A 3HDNA 3ORXA 4YO4A 4GT4A 5GNKA 4AA4A 3PLSA 4TYHA 4E5AX 4ZSAA 3VHKA 4HPUE 5EM6A 4BKYA 4DFUA 4L68A 4FZ6A 3GU6A 3HUBA 5CX9A 2QODA 3WE8A 4IIRA 3M42A 4GT3A 5AUVA 3ZDIA 1TQPA 4MD7E 3TV4A 2E2BA 3GGFA 5BVKA 5GIOE 2VO0A 3C51A 1QL6A 5L6PA 5J7BA 4AE9A 4YNOA 3H10A 3AT4A 5TOZA 2WEVA 2GQGA 1PXLA 3VULA 3UVPA 4PP9A 4O82A 3PRIA 3B2TA 3VS1A 3LQ3A 3F5XA 1J91A 1GIIA 3NSZA 3AT3A 2X39A 4FKPA 4RLKA 4TWNA 2Z60A 2XKDA 3AMYA 5G1XA 5M56A 3OCTA 3GC8A 3KA0A 3ERKA 1H01A 2LAVA 3UOKA 2F57A 3VS7A 4MD8E 5BUIA 5CQWA 2ZYBA 1LR4A 1QMZA 2W96B 2I7QA 4NCTC 3ETAA 2VNWA 4KBKA 2IG7A 2B9JA 3M1SA 3FPMA 4CTBA 4HGLA 4DLJA 4U5JA 3MB7A 3D2IA 4NCTA 4FMQA 4BDKA 2AC5A 4MQ2A 3K3JA 3ULZA 5KMLA 2WMRA 2NPQA 2R5TA 3KGAA 3MVHA 4J99A 3SX9A 2WU7A 3KRXA 3OXTA 2OH0E 4CLJA 2VO6A 2BIKB 4C3PA 1Z57A 4XG8A 2FB8A 2BKZA 5E9EA 4Y95A 4F7JA 5DE2A 3EJ1A 4M0ZA 3UQGA 3PPKA 3E92A 3QZFA 2GNHA 3F82A 4WRSA 4NIFA 2XJ0A 3OROA 2YAAA 4FKUA 4U41A 2VTRA 2JBPA 3EN4A 5B2LA 3LCSA 3NMUF 3ZC6A 3CBLA 4YO6A 4BF2A 2CKQA 3DZOA 3UMWA 4NK9A 2FH9A 3RPRA 4C4EA 3WI6A 3UIMA 4FVRA 3ACKA 4L43A 5FEEA 3TWJA 3W10A 4LGHA 2EVAA 3UMXA 4KAOA 4HNIA 2B0QA 1OL1A 2GQSA 3UNKA 2PMOX 4O0RA 4X2NA 5FBOA 3U6JA 4D0WA 1SNUA 4JS8A 3RK5A 3C5UA 3PP0A 3RM7A 4B0GA 4CKJA 2CPKE 4MBLA 3ZLSA 2NNWB 3IK3A 4FX3A 4BCHA 4C4GA 4M13A 4QMSA 4BWPA 5HE1A 3KMWA 5HVKA 2X6DA 1KE8A 4FV0A 4L3LA 3MA3A 5AV1A 4RLLA 2ETMA 4M69B 4DLIA 5C26A 4PPCA 4L44A 3OZ6A 2EWAA 2AYPA 4QP2A 5A4LA 2F7EE 2WTKB 4I5MA 5IISA 4FTJA 3F6XA 5E1EA 3H3CA 3ZO3A 4C3FA 5AR7A 4QNYA 2GS2A 2O64A 4BYJA 3OBGA 3ROYA 4HOKA 3G90X 3CXWA 3PWYA 4IDTA 2JBOA 2W4OA 1Y8YA 5EW9A 2BUJA 4OLIA 1XKKA 3R7OA 5DLSA 3F5PA 1GAGA 4EUUA 3EN9A 4KUJA 4R77A 1P2AA 3DAJA 3FMJA 5BVWA 4AQCA 5HX8A 5HZNA 4D4SA 4DT9A 3D5VA 4GIIA 1M7QA 2HK5A 2UZLA 3O17A 1ATPE 2REIA 4Z7GA 3OF0A 5CU0A 3D9VA 3S0OA 2YCFA 3LCDA 3G33A 4RX8A 4RJ5A 4X3FC 4OUCA 3UP7A 2IVTA 2BILB 5C8NA 3VBVA 4X3FA 4EHVA 3W1FA 2GU8A 2HENA 1Q61A 4K1BA 1U46A 1BLXA 4W4VA 4DN5A 3OTUA 2QG7A 4O7ZA 3FQHA 1JOWB 1O6YA 3AT2A 4FV1A 3A99A 4J1RA 5FEQA 5DMZA 1CM8A 1B39A 4C58A 3DBQA 2XP2A 2XYNA 4G3EA 5DYJA 3OWKA 2C5NA 4ITIA 4FKWA 2HZ4A 5H9BA 3UGCA 3SKCA 3R9NA 2JKMA 3DU8A 3PVUA 2XJ2A 1YDTE 2F49A 3BQRA 5CALA 2Y6OA 2PYWA 2EUFB 2XRWA 3UOLA 3FYKX 3QTWA 2CKPA 5M4IA 4O84A 4IB1A 1M2RA 4Z7HA 4WG5A 2EB2A 3Q96A 4DBNA 4YZNA 5BYYA 3FI2A 2QOOA 4YZ9A 3QQGA 4TYJA 3MIYA 4PMTA 1O6KA 5M4CA 4JDIA 4S31A 2OICA 4XNEA 2W06A 4K2RA 4YJRA 5GINE 5HCZA 2ZMCA 2FSOX 4RC4A 3LLTA 4G6NA 2BFYA 4MCVA 4KS8A 3WIGA 4F09A 1JSVA 3BBTB 2ZMDA 3P7AA 3GUBA 2Z2WA 4L52A 1NVRA 5AWMA 4NM3A 5E8XA 5DOSA 5BVFA 4KIKA 2YM7A 3KMUA 4IDVA 4J71A 4YTCA 3BRBA 4HZSA 3LFCA 1DAWA 5L8LA 4IC8A 5E8ZA 5LQFA 1KE7A 1WAKA 1WBSA 3LIJA 3HLLA 5L2TA 5BUJA 5B2MA 4NW5A 1YI4A 4UEUA 3BIZA 1Q5KA 3EYGA 5IH5A 2GQRA 3MDYA 5EHYA 3TCPA 3IDBA 1JVPP 5E8SA 4RBLA 4O27B 4XYFA 5HO8A 4YJQA 3SDJA 5KKRB 3UOJA 4DTAA 4CGAA 2FVDA 4E20A 4YR8A 4L3JA 3RCDA 4B7TA 1IRKA 3UO5A 1ZRZA 2R3GA 3S1HA 5J9YA 3G15A 1OL2A 3KXZA 3GQIA 5M57A 1CSNA 3D4QA 4QP4A 3R7IA 5CXHA 5KZ0A 3BX5A 2X8IA 3MTFA 2WHBA 2XNOA 3BLQA 3PXQA 2YERA 3MPTA 2GNFA 3E8EA 3FHIA 3EN6A 4XJ0A 5DNRA 3ANQA 5TE0A 1U54B 2IPXA 4HJOA 1AD5A 4IAAA 3D7TB 3VN9A 4QMMA 3TKHA 3ZS5A 4BKJA 2W9FB 5HNIX 2GPHA 4DGMA 5K4IA 4YUQA 3NCGA 5EM7A 4E26A 5EQEA 4J53A 5J87A 3M11A 4EZ7A 3ZLWA 4FV9A 4I41A 