5HTBA

Crystal structure of haspin (gsg2) in complex with bisubstrate inhibitor arc-3353
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
GPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase haspin
publication title Co-crystal structures of the protein kinase haspin with bisubstrate inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 328
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5htbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5htbA01
5AP2A 2P4IA 2P33A 4HCTA 3MSSA 2OH4A 4IX5A 2UZVA 4QTEA 2YDKA 3R02A 4J71A 3VAPA 1DS5A 4A9SA 4GYGA 4E5AX 2X2KA 4YTIA 2ITOA 3E5AA 5A3XA 3L9NA 3ZZEA 4AU8A 2Y4IB 4B7TA 3T3VA 3B2WA 3W2CA 4AN3A 3PIXA 4C57A 1Y6AA 3VRZA 4GK4A 3RPVA 4FTRA 3JY9A 4M69B 3AD5A 5HVYA 4C7TA 2PHKA 3F82A 3GCPA 3RBWA 2IVTA 4AGUA 1PXKA 4YMJA 3FXZA 4FEXA 4QQJA 3TI1A 4C2VA 5ANKA 2O65A 1OL7A 4JBPA 2FH9A 3VN9A 4DEIA 3FZOA 2QD9A 3HV4A 3PPJA 4BVUA 3L8PA 5CF4A 2YN8A 3R00A 2BZIB 5IA2A 1J7UA 3FAAA 1V1KA 5CVHA 4CGAA 4R78A 3ZM9A 3HMOA 1Q4LA 2XK6A 3ZYAA 3NYNA 3NEWA 2J0LA 3VHEA 3BZ3A 4IW0A 2F4JA 4ZAUA 2BAQA 4YJVA 2CLQA 4OTQA 3LAUA 4U80A 4FICA 1TKIA 5CU3A 2WIPA 4J8MA 5EM5A 3NW5A 5FP5A 5E1EA 2XKCA 3F3TA 4J1RA 3ZHPC 4E4MA 3SG8A 1WBNA 5F20A 1FGIA 5CEIA 3RNYA 3LCSA 4CT1A 3NUXA 3ZTXA 4BGQA 5IA0A 3QD4A 3W16A 2XK4A 3U6JA 4EH3A 5IA3A 3RZFA 1IAJA 3PRIA 4WA9A 3B8QA 1GZNA 4KABA 2YFXA 4AT5A 5CAVA 4U81A 5DEYA 1KV1A 2WAJA 4JJRA 4UMTA 3B2TA 3RPSA 5G6VA 3WZDA 3ZUUA 3QLFA 4CYJA 3UC4A 4IMYA 4PL3A 3ZLXA 4EC8A 4C3FA 1AD5A 2GQGA 4AZTA 4I23A 4BHZA 4BCQA 5AA9A 2X39A 4TW9A 2UVZA 3H4JA 3UZPA 3G15A 4LL0A 1O6LA 3CR0A 4O1PA 3NVKI 2VTPA 3TEIA 1URCA 3F66A 1KE7A 3KRLA 4I0RA 3UNJA 4ZS0A 1JVPP 3C5IA 2Y6MA 3QGWA 4TWOA 4A7CA 4A9TA 5CAQA 4GKIA 5KX8A 4XCUA 4OT5A 4BZNA 4W4VA 2HXQA 4EUUA 3BE2A 5EKOA 3OUKA 3QYZA 3MDYA 3UYTA 4LI5A 3KN5A 3CTJA 3K2LA 5CX9A 4XG9A 5AM6A 3ZC5A 5LMKC 2W1FA 5F94A 4O7LA 4JAJA 4U0IA 4IZYA 1CM8A 3IECA 4O1OA 2RFEA 4AA4A 1YOJA 4QMVA 4GT3A 5C8NA 4NFNA 1GZKA 4YO6A 4RJ3A 3I81A 1QPCA 4UWCA 4EBVA 1K2PA 5FRIA 1UKIA 3CBLA 3EKKA 2UZUE 1WBSA 3F69A 2YM5A 3SHEA 4KAOA 3VUGA 2ITWA 4JT3A 4YJTA 4B8MA 1NVQA 2Y0AA 3H9RA 3QTRA 5BVFA 4AT4A 1B39A 1OITA 3KN6A 3Q4TA 4TXCA 2C0OA 4QMOA 5DEWA 2WHBA 1O6KA 3EH9A 4EH7A 1PXPA 1CTPE 4BDAA 2OXXA 3PPKA 5FTQA 4CTBA 3MESA 1DAYA 1SNUA 2BPMA 1Y8GA 4O2PA 3KMWA 4PMTA 1KOBA 4L45A 2X8EA 3ZDUA 3KK9A 1QL6A 3FWQA 3MW1A 5T6KA 4D2PA 5EKNA 4YZNA 4F6UA 4EUTA 2WMAA 3OHTA 5IDNA 1ZYDA 2WXVA 3NR9A 4N57A 5J5SA 4NH1A 2OFVA 1P5EA 5ACBC 3LW0A 3MFRA 2W1GA 3V5WA 3NYOA 4DFBA 2RF9A 3D14A 1PMUA 3SLSA 3TWJA 4CRSA 4ACCA 4EYJA 2R3GA 2WQMA 2OG8A 3FYKX 2OJGA 2C1AA 3CXWA 3ORMA 4I93A 4C4GA 4W9WA 5KMJA 3DKFA 3C4WA 5KZ0A 3NNUA 4ZY6A 3VJNA 3H10A 3U4UA 3E92A 5ITAA 4FT7A 5BUJA 5EQEA 3TUBA 5T68A 3ZOSA 3A4OX 1G3NA 3VS2A 4Z7HA 1OI9A 3O96A 4QYHA 1WBOA 1UU7A 4HVGA 4GT5A 4F7SA 3QTUA 3Q6UA 5EQYA 3CD3A 5IA4A 1P4OA 5KNJA 2VZ6A 1S9IA 2YHVA 5EM7A 4DFZE 5L2IA 2CKOA 4QOXA 4TT7A 2B4SB 3O8PA 4GS6A 3FSKA 5J9YA 5D9HA 3IK3A 5D11A 4V0GB 4YJOA 4HCUA 5CTPA 5JZJA 2HY81 2ZOQA 1PXMA 4EZ3A 2W9FB 5IH6A 2UW0A 3G90X 3JVSA 1Q41A 1HCLA 3WILA 3AD4A 2W1HA 3P79A 5AV1A 3NUAA 1XJDA 5AR2A 4ALUA 2ETRA 2G2FA 4XMOA 5DNRA 5DLSA 4CT2A 2QOKA 4I6FA 4YP8A 2WMVA 4C3RA 4PL5A 3NW7A 1YWNA 3QCQA 2F7ZE 1DM2A 4FGBA 4FKSA 5CXHA 4FTJA 2VAGA 1PXIA 