5HTBA

Crystal structure of haspin (gsg2) in complex with bisubstrate inhibitor arc-3353
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
GPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Co-crystal structures of the protein kinase haspin with bisubstrate inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase haspin
total genus 115
structure length 328
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5htbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5htbA01
3PXYA 5HE3A 4BCQA 2G9XA 2X8EA 3E7OA 2XNGA 3HRBA 3K2LA 2R7IA 4H3QA 4O7SA 4BCFA 3ZOSA 3NUUA 4JQ8A 4IFGA 4FEWA 3CCNA 3PPJA 3R63A 4GK3A 3EL7A 1PKGA 4HJOA 4MXXA 5IUIA 4ZJIA 4ZY4A 3BU3A 3TM0A 2HAKA 3W2QA 4EC9A 5HU3A 2PSQA 4RFZA 4RFYA 4F7SA 3DZOA 3ZUUA 3R02A 4GS6A 4U42A 3F7ZA 5JK3A 3KMWA 2ACXA 4YJQA 4Q5HA 4AZTA 4OAVB 2E9UA 4O0VA 3GU7A 3RWQA 3BWFA 4RX9A 2XA4A 3DDQA 2V62A 2PMNX 4NZWB 2HY0A 5IQFA 4FVRA 4BHNA 2IW9A 3JPVA 4KB8A 5CSWA 3FDNA 4IIRA 5HO7A 3OMVA 5JGAA 4I1ZA 4ASXA 1G8SA 3CS9A 3KXMA 4DFUA 1XBAA 4IAFA 3QCQA 5IG1A 3D5WA 2NNWB 4IB5A 4M0ZA 2GTMA 2Q83A 2AC3A 5C8NA 4E5BA 1PYEA 4BI2A 3F69A 4LGGA 4OTDA 4IVAA 3KEXA 5KHWA 2CGWA 1IAHA 3ZC5A 4R5SA 5DBXA 1S9JA 3WYXA 3PPZA 4O0WA 2YISA 4JLCA 1WVXA 2VTSA 4FV2A 3KULA 3OW4A 3R7IA 3EQRA 4OTWA 4YHFA 3ZHPC 3E5AA 3RAKA 5IA4A 3P08A 3O71A 4C4IA 1OIYA 3R0TA 1PF8A 2QHNA 4NU1A 3F6XA 1J7UA 1JOWB 2Z02A 3NR9A 3PY1A 2WHBA 2GHGA 5HOAA 2W5BA 4IANA 3V5PA 4L42A 4XG6A 1G3NA 2UW9A 4P2KA 2E9OA 1IASA 2WTJA 3KL8A 4BGHA 1H08A 4BN1A 2QVSE 2OFVA 4KIKB 1QMZA 3DDPA 1VZOA 1MP8A 1H28A 3IDPA 4JNWA 5CU4A 4XG3A 4EYJA 4AZWA 3LJ0A 4MHAA 3VS2A 4CRSA 4BBEA 2JDVA 3PRFA 4JBPA 4L52A 3FI4A 4CV8A 3LXLA 3FLSA 4F1TA 5BUIA 2YERA 3R71A 3WILA 2GHLA 4ANQA 3EFWA 4PWNA 4W4YA 2YM3A 4AWIA 4A4LA 4MBJA 1M14A 3NVKI 2DS1A 4I94A 1UVRA 3FUPA 2BILB 4XH6A 2YIXA 4PV0A 4Y8DA 2VTJA 3TNIA 1B39A 3IECA 5AUYA 4USDA 4BIEA 4LMNA 4KUJA 5J7HA 3FI2A 4BCJA 2WKMA 2UW0A 3I0OA 5GHVA 2YZAA 3CP9A 1ZZLA 4PP9A 3RP9A 4TZRA 4XOZA 3F9NA 4EEVA 4EKKA 5KE0A 5M56A 1V0PA 4K8AA 3FZPA 4FTLA 3SX9A 4XCUA 3BQCA 4UY9A 3DA6A 3O8UA 2OW3A 2VTMA 3GC7A 2Y9QA 3QAME 4LM5A 2VU3A 4BF2A 3ORKA 4G9CA 3D15A 1BI7A 4TWPA 2GDOA 3ACKA 3KKVA 5LVNA 4IWQA 2OFUA 4CT1A 3HNGA 4JJRA 2YM4A 3WARA 1RE8A 3TV7A 4IAZA 4DC2A 3EL8A 3ZO3A 5K0XA 3RPOA 4YJSA 3VS4A 3QCSA 3HAVA 4L46A 5HESA 4UWCA 4TYHB 3KFAA 3NW7A 4YZDA 4I6HA 1Y6BA 4E73A 4X3FC 4D1XA 3QD2B 5C1QB 3DY7A 4Z7HA 3OBJA 2GCDA 1ZARA 3LZBA 1NW1A 3JXWA 3NIZA 5DRBA 4B9DA 5IUGA 3D4QA 4JT3A 4I5HA 2QI8A 4I24A 4LOOA 1YDTE 4XP3A 3UOLA 3ZO1A 1GZNA 2C6TA 2I0VA 3DKGA 2WXVA 2YABA 3W8LA 2F57A 4RLLA 5AP4A 4FKVA 2ESMA 2C69A 4DA5A 5A4LA 2YM6A 2ZVAA 4UEUA 5AP1A 3TNPC 3EFKA 5HD4A 4JOAA 2ITZA 2R3LA 4H39A 4QMSA 3PUPA 1V0OA 4F99A 3RNYA 2BRHA 2J5EA 4QQ5A 5EYKA 4IZAA 3VVHA 3FPQA 3R2BA 5DT4A 4BBMA 5M57A 5E8TA 2UV2A 2YHVA 2VTHA 3SXRA 1GIJA 3QKKA 4R5YA 3DKFA 3QUDA 4IB3A 4EOLA 2XIKA 4QMOA 5T6KA 5BUJA 1APME 2P2HA 4IX3A 5CVFA 2B9JA 2WFYA 4UXQA 2E2BA 4YZ9A 5K4JA 5LMKA 3AMYA 3CLYA 3C4FA 1PXMA 5T3QA 3GBZA 5EM6A 5GNKA 2WMXA 2C6DA 4UZDA 5BVNA 5KMKA 2UZVA 2GQSA 4IC8A 1ZOGA 4FSMA 3AXWA 3UIBA 2RG5A 4FX3A 4AGCA 3MFSA 2X39A 3OXZA 2W06A 4EK8A 1P2AA 5HBJA 5FTOA 5H9BA 3ZUVA 3W8QA 4IM3A 4UBAA 4PDOA 3CTHA 3EQGA 3EYGA 5L4QA 3I6WA 4KINA 3SKCA 4E8AA 2ZV2A 5ICPA 4BCIA 4IX6A 4L67A 4S34A 4E26A 4ZSAA 1ZYJA 5EW9A 3V51A 4EH8A 4XUFA 3IO7A 3K3IA 2XK6A 1W83A 4NSTA 3AGMA 4J97A 4RGJA 4DGLC 4HYUA 2C6MA 4U0IA 1H0WA 3VC4A 2BFYA 5J9ZA 4BDKA 4GSBA 3ZU7A 5JRQA 5AUUA 3NUSA 2BKKA 2XJ0A 3ZYAA 3FQEA 5EYMA 3BGPA 4PTGA 5L8KA 3COMA 4QOXA 3DT1A 3C50A 3G90X 3JVRA 4M14A 5AUXA 2QODA 3VUGA 1ZY5A 3BV3A 4EOJA 3KMMA 4LFIA 1YWVA 3OT3A 5D11A 1B38A 3QTIA 3ORPA 4A06A 2O65A 3Q6WA 3FZSA 5K3YA 4TW9A 4F1OA 1G8AA 4FTMA 3FHIA 4L43A 3POZA 4O83A 3G51A 3R22A 4FV0A 4JRNA 2QURA 3P5KA 1Q62A 3DQWA 4XHKB 5E1EA 2C6IA 4KBAA 5BVEA 3RPYA 4RJ8A 3G6HA 4IJPA 4E6QA 3DJ6A 4QNYA 3FXZA 5J7BA 1KWPA 2YLFA 4FTUA 2GFSA 2X6EA 4W4WA 2JC6A 4BKZA 3D14A 3KCFA 3ET7A 2W17A 4ITJA 5HORA 1X8BA 2PMIA 4I0RA 5EDQA 4CFMA 3EKNA 4UWBA 4ZSEA 5JEBA 2R3NA 4QMLA 4I6QA 5J5SA 3DFCB 1YI4A 4ZMFA 3CC6A 2PE0A 4Y85A 3EN4A 5JQ5A 2BPMA 3GU6A 4FG9A 3UOKA 3I7CA 4YO4A 2QU6A 1R3CA 2F49A 4I4EA 4CYIA 5IQDA 2JBOA 3AD5A 4L68A 4OR5A 2C5NA 1ZOEA 1PXOA 2W1DA 2YFXA 4IE9A 3FY0A 3MYGA 4OBOA 4XV1A 5DNRA 4BCPA 4G6NA 5AP0A 3DU8A 1JBPE 1YQJA 2CMWA 1Q8UA 3U8WA 2HW7A 3HV7A 3QQKA 3N4UA 5E92A 3W2OA 3P78A 1OIQA 2RFNA 3QA0A 5KMOA 2BHHA 2JKKA 2XKDA 4O6EA 4RWIA 4NCTC 4F65A 3FLQA 2OH4A 3V6SA 4FKUA 1H00A 3KRRA 2VNWA 4YJOA 5C27A 5J79A 2W9FB 3C4CA 3KVWA 2UZBA 4V05A 4BDCA 3FZOA 4L44A 3I0QA 4W8EA 3UG1A 5AADA 3NYVA 3NEWA 4RIYB 3UNJA 4A9TA 2QC6A 1WFCA 3QKLA 1CDKA 1OGUA 1PHKA 3G33A 4DLIA 4G3DA 5ETIA 1UA2A 4XRJA 4YC6A 2A0CX 5I0BA 2PE2A 3NNWA 3QHRA 4RWKA 2HXLA 3D7TA 5BUEA 2UVYA 5AR3A 4ACHA 5LQFA 4N4SA 3PP1A 3ZS5A 3P7CA 2I0YA 2DWBA 5BPYA 2XM8A 3H9OA 4AS0A 3V5JA 4CG9A 4GEOA 1TQIA 2BIKB 1DS5A 2QLQA 4FKIA 1T46A 3G5DA 1OKWA 2VO6A 3BYUA 3MGYA 4C37A 4AQCA 2QOLA 3L9NA 3DLZA 3ZRMA 3MIAA 1Z57A 4EJ7A 5BVOA 3ORIA 3WZJA 2R2PA 5B2MA 3K5UA 4V01A 3FKOA 3QGYA 4F6UA 3IQ7A 5IUHA 3II5A 