2CN5A 2VD5A 4JQ8A 4EWQA 2Y8OA 4BWKA 1VR2A 5HO6A 3KK9A 2YM3A 3SOAA 3COKA 5DIAA 4D2WA 3ZLXA 4YC6A 4EORA 3LMGA 4IC7A 1AQ1A 4NZWB 1VEBA 1U59A 5IMXA 3I1AA 4FT5A 3Q9WA 1I09A 4J95A 4QOXA 3IOPA 2R3FA 3IGOA 3TACA 3ZLYA 4AWIA 3FL5A 3QD4A 4PDPA 5ANEA 5I3RA 5C1QB 1TVOA 2J5EA 2PZRA 2WO6A 3QRIA 3PDTA 3F3VA 2VX3A 3HL7A 3I4BA 4ZJJA 3NRMA 3SW4A 5LWMA 2Y6MA 4FT9A 4EL9A 3UNZA 4DFNA 4F6UA 4ZTMA 4FTTA 3TTJA 1M2PA 4B8LA 4F9WA 4GV1A 4MTAA 3PE2A 3LXLA 3AC8A 4O22A 5JH6A 3OWPA 1YOJA 4F63A 3ZXZA 2OJGA 3E3PA 5HQ0A 2C5OA 3DQWA 2CLQA 1KSWA 4PTEA 5AADA 1KOAA 4RA5A 1HCLA 5BMMA 4EYJA 2CCIA 2QO2A 1H1SA 4B99A 4AW5A 1PMEA 1XH7A 4QP1A 4W9WA 1IAHA 3EN5A 1IEPA 2W1CA 4RGJA 3U51A 5HCXA 3BWJA 4YZCA 2GTMA 2OZAA 4HVGA 4PDYA 4DH1A 1XHAA 2X8EA 3LJ0A 3R30A 3NYOA 4FKTA 2ZM1A 4TWCA 1U5RA 4M66A 4WRGA 3RK7A 5JQ5A 3U9CA 3R21A 4DH5A 3LFAA 2ETKA 4F6WA 3BLRA 2P3GX 2ZB0A 3OFMA 4AAAA 2QOLA 1XH4A 3AXWA 4ACCA 4JI9A 1W84A 2CHLA 4ASDA 5GZAA 2ITUA 3WZDA 3VUGA 4C3RA 4QTDA 1OECA 3V5QA 1PKDA 4BDFA 4DCEA 5M09A 5HEZA 4FV5A 1T45A 3ZU7A 3W2PA 3EKNA 4FBXA 1B6CB 1R0PA 2VGPA 1GY3A 4HVDA 4XS2A 4PUZA 4QMLA 2C0TA 3CKWA 5IUHA 2UW8A 4FKGA 3NS9A 4Y8DA 4JNWA 4MH7A 3VUMA 4FSTA 1LEWA 3CCNA 4KKEA 4ERKA 4LMNA 2VUWA 5AJQA 2BKKA 1MRVA 5I4NA 1KOBA 1ZY4A 5AUXA 5KMNA 5A9UA 3L8SA 4MXAA 2OJIA 2R3NA 3F5UA 5KX8A 4WD5A 5LARA 4B4LA 3DK6A 1P14A 4EQMA 2VTSA 4HVHA 1Z9XA 2X9FA 3UP2A 3WBLA 4C35A 4EKKA 2WTDA 3PP1A 2YITA 3BHHA 2IZSA 4L7SA 4RJ8A 4JG8A 4AW2A 3FXZA 3QTSA 3P1AA 2C5YA 3VS3A 4LMUA 4F1OA 4F9YA 5FTGA 2BRHA 3FMEA 4EOLA 2EXCX 3PLAE 5EDQA 3R7UA 5CVGA 3R8MA 4WUAA 2PHKA 1EH4A 4ANQA 2UZOA 4C62A 4AF3A 4RIWA 2CLXA 3QU0A 4N6YA 3QRUA 3R00A 4JBQA 5FG8A 3HNGA 3FKNA 4AACA 4QYHA 5KHWA 5AM7A 4G9CA 5LVLA 4CV8A 1SVHA 4FTCA 2YZLA 3LQ8A 4W8DA 2OO8X 2XA4A 4ZJVA 4IM3A 3C4CA 4AGDA 4CZUA 3MGYA 5HBEA 4GUBA 4AFJA 3KU2A 2WMUA 2XUUA 1RE8A 4HGTA 1W7HA 1STCE 4GL9A 5H2UA 4E6CA 4AZWA 2OLCA 1H00A 5LXMA 2GNLA 3ACJA 4DTKA 2JDVA 1JSUA 5E8YA 3Q6UA 3W8QA 2QKRA 3TZ7A 2HCKA 3OEFX 5L2WA 1Y8GA 2XKFA 3V6SA 2C3LA 2UUEA 4P5QA 1IAJA 3ORZA 2FGIA 4BCIA 2BRGA 3NW6A 3BCEA 3RMFA 4X0MA 4OBOA 4MNFA 4A4XA 3TT0A 5IA1A 5DEWA 3MN3A 3C4WA 2OBJA 2PVHA 4EH6A 2F9GA 2XH5A 3NUAA 1ZZLA 4FEXA 3NVKI 3CQWA 3QUPA 4BN1A 3VF9A 3ZBXA 3DS6A 4BY9E 3OUNB 3HA8A 4UWBA 3ZZWA 3HRFA 2JIIA 5AV3A 1WBVA 2OJJA 2QLUA 3CJGA 2R3RA 2QOBA 5EOBA 3JY0A 4UZDA 5F20A 5DRDA 2ZV9A 4BHZA 5CF4A 1Q97A 3KN6A 4G34A 3C50A 3EKKA 5IH6A 5L2IA 4D1XA 5HHWA 2W05A 5D7AA 5HBHA 4FG7A 4KIPA 4G3DA 3BHYA 2BVAA 3FC2A 3KVWA 3BKBA 4FKVA 4KIOA 1H27A 4MBIA 4BDJA 2W1FA 5HIBA 4CKIA 2OFVA 4TNDA 5F1ZA 2OIQA 2WTJA 5KO1A 3OG7A 4EH2A 3AGLA 2R3IA 2ITOA 3TUCA 2WPAA 1H0VA 3F69A 4PDOA 5KE0A 4QQCA 2VN9A 3C0IA 4NL0A 4QT1A 1WCCA 3W2RA 2ITQA 4W4WA 3ZUUA 3RALA 3FXWA 4FL1A 1M17A 4M15A 1WBOA 3EQGA 2C6TA 4X2KA 2BAQA 4MVFA 3WF5A 3L9NA 4UMTA 5CSPA 4I0TA 2CGUA 4KKHA 3EH9A 3LFDA 5AR4A 1UNGA 4CTCA 3SQQA 2XIRA 2V55A 3GB2A 4LOOA 3VS2A 3R9RA 4JBOA 2HY81 2IN6A 4K33A 3VAPA 1XH8A 3HMIA 2VWUA 4M14A 2QU6A 3C9WA 3V3VA 4PL5A 4ANSA 5EI6A 5CAUA 2OXDA 4GJ3A 4E93A 1IASA 4FV3A 5L8KA 2ZV8A 2WMAA 2X4FA 2XF0A 3QQUA 3DK3A 2QKWB 2ZB1A 3ZFXA 4UWCA 4EZ5A 3ORKA 3UPXA 5M53A 2WMVA 5CTPA 1UU9A 3A8XA 3IS5A 3MSSA 3NW5A 5CEIA 1QPJA 5IU2A 2HZ0A 3TL8A 3O7LD 3F88A 4IZ7A 4E1ZA 3QXPA 2W99B 5IEYA 2WD1A 3L9PA 5DG5A 4KS7A 4FV6A 