5DEWA 4U7ZA 3ORTA 5B2LA 5FG8A 3K5VA 1OL5A 2OJ9A 2F7ZE 2PVRA 4OBQA 3PG3A 3R9DA 2UZWE 2VTOA 4U3YA 1OPKA 4DFXE 4YHTA 2AC5A 3FQHA 3W33A 2C5YA 2OF2A 2R9SA 4PQNA 4C2WA 2Y6MA 4BCKA 2PZPA 4F7JA 4AZVA 1XBCA 1YHVA 2OZOA 3AT2A 3U6IA 3DZQA 1BI8A 1AQ1A 3A8WA 4W8DA 2VX1A 3ENHA 2CNQA 2BAJA 3KRXA 4WG4A 5I9XA 3F7WA 1SM2A 2HWOA 1YDRE 3VUMA 3OUNB 2ZAZA 5ANEA 1F3MC 5BNJA 5EG3A 5AM6A 4OTIA 4OW8A 3R01A 3B8RA 4GU6A 3WOWA 4AOTA 4DF3A 3SV0A 4MH7A 4TPTA 4M3QA 3T3UA 2VRXA 3KXXA 4CV9A 1SVGA 1SMHA 2J6MA 3KXGA 3TXOA 2QOQA 4F0GA 4J53A 3KREA 3H9FA 1OIRA 3F5GA 3PY3A 2YIQA 5DA3A 2C4GA 2WMRA 1HCLA 4QP7A 3AMAA 1REKA 3VBWA 1NVQA 4J95A 1YHSA 2QO7A 5FEEA 1H1QA 5E90A 5EKOA 4TYJA 4MXZA 4AE9A 2IW6A 5FXQA 4F6WA 4E6CA 5EQEA 4BCNA 4HCTA 2XK4A 5HNGA 4C4EA 4IXPA 5JSMA 2ZDTA 4WBOA 1YXVA 2VO3A 4YJTA 3QTZA 5HZNA 4ACCA 4FSNA 3D83A 3PWDA 2J0MB 2CGXA 1M2QA 4NFMA 5DWRA 5HTBA 4TT7A 2J2IB 3HRCA 3BKBA 4C33A 4O0XA 3ZSGA 3H4JA 3V6RA 4C0TA 3PJ3A 2GQRA 2XRUA 2O3PA 2VTIA 4YZNA 5AV0A 2YAAA 4CQEA 2F2UA 1WVWA 3ZZWA 3R21A 4QRCA 3EKKA 4MXOA 1I44A 4FT9A 5AR7A 1Y8YA 4F9BA 2J51A 5CZIA 4M69A 2QNJA 4AP7A 2FUMA 4GIHA 3OY3A 4YLJA 3PXKA 3KK9A 5CQUA 5AAFA 2R3MA 5T68A 2XNNA 5J8IA 4HVHA 3GCUA 1OB3A 2I0EA 3QUPA 3MH3A 5HX6A 1Q24A 2WOTA 3IGGA 4R3RA 3TUCA 1ZRZA 3MESA 5K0KA 4XG9A 4H1MA 2VZ6A 3A62A 5M07A 4WBBB 2JDTA 3DJ7A 3FYJX 3VO3A 4D1ZA 4FTKA 5CF4A 3UZTA 1OKYA 4X6QC 4ERKA 3UMWA 4B6LA 4X6RA 3SD0A 4AA4A 5EI6A 3KU2A 1H27A 5FEQA 5LXMA 3G2FA 4DTBA 4IVCA 4XP0A 3F3WA 2ITTA 2QOBA 3F3ZA 3Q4TA 2B55A 4DH5A 3QZIA 3ZM4A 2PZIA 4TKSA 4IWDA 2QO9A 4U80A 1ZXEA 4WO5A 4O0YA 5KMNA 3FKLA 4ASDA 4E4NA 4IZ7A 3MFTA 3AMBA 5E8YA 5CU0A 4MD7E 3TUDA 3QHWA 5DG5A 3R7YA 1WZYA 2VO0A 4AZEA 4AGDA 5LVPA 4AFJA 5HBEA 3UZRA 3FXXA 4MD8E 1RW8A 4I0TA 3NZ0A 4IX5A 4FTAA 3P7BA 5EM5A 2X9FA 4FTIA 4RJ7A 4U3ZA 3RJCA 2UUEA 1DI9A 2ZYBA 3UC4A 4P5QA 5DR6A 1WMKA 3GGFA 2PMOX 4YUQA 3FEGA 2GFCA 5CT7A 4BYIA 2G2IA 4QYYA 4FE2A 4YNEA 4FR4A 3NW5A 4ARKA 2CDZA 3HYHA 4FG8A 4CTCA 5A4TA 4O91A 5EOLA 5HLPA 1O6YA 3EQCA 4M69B 4FKRA 1YWRA 3VUTA 5GZAA 4USEA 3NRMA 1M2RA 4FTQA 5HIBA 2C1BA 4YSJA 4O82A 3DTWA 3IOPA 3PY0A 2W1HA 4D55A 4B7TA 2XBJA 3PE1A 5CU6A 3TZ7A 1CKJA 3BLQA 3Q53A 2ETKA 4QQJA 1BL6A 2YJRA 3MVHA 1JKTA 4KS8A 5HTCA 3R8LA 4AN3A 5DVRA 5EI8A 3G6GA 1YOLA 4M15A 4EOPA 2QOFA 5F95A 4EH6A 2G2HA 4U43A 3QX4A 5DE2A 2FSOX 1H25A 5AEPA 3T9TA 4IBMA 4BDDA 3IW7A 5BVKA 3I5NA 2SRCA 3OTUA 3VBXA 4D4YA 1PRYA 2QCSA 3FMDA 4F64A 5FD2A 5CEIA 2JD5A 2X1NA 3DKOA 3IS5A 3ZXZA 3CPCA 3SC1A 2C30A 4E4LA 4A9RA 3PXFA 3MPMA 4LGHA 4I5MA 4BKYA 4EUTA 3H30A 3R7OA 3QCYA 4NM5A 4LUDA 2CLXA 5HG8A 4C7TA 4IH8A 5HG9A 3F5XA 4RVKA 2F7EE 2WEVA 3NGAA 3IDBA 1O6KA 4EOOA 3UYTA 4EK5A 3RKBA 3GQIA 4S31A 1PXPA 1HCKA 4R3PA 1WVYA 3QTUA 4IWPA 4MTAA 4O0TA 3DBEA 4F70A 4R6VA 2B0QA 2C68A 3NDMA 5IA1A 4QO9A 3O50A 2YA9A 5FM3A 4R77A 1Q8YA 2NRYA 3A8XA 3FWQA 3GEQA 4XJ0A 2ZB0A 4KIKA 5FP5A 2JDRA 2XIZA 2OIDA 3DB6A 4FKQA 3F5UA 3SHEA 5CEOA 5BYZA 5AA8A 1DI8A 5BMMA 2OJJA 3BCEA 4KA3A 1FQ1B 1L3RE 3KRJA 4USFA 4I3ZA 4L00A 3KA0A 3POOA 3PDTA 3GVUA 2RF9A 4F9CA 4RIXB 5AR4A 3F5PA 5K5NA 2W1GA 3RNIA 4R3CA 3VHKA 2CLQA 5ANJA 5EK7A 2CGVA 2W7XA 3MV5A 3MPAA 1VYZA 4PMSA 5CU2A 3TDWA 1WCCA 5LJJA 4IAKA 4FEVA 3OCGA 4J99A 5EI2A 4I20A 4ZY6A 3DTCA 3P7AA 4D2RA 5CNNA 4D4SA 4QP3A 2BDJA 4RC4A 4X3FB 5IQHA 4RSSA 4YLKA 5K5XA 3UZPA 2PUUA 3SG8A 4WNPA 2JBPA 3L8VA 4OT5A 1JSTA 2VWVA 4MWHA 5EH0A 1AGWA 5GZ9A 4W9XA 2ETMA 4MAOA 4K9YA 4QP1A 4K1BA 1MRYA 2BDWA 4FICA 5DLSA 4UB7A 2HXQA 1PMUA 3EZVA 3PLSA 2AUHA 4EZ5A 4BWXA 4F7LA 3S4QA 4M68A 3ZEWA 3FL5A 5AUVA 5E9EA 3V8WA 5GIPE 4FTCA 3A4OX 4KRDA 3D5UA 4XBUA 1KV2A 2BTRA 4O22A 4NUSA 2HZ0A 4Y72A 4IZ5A 3MJ2A 3R83A 1H1SA 3UDBA 3VRYA 3P9JA 1IRKA 3IK3A 4YGAA 4CCUA 4FKLA 2F9GA 4ZTLA 4LGDA 5HO8A 2GNGA 3BELA 4KSPA 3AC5A 4TYHA 1KV1A 2G2FA 1UKIA 4GVJA 3CGFA 4RQKA 2XEYA 4C38A 3UNKA 2X8DA 4IAAA 4JS8A 3C1XA 2YACA 4K0YA 2W5HA 4FL2A 4WUNA 4YPSA 1LEZA 3KY2A 3QTRA 3PJ1A 3Q32A 3F2NA 3D94A 3AQVA 3FMEA 2A27A 4KKGA 3W32A 4CTBA 4DGMA 2P0CA 2LAVA 4YMJA 3WIGA 1A9UA 4FT5A 2XJ2A 4ALUA 5CF6A 3LXKA 3SXFA 2G15A 2YM7A 4AT3A 3AC3A 1BX6A 1LR4A 2UW3A 4PUZA 5AM7A 4M67A 2R5TA 5E8VA 3QRUA 3FHRA 4WOVA 4O38A 4FSRA 4FUYA 4DEBA 4ZY5A 3G15A 1MRVA 4QMQA 1KOBA 5A3XA 4EI4A 4O84A 3C9WA 2UW8A 4U79A 3ZONA 3VULA 4G3EA 3EH9A 4G5JA 3E64A 2UZTA 4ALVA 1XH8A 4FKWA 4FZ6A 2A19B 3PXZA 4NW6A 4FV4A 3ZBXA 3ZFYA 2Z2WA 1OL2A 2YDKA 3ALOA 3FPMA 3UIXA 4YSMA 3RMFA 3ZLXA 4ZTRA 5IQAA 4S33A 4Y46A 3AT4A 4ZTQA 2QD9A 2V5QA 4IDTA 2FSTX 4OTQA 4YJPA 5JZJA 3UP7A 4BYJA 3EQPA 3C0IA 4G1WA 5EM7A 3V5LA 3EQFA 2OZAA 4P90A 2OJFE 3QTQA 2ITUA 3MWUA 1BMKA 3E3BX 4I5CA 2G1TA 4DITA 4BGQA 1JKKA 4C02A 5FTGA 5IZFA 1OL7A 1ZYSA 4RC3A 3KXHA 4ZJVA 2QOOA 1SYKA 4UN0C 2KTYA 4XX9A 3RM6A 5CEQA 3E7VA 3HV5A 1XH9A 3IGOA 4BWKA 4D1SA 4R78A 2X7OA 4FBXA 1FMKA 2P3GX 1I09A 5G1XA 3PIXA 5C4LA 1OUYA 2KULA 2X9EA 3AT3A 3LHJA 3RK9A 3LMHA 3W1FA 1URWA 4DG0E 3FLWA 1KE8A 3TWJA 3R8ZA 4U81A 2PVYA 4KWPA 2UZDA 2VV9A 2I40A 4NM3A 3W18A 3RPRA 1XH7A 3HECA 4FL3A 2HK5A 5CAPA 2WMUA 1FVRA 3D5XA 3OXTA 5HG5A 5AV4A 3NSZA 4U40A 2YWVA 3S95A 3LFQA 3W2CA 3LCKA 5DI1A 4HVIA 5FGKA 4JG8A 2YCFA 3SQQA 