1YHSA 1PXKA 2PL0A 5HVJA 2WOTA 4GVAA 1JAMA 1M52A 5EW8A 3KXMA 5IUIA 5IEVA 3TZ9A 2H8HA 3NX8A 1OL7A 4JBPA 3QCYA 4ASXA 4WBBB 2VTOA 1UU3A 3P86A 3POOA 2PVYA 1M7NA 2O0UA 2UZEA 4FOBA 5KMIA 3FI4A 1OI9A 5C8MA 5EYKA 3OEZA 3BEGA 3CQEA 5HOAA 4IAFA 5HVYA 2E9PA 3FLYA 4A9YA 3N4VA 5LVOA 1OIRA 4F08A 5A4EA 2QNJA 2BCJA 3IW7A 5JK3A 4EK3A 3FV8A 2C6IA 2VNYA 3QFVA 4HVSA 1WVWA 1XJDA 2WQMA 2XEYA 4RVTA 3VUKA 4D2RA 3PY1A 2GHGA 3QXOA 5GHVA 4ZAUA 4F9BA 4AUAA 2PE0A 3UZPA 3VIDA 1BYGA 4ANNA 4AN2A 2F7ZE 1IA8A 3BLHA 4FIJA 4R7IA 2QG5A 4XX9A 4RIXB 4X2JA 3C4ZA 5LVPA 3IW8A 3VS6A 1GIJA 4FL2A 4RJ3A 2YM6A 4XV1A 4FSYA 2CSNA 3WE4A 3ODYX 1SVEA 5J79A 2GNIA 2QC6A 4ID7A 4BRXA 4CQEA 4EQUA 4XG9A 3HV7A 2OF4A 4TTHB 3EQCA 4LOQA 3UNJA 4DG0E 4IX6A 4FC0A 4UV0A 1ZARA 3BE9A 3QL8A 1H28A 4EYMA 2YZAA 4YC3A 4YPSA 3VUDA 4AOJA 1DAYA 5EYDA 1TQMA 3EIDA 5I9UA 5IQBA 1V0BA 2X2KA 3E63A 4TWPA 1Y57A 2X0GA 4Q2AA 3SC1A 4N57A 3LW0A 4RIOA 4TYGA 4YC8A 3FKOA 5EI8A 2VTAA 2EB3A 4GK3A 2XM9A 5FM3A 5IMEA 4FSMA 2C1BA 3AMBA 3DGKA 3HV5A 2GNJA 3Q4UA 4JLCA 4NJDA 4QO9A 3WILA 2B9IA 4GFGA 3RNIA 4DG3E 5J7HA 4O83A 4R7BA 5JGAA 4I93A 4ENYA 4O2ZA 2HELA 5HGIA 2IW9A 3VRYA 4AN9A 2XNBA 3QZIA 3R8UA 4C4HA 4F70A 4G17A 4MNEA 4FTKA 4IADA 5EDRA 4EOSA 4I20A 1NT2A 1CMKE 4AOTA 5H8GA 2JDRA 1E1VA 3COIA 3R1QA 4WHZA 5KHXA 2W1GA 2YWVA 4XH6A 4MQ1A 5HESA 1WBPA 4BDGA 3DY7A 3A62A 3BV3A 3Q4ZA 4BZDA 2WTKC 3PUPA 3G6GA 2YDJA 1Y6BA 5DA3A 1YWVA 3EZRA 2XNEA 3I0QA 3FKLA 4J97A 4QRCA 3POZA 4FIEA 1QPCA 5AP1A 3RAKA 2X9EA 2PK9A 5FGKA 3GFWA 4ALUA 3ZMMA 1MQ4A 2E9OA 5FM2A 5D7VA 3R8ZA 4YZMA 3KN5A 2UVXA 2B1PA 3VJNA 2R7IA 4RVMA 1QPEA 3FUPA 4JJRA 3UC4A 5A4QA 4E8AA 3R28A 4RJ6A 3DT1A 3QQJA 5DEYA 2BZHB 4I0RA 4J96A 4Q9SA 1YWRA 1BX6A 4DFLA 2R3LA 2EXMA 4GU6A 4U81A 1PMNA 4XG6A 4JDHA 4CFFA 4E6DA 1RW8A 1LPUA 3DKCA 5HTCA 3MY0A 5IQGA 2UW3A 4L67A 5TO8A 1IA9A 2YCRA 2G2FA 5M08A 5IDPA 3AD4A 4RX7A 2F7XE 2XK7A 5C03A 1YRPA 2UZVA 4EZ3A 5HIEA 4GSBA 4DA5A 3LPBA 1R39A 3VS4A 4Z9LA 3AOXA 4AX8A 3QWKA 3PVGA 1SNXA 5AUTA 4JDJA 5LCKA 4ZY5A 4FYNA 5KMKA 2C6DA 4G1WA 3ATTA 1ZOGA 3OUKA 1SMHA 2V0DA 3EFWA 3R0TA 5HNGA 4CZYB 4IVAA 5ETFA 2OJFE 3WZUA 4NU1A 3RVGA 2XK9A 4I6FA 3VQHA 2ZJWA 5LCJA 1L3RE 4L9IA 3L9LA 4G3CA 4K77A 3NZ0A 4RFMA 2BRBA 4L45A 4YNEA 4CFWA 3II5A 3IW6A 3QX2A 3RPOA 1KE6A 4RIYA 1FVVA 4H3BA 3N4UA 4ZOGA 2JKOA 4OTRA 3JR1A 1F0QA 3Q5ZA 4FTUA 2XK4A 4BIEA 4IEBA 2XEZA 3LCKA 4YSMA 3H0ZA 2R7BA 3NNUA 2RFSA 4V01A 4U3YA 4YLKA 4OTHA 3A8WA 1UNLA 2WMWA 3GC0A 5D9HA 3ZFMA 2PZPA 5DBXA 4BTKA 4EC8A 4YTFA 4DG2E 5J5SA 3FMDA 4KABA 3NYNA 4M3QA 4Y46A 4C7TA 1YI3A 3P78A 3AC2A 3DJ6A 4KRCA 4PNKA 3UQCA 5CAPA 1RQQA 4RZWA 3ZCLA 3MW1A 2P0CA 3DAEA 3TKUA 3UODA 4HYHA 5C9CA 5AAEA 4GKIA 4G5JA 5M51A 4CFMA 3QA0A 3G0FA 3AD5A 4IB5A 4R3RA 5CF8A 3A7IA 3G51A 3KK8A 3PVBA 3RAIA 4FICA 5IA3A 4BWXA 3NEWA 4ZMEA 5EM8A 3NUYA 3SA0A 5IF1A 3QCXA 2X1NA 4FSUA 2WTIA 4L7FA 4NWMA 5L6WL 4DT8A 2WMTA 4D4YA 4I92A 2WTVA 3CPCA 5FDPA 5EK7A 1Y6AA 5IQEA 3ZRMA 3A7GA 2A2AA 3QF9A 3V01A 3L8XA 5EKNA 4AZVA 5GJGA 4S30A 3E3BX 4I6QA 5KKRC 4GW8A 3DBDA 3BHUA 4ZS0A 3CD3A 2R9SA 4A7CA 4CCUA 4MXCA 1YDRE 5CASA 3H0YA 5GIPE 1GJOA 3G6HA 4UXQA 3QKKA 2ESMA 3DLZA 3H9OA 2AC3A 2R3OA 4C38A 5C27A 3U54A 2JFMA 1P4FA 2PVFA 4IBMA 4ALWA 4Z55A 2OF2A 3DJ7A 1ZMUA 3AG9A 1U4DA 3EQDA 2C6MA 3SVVA 5CU2A 3E87A 4DGLC 4Y5HA 1U54A 5J8IA 