4L9IA 3TV6A 5JQ8A 4BI1A 2QG7A 2VWYA 4KAOA 4QMNA 3ENMA 4YJRA 3UGCA 4ZOGA 4BFMA 4I6FA 4DE4A 3QLFA 4WUAA 1YOMA 5IEYA 5IQCA 4L7SA 2Z7QA 3MA3A 4HGLA 3UOHA 5A9UA 4FEQA 2EU9A 2X7FA 4IW0A 3BLRA 4D0WA 4E6DA 4MF0A 2RGPA 3C4XA 1OECA 3C5UA 5CWZA 4EK6A 2I0HA 1JKLA 3E8DA 2IVTA 3UO6A 2FGIA 2ZOQA 3D2IA 4X7QA 1H8FA 4C8BA 5AAEA 4E5WA 4ZIMA 2ONLA 3QKMA 2YCRA 4QTDA 4NM7A 2C1AA 5TKDA 5HX8A 4A9UA 3MTLA 4UMTA 4FF8A 2W1EA 4QQTA 1FVTA 5KBRA 2E9NA 4K33A 2OK1A 4PL4A 3M2WA 4XV2A 2W9ZB 3RZBA 2UVZA 3U87A 4O0SA 4YTFA 3FI8A 1G5SA 2R3PA 2WTDA 3QQUA 2R3QA 3I4BA 3FLZA 3OFMA 1JSUA 2IN6A 2W4JA 2XZSA 1UU8A 3Q5ZA 4CLJA 3L8XA 4ZTHA 3LLTA 4FV1A 3LCTA 5HQ0A 2GHMA 2C0IA 2XYUA 2FSLX 4CT2A 5LOHA 3LQ3A 3ZMMA 4DINA 4W4XA 2OI4X 4FT3A 4CFNA 5CAOA 4Z16A 2GNHA 1H0VA 1A06A 5M09A 3BE9A 4KBKA 2X0GA 5JFWA 4F9YA 4EONA 3R7UA 2XCKA 4OBPA 3ID6C 2UZLA 1U59A 3QC9A 3JS2A 5CVHA 3Q2MA 4UXLA 5D10A 4I22A 2V7AA 3CKXA 3ALNA 3QQFA 3VQUA 3IPHA 3AC2A 3BBWA 3BV2A 4FNZA 4Z7GA 4FC0A 2FVDA 3HV6A 3WZUA 3HAMA 3F82A 2OBJA 4JI9A 3ZCLA 3KB7A 4AA0A 4FEUA 3EB0A 3HUBA 3WF5A 1E1XA 2GNJA 5CLPA 4BDJA 3NAYA 4HGTA 5EW3A 4J52A 4ZS0A 5I9WA 2XM9A 5M4FA 1KE5A 2JKOA 3R73A 2PMLX 2EXMA 2QO2A 1FPUA 2R3OA 1P4FA 4JDHA 1U46A 2Z8CA 4AGUA 3JR1A 4HVSA 4GMYA 4C3PA 3PRIA 4KIPA 3N4VA 4QMVA 3ATSA 4HVDA 2WELA 3Q96A 3HDMA 3I6UA 4GV1A 1RJBA 3E62A 2Q0BA 3LOKA 2IW8A 4WNMA 4CFWA 3ANQA 5DMZA 3LXNA 4NL0A 5LVLA 3TG1A 1MQ4A 2QQ7A 4LOPA 3MSSA 3NNVA 1UU3A 3BYSA 4M66A 2UZOA 4DGNA 4D9TA 3E3PA 3GQLA 4AAAA 4K2RA 5IF1A 3CE3A 4GFOA 4LG4A 3UPXA 1TVOA 2C5XA 2H8HA 3IW4A 4I23A 5BMSA 4Q5EA 4M8TA 4U5JA 2XBAA 3VAPA 4CMTA 1PJKA 1L8TA 4AN2A 3ACJA 5K4IA 2X7GA 3PIYA 1P14A 5JGBA 2XS0A 1S9IA 5I9YA 2ITVA 3BZ3A 1W84A 2HWPA 4FVPA 3LKMA 3QA8A 4F1MA 1NVRA 4AXAA 4YTCA 3FZ1A 2QHMA 1YDSE 5EDRA 1WBNA 4IB0A 5HCZA 4HYHA 1IR3A 4P7EA 4CRLA 2VTPA 5C4KA 3EQIA 4TXCA 1DAYA 4O6LA 5LMAA 1P5EA 4L01A 5CALA 2ZMCA 3MFRA 4O7WA 3DBDA 2UW7A 4XNEA 2PUNA 4IEBA 3PA3A 2WIHA 4BTMA 3Q04A 1FOTA 3QFVA 4LYNA 1QPEA 3FL4A 3E88A 2PVMA 1CSNA 3LPBA 2CHLA 4CMOA 5C01A 3ULIA 4R8QA 2WMWA 3S00A 5IDPA 4IJ9A 4O96A 3QRJA 4O0RA 4E7WA 4KSQA 4TWOA 1U5QA 2V55A 3AGLA 3TNWA 2X4ZA 5CAUA 2CKQA 4EH9A 1UNHA 2OWBA 2YIRA 3VBTA 2O2UA 3DOGA 5CQWA 4DAWA 4BDFA 2XKCA 2VWZA 3GNIB 4O7YA 3WF9A 1CMKE 1NT2A 5HVJA 1OPLA 3WZKA 4I4FA 5LCKA 5HU9A 2HIWA 4L6QA 4QYGA 2WGJA 3QTWA 3ODZX 4AW2A 4PP7A 3HZTA 4F0IA 2PYWA 5C03A 5AP7A 2BDFA 4NH1A 3QRKA 5LVMA 3HA6A 3NYOA 4FSWA 3FMKA 3S1HA 2OJGA 3AC4A 1Y91A 3O7LB 4F63A 4NT4A 4D2TA 5IMEA 5DPVA 4FKOA 4JXFA 4EORA 4ANLA 5F1ZA 3Q6UA 1W0XC 5DT0A 2H6DA 1SNXA 2XK3A 2O8YA 3KULB 2ERKA 3MPTA 3QQGA 5AR8A 3S3IA 4AX8A 4PDYA 3F88A 2PY3A 3OTVA 3W10A 4ACGA 5AX9A 4BICA 3OCBA 3JYAA 4AG8A 4C59A 5DEYA 2BKZA 3D0EA 4JIAA 4MXAA 2C5VA 4WG5A 5EHLA 3U4UA 3NW6A 1ZYDA 4MNFA 5L6PA 3DCVA 3LE6A 5EDPA 3TZ9A 2R7BA 3U51A 5JMSA 1MRUA 1ZWSA 2GNIA 2Z7LA 2IWIA 4AF3A 4BTJA 1Y8GA 4A4OA 3G0FA 4V0GA 3KF4A 4G6OA 4MVFA 3FLNC 4RVMA 4C34A 5BYLA 2XP2A 1ZMWA 5EW8A 3UBDA 2A4LA 2HENA 3BGZA 2BALA 3SA0A 1KUTA 2YAKA 3VJOA 4U44A 5JFXA 4Z3VA 4DT9A 1KE7A 2J4ZA 3PZEA 4AFEA 3QXOA 5BYYA 4I92A 2Y7JA 3OG7A 2XB7A 2B53A 3DXQA 1ND4A 2WQEA 3H9RA 4YU2A 4Q9SA 5FDXA 3UIUA 3OS3A 5CF8A 3I5ZA 1JNKA 4GYIA 1CKPA 2WD1A 4NKAA 4GUBA 1JLUE 3PA5A 2WMBA 5ACKA 4D2SA 1UU7A 3LVPA 1AD5A 4KKEA 3FXWA 3BU6A 4FNXA 4E5AX 5DYJA 1URCA 2VTLA 5L8LA 3COHA 4HZRA 4E20A 2BZJA 3I60A 4TYIA 2ZV9A 3WF6A 4XS2A 2XH5A 3IONA 4H1JA 4BCOA 2I1MA 2ONLC 3DS6A 3R6XA 5EYCA 4R7BA 4BVUA 4O7LA 4O21A 3TACA 3GOKA 2RFSA 3A61A 2RL5A 4YBJA 4DH8A 4DCEA 4U9AA 3UPZA 4WNOA 4HYSA 4KRCA 2ZV7A 1OVEA 1ZYLA 1SVEA 3FMMA 1P4OA 5GIOE 1QL6A 3EQBA 4I6BA 2XNPA 5FXSA 3VS5A 1H4LA 3O8TA 3OBGA 4JBVA 5CI7A 4K11A 3V5TA 3SVVA 2REIA 1MQBA 2HW6A 2JEDA 3OHTA 3ZO4A 3GU4A 3HUCA 4OTPA 2RKUA 5CAQA 4RT7A 3HP5A 2XNOA 3DJ5A 4QYEA 4FV5A 4IMYA 3VUKA 4CQGA 4RA4A 2BVAA 4FZFB 5AMNA 3OROA 2EUFB 2F2CB 3DB8A 1Q4LA 3G0EA 3OWLA 1SZMA 3BBTB 1NY3A 4FSUA 3DK6A 2XNMA 4C36A 1UU9A 3R7GA 3ZLSA 2JFLA 4XEYA 5IEXA 4LMUA 5J5TA 5HHWA 3MDYA 3ORXA 4XV9A 4Q2AA 3BX5A 5JFSA 5TT7A 2GS6A 2VWWA 3O96A 3R9HA 4IHPA 2ZM3A 1RQQA 5JN2A 3LFBA 5FXRA 4YC8A 3OC1A 5ANGA 2JAMA 2Q0NA 4YC3A 3AC8A 3FMHA 4KNBA 3Q9WA 3TT0A 4H58A 4CKRA 3WF8A 2WMSA 1PMEA 2PUIA 5CI6A 3CSVA 4RC2A 4LV8A 1XKKA 1R0EA 3L8SA 2FO0A 5D9HA 3W2RA 2RG6A 1PKDA 3E8EA 4PPAA 2OXXA 2IVSA 3QU0A 3UNZA 5E8WA 3C51A 4GU9A 4IM2A 4UYNA 4D4RA 5IQIA 1UNLA 3R9NA 4ITIA 4FKGA 3QBNA 4JQ7A 4BCGA 3RHXA 3LXPA 3HMOA 3ZTXA 4O2PA 4GG7A 5IDNA 5IU2A 3F3VA 4FT0A 4Y5QA 4WSQA 2NPQA 4EWQA 2LGCA 1ZMUA 4GKHA 3A7IA 3OY1A 3LFDA 1XH5A 2AYPA 4JDKA 5M44A 4KABA 4ZZOA 3BYOA 3BE2A 4MWIA 4PMTA 1M2PA 3R28A 3RM7A 1XH4A 3TL8A 4BDEA 3FI3A 4EJNA 4W9WA 1XHAA 3QD0A 2QG5A 3LFFA 1IA9A 2CKOA 4YLLA 3NIEA 3OZ6A 5CT0A 2JIVA 4WG3A 4FTJA 4KIQA 5I9ZA 3MFUA 5JKGA 4JX7A 3DPKA 2BRMA 2CNUA 2B9FA 4R7IA 1A48A 2W96B 4EOSA 5J9LA 5H2UA 3ZXTA 4BI0A 4JG7A 5CXZA 2VWIA 3RAIA 1O6LA 2BHEA 3NCGA 3Q9XA 1R1WA 1UKHA 3MJ1A 4APPA 3N4TA 3NUAA 1J91A 4N57A 1TQPA 1OIUA 5FTQA 5DGZA 3VRZA 3CY2A 1U5RA 4RZVA 4EHGA 3O0GA 5B2KA 2GMXA 3BEGA 1CKIA 4X2GA 2XNBA 5HGIA 3PP0A 3MA6A 1R0PA 4DFYA 1R39A 4E6AA 5HTIA 3A7JA 4CG8A 