5CANA 4I1ZA 5JRSA 4ZTNA 2EXEA 4GKHA 3D7TA 5ETIA 3EQBA 4IZYA 4AZEA 2R3JA 3BZ3A 3OBJA 1Q8TA 2BAKA 2XKCA 3P23A 4U80A 4A9TA 1P5EA 4GK2A 3I60A 3QC4A 3QKMA 3QQHA 4BDCA 1J1BA 4BKZA 2RKUA 2O5KA 3BHVA 3MS9A 2QOIA 4V04A 4IANA 4J52A 3MH1A 4ACMA 3AQVA 5M44A 5CLPA 5IQHA 3F61A 1PY5A 5E1SA 2O63A 2O2UA 1Q3DA 3JXWA 4YPDA 1MRYA 3D15A 2RIOA 2C5XA 3BEAA 4O91A 5DR9A 3QX4A 3IOKA 5DT3A 5AAGA 4IAYA 2YIYA 3HUCA 3P9JA 4YZDA 4XEYA 3MI9A 1BKXA 4EQCA 4IVBA 1S9JA 4KINA 4ZSJA 3S4QA 2BHEA 4BGGA 4E4LA 2OI4X 1J3HA 3P7BA 3D5WA 4RPVA 4C33A 4BTJA 5HU3A 3JUHA 3NNXA 3ORNA 5EM5A 4ACDA 2QR7A 5HLPA 5BPYA 2C0OA 2VWZA 3OP5A 3RHKA 5T68A 1ZYJA 4UXLA 4LUDA 5AUUA 1OUKA 4TY1A 4UZHA 2RGPA 4H36A 4L00A 3ZH8A 4OAUC 4QMQA 3TZ8A 3NUXA 4XV9A 2RFDA 4O81A 1LP4A 5JKGA 2X7GA 2O8YA 3QALE 5KMOA 2FSLX 4TYHB 3AC5A 4ENXA 2RG5A 2VTTA 5HBJA 1SM2A 4O21A 4EOKA 4CMOA 3L8PA 1H1QA 3DCVA 4FTIA 3UIBA 3U6HA 2PSQA 4IWDA 2XIZA 4IACA 1YKRA 5CEKA 5LJJA 4U45A 4A4LA 3DXPA 2RL5A 1Q4LA 4EOQA 4Z3VA 2VRXA 3IGGA 2GHMA 4GG7A 5BYZA 5TKDA 3NUUA 4X2FA 3WZJA 5CF6A 5JT2A 2BTSA 3TN8A 3M2WA 2OW3A 4XRJA 4F64A 1G3NA 3GBZA 4CYIA 3F3UA 4HCUA 2BRMA 4JQ7A 2QI8A 4EH8A 3LMIA 5CSHA 4PPBA 5BNJA 2XVDA 3VC4A 4BZOA 3FE3A 1MUOA 1YVJA 3I0OA 1G5SA 3SXSA 2J0KA 1MQBA 1BUHA 3JVRA 1OL5A 3DTCA 4G9RA 5CU3A 5A6NA 1L8TA 3I7BA 3PTGA 2OFUA 2P55A 3ZSHA 4F7SA 2DYLA 4XP3A 4F0IA 3HMNA 2XIKA 3H9FA 3O2MA 5M55A 3IPHA 3VUHA 3F7WA 3LCOA 3SAYA 3VNTA 1VYWA 3ZC5A 4WNPA 2I0YA 4KRDA 4E5BA 2WQOA 4LRMA 2P2HA 5IPJA 1JWHA 2YDIA 4W4XA 1U5QA 2PVNA 1OIQA 3K2LA 4FUYA 4EWHA 4JVGA 3G5DA 3LFFA 3TNHA 4ZEGA 1H24A 5AP5A 3PYYA 3VQUA 5EG3A 4NYEA 3UO6A 2GCDA 4J98A 3C0HA 4JQEA 4UMRA 5J5TA 2Q0BA 4O7TA 4O2PA 4BCFA 4I6HA 5CEPA 3CIKA 2ZV7A 4Q5HA 4AP7A 3CKXA 3OXZA 4O0XA 5GJDA 2I0HA 3QC9A 2YEXA 2OKRA 3NDMA 3HMPA 3QQKA 4P90A 4FNYA 4ZTRA 4DFXE 4EK8A 5KNJA 3CTJA 5CXZA 2WAJA 3E8NA 2UZUE 3NAXA 1CDKA 2A0CX 3TEIA 4R5SA 1O9UA 2XIXA 3DBCA 4MBJA 4YJSA 4DH8A 4F6SA 3MFTA 2XNGA 3LLAA 4JAIA 4CZTA 4V0GA 3PXFA 2ZDUA 5IKWA 2RF9A 4ZLOA 5JSMA 5CY3A 3QRKA 4BHNA 2NO3A 3UJGA 3OD6X 4FZFB 1OIYA 4HYUA 3HMMA 2UVZA 5AV0A 3L9MA 3FBVA 5K0XA 3Q32A 3FDNA 3R22A 2C30A 2UV2A 4KA3A 4X7QA 2IO6A 5B2KA 3FXXA 3GEQA 5E91A 4RWLA 3VRZA 4S34A 5FXQA 2QVSE 1OITA 1YW2A 1YXVA 2CKOA 4FE2A 3BU5A 2PVLA 3QWJA 4BDHA 4C61A 3N51A 3LFSA 2OZOA 5CEQA 1DI8A 5EHOA 2YIXA 4R8QA 5AA9A 3FQSA 1OM1A 4CG9A 3I79A 4LM5A 3S95A 4FK3A 4NW6A 3QAME 2HXQA 3OHTA 3PXKA 4FZDB 5F4NA 2BZJA 2QU5A 3THBA 4BCKA 4RSSA 4U8ZA 5BQ0A 5HE0A 2CNUA 2YHVA 3MWUA 4DFZE 5A54A 4XUFA 4DFYA 1PYEA 1E9HA 2BHHA 2VU3A 1CKPA 4NKAA 2C3JA 5CZIA 3OY1A 4JIKA 4FEUA 5HIDA 2FA2A 5FDXA 5AR3A 4ALVA 3HYHA 2QOKA 3ORLA 4IB3A 3MIAA 2XNNA
chains in the Genus database with same CATH superfamily
4LV8A 4AN3A 2ERZE 5B0XA 2WU6A 4EK4A 3UG2A 3KRWA 3TI1A 3OT8A 3R1YA 1V0OA 5AIKA 4ZLZA 5H8EA 3VUTA 3CJFA 3EHAA 4FSZA 1OKVA 2ZOQA 3G9LX 4ANMA 2UZBA 4UMQA 5C4KA 2J90A 3Q4CA 3F3WA 4FSNA 5CI6A 4RWJA 3D94A 3NR9A 4PTCA 1YOLA 1XBBA 3V51A 4O0WA 5D11A 4BZNA 3WZEA 3MVLA 4CV9A 3WF7A 5A3XA 1H25A 4QYEA 3BE2A 3KXXA 2VWBA 5ANGA 5H8BA 4M84A 4XLIA 5ANDA 4F7LA 5JGDA 5TF9A 4ACGA 3PY0A 4QEBA 3ZRLA 5FBNC 4ACHA 3QHWA 4QMTA 4BIDA 3KB7A 4TXCA 4Y83A 3MY5A 4MXXA 5K5XA 2YCQA 3QLGA 2NYAA 1J1CA 2OJ9A 2WMSA 3ATSA 3OW4A 4ITJA 1RJBA 4WA9A 5DFPA 4F1TA 4II5A 1A48A 2Q83A 3D2KA 