3MVMA 1XQZA 4IACA 3T8OA 4ANMA 2Y6OA 5CZHA 4N0SA 4D58A 1PXKA 4FSQA 4EOKA 2CSNA 3U4WA 2YWPA 3MI9A 3MVJA 4EWHA 4CNHA 4FGBA 1UNGA 1V0BA 2W1CA 3CQEA 3RWPA 4PNIA 1YKRA 3AD4A 3EYHA 3BGQA 2OICA 2JLDA 3WF7A 4Z55A 4FIJA 2WQMA 3NLBA 4O1PA 3GI3A 3EZRA 4KD1A 4RLKA 2C47A 3QD4A 4MX9A 3KN6A 5HG7A 3C0GA 3SXSA 2C3LA 5GZ8A 4G31A 4RFMA 3MW1A 4GT4A 3VS0A 5L6OA 1H07A 3ERKA 3BHHA 4EKLA 2ITYA 3T9IA 3TNQB 3ZRLA 4E1ZA 1OI9A 4EBVA 4FL1A 4GYGA 4BRXA 2Z7RA 2VTQA 4QD6A 5ANIA 4NIFA 2GNLA 2IO6A 3JVSA 4YP8A 2W1IA 4FEXA 1TKIA 3DXNA 4RRVA 3VS3A 4FKJA 4MBLA 1XH6A 4RWLA 4PDPA 3M42A 3R8UA 3DLSA 3FSFA 5FDPA 4ERWA 2VTTA 3A99A 2R3JA 2OIBA 5KX8A 1WAKA 4JVGA 4O7TA 5M08A 1VEBA 4NJDA 4NEUA 5EOBA 3VIDA 2EB2A 3H10A 3R7EA 4RZWA 5HD7A 4TTHB 2WEIA 4KKHA 5E1SA 2YIWA 3FZTA 2OXDA 3PPKA 5H8GA 2HZNA 4YTHA 2XNEA 3NUPA 2GPHA 4NW5A 3UYSA 4YTIA 2OZAB 2VNYA 2JDSA 3MH1A 3TJDA 4X2FA 1H1RA 2NRUA 3SOCA 2ITQA 3I81A 3W16A 2Z60A 4AGWA 5ACBC 3BYVA 2IZSA 4EQMA 3A4PA 1QCFA 2XK9A 2X2LA 4OGRA 5IMXA 2X8IA 4G2FA 5I3OA 4KS7A 2P33A 4ZTNA 3TTJA 5KZ0A 2WMQA 4RWJA 4QMMA 5CASA 3D7TB 3GC8A 3DBFA 3EQDA 4FUXA 1H26A 5FBOA 2UW6A 4FK3A 4MNEA 3V5WA 4CMUA 5CXHA 1JWHA 3QQJA 4EZ7A 1YHWA 2O0UA 3RTPA 4UZHA 5EQPA 4HYIA 4XMOA 3CXWA 4EYMA 2J0IA 4L7FA 4XG7A 5CSXA 2BTSA 2IZRA 2ITXA 3EN6A 3BI6A 2GS2A 2JKMA 4DH7A 4BKJA 5HICA 3FE3A 3TN8A 4ZZNA 5EQYA 3GCPA 4MD9E 2PZRA 3D2KA 3RCDA 4DG2E 5LVOA 4AT4A 4EUUA 3ZFMA 1H1WA 1ZOHA 4X21A 2WMAA 2R3GA 2B7AA 1WBWA 3GB2A 2R4BA 3P23A 4FODA 5A4QA 3FC1X 5K9IA 1HOWA 5L3AA 3ATTA 3BHTA 2BAQA 4EK4A 4FSZA 3GCQA 4YZCA 1WBPA 4YZBA 5TF9A 1K2PA 3HMIA 2JKQA 4FTTA 3F2AA 4BL1A 3FAAA 3WI6A 3IOKA 3WBLA 2UZEA 3RAWA 3SAYA 1PYXA 2G01A 2OKRA 4QYFA 3GFEA 4BY9E 2BIYA 2QOKA 4FIFA 3GC9A 2J9MA 4D28A 5M51A 5E4HA 2VAGA 2W1ZA 2FH9A 2WTWA 4JDIA 4RA5A 4QP9A 1NXKA 5TE0A 5J1VA 4BCMA 3TNHA 3EQHA 3ODYX 2HCKA 2WU7A 3ZC6A 5BX0A 3CJGA 3MBLA 1XO2B 2BZHB 5F20A 4BIBA 4G16A 3R2YA 3ZSHA 2XUUA 2BRNA 4DEGA 1FGKA 5ANDA 4DFNA 1FGIA 4FV9A 4G3GA 4UYAA 4BB4A 3LCOA 5FRIA 3MTFA 3KRLA 4X2KA 4B4LA 1GNGA 3Q52A 2GU8A 2R0IA 2W05A 3R9OA 3TZMA 5CEPA 5M53A 3AG9A 4H05A 4TRLA 3U9NA 3VW8A 1XJDA 5GJGA 1GIHA 2HY81 3A60A 3P86A 4C61A 4XRLA 3A7FA 3DV3A 3EWHA 4IX4A 5FQDC 4YZMA 4EHZA 2PULA 3PSCA 1GJOA 4L3LA 2XJ1A 5CNOA 3QGWA 4AUAA 3CQWA 5KMIA 3NWWA 4YBKA 5L8JA 3UQGA 1QPDA 4DCAA 3S0OA 2ITPA 5CYIA 2XCHA 3FC2A 5H8BA 1W82A 5GINE 3COIA 5DFPA 5ITAA 3TV4A 3VN9A 3HX4A 4O0UA 3GUBA 2R0UA 2JIIA 2ZM4A 3IDCA 3GXLA 4GK2A 3DBCA 3OEZA 4L3PA 5IA0A 5C9CA 4FZ7A 5ETAA 2GQGA 3FBVA 3NCZA 5HE0A 4ACMA 3QRIA 1XWSA 3RPVA 3MS9A 4A9SA 2W4OA 2X2MA 4R1VA 3LIJA 4GCJA 3IW6A 1YI3A 3RK5A 5KMMA 1DAWA 3QLGA 3UIMA 4ANSA 4GT5A 5JFVA 2F4JA 5A4CA 4QYHA 4ZMEA 2JAVA 2Y8OA 4QMZA 4M84A 4U6RA 3ITZA 5M06A 3M11A 4BTKA 3EHAA 1YXUA 5JH6A 4RX7A 4FGRA 5AV2A 4CKIA 5A46A 4JX3A 1XBBA 4RPVA 4CD0A 2WO6A 2VWBA 2ZDUA 2YM5A 3DQXA 1PW2A 2RIOA 2PWLA 4DFLA 3EIDA 3NPCA 4CLIA 1J7LA 3FQSA 4FTOA 4LL0A 5E8ZA 4UWYA 1OUKA 4G5PA 3SLSA 3ZFXA 4D2WA 2VTRA 3PTGA 2Y4IC 4FOBA 3THBA 2XEZA 3CQUA 4LRKA 3WZDA 3GU8A 4GG5A 3TDVA 4BGGA 4GFGA 4LV5A 3QL8A 4RX5A 4FSYA 3OWPA 4RBLA 3ETAA 3Q9ZA 4C4GA 5FUTA 3C13A 3PVWA 3H0ZA 4WHZA 4ZK5A 5E8XA 3KVXA 3UODA 3LJ1A 3E8NA 4D2PA 3R8PA 5KMJA 5FM2A 5HNIX 4OTGA 3QUEA 3VUHA 3UE4A 3MY1A 3VUIA 3P79A 4S2ZA 5CAVA 4JAJA 3FMJA 2WTIA 3PXQA 4NCTA 5KCVA 4UMUA 3ZDIA 1WBVA 1J1CA 2V0DA 4AZFA 3WYYA 3F66A 4QPAA 4WT6A 5HVKA 3W55A 3EN7A 4E4MA 3COKA 5HKMA 5DIAA 3T3VA 1RDQE 4BDHA 4J7BA 3H0YA 4BDGA 2J7TA 2R3KA 5D12A 2VX3A 1STCE 4M0YA 1OKZA 2DQ7X 4ZSLA 2JDOA 4ZXTA 1M52A 4XG2A 3WZEA 4ASEA 1PXIA 2WTKB 1YXSA 3CBLA 1ZZ2A 3LCDA 3QC4A 1ZY4A 4K6ZA 2NP8A 5DRDA 2UW5A 3HP2A 4XLIA 2XKFA 3SW4A 5HLWA 5BQ0A 1OBGA 4OTRA 4PPCA 5HEZA 1JKSA 3B2TA 5AFVA 4I0SA 3RK7A 3CR0A 4XP2A 3GC0A 2E9PA 3MY5A 1OITA 2OF4A 4PRJA 2RSVA 3NNXA 4AACA 3ZRKA 4D9UA 2ITOA 3DGKA 4IAIA 4YJVA 3PVGA 5J9YA 4IVBA 1DM2A 3G9NA 3N9XA 4XOYA 3QQHA 4C35A 5EKNA 3QCXA 4PL3A 3O8PA 5CEMA 2BFXA 2YITA 3QXPA 2EVAA 2YIYA 3HMMA 3O51A 4RG0A 5LCJA 4GUEA 5CSVA 2WTVA 2JITA 2DYLA 3RZFA 3C4ZA 2VO7A 4MEDA 4FZDB 4ID7A 4Q9ZA 2QKRA 2YDJA 3Q60A 3MH0A 4GIIA 4ACDA 3KXNA 3SDJA 4ENYA 4U41A 4GK4A 3PJCA 2OH0E 5ETCA 1O9UA 4G9RA 5L2TA 1ATPE 3RGFA 3U6HA 1FVVA 3JY9A 3MN3A 3GCSA 4ZP5A 1BKXA 4TN6A 4N6YA 4AOIA 3GFWA 4RIWA 3HGKA 2H34A 1PXJA 2BUJA 3E63A 4FYNA 3UJGA 3F3UA 4A07A 3BLHA 1GAGA 4A4XA 1YOJA 2XKEA 2BR1A 5AR2A 5FBNC 3TIZA 4BZOA 2I7QA 1U54A 2WIPA 1Q61A 3QZFA 3UO5A 4GL9A 4J8NA 3UC3A 3BIZA 1JSVA 3Q5IA 5G6VA 3CD8A 2PVJA 5IPJA 1Z9XA 4G6LA 4DBXA 2WPAA 3SRVA 5AUZA 5FP6A 3ZO2A 5HE2A 3TKUA 3FZRA 3MH2A 4FG7A 5HIEA 4K18A 3KCKA 2J5FA 4GJ3A 4O1OA 4TWCA 3SW7A 2NO3A 3ZH8A 2PPQA 1ZLTA 2YEXA 3BHVA 3UMXA 4IADA 3U54A 5DR2A 3SGCA 1LUFA 4QMYA 5CY3A 1W7HA 2XIRA 2J0LA 2VGOA 5L6WL 4H36A 5IH6A 3QZHA 1XR1A 1UWHA 3LM0A 4G3CA 3V01A 2UZUE 1FMOE 3VF9A 1CTPE 2C5OA 4NKSA 4QTCA 1FBNA 5C8KA 4EK3A 4WA9A 1SVHA 3AD6A 3BRBA 4RJ5A 3QX2A 5KKRB 4WRGA 4U8ZA 2VD5A 2X4FA 3C4WA 1M17A 1GY3A 3ZZEA 3TCPA 3VBVA 1VJYA 4EOQA 3IW8A 3LW0A 1TQMA 5A54A 4PX6A 5KO1A 2XK8A 2QR7A 3PA4A 2V22A 3UG2A 1YXXA 5ANOA 1VR2A 4QNAA 4HW7A 2OU7A 2EXCX 5CEKA 3ANRA 3FSKA 4AW0A 3C5IA 2CCIA 3F3TA 4XYFA 4OTFA 2XK7A 4C2VA 4C4HA 5L2SA 2VUWA 3KN5A 4H3PA 4RIXA 5EYDA 3AOXA 4JR7A 4QMWA 4CZUA 4WNKA 4RVLA 4EH5A 1OZ1A 3HVCA 5I9UA 2UZNA 1U54B 1Q99A 4FKTA 3NAXA 5L2QA 4CFXA 4LL5A 2UW4A 2IJMA 4HNIA 3JY0A 3TEIA 1M7NA 3NYNA 4P5ZA 5ETFA 4G3FA 4FTNA 4X3FA 3JUHA 5HCYA 3UP2A 5DT3A 3GT8A 4RIOA 2XVDA 1SNUA 4M97A 3ZEPA 3L9LA 3SRVB 2JGZA 4QMXA 3TTIA 4ASZA 4BDIA 4BTFA 3PVBA 2ZJWA 3CIKA 3QALE 4NK9A 2X81A 4JDJA 4ZSGA 3P1AA 2ZV8A 4O7ZA 4F7NA 3LQ5A 4RQVA 2W5AA 2IZTA 5EHOA 2VX0A 1LP4A 1BL7A 2VGPA 2OGVA 2W0JA 2B54A 4TNBA 4F08A 3NVMB 3BHUA 3BYMA 3RI1A 2C6OA 2WTCA 4DG3E 4DLJA 5E7RA 2OIQA 1B6CB 2PVFA 4Y83A 2B9IA 2VWXA 4FV7A 5L2WA 2PK9A 2PVKA 2GSFA 3HKOA 4MYGA 4TL0A 2BAKA 1OL1A 4Y73A 2HOGA 4C58A 4ZLOA 4HPUE 1R78A 3R1QA 1J1BA 5AIKA 4ZJJA 4F6SA 2PVLA 5I5ZA 3FJQE 4D2VA 1M7QA 4PL5A 5HNBA 4DYMA 5LWMA 3OF0A 4NM0A 3Q2JA 3OW3A 5AA9A 5D7VA 2BZKB 2P4IA 2QONA 2PU8A 5AIRA 2WAJA 4I21A 2R3FA 5DN3A 4TY1A 4RVTA 3ZUTA 4X2NA 4L45A 3CEKA 4C4FA 4WKQA 3NNUA 5AR5A 4IFCA 2FSMX 4S32A 2RFEA 4P4CA 4QQCA 4I93A 2QOHA 3A7GA 3D5VA 3D9VA 4FIEA 4ZTMA 2YN8A 2PZYA 2CJMA 3ZBFA 4PTEA 4FKPA 3P4KA 4II5A 3OOMA 3NMUF 3BU5A 3EFLA 1YW2A 2CN8A 3F61A 2GS7A 3NUYA 5H8EA 4DH1A 4Y95A 5CANA 3WIKA 2I6LA 1IAJA 2C3KA 4FOCA 3PFQA 4PMMA 4QPSA 3L1SA 5C8MA 3PWYA 1YWNA 3GCVA 4EOIA 4IDVA 2W1FA 5EM8A 3EOCA 2H96A 4AU8A 3FY2A 1JQHA 2X2KA 2HYYA 4KIOA 4ALWA 1JAMA 3TIYA 2VWUA 1IA8A 1YXTA 1GIIA 3DFAA 4JAIA 3TKHA 4CFVA 3FKNA 4IVDA 4GFMA 4RIYA 4XBRA 4DEHA 5J95A 4LUEA 5IQBA 2VN9A 3K3JA 4V04A 4GRBA 3WE4A 4FIHA 1QPCA 4IM0A 2QR8A 2OXYA 2BROA 3UTOA 4EH7A 4JG6A 5HIDA 4QP2A 3OOGA 4O27B 5EHYA 2QU5A 3R00A 3ZDUA 2F7XE 2WZJA 4YJUA 3NYXA 3IG7A 3IW5A 3R9RA 3OVVA 4F4PA 3PJ8A 5DHJA 2PVNA 3OCTA 4XG8A 1IEPA 2BRGA 3KK8A 3LMIA 1JPAA 1H1PA 3KQ7A 3PJ2A 4R1YA 5I4NA 3QYWA 4E93A 4I41A 4ZSJA 5AUWA 5LMKC 3MB6A 4BIDA 4UMRA 4FYOA 3C0HA 3LQ8A 3UVPA 4RJ6A 2C0TA 4J96A 1OPJA 2O64A 4AW5A 1OKVA 4R7HA 3VS1A 3UQFA 4M13A 3LAUA 4FVQA 3PSBA 3CJFA 1KE9A 2WOUA 2IPXA 3H3CA 4EOMA 3QD3A 4ONAA 4FI1A 2OJIA 4O86A 4ITHA 5AP5A 1PY5A 5TR6A 1JVPP 4OT6A 2UVXA 2V7OA 3EN9A 4NFNA 4H3BA 3CY3A 2EB3A 2PUPA 2WNTA 2VTNA 4PTCA 4WD5A 4O7VA 1H24A 3Q9YA 3AC1A 5M4UA 4ORKA 1KE6A 4NYEA 3OP5A 5AUTA 2BCJA 3R04A 5IEVA 2B1PA 4YHJA 3TKIA 4BC6A 3PZHA 4MCVA 2W99B 4MK0A 4DEDA 4OLIA 4ZEGA 4CYJA 5JZNA 3C4EA 4K77A 2B52A 2QKWB 4ANNA 4C62A 4WIHA 1U4DA 3RINA 5C26A 5JT2A 4HNFA 3ROCA 3ORLA 4XG4A 2C6KA 5D7AA 4J8MA 2QOCA 4CZYB 4QTAA 3LFSA 3LMGA 4CXAA 4U97A 4DGGA 2OG8A 1OMWA 3A7HA 2B4SB 3OEFX 4JBOA 2WQNA 5GJFA 3VNTA 1K9AA 1F5QA 4HZSA 3VQHA 3F2RA 4EQCA 5M4CA 3HL7A 2YZLA 4ZS4A 4JR3A 2QLUA 2J90A 2ZMDA 4PNKA 4C57A 4GH2A 4ZZMA 2FB8A 4F9WA 4L53A 3ORMA 2PTKA 3BQRA 3R7VA 5DOSA 3L9MA 4NTTA 5IQGA 2J0KA 3VW6A 3E87A 3QRTA 4FV8A 3RALA 1KSWA 5HVYA 4BR3A 2P2IA 4ANOA 3E93A 2XF0A 1K3AA 1Y6AA 3VS6A 3CTJA 3PYYA 3R1SA 4PF4A 5AV1A 4OAUC 3DAEA 3HV3A 3MVLA 4DH3A 4HCUA 2CNVA 3O17A 1Q3DA 5FEDA 4YPDA 1YI6A 4E4XA 3TZ8A 3CD3A 3ELJA 3LFCA 3NUNA 4BDAA 5BVFA 2CCHA 4YNOA 3FMLA 2Y4IB 1WBOA 1REJA 1ZMVA 1NVSA 2A1AB 4QP6A 5M4IA 3ZSIA 4HGSA 5CENA 4RJ3A 3LCSA 5CS6A 5AX3A 3VBYA 4UMPA 4RJ4A 2EWAA 2WB8A 4B0GA 4B99A 4FMQA 3GU5A 4RIWB 5M55A 4DBNA 1V1KA 2BZIB 2GTNA 2ZB1A 4NTSA 5AJQA 4Z9LA 5LARA 3ORNA 3S2PA 3V04A 4EC8A 5CF5A 1PXLA 2WMVA 3V3VA 2XIXA 3DXPA 5AWMA 4C3RA 5LMBA 4G17A 4X2JA 4YURA 4GW8A 3VJNA 4KBCA 2PE1A 5CSPA 4J1RA 2HZ4A 2XIYA 3FYKX 4FTRA 4AT5A 4HPTE 3BHYA 4MXCA 2P55A 3CKWA 3LFNA 4DTKA 1BYGA 2DUVA 4QMUA 3C7QA 3VWAA 4D5HA 2WU6A 3KXZA 3U9CA 4EBWA 4J98A 3EMGA 1Q41A 4CFUA 4LQMA 3VS7A 1BLXA 3R8VA 3KC3A 3NUXA 1ZYCA 2OO8X 3V8TA 3QTXA 5GJDA 2VTAA 1MUOA 3TUBA 4PPBA 2RFDA 4NJ3A 4GJ2A 4QPMA 4I5PA 2YLEA 4MXYA 5F9EA 4EQUA 3I1AA 3QQLA 2C6LA 2R64A 3A2CA 4PY1A 4MBIA 3W2PA 5D41A 5IH4A 5KNJA 4HVGA 3GP0A 1OBDA 1WBSA 2R3IA 4BWPA 3QYZA 5JRSA 1Z5MA 4DTAA 1W8CA 3E92A 4HCVA 4HGEA 4WRSA 2Y4PA 3R1NA 4FKSA 2BRBA 4UMQA 3UVQA 4F09A 4FA2A 3UVRA 1Q3WA 2HELA 3LJ2A 5E8SA 1VYWA 4FK6A 4AA5A 4D4VA 1IG1A 3DKCA 3PXRA 3PG1A 3IKAA 4F9AA 1PMVA 3OWKA 3LFAA 3DAJA 1NA7A 2O63A 3KMUA 1Y57A 2Z7SA 3DK3A 4G34A 4X3JA 2A2AA 4IAYA 4FIIA 4DFZE 2IVVA 4QMTA 2J50A 5J1WA 3L9PA 5IKWA 4O7RA 1ZAOA 4CZTA 3HMPA 3OWJA 4HOKA 1FINA 3BPRA 3BWJA 3M1SA 3OT8A 2J0JA 3E8CA 3HV4A 4FV3A 4S30A 3GOPA 2WMTA 3QWKA 4A7CA 4AOJA 3VF8A 1E1VA 5KHXA 4DFBA 4BDBA 1UV5A 4FT7A 4APCA 3LLAA 3DK7A 1Q5KA 4C4JA 4FNWA 4YR8A 5LWNA 5JGDA 3ULZA 3OD6X 4QTEA 2PHKA 1UWJA 3O23A 3I7BA 4GT3A 4YO6A 2CN5A 5BVDA 4CVAA 4LI5A 4C3FA 4BCHA 5IA2A 4JIKA 4W4VA 4EHEA 2PZ5A 4OTHA 4WSYA 3UQCA 4BHZA 5E8UA 2E9VA 4IQ6A 4NIFB 2OSCA 4DEEA 2C3IB 2YCSA 5CSHA 3TJCA 3ZM9A 2IZUA 5I3RA 3MB7A 1GOLA 3DNDA 2O5KA 5EFQA 1Q8WA 3R30A 2BMCA 3RBWA 4EH2A 1LPUA 1EH4A 3QTSA 5IH5A 3WE8A 3DNEA 4J71A 3B2WA 3U55A 4XV3A 3NS9A 5CVGA 4DHFA 1OL6A 4GVAA 3RHKA 4L8MA 4N6ZA 4IC7A 5AP3A 1QPJA 4GKIA 2YM8A 1CM8A 1WBTA 3B8QA 4X0MA 3P0MA 4DT8A 1BUHA 4CFFA 4B8MA 4DEIA 5F94A 2ITWA 5B7VA 4JRVA 4ZAUA 2PVHA 4BBFA 2CKEA 2IVUA 3VHEA 5HE1A 3HLLA 1YVJA 3QWJA 3N51A 4MF1A 5H3QA 5KZIA 5TOZA 4CGAA 4ZTSA 2WQOA 2CKPA 4PMPA 4TWNA 4V0GB 4QP4A 4QP8A 2WQBA 2YJSA 5B0XA 4LRJA 4XLVA 5CX9A 4ZLYA 2GNFA 3VBQA 