3Q2JA 2HZNA 4USEA 5FRIA 2ZFYA 3EFKA 2V22A 3BU3A 3IDPA 5HCYA 3KCFA 4WBOA 3HV6A 4APPA 1XH5A 5JN2A 2CGWA 3GNIB 2BIYA 5CI7A 4CD0A 2BRNA 5JFSA 3V6RA 1H4LA 5IUGA 3MESA 3SLSA 4F0FA 2IW8A 4BGHA 4CCBA 4U43A 4KIKB 4E73A 4HW7A 4FEWA 2V7AA 3MFUA 3FZ1A 4A4OA 3NNWA 4ASZA 2HWOA 2PVJA 2LGCA 3A4PA 3KULB 4TT7A 2YIQA 3KMMA 2VAGA 3Q6WA 5HE2A 3CTQA 3QQLA 2XZSA 3R9OA 4U0IA 4NM7A 3PXZA 1H1RA 2OXYA 4DGGA 4TYEA 3F2RA 4U42A 4XHKB 3O8TA 3L1SA 3ZUVA 2E9UA 5ITAA 4PPAA 3NIEA 4XG7A 4QQ5A 3BV2A 3LQ5A 4P7EA 1UA2A 3U9NA 3ZEWA 4OAVB 2IZUA 3E7VA 2ZAZA 1PXIA 3FLSA 3P79A 4IZ5A 4IM0A 3G0EA 5AR5A 5EQYA 4ERWA 5CSXA 4LFIA 4N4SA 4LL5A 5CNOA 2B53A 2YM5A 4A9UA 3W0NA 5EOLA 5IA4A 3R73A 5HLWA 4FKIA 3FI8A 2BZKB 4DBXA 3BI6A 3ZFYA 3SRVA 2C6KA 2OIDA 2ETRA 2YWPA 2PMLX 4CRSA 4CT1A 1H1WA 2WOUA 3PA5A 3PG1A 4FT7A 3UQFA 4QDEA 5AFVA 5DHJA 3DBEA 2XS0A 2WGJA 3FMLA 5EQPA 2UW4A 5KUPA 3JPVA 2C4GA 4PF4A 2PULA 5JFWA 4X21A 1H26A 2I0EA 3C4FA 3L8VA 4C2VA 2OXXA 2X81A 5E8UA 3KIOC 2Z7QA 5EKOA 4RIXA 3IQ7A 3UC3A 1OPLA 2BTRA 2HWPA 2ITTA 2RG6A 3LFBA 4FIHA 5AV2A 4WNOA 3GCSA 4AW0A 2YN8A 3BYOA 3C4EA 4C37A 4TWOA 2R3KA 4I5HA 4BDIA 3AC4A 3MH0A 3FLQA 5ANJA 4ZZOA 5IEXA 3SD0A 3VJOA 3TUDA 5DGZA 4WKQA 4C0TA 4D1SA 2R2PA 2QR8A 3PXYA 2CJMA 3W8LA 3RPYA 3O0GA 5AUYA 3MH3A 4L8MA 2KTYA 4FV7A 1YXXA 4D9TA 3E88A 3R01A 4BCNA 3MFSA 4FV4A 2WIPA 3TNIA 4ZTLA 2Y4PA 3D7ZA 1YI6A 2RFNA 2X6EA 3QRTA 3PG3A 2QO9A 1YXUA 2JAVA 4QP6A 1YWNA 4JG6A 4PL4A 4XOZA 1GZOA 2B52A 3MA6A 4XCUA 5AIRA 3HX4A 4AA5A 5KCVA 2AUHA 5CVFA 4D2VA 3HECA 3QZHA 3LZBA 4UB7A 5ANIA 3R83A 4I94A 4D1ZA 5IA0A 4QTAA 3DXQA 3FLZA 1UNHA 1BL7A 2IWIA 3LMHA 4RFZA 2JDTA 3GFEA 4TPTA 3A7JA 2CN8A 2EU9A 2PZIA 3IG7A 3NWWA 4I5CA 5HG5A 4DITA 3VBTA 3W2CA 3AKJA 3FMMA 3FJQE 3Q53A 4YP8A 5AAFA 4C4FA 4QMPA 3OCBA 3PFQA 2YAKA 4M12A 3EQPA 3FZPA 5LOHA 4O7WA 4BDEA 3R6XA 1M14A 4CKRA 4GJ2A 4FF8A 3VHEA 5LMAA 4BCGA 2W1ZA 4FEQA 2G15A 2J50A 3B8RA 4ANOA 4C57A 3TDWA 3TXOA 4UX9A 4YLJA 4IX4A 2ITZA 1URWA 2QHMA 3KRLA 4O0VA 4BDBA 4OTGA 4GCJA 4EOJA 3CY2A 4EHEA 4HPTE 3AD6A 5CAVA 2PVMA 4IVCA 1URCA 3FYJX 3I6UA 4MXYA 4R3PA 4AT3A 4EJ7A 3R7GA 2B9FA 3PSDA 4NH1A 1MP8A 2W1HA 4FTMA 2PMIA 3P7CA 2UZTA 2Y9QA 4EHGA 5IQFA 4AZFA 4JR3A 3PXRA 1OPKA 2C1AA 4G31A 4XRLA 3RJCA 4IMYA 2UW5A 3HV3A 3IONA 4USFA 4JX7A 3W0RA 2C3KA 4FKOA 3R8PA 3KY2A 4EHZA 1BI8A 2IEWA 4NSTA 3K3IA 3ZSIA 4AZSA 4TNBA 3HKOA 2PPQA 3ZDUA 4FOCA 4QYGA 3CC6A 3QD3A 4OTDA 5D10A 4HYSA 2W1DA 4KWPA 3WIKA 5IZFA 3LHJA 4D9UA 4IAZA 3OWLA 3LJ1A 4EK6A 5I5ZA 1OGYA 3LFNA 3QTZA 4CEGA 4Q5EA 3I7CA 5M4FA 4BDAA 3QQFA 1BL6A 2IW6A 3FMHA 2PE1A 5AX9A 3TNWA 2VTNA 4TW9A 4EC9A 4EH9A 4D2TA 2JKKA 4YLLA 1WBTA 4N6ZA 2UZWE 1WMKA 4QMVA 4LYNA 4OT5A 2WB8A 3ZONA 3PPZA 2UW0A 2VO3A 2FSMX 4DYMA 5EHLA 4RIWB 3QUEA 3EN7A 4MYGA 4U6RA 2VGOA 1PF8A 5HG9A 3CSVA 4BC6A 2JKQA 3LCTA 1NW1A 3VF8A 1H8FA 3DK7A 3E8DA 3ML1A 2UZNA 4QTCA 3PZEA 2FUMA 3ZRKA 5BVNA 3H30A 3RKBA 3R7VA 5CENA 4G3FA 4FTAA 4NFMA 4DF3A 1JNKA 3VS0A 5EW3A 5L4QA 3K5VA 4IZAA 4C36A 3UOHA 2XJ1A 4MXOA 5FTOA 3QZGA 4OR5A 3E8CA 3LM5A 3PJ1A 1JKTA 1ST0A 2VTIA 3MBLA 3O7LB 4PMSA 3HV4A 3UO4A 2VWVA 1XWSA 4TZRA 4UYAA 4BIBA 4KSQA 4H58A 5AUWA 4MF1A 2GDOA 3E7OA 3KF7A 3I5ZA 5AEPA 4FTRA 4F65A 4U79A 5JGBA 2CGXA 4GFOA 4B6LA 5I9YA 5L6OA 4PV0A 4OTPA 5ETAA 3GU7A 2VX1A 5A14A 4BBFA 5BVOA 4UN0C 2CNQA 3K5UA 4MD9E 3FZTA 