3KF7A 5FLFA 4IZYA 3R1YA 4UV0A 3KRWA 3UO4A 5J87A 3SG9A 3PIZA 1Q97A 1H01A 5CTPA 2R3RA 3PSDA 3HMNA 5FWKK 1YRPA 4MNEB 5IA5A 5A14A 3U6JA 2PL0A 4FSTA 3CGOA 4TYEA 3RCJA 5A6OA 5BVWA 1OM1A 3Q4ZA 4ANBA 5IISA 3LM5A 5AP6A 4D0XA 3PLAE 2C3JA 5DR9A 5TO8A 2OLCA 4RMZA 5DH3A 2ITNA 4M12A 1F0QA 5KUPA 3O7LD 4O2ZA 1W98A 4F0FA 3KGAA 3VUDA 4MKCA 4UX9A 2XMYA 2CPKE 3HDNA 4CEGA 4DN5A 4UALA 3V5QA 3FV8A 4B8LA 3G9LX 3PE2A 3HA8A 3Q4UA 3BEAA 3ROYA 4JBQA 4TYGA 3RVGA 4RX8A 1PMNA 3OXIA 3O2MA 4EH4A 3NX8A 2JFMA 4FNYA 4ENXA 1E9HA 2FA2A 3SOAA 5KBQA 2ETRA 5A4EA 2ZM1A 3HRFA 4EHVA 4QMPA 4FZAB 4YJNA 5HLNA 4Y5HA 4IB1A 5E91A 3RAHA 1PXNA 2XRWA 1GZOA 1Q8TA 3D7ZA 4CCBA 4DGOA 5AV3A 4BZNA 4U45A 5HO6A 2B9HA 4AE6A 3CPBA 3UOJA 4BZDA 4MQ2A 2W4KA 4CSVA 3FMNA 3K54A 4CKJA 3PVUA 2Y0AA 4LRMA 4N70A 2CGUA 4OUCA 3R8MA 4JQEA 5KKRC 4AN9A 3DBQA 4LOQA 5AP2A 5HI2A 5IQEA 2HZIA 3I79A 5D1JA 5AAGA 2WTKC 3EN5A 3OCSA 3ORZA 4IWOA 1KOAA 3EJ1A 3ZLYA 3MIYA 1GZKA 5I9VA 5A6NA 4MQ1A 4O81A 3LFEA 2C0OA 3ZLWA 3OUKA 4EH3A 2EXEA 5CU3A 2JIUA 1LEWA 4AZSA 4EL9A 3Q3BA 2QOIA 3GENA 4D5KA 3W2SA 2FYSA 4JL9A 4AW1A 1J3HA 4E3CA 1ERKA 1T45A 5HCXA 3REPA 3QF9A 4QTBA 4A9YA 2X6DA 3Q4CA 2R3HA 2YCQA 4QT1A 3DAKA 3EFJA 1Q8ZA 1GZ8A 3CTQA 4M7IA 4TNDA 2XYNA 5ANKA 3V8SA 3TI1A 1J7IA 4ZLZA 2YDIA 5IA3A 4FV6A 3FLYA 4DEAA 4EZ3A 5L2IA 3RPSA 2H9VA 5HBHA 4L3JA 2ERZE 3QZGA 4PDSA 3HEGA 4FIGA 4NWMA 5F4NA 3L8PA 4O7NA 3MY0A 2IG7A 2C6EA 5KMLA
chains in the Genus database with same CATH superfamily
3PXYA 5HE3A 4BCQA 2G9XA 2X8EA 3E7OA 2XNGA 3HRBA 3K2LA 2R7IA 4H3QA 4O7SA 4BCFA 3ZOSA 3NUUA 4JQ8A 4IFGA 4FEWA 3CCNA 3PPJA 3R63A 4GK3A 3EL7A 1PKGA 4HJOA 4MXXA 4O4EA 5IUIA 4ZJIA 3BU3A 4ZY4A 4QDVA 3TM0A 2HAKA 3W2QA 4EC9A 5HU3A 2PSQA 4RFZA 4RFYA 4F7SA 3DZOA 3ZUUA 3R02A 4GS6A 4U42A 3F7ZA 5JK3A 3KMWA 2ACXA 3KIOC 4YJQA 4Q5HA 4AZTA 4OAVB 2E9UA 4O0VA 3GU7A 3RWQA 3BWFA 4RX9A 2XA4A 3DDQA 2V62A 2PMNX 4NZWB 2HY0A 5IQFA 4FVRA 4BHNA 2IW9A 3JPVA 4KB8A 5CSWA 3FDNA 4IIRA 5HO7A 3OMVA 5JGAA 4I1ZA 4ASXA 1G8SA 3CS9A 3KXMA 4DFUA 1XBAA 4IAFA 3QCQA 5IG1A 3D5WA 2NNWB 4IB5A 4M0ZA 2GTMA 2Q83A 2AC3A 5C8NA 4E5BA 1PYEA 4BI2A 3F69A 4LGGA 4OTDA 4IVAA 3KEXA 5KHWA 2CGWA 1IAHA 3ZC5A 4R5SA 5DBXA 1S9JA 3WYXA 3PPZA 4O0WA 2YISA 4JLCA 1WVXA 2VTSA 4FV2A 3KULA 3OW4A 3R7IA 3EQRA 4OTWA 4YHFA 3ZHPC 3E5AA 3RAKA 5IA4A 3P08A 3O71A 4C4IA 1OIYA 3R0TA 1PF8A 2QHNA 4NU1A 3F6XA 1J7UA 1JOWB 2Z02A 3NR9A 3PY1A 2WHBA 2GHGA 5HOAA 2W5BA 4IANA 3V5PA 4L42A 4XG6A 1G3NA 2UW9A 4P2KA 2E9OA 1IASA 2WTJA 3KL8A 4BGHA 1H08A 4BN1A 2QVSE 2OFVA 4KIKB 1QMZA 3DDPA 1VZOA 1MP8A 1H28A 3IDPA 4JNWA 5CU4A 4XG3A 4EYJA 4AZWA 3LJ0A 4MHAA 3VS2A 4CRSA 4BBEA 2JDVA 3PRFA 4JBPA 4L52A 3FI4A 4CV8A 3LXLA 3FLSA 4F1TA 5BUIA 2YERA 3R71A 3WILA 2GHLA 4ANQA 3EFWA 4PWNA 4W4YA 2YM3A 4AWIA 4A4LA 4MBJA 1M14A 3NVKI 2DS1A 4I94A 1UVRA 3FUPA 2BILB 4XH6A 2YIXA 4PV0A 4Y8DA 2X0QA 2VTJA 3TNIA 1B39A 3IECA 5AUYA 4USDA 4BIEA 4LMNA 4KUJA 5J7HA 3FI2A 4BCJA 2WKMA 2UW0A 3I0OA 5GHVA 2YZAA 3CP9A 1ZZLA 4PP9A 3RP9A 4TZRA 4XOZA 3F9NA 4EEVA 4EKKA 5KE0A 5M56A 1V0PA 4K8AA 3FZPA 4FTLA 3SX9A 4XCUA 3BQCA 4UY9A 3DA6A 3O8UA 2OW3A 2VTMA 3GC7A 3O5AA 2Y9QA 3QAME 4LM5A 2VU3A 4BF2A 3VONA 3ORKA 4G9CA 3D15A 1BI7A 4TWPA 2GDOA 3ACKA 3KKVA 5LVNA 4IWQA 2OFUA 4CT1A 3HNGA 4JJRA 2YM4A 3WARA 1RE8A 3TV7A 4IAZA 4DC2A 3EL8A 3ZO3A 5K0XA 3RPOA 4YJSA 3VS4A 3QCSA 3HAVA 4L46A 5HESA 4UWCA 4TYHB 3KFAA 3NW7A 4YZDA 4I6HA 1Y6BA 4E73A 4X3FC 4D1XA 3QD2B 5C1QB 3DY7A 4Z7HA 3OBJA 2GCDA 1ZARA 3LZBA 1NW1A 3JXWA 3NIZA 5DRBA 4B9DA 5IUGA 3D4QA 4JT3A 4I5HA 2QI8A 4I24A 4LOOA 1YDTE 4XP3A 3UOLA 3ZO1A 1GZNA 2C6TA 2I0VA 3DKGA 2WXVA 2YABA 3W8LA 2F57A 4RLLA 5AP4A 4FKVA 2ESMA 2C69A 4DA5A 5A4LA 2YM6A 2ZVAA 4UEUA 5AP1A 3TNPC 3EFKA 5HD4A 4JOAA 2ITZA 2R3LA 4H39A 4QMSA 3PUPA 1V0OA 4F99A 3RNYA 2BRHA 4F78A 2J5EA 4QQ5A 5EYKA 4IZAA 3VVHA 3FPQA 3R2BA 5DT4A 4BBMA 5M57A 5E8TA 2UV2A 2YHVA 2VTHA 3SXRA 1GIJA 3QKKA 4R5YA 3DKFA 3QUDA 4IB3A 4EOLA 2XIKA 4QMOA 5T6KA 5BUJA 1APME 2P2HA 4IX3A 5CVFA 4BJJA 2B9JA 2WFYA 4UXQA 2E2BA 4YZ9A 5K4JA 5LMKA 3AMYA 3CLYA 3C4FA 1PXMA 5T3QA 3GBZA 5EM6A 5GNKA 2WMXA 2C6DA 4UZDA 5BVNA 5KMKA 2IF8A 2UZVA 2GQSA 4IC8A 1ZOGA 4FSMA 3AXWA 3UIBA 2RG5A 4FX3A 4AGCA 3MFSA 2X39A 3OXZA 2W06A 4EK8A 1P2AA 5HBJA 5FTOA 5H9BA 3ZUVA 3W8QA 4IM3A 4UBAA 4PDOA 3CTHA 3EQGA 3EYGA 5L4QA 3I6WA 4KINA 3SKCA 4E8AA 2ZV2A 5ICPA 4BCIA 4IX6A 4L67A 4S34A 4E26A 4ZSAA 1ZYJA 5EW9A 3V51A 4EH8A 4XUFA 3IO7A 3K3IA 1TZDA 2XK6A 1W83A 4NSTA 3AGMA 4J97A 4RGJA 4DGLC 4HYUA 2AEGA 2C6MA 4U0IA 1H0WA 3VC4A 2BFYA 5J9ZA 4BDKA 4GSBA 3ZU7A 5JRQA 5AUUA 3NUSA 2BKKA 2XJ0A 3ZYAA 3FQEA 5EYMA 3BGPA 4PTGA 5L8KA 3COMA 4QOXA 3DT1A 3C50A 3G90X 3JVRA 4M14A 4O4DA 2QODA 5AUXA 3VUGA 1ZY5A 3BV3A 4EOJA 3KMMA 4LFIA 1YWVA 3OT3A 5D11A 1B38A 3QTIA 3ORPA 4A06A 2O65A 3Q6WA 3FZSA 5K3YA 4TW9A 4F1OA 1G8AA 4FTMA 3FHIA 4L43A 3POZA 4O83A 3G51A 3R22A 4FV0A 4JRNA 2QURA 3P5KA 1Q62A 3DQWA 4XHKB 5E1EA 2C6IA 4KBAA 5BVEA 3RPYA 4RJ8A 3G6HA 4IJPA 4E6QA 3DJ6A 4QNYA 3FXZA 5J7BA 1KWPA 2YLFA 4FTUA 2GFSA 2X6EA 4W4WA 2JC6A 4BKZA 3D14A 3KCFA 3BL9A 3ET7A 4O4CA 4DHIB 2W17A 4ITJA 5HORA 1X8BA 2PMIA 4I0RA 5EDQA 4CFMA 3EKNA 4UWBA 