3DPKA 3U55A 2WTWA 2BDFA 4FZ7A 1JKKA 2QLQA 2BDJA 3PPJA 2Z7SA 4QMZA 4WO5A 3WYXA 1IG1A 2WQEA 4LI5A 4G6LA 4C02A 4O6LA 5AMNA 4R1VA 4EOPA 4YBJA 1UU7A 4ZTSA 2HW6A 3ANRA 2PWLA 3ZO1A 4AA0A 3MVMA 2XALA 4WG4A 3VWAA 2YISA 4FNWA 4LQMA 5I3OA 3HMOA 5KZIA 2GMXA 3V8WA 2FYSA 3PIZA 5C4LA 1SVGA 3OCGA 2B55A 3OMVA 3UZTA 3EQIA 3R7YA 1OVEA 4F9CA 5I9ZA 5I9VA 3F5GA 4DHJA 2Y4IB 2WELA 1H08A 1GZ8A 3Q4TA 2E9VA 4FVQA 4FV2A 5AUZA 4CFNA 1M2QA 2DWBA 4F9AA 1OBDA 2VTHA 2WMBA 4FTQA 1ZYSA 3R7EA 2ONLC 3FC1X 4IX5A 4C34A 4EH7A 4HCVA 3WF8A 2J0MB 4ZSLA 4M69A 3BELA 4LGDA 4CFUA 3LKMA 3FSKA 2X8DA 3HP2A 3HZTA 2PUIA 1KV1A 5IG1A 1Q8WA 3R71A 2YCSA 5HX6A 4QPMA 2VTMA 1WBWA 3A2CA 5HG7A 5FXRA 4H3QA 3FSFA 2Z8CA 2JAMA 4YHJA 1OKZA 1ZWSA 5JZJA 4ZXTA 2BDWA 4IWPA 3N4TA 4R5YA 4GYGA 3RAWA 2OK1A 2G2HA 4XOYA 5CU6A 3JS2A 3MY1A 4QMOA 4RQKA 4IJ9A 3VVHA 2G1TA 4O4EA 1JQHA 3EL7A 2DQ7X 3W32A 4CSVA 4DEHA 2X7OA 3GC7A 3NCZA 1BI7A 5DT4A 1FBNA 3DQXA 4O96A 1J7IA 3A7HA 2WZJA 2NP8A 4IJPA 3QLFA 4Y85A 4DAWA 4ZK5A 2WIHA 3W2SA 2IVVA 3F2NA 4CYJA 4DGNA 4M8TA 3S2PA 3GVUA 4FK6A 2ZDTA 4DHZA 4RRVA 3DDQA 2I0VA 2WNTA 2QOQA 2C6LA 3S3IA 3QTIA 3RBWA 1PXOA 3MJ1A 3ZZEA 2OWBA 2J9MA 4NM0A 4XV2A 4R3CA 4U3ZA 3QCQA 5HU9A 5BYLA 1AGWA 2W5BA 3COHA 2R4BA 1VJYA 3QD0A 4CG8A 4QP7A 4E6AA 2QO7A 3W0MA 1ZYDA 2YLFA 5A4CA 3ID6C 3KC3A 3HAVA 3HRCA 5HNBA 2RFEA 3O23A 4YJPA 4YU2A 4GEOA 2E9NA 5AP4A 3LJ2A 5FP5A 3UVQA 3QTXA 2GTNA 5AR2A 4RC3A 3VO3A 4D58A 3TKIA 4ZS4A 4G5PA 4TKSA 2HZIA 3DBFA 4YHFA 1PHKA 4CMUA 4FI1A 4TL0A 1JKSA 5IDNA 4O7NA 1K3AA 3C13A 3DFAA 4IM2A 4XG2A 3UYTA 1SZMA 4IB0A 2GFCA 4S33A 4NTTA 4ZP5A 5CVHA 5HTIA 3GOKA 4UBAA 4APCA 2Q0NA 1LEZA 4FG8A 1KV2A 3PA4A 5IQAA 1WVYA 3KFAA 3JVSA 3GP0A 3GU5A 3SV0A 4A9RA 5LWNA 4Y72A 3MB6A 2PUPA 1APME 2R3MA 5L3AA 3EQRA 3BGPA 2PZYA 5FQDC 1ZYLA 2W0JA 3G9NA 3LXNA 5EI2A 4ZZNA 3R63A 3SXFA 1K9AA 2OG8A 2BR1A 2ZVAA 4QMUA 3NUSA 4NFNA 3F2AA 3H4JA 4I3ZA 3QD2B 4KSPA 1K2PA 1ZZ2A 4IQ6A 5L2SA 4IWOA 3O71A 3FZRA 4KIQA 4X6QC 4ZLYA 2X0QA 4CMTA 4JAJA 4EKLA 1W2FA 3RTPA 4R7HA 1MRUA 4JX3A 1OBGA 3WYYA 2ZM4A 3BPRA 4XG3A 3UIXA 3IECA 4DEIA 2BALA 3CLYA 3ULIA 2HIWA 2PMNX 4LRJA 4AXFA 3P5KA 3FY2A 1JLUE 5IQCA 3OCSA 3QTRA 1FMKA 3P4KA 4HVIA 3ROCA 2W4KA 4D4VA 2I40A 3A7FA 4RVLA 4EOOA 1VYZA 4EOIA 4YJVA 1PYXA 2C6OA 3LFEA 5FTQA 3RK9A 5AA8A 3BL9A 3FMKA 2WEIA 2XIYA 4I22A 2WXVA 3QGYA 5CZHA 4AXEA 5GZ8A 4EH5A 2GS7A 5CT7A 3KQ7A 3MJ2A 3MH2A 4QQJA 3S00A 4BCMA 4CFXA 3ENHA 4FL3A 3F3TA 1W98A 4MAOA 5IA2A 2PE2A 4D4RA 4S2ZA 4BGQA 4RX5A 1PXMA 2F2UA 2J4ZA 3B2WA 4MNEB 4QPSA 3ZOSA 3IKAA 4XMOA 3I5NA 3FI3A 1Q62A 1YXTA 2J51A 3Q9YA 4XG4A 4QQTA 3RI1A 4IVDA 3QHRA 2VTPA 3SW7A 2JD5A 1Q41A 3D14A 5KMJA 4O7RA 1YHWA 4UYNA 3TM0A 5CSVA 3QTUA 4FSQA 1TQIA 2C47A 2W9ZB 1JPAA 1PXJA 1PXNA 5EFQA 5ANOA 3MV5A 5AR8A 1V1KA 3PWDA 3ZYAA 2HOGA 3HEGA 4JRNA 4YTIA 4PP7A 2VWIA 1R1WA 3OOMA 3O50A 4AGUA 3TG1A 4TN6A 5HICA 4QP3A 4U97A 4XBUA 1QCFA 3T9IA 5HD7A 5K9IA 4F4PA 3O96A 5IQIA 3W0QA 4O0SA 5KMMA 4R78A 3BU6A 2VTQA 4QDVA 4ONAA 3ORPA 4FTLA 2XCKA 4E3CA 5FXSA 2C6EA 1GZNA 4FIFA 2ITVA 4FIGA 1Q24A 4F1MA 3BGQA 3FMNA 4OT6A 4X2GA 4DHFA 4YJOA 3W0OA 3BYSA 1HOWA 3DNDA 1J7UA 3LE6A 3NNVA 1F5QA 4I6BA 3U87A 4EH4A 1NVSA 4FKRA 5B7VA 3FZSA 4I0SA 3DKOA 3W55A 4A9SA 3OW3A 4L3PA 1O6LA 4C8BA 5CNNA 4JRVA 3NVMB 3ORTA 2J0LA 2B4SB 2HAKA 5D12A 4FZAB 5DN3A 2QD9A 3ENMA 4EI4A 3MFRA 3RWPA 4JIAA 4LOPA 4PTGA 2G2IA 5E92A 3V5LA 4QMNA 5CQUA 2B9HA 2YDKA 3T8OA 4FEVA 2UVYA 4D55A 1RDQE 5KBRA 1A06A 2XYUA 4C2WA 1ZOHA 2WFYA 2UW6A 3CY3A 4A06A 3PZHA 3FPQA 3QYZA 3F9NA 5EDPA 5DH3A 3UVRA 2VO7A 4O7LA 3BBWA 5EYMA 2PUUA 4C59A 4BBMA 5J9LA 3GOPA 2Z02A 5CS6A 3EB0A 3TJDA 4AS0A 5A4TA 1ZLTA 3ODZX 5IH4A 3W2QA 4FJVA 1XH9A 4RQVA 5JEBA 2Z7LA 3NYXA 4JOAA 4WIHA 4RIYB 4RWIA 4RJ7A 5AP2A 5ANKA 4ITHA 1W82A 5A6OA 3N9XA 3R1SA 4JXFA 4GG5A 3V04A 4AFEA 3O51A 5J1VA 4PWNA 1PMVA 4UY9A 4D2PA 4FNXA 1ERKA 2PVKA 3D83A 3QTQA 2X7FA 3R1NA 4GFMA 3RPSA 3WOWA 4FGRA 3A61A 4G16A 3PY3A 1R0EA 5JFXA 4TRLA 2XK8A 3V5WA 4H1MA 4L46A 3NAYA 4YJTA 5KBQA 3V5JA 2PU8A 2ITPA 1W2DA 3EFLA 3ORIA 2VZ6A 5K0KA 4GH2A 4BB4A 4DEGA 4OGRA 4NIFB 2JITA 4KBCA 3BYVA 3JYAA 3PE1A 5J95A 5C8KA 4Z16A 4DH3A 4EK5A 5AM6A 5HD4A 3KULA 1FVTA 5AX3A 4EOMA 2B54A 2R0UA 3NGAA 4IAKA 3UIUA 4YSJA 4L53A 4MK0A 1BMKA 2XCHA 4L6QA 2WQNA 3VW6A 4B8MA 4GYIA 5GJFA 4UMUA 5F9EA 3QKLA 3UDSA 3HDMA 3BGZA 4MWIA 3RINA 4ANBA 1OKYA 4QP9A 4GU9A 4R6VA 4RFYA 3NPCA 3RWQA 5L8JA 1X8BA 4FSWA 1A9UA 2BMCA 4HZRA 3FL4A 4PX6A 3R9DA 3P08A 4X3JA 3BWFA 5J9ZA 4GRBA 3MYGA 1PXPA 3DDPA 4FRFA 4OTWA 4RG0A 4AE6A 5DPVA 4QMXA 3CE3A 4BDDA 4FA2A 1KWPA 1F3MC 4FKJA 4K6ZA 2NRYA 5F95A 1Q8ZA 3GCVA 3UBDA 3EQFA 3CPBA 2PUNA 5M07A 1R3CA 4FODA 1CKJA 4AT5A 4NM5A 4ZJIA 3FAAA 4DDIA 3VBYA 4E4NA 3TNQB 2XNPA 3MPMA 1J7LA 2YM4A 3D0EA 1DI9A 2X4ZA 4M68A 4ZTQA 4ZY6A 4NKSA 1YQJA 3T3VA 3QUDA 4I4FA 5TT7A 3DKFA 3PA3A 4K8AA 5HI2A 3WZKA 4BYIA 5I9WA 1ND4A 3SG8A 2QCSA 2CGVA 3CQUA 3HA6A 4E6QA 1CKIA 3EZVA 3DJ5A 3ELJA 4H1JA 3VUIA 3AMAA 4H3PA 3V8TA 4FGBA 4D2SA 4FTOA 3IO7A 3KKVA 4P5ZA 3NYVA 2V7OA 3ZTXA 1OIUA 3GT8A 4AOIA 3KF4A 2V62A 3C1XA 4IH8A 3IW5A 3RCJA 3QRJA 3HVCA 4C4JA 5FEDA 5H3QA 3F66A 3QBNA 4U9AA 1ZMVA 3U4UA 2R3PA 3LVPA 4X3FB 4AZTA 4BCJA 5DWRA 5J1WA 2FSTX 4LV7A 4USDA 2JIVA 4O0YA 4Y5QA 2OH4A 4I24A 1FGKA 1XR1A 3PSBA 3QA8A 4P2KA 4CVAA 1UWJA 3KRRA 2W5HA 3ALNA 4H05A 2XB7A 2WMXA 2A1AB 3EOCA 1OMWA 2PTKA 5DRBA 5GZ9A 2C5VA 2QQ7A 2QOFA 4DFBA 2QHNA 1FMOE 4BICA 3VBQA 3KL8A 2OGVA 3CTHA 1XBCA 4JR7A 2OU7A 3NUNA 4CRLA 3C0GA 2YJRA 4ZTHA 3W16A 4I5PA 1G8SA 5E90A 5DI1A 4MHAA 2J0JA 4RWKA 1FOTA 3UZRA 1KE9A 1JBPE 4EEVA 3KXNA 4WOVA 5CAOA 3FLNC 4GS6A 1H1PA 3E64A 3UE4A 4CNHA 4QD6A 4RX9A 4YMJA 4O7VA 2ERKA 4O4BB 1ZAOA 4YGAA 5ICPA 4O1PA 4N70A 3IDCA 1UWHA 1DM2A 1NXKA 4K18A 2ACXA 4MF0A 2J0IA 3WF6A 3ZUTA 1FPUA 3MPAA 2GNGA 4UWYA 1KE5A 2CKEA 3FEGA 2J5FA 4QPAA 3V8SA 3BYUA 2W4JA 5CU4A 1UVRA 2WKMA 4HGSA 3HAMA 3OS3A 2RSVA 4NEUA 5HG8A 3R2BA 4BCQA 5JMSA 4IW0A 2I1MA 4RC2A 4YTHA 5JFVA 3UTOA 4QYFA 3PIXA 2UZDA 4BI2A 3GC9A 4ZZMA 3UYSA 4DGOA 3TMOA 3GENA 4F78A 4E5WA 3P0MA 4WSYA 3SXRA 4Q9ZA 3GXLA 3TJCA 1FINA 1PW2A 2VWWA 4XLVA 2ITXA 4AGCA 3FZOA 3QYWA 5FP6A 3R2YA 1JSTA 3D5XA 3DXNA 1V0PA 3DV3A 1WZYA 3KRJA 5AP3A 2JFLA 4E4XA 5K4JA 2IVSA 3CGFA 3QCSA 4YHTA 4EONA 4WNKA 3ZM9A 2W7XA 4KBAA 3ZHPC 4YZBA 1VLRA 5LVNA 2DUVA 3ZSGA 4DCAA 4W4YA 4KNBA 1UKIA 3OWJA 3PIYA 4TYIA 5DVRA 4EH3A 2CDZA 4U40A 5IA5A 3TYKA 5HKMA 2CCHA 3PJ8A 3ZM4A 4BFMA 4PMMA 4D5KA 3VBXA 1Q3WA 4M67A 2O65A 5M06A 2R0IA 3FWQA 3GI3A 4IWQA 3ZBFA 2H96A 3VBWA 4M0YA 4CQGA 4IFGA 2YACA 4U44A 2ZV2A 4MX9A 3CD8A 4DEBA 2UW7A 3RZFA 4O1OA 4V05A 3DKGA 4F99A 1FGIA 2JGZA 3DAKA 1REJA 2KULA 3FLWA 1DS5A 2ITWA 