4ZSEA 5JEBA 2R3NA 4QMLA 4I6QA 5J5SA 3DFCB 1YI4A 4ZMFA 3CC6A 2PE0A 4Y85A 3EN4A 5JQ5A 2BPMA 3GU6A 4FG9A 3UOKA 3I7CA 4YO4A 2QU6A 1R3CA 2F49A 4I4EA 4CYIA 5IQDA 2JBOA 3AD5A 4L68A 4OR5A 2C5NA 1ZOEA 1PXOA 2W1DA 2YFXA 4IE9A 3FY0A 3MYGA 4OBOA 4XV1A 5DNRA 4BCPA 4G6NA 5AP0A 3DU8A 1JBPE 1YQJA 2CMWA 1Q8UA 3U8WA 2HW7A 3HV7A 3QQKA 3N4UA 5E92A 3W2OA 3P78A 1OIQA 2RFNA 3QA0A 5KMOA 2BHHA 2JKKA 2XKDA 4O6EA 4RWIA 4NCTC 4F65A 3FLQA 2OH4A 3V6SA 4FKUA 1H00A 3KRRA 2VNWA 4YJOA 5C27A 5J79A 2W9FB 3C4CA 3KVWA 2UZBA 4V05A 4BDCA 3FZOA 4L44A 3I0QA 4W8EA 3UG1A 5AADA 3NYVA 3NEWA 4RIYB 3UNJA 4A9TA 2QC6A 1WFCA 3QKLA 1CDKA 1OGUA 1PHKA 3G33A 4DLIA 4G3DA 5ETIA 1UA2A 4XRJA 4YC6A 2A0CX 5I0BA 2PE2A 3NNWA 3QHRA 4RWKA 2HXLA 3D7TA 5BUEA 2UVYA 5AR3A 4ACHA 5LQFA 4N4SA 3PP1A 3ZS5A 3P7CA 2I0YA 2DWBA 5BPYA 2XM8A 3H9OA 4AS0A 3V5JA 4CG9A 4GEOA 1TQIA 2AQXA 2BIKB 1DS5A 2QLQA 4FKIA 1T46A 3G5DA 1OKWA 2VO6A 3BYUA 3MGYA 4C37A 4AQCA 3UDTA 2QOLA 3L9NA 3DLZA 3ZRMA 3MIAA 1Z57A 4EJ7A 5BVOA 3ORIA 3WZJA 2R2PA 5B2MA 3K5UA 4V01A 3FKOA 3QGYA 4F6UA 3IQ7A 5IUHA 3II5A 5DEWA 4U7ZA 3ORTA 5B2LA 5FG8A 3K5VA 1OL5A 2OJ9A 2F7ZE 2PVRA 4OBQA 3PG3A 3R9DA 2UZWE 2VTOA 4U3YA 1OPKA 4DFXE 4YHTA 2AC5A 3FQHA 3W33A 2C5YA 2OF2A 2R9SA 4PQNA 4C2WA 2Y6MA 4BCKA 2PZPA 4F7JA 4AZVA 1XBCA 1YHVA 2OZOA 3AT2A 3U6IA 3DZQA 1BI8A 1AQ1A 3A8WA 4W8DA 2VX1A 3ENHA 2CNQA 2BAJA 3KRXA 4WG4A 5I9XA 3F7WA 1SM2A 2HWOA 1YDRE 3VUMA 3OUNB 2ZAZA 5ANEA 1F3MC 1TFFA 5BNJA 5EG3A 5AM6A 4OTIA 4OW8A 4JMQA 3R01A 3B8RA 4GU6A 3WOWA 4AOTA 4DF3A 3SV0A 4MH7A 4TPTA 4M3QA 3T3UA 2VRXA 3KXXA 4CV9A 1SVGA 1SMHA 2J6MA 3KXGA 3TXOA 2QOQA 4F0GA 4J53A 3KREA 4FJVA 3H9FA 1OIRA 3F5GA 3PY3A 2YIQA 5DA3A 2C4GA 2WMRA 1HCLA 4QP7A 3AMAA 1REKA 3VBWA 1NVQA 4J95A 1YHSA 2QO7A 5FEEA 1H1QA 5E90A 5EKOA 4TYJA 4MXZA 4AE9A 2IW6A 5FXQA 4F6WA 4E6CA 5EQEA 4BCNA 4HCTA 2XK4A 5HNGA 4C4EA 4IXPA 5JSMA 2ZDTA 4WBOA 1YXVA 2VO3A 4YJTA 3QTZA 5HZNA 4ACCA 4FSNA 3D83A 3PWDA 2J0MB 2CGXA 1M2QA 4NFMA 5DWRA 5HTBA 4TT7A 2J2IB 3HRCA 3BKBA 4C33A 4O0XA 3ZSGA 3H4JA 3V6RA 4C0TA 3PJ3A 2GQRA 2XRUA 2O3PA 2VTIA 4YZNA 5AV0A 2YAAA 4CQEA 2F2UA 1WVWA 3ZZWA 3R21A 4QRCA 3EKKA 4MXOA 1I44A 4FT9A 5AR7A 1Y8YA 4F9BA 2J51A 5CZIA 4M69A 2QNJA 4AP7A 2FUMA 4GIHA 3OY3A 4YLJA 3PXKA 3KK9A 5CQUA 5AAFA 2R3MA 5T68A 2XNNA 5J8IA 4HVHA 3GCUA 1OB3A 2I0EA 3QUPA 3MH3A 5HX6A 1Q24A 2WOTA 3IGGA 4R3RA 3TUCA 1ZRZA 3MESA 5K0KA 4XG9A 4H1MA 2VZ6A 3A62A 5M07A 4WBBB 4AXEA 2JDTA 3DJ7A 3FYJX 3VO3A 4D1ZA 4FTKA 5CF4A 3UZTA 1OKYA 4X6QC 4ERKA 3UMWA 4B6LA 4X6RA 3SD0A 4AA4A 5EI6A 3KU2A 1H27A 5FEQA 5LXMA 3G2FA 4DTBA 4IVCA 4XP0A 3F3WA 2ITTA 2QOBA 3F3ZA 3Q4TA 2B55A 4DH5A 3QZIA 3ZM4A 2PZIA 4TKSA 4IWDA 2QO9A 4U80A 1ZXEA 4WO5A 4O0YA 5KMNA 3FKLA 4ASDA 4E4NA 4IZ7A 3MFTA 3AMBA 5E8YA 5CU0A 4MD7E 3TUDA 3QHWA 5DG5A 3R7YA 2XANA 1WZYA 2VO0A 4AZEA 4AGDA 5LVPA 4AFJA 5HBEA 3UZRA 3FXXA 4MD8E 1RW8A 4I0TA 3NZ0A 4IX5A 4FTAA 3P7BA 5EM5A 2X9FA 4FTIA 4RJ7A 4U3ZA 3RJCA 2UUEA 1DI9A 2ZYBA 3UC4A 4P5QA 5DR6A 1WMKA 3GGFA 2PMOX 4YUQA 3FEGA 2GFCA 5CT7A 4BYIA 2G2IA 4QYYA 4FE2A 4YNEA 4FR4A 3NW5A 4ARKA 2CDZA 3HYHA 4FG8A 4CTCA 5A4TA 3P5JC 4O91A 5EOLA 5HLPA 1O6YA 3EQCA 4M69B 4FKRA 1YWRA 3VUTA 5GZAA 4USEA 3NRMA 1M2RA 4FTQA 5HIBA 2C1BA 4YSJA 4O82A 3DTWA 3IOPA 3PY0A 2W1HA 4D55A 4B7TA 2XBJA 3PE1A 5CU6A 3TZ7A 1CKJA 3BLQA 3Q53A 2ETKA 4QQJA 1BL6A 2YJRA 3MVHA 1JKTA 4KS8A 5HTCA 3R8LA 4AN3A 5DVRA 5EI8A 3G6GA 1YOLA 4M15A 4EOPA 2QOFA 5F95A 4EH6A 2G2HA 4U43A 3QX4A 5DE2A 2FSOX 1H25A 5AEPA 3T9TA 4IBMA 4BDDA 3IW7A 5BVKA 3I5NA 2SRCA 3OTUA 3VBXA 4D4YA 1PRYA 2QCSA 3FMDA 4F64A 5FD2A 5CEIA 2JD5A 2X1NA 3DKOA 3IS5A 3ZXZA 3CPCA 3SC1A 2C30A 4E4LA 4A9RA 3PXFA 3MPMA 4LGHA 4I5MA 4BKYA 4EUTA 3H30A 3R7OA 3QCYA 4NM5A 4LUDA 2CLXA 5HG8A 4C7TA 4IH8A 5HG9A 3F5XA 4RVKA 4AQKA 2F7EE 2WEVA 3NGAA 3IDBA 1O6KA 3TMOA 4EOOA 3UYTA 4EK5A 3RKBA 3GQIA 4S31A 1PXPA 1HCKA 4R3PA 1WVYA 3QTUA 4IWPA 4MTAA 4O0TA 3DBEA 4F70A 4R6VA 2B0QA 2C68A 3NDMA 5IA1A 4QO9A 3O50A 2YA9A 5FM3A 4R77A 1Q8YA 2NRYA 3A8XA 3FWQA 3GEQA 4XJ0A 2ZB0A 4KIKA 5FP5A 2JDRA 2XIZA 2OIDA 2X0OA 3DB6A 3F5UA 4FKQA 3SHEA 5CEOA 5BYZA 5AA8A 1DI8A 5BMMA 2OJJA 3BCEA 4KA3A 1FQ1B 1L3RE 3KRJA 4USFA 4I3ZA 4L00A 3KA0A 3POOA 3PDTA 3GVUA 2RF9A 4F9CA 4RIXB 5AR4A 3F5PA 5K5NA 2W1GA 3RNIA 4R3CA 3VHKA 2CLQA 5ANJA 5EK7A 2CGVA 2W7XA 3MV5A 3MPAA 1VYZA 4PMSA 5CU2A 3TDWA 1WCCA 5LJJA 4IAKA 4FEVA 3OCGA 4J99A 5EI2A 4I20A 4ZY6A 3DTCA 3P7AA 4D2RA 5CNNA 4D4SA 4QP3A 2BDJA 4RC4A 4X3FB 2XALA 4RSSA 4YLKA 5K5XA 5IQHA 3UZPA 2PUUA 3SG8A 4WNPA 2JBPA 3L8VA 4OT5A 1JSTA 2VWVA 4MWHA 5EH0A 1AGWA 5GZ9A 4W9XA 2ETMA 4MAOA 4K9YA 4QP1A 4K1BA 3ML1A 1MRYA 2BDWA 4FICA 5DLSA 4UB7A 2HXQA 1PMUA 3EZVA 3PLSA 2AUHA 4EZ5A 4BWXA 4F7LA 3S4QA 4M68A 3ZEWA 3FL5A 5AUVA 5E9EA 3V8WA 5GIPE 4FTCA 4I6LA 3A4OX 4KRDA 3D5UA 4XBUA 1KV2A 2BTRA 4O22A 4NUSA 2HZ0A 4Y72A 4IZ5A 3MJ2A 3R83A 1H1SA 3PFYA 1W2CA 3UDBA 3VRYA 3P9JA 1IRKA 3IK3A 4YGAA 4CCUA 4FKLA 2F9GA 4ZTLA 4LGDA 5HO8A 2GNGA 3BELA 4KSPA 3AC5A 4TYHA 2XARA 1KV1A 2G2FA 1UKIA 4GVJA 3CGFA 4RQKA 2XEYA 4C38A 3UNKA 2X8DA 4IAAA 4JS8A 3C1XA 2YACA 4K0YA 2W5HA 4FL2A 4WUNA 4YPSA 1LEZA 3KY2A 3QTRA 3PJ1A 3Q32A 4AXCA 3F2NA 3D94A 