2SRCA 4K9YA 4WUNA 3TZMA 3U6IA 4ORKA 4MWHA 4DE4A 3F3ZA 3O8PA 4GK4A 4FNZA 4XBRA 5DT0A 3ZO2A 5FLFA 4FVPA 2C68A 3REPA 3A60A 3LAUA 2A19B 2GHLA 4D0XA 1Q8UA 1FQ1B 2JLDA 3HGKA 4NT4A 5CEMA 1XBAA 1P4OA 2BROA 2C0IA 2OIBA 2PZ5A 3PRFA 4V0GB 5BX0A 3BHTA 4O38A 1OZ1A 3ET7A 4N0SA 2R3QA 1ZOEA 3OXIA 4JL9A 3ORMA 2C3IB 3RP9A 4R1YA 2NRUA 4J8NA 2IZRA 4QTBA 1REKA 4MKCA 3TDVA 5CYIA 2F4JA 4JBVA 1WVXA 4O6EA 4AU8A 3RZBA 3TV7A 3ZXTA 5LMKC 3MVJA 4I21A 4LV5A 2VX0A 3NLBA 1XH6A 4RMZA 3FY0A 1YHVA 4FKLA 2BZIB 4KB8A 5LMKA 4PY1A 3W0PA 5CEOA 1B38A 1FVRA 4NUSA 3WARA 4CFVA 4DDGA 5TR6A 3I6WA 1UU8A 4PNIA 5CAQA 4WSQA 3R04A 3CP9A 3LOKA 1QPDA 4L01A 5FUTA 5BMSA 1VZOA 3PJCA 4HGEA 3R9HA 1TZDA 2PY3A 4M97A 3NW7A 2XBAA 3RPVA 3U4WA 3IW4A 2Y4IC 4CT2A 3AKLA 3GCPA 4IFCA 1YXSA 4GIHA 4LG4A 1S9IA 2YABA 4NTSA 4HNFA 3RM6A 2W5AA 3AC3A 2H34A 3W18A 2JDOA 3DNEA 4IAIA 5DR2A 4DINA 4EUTA 4O7SA 4FT3A 5CWZA 2XAOA 4WNMA 5AP7A 2VTJA 5EH0A 2OZAB 4D5HA 4FT0A 5K3YA 4HCTA 4DTBA 3EFJA 3I81A 4G3GA 2QOHA 5BUEA 4K0YA 1WFCA 2HXLA 3BYMA 4OBQA 2YLEA 2BPMA 2P2IA 4GMYA 3T3UA 4W9XA 1GOLA 3B8QA 4BTMA 2YJSA 5HORA 1OB3A 1YDSE 2P33A 2XRUA 3EYHA 3NIZA 4JT3A 4O7YA 1PKGA 3Q3BA 3CR0A 2A27A 2HW7A 4CXAA 4ANLA 1W8CA 4GT5A 2H9VA 4RZVA 5F94A 3TUBA 3Q2MA 5E8TA 3W33A 4QTEA 4EBWA 4M7IA 5A46A 1Q8YA 4F7NA 5ACBC 1OUYA 2JDSA 3Q60A 4G2FA 3MTLA 4FYOA 1PRYA 4RJ4A 3H9RA 3TV6A 1OPJA 3DTWA 5AP0A 4BR3A 2W1EA 1GNGA 4I6LA 3VW8A 4YURA 2W17A 3KCKA 2XK6A 3NUPA 3O8UA 3DB8A 5E7RA 3R8LA 4JDKA 4AT4A 5E4HA 2WMQA 3CS9A 2XBJA 3OVVA 1T46A 2IJMA 2JEDA 1XO2B 3G2FA 3OOGA 4FG9A 4P4CA 3Q9XA 3OY3A 4UALA 1OGUA 5ACKA 3Q5IA 4AW1A 5HLNA 3K54A 1E1XA 3ZO4A 4ARKA 4ZY4A 5BVEA 3TNPC 3FHRA 2GSFA 4UMPA 5BVDA 5G6VA 2XK3A 4LRKA 5AV4A 4LGGA 3GU8A 3SG9A 3WF9A 1H07A 3COMA 4QMWA 2GS6A 3LXPA 4WT6A 4BL1A 3KREA 5JQ8A 1PJKA 3OT3A 2PVRA 3SGCA 3GCUA 3QGWA 2X2MA 5I9XA 5FWKK 5M4UA 3VS5A 5JRQA 3OTVA 5T6KA 3TTIA 2V5QA 5HO7A 2IVUA 2P4IA 3CGOA 5LMBA 1ZMWA 2HYYA 2Z7RA 5D41A 4PL3A 3DA6A 5C01A 2WTCA 3CEKA 3R8VA 3OC1A 2Y0AA 3PVWA 4FSRA 4ZIMA 3LFQA 4LL0A 4BI1A 4RVKA 4X6RA 1R78A 3KVXA 5D1JA 4PMPA 4XP2A 4E4MA 3BQCA 2JIUA 3O5AA 3TIZA 2VV9A 2OSCA 2W1IA 4OTQA 2XMYA 5E8WA 1OKWA 3AGMA 1ZYCA 2H6DA 2X0OA 3Q52A 4LUEA 3LM0A 1YOMA 4S32A 1XQZA 4IHPA 4FV8A 1CTPE 3DZQA 2R3HA 3SRVB 2BAJA 5FD2A 3W2OA 4JG7A 1PMUA 3GQLA 4H39A 3EWHA 1NY3A 1UKHA 2QONA 2BFXA 5AP6A 3RHXA 1G8JA 4O4FA 2GFSA 2DS1A 3EL8A 3HP5A 2VTLA 3RAHA 2CMWA 3TIYA 1Z5MA 5I0BA 5CT0A 1ZXEA 4NJ3A 1OL6A 2HY0A 1GZKA 3A4OX 4XV3A 2J6MA 2YM8A 5L2QA 3DB6A 4BVUA 4HYIA 1HCKA 1Q99A 4AGWA 2G9XA 1GIHA 2Y7JA 4BTFA 5K5NA 1ZY5A 5IQDA 4ZSEA 4KKGA 3U8WA 2I6LA 1W0XC 3PSCA 3PJ3A 1Y91A 3KXGA 5EYCA 5HTBA 3FQEA 3C5IA 4OTIA 4OTFA 5HE3A 5JZNA 3E5AA 4QNAA 3EQHA 2YIRA 3PJ2A 1TKIA 4ZSGA 4QP8A 4BBEA 4BCOA 4RA4A 4ASEA 4W8EA 3HRBA 4FKQA 2WQBA 5ETCA 4O0TA 4DEEA 3F7ZA 2ITNA 4DH7A 3D5UA 2XKEA 3GU4A 3UDBA 3UG1A 2R64A 1W83A 4L42A 2YA9A 5LVMA 4ZMFA 2YFXA 5DR6A 2XNMA 2ONLA 5CSWA 4U7ZA 4OW8A 4FUXA 4KD1A 3V5TA 4A07A 4EJNA 2C69A 2F2CB 3DLSA 3KEXA 4O0UA 3ITZA 4FR4A 3JY9A 3DOGA 3UPZA 3KXHA 2A4LA 2XM8A 4F0GA 2ITYA 4I4EA 3GCQA 3C7QA 2JC6A 1SYKA 2YIWA 2IZTA 4D28A 1G8AA 4GVJA 4O4DA 4YJNA 1I44A 4DEAA 2O3PA 4IXPA 1H0WA 3R02A 4QMYA 3Q9ZA 2VWYA 3LXKA 4J7BA 3SOCA 4FTNA 2XARA 4DC2A 4EBVA 3RNYA 4BCPA 1NA7A 2VWXA 1KUTA 4C4IA 3C4XA 4O86A