3AQVA 3FMEA 2A27A 4KKGA 3W32A 4CTBA 4DGMA 2P0CA 2LAVA 4YMJA 3WIGA 1A9UA 4FT5A 2XJ2A 4ALUA 5CF6A 3LXKA 4QDEA 3SXFA 2G15A 2YM7A 4AT3A 3AC3A 1BX6A 1LR4A 2UW3A 4PUZA 5AM7A 4M67A 2R5TA 5E8VA 3QRUA 3FHRA 4WOVA 4O38A 2XAMA 4FSRA 4FUYA 4DEBA 4ZY5A 3G15A 1MRVA 4QMQA 1KOBA 5A3XA 4EI4A 4O84A 3C9WA 2UW8A 4U79A 3ZONA 3VULA 4G3EA 3EH9A 4G5JA 3E64A 2UZTA 4ALVA 1XH8A 4FKWA 4FZ6A 2A19B 3PXZA 4NW6A 4FV4A 3ZBXA 3ZFYA 2Z2WA 1OL2A 2YDKA 3ALOA 3FPMA 3UIXA 4YSMA 3RMFA 3ZLXA 4ZTRA 5IQAA 4S33A 4Y46A 3AT4A 4ZTQA 2QD9A 2V5QA 4IDTA 2FSTX 4OTQA 4YJPA 5JZJA 3UP7A 4BYJA 3EQPA 3C0IA 4G1WA 5EM7A 3V5LA 3NFGB 3EQFA 2OZAA 4P90A 2OJFE 3QTQA 2ITUA 3MWUA 1BMKA 3E3BX 4I5CA 2G1TA 4DITA 4BGQA 1JKKA 4C02A 5FTGA 5IZFA 1OL7A 1ZYSA 4RC3A 3KXHA 4ZJVA 2QOOA 1SYKA 4UN0C 2KTYA 4XX9A 3RM6A 5CEQA 3E7VA 3HV5A 1XH9A 3IGOA 4BWKA 4D1SA 4R78A 2X7OA 4FBXA 1FMKA 2P3GX 1I09A 5G1XA 3PIXA 5C4LA 1OUYA 2KULA 2X9EA 3AT3A 3LHJA 3RK9A 3LMHA 3W1FA 1URWA 4DG0E 3FLWA 1KE8A 3TWJA 3R8ZA 4U81A 2PVYA 4KWPA 2UZDA 2VV9A 2I40A 4NM3A 3W18A 3RPRA 1XH7A 3HECA 4FL3A 2HK5A 5CAPA 2WMUA 1FVRA 3D5XA 3OXTA 5HG5A 5AV4A 3NSZA 4U40A 2YWVA 3S95A 3LFQA 3W2CA 3LCKA 5DI1A 4HVIA 5FGKA 4JG8A 2YCFA 3SQQA 4L9IA 3TV6A 5JQ8A 4BI1A 2QG7A 2VWYA 4KAOA 4QMNA 3ENMA 4YJRA 3UGCA 4ZOGA 4BFMA 4I6FA 4DE4A 3QLFA 4WUAA 1YOMA 5IEYA 5IQCA 4L7SA 2Z7QA 3MA3A 4HGLA 3UOHA 5A9UA 4FEQA 2EU9A 2X7FA 4IW0A 3BLRA 4D0WA 4E6DA 4MF0A 2RGPA 3C4XA 1OECA 3C5UA 5CWZA 4EK6A 2I0HA 1JKLA 3E8DA 2IVTA 3UO6A 2FGIA 1XMLA 2ZOQA 3D2IA 4X7QA 1H8FA 4C8BA 5AAEA 4E5WA 4ZIMA 4LV7A 3AKLA 2ONLA 3QKMA 2YCRA 4QTDA 4NM7A 2C1AA 5TKDA 5HX8A 4A9UA 3MTLA 4UMTA 4FF8A 2W1EA 4QQTA 1FVTA 5KBRA 2E9NA 4K33A 2OK1A 4PL4A 3M2WA 4XV2A 2W9ZB 3RZBA 2UVZA 3U87A 4O0SA 4YTFA 3FI8A 1G5SA 2R3PA 2WTDA 3QQUA 2R3QA 3I4BA 3FLZA 3OFMA 3AKJA 1JSUA 2IN6A 2W4JA 2XZSA 1UU8A 3Q5ZA 4CLJA 3L8XA 4ZTHA 3LLTA 4FV1A 3LCTA 3TYKA 5HQ0A 2GHMA 2C0IA 2XYUA 2FSLX 4CT2A 5LOHA 3LQ3A 3ZMMA 4DINA 4W4XA 2OI4X 4FT3A 4CFNA 5CAOA 4Z16A 2GNHA 1H0VA 1A06A 5M09A 3BE9A 4KBKA 2X0GA 5JFWA 4F9YA 4EONA 4O4FA 3R7UA 2XCKA 4OBPA 3ID6C 2UZLA 1U59A 3QC9A 3JS2A 5CVHA 3Q2MA 4UXLA 5D10A 4I22A 2V7AA 3CKXA 3ALNA 3QQFA 3VQUA 3IPHA 3AC2A 3BBWA 3BV2A 4FNZA 4Z7GA 4FC0A 2FVDA 3HV6A 3WZUA 3HAMA 3F82A 2OBJA 4JI9A 3ZCLA 3KB7A 4AA0A 4FEUA 3EB0A 3HUBA 3WF5A 1E1XA 2GNJA 5CLPA 4BDJA 3NAYA 4HGTA 5EW3A 4J52A 4ZS0A 5I9WA 2XM9A 5M4FA 1KE5A 2JKOA 3R73A 2PMLX 2EXMA 2QO2A 1FPUA 2R3OA 1P4FA 4JDHA 1U46A 2Z8CA 4AGUA 3JR1A 4HVSA 4GMYA 4C3PA 3PRIA 4KIPA 3N4VA 4QMVA 1G8JA 3ATSA 4HVDA 2WELA 3Q96A 3HDMA 3I6UA 4GV1A 1RJBA 3E62A 2Q0BA 3LOKA 2IW8A 4WNMA 4CFWA 3ANQA 5DMZA 3LXNA 4NL0A 5LVLA 3TG1A 1MQ4A 2QQ7A 4LOPA 3MSSA 3NNVA 1UU3A 3BYSA 4M66A 2UZOA 4DGNA 4D9TA 3E3PA 3GQLA 4AAAA 4K2RA 5IF1A 3CE3A 4GFOA 4LG4A 3UPXA 1TVOA 2C5XA 2H8HA 3IW4A 4I23A 5BMSA 4Q5EA 4M8TA 4U5JA 2XBAA 3VAPA 4CMTA 1PJKA 1L8TA 4AN2A 3ACJA 5K4IA 2X7GA 3PIYA 1P14A 5JGBA 2XS0A 1S9IA 5I9YA 2ITVA 3BZ3A 1W84A 2HWPA 4FVPA 3LKMA 3QA8A 4F1MA 1NVRA 4AXAA 4YTCA 3FZ1A 2QHMA 4AAYA 1YDSE 5EDRA 1WBNA 4IB0A 5HCZA 4HYHA 1IR3A 4P7EA 4CRLA 2VTPA 5C4KA 3EQIA 4TXCA 1DAYA 4O6LA 5LMAA 1P5EA 4L01A 5CALA 2ZMCA 3MFRA 4O7WA 3DBDA 2XAOA 2UW7A 4XNEA 2PUNA 4IEBA 3PA3A 2WIHA 4BTMA 3Q04A 1FOTA 3QFVA 4LYNA 1QPEA 3FL4A 3E88A 2PVMA 1CSNA 3LPBA 2CHLA 4CMOA 3BLAA 5C01A 3ULIA 4R8QA 2WMWA 3S00A 5IDPA 4IJ9A 4O96A 3QRJA 4O0RA 4E7WA 4KSQA 4TWOA 1U5QA 2V55A 3AGLA 3TNWA 2X4ZA 5CAUA 2CKQA 4EH9A 1UNHA 2OWBA 2YIRA 3VBTA 2O2UA 3DOGA 5CQWA 4DAWA 4BDFA 2XKCA 2VWZA 3GNIB 4O7YA 3WF9A 1CMKE 1NT2A 5HVJA 1OPLA 3WZKA 4I4FA 5LCKA 5HU9A 2HIWA 4L6QA 4QYGA 2WGJA 3QTWA 3ODZX 4AXFA 3NFFB 4AW2A 4PP7A 3HZTA 4F0IA 2PYWA 5C03A 5AP7A 2BDFA 4NH1A 3QRKA 5LVMA 3HA6A 3NYOA 4FSWA 3FMKA 3S1HA 2OJGA 3AC4A 1Y91A 3O7LB 4F63A 4NT4A 4D2TA 5IMEA 5DPVA 4FKOA 4JXFA 4EORA 4ANLA 5F1ZA 3Q6UA 1W0XC 5DT0A 2H6DA 1SNXA 2XK3A 2O8YA 3KULB 2ERKA 3MPTA 3QQGA 5AR8A 3S3IA 4AX8A 4PDYA 3F88A 2PY3A 3OTVA 3W10A 4ACGA 5AX9A 4BICA 3OCBA 3JYAA 4AG8A 4C59A 5DEYA 2BKZA 3D0EA 4JIAA 4MXAA 2C5VA 4WG5A 5EHLA 3U4UA 3NW6A 1ZYDA 4MNFA 5L6PA 3DCVA 3LE6A 5EDPA 3TZ9A 2R7BA 3U51A 5JMSA 1MRUA 1ZWSA 2GNIA 2Z7LA 2IWIA 4AF3A 4BTJA 1Y8GA 4A4OA 3G0FA 4V0GA 3KF4A 4G6OA 4MVFA 3FLNC 4RVMA 4C34A 5BYLA 2XP2A 1ZMWA 5EW8A 3UBDA 2A4LA 2HENA 3BGZA 2BALA 3SA0A 1KUTA 2YAKA 3VJOA 4U44A 5JFXA 4Z3VA 4DT9A 1KE7A 2J4ZA 3PZEA 4AFEA 3QXOA 5BYYA 4I92A 2Y7JA 3OG7A 2XB7A 2B53A 3DXQA 1ND4A 2WQEA 3H9RA 4YU2A 4Q9SA 5FDXA 3UIUA 3OS3A 5CF8A 3I5ZA 1JNKA 4GYIA 1CKPA 2WD1A 4NKAA 4GUBA 1JLUE 3PA5A 2WMBA 5ACKA 4D2SA 1UU7A 3LVPA 1AD5A 4KKEA 3FXWA 3BU6A 4FNXA 4E5AX 5DYJA 1URCA 2VTLA 5L8LA 3COHA 4HZRA 4E20A 2BZJA 3I60A 4TYIA 2ZV9A 3WF6A 4XS2A 2XH5A 3IONA 4H1JA 4BCOA 2I1MA 2ONLC 3DS6A 3R6XA 5EYCA 4R7BA 4BVUA 4O7LA 4O21A 3TACA 3GOKA 2RFSA 3A61A 2RL5A 4YBJA 4DH8A 4DCEA 4U9AA 3UPZA 4WNOA 4HYSA 4KRCA 2ZV7A 1OVEA 1ZYLA 1SVEA 3FMMA 1P4OA 5GIOE 1QL6A 3EQBA 4I6BA 2XNPA 5FXSA 3VS5A 3W0SA 1H4LA 3O8TA 3OBGA 4JBVA 5CI7A 4K11A 3V5TA 3SVVA 1XMMA 2REIA 1MQBA 2HW6A 2JEDA 3OHTA 3ZO4A 3GU4A 3HUCA 4OTPA 2RKUA 5CAQA 4RT7A 3HP5A 2XNOA 3DJ5A 4QYEA 3W0RA 4FV5A 4IMYA 3VUKA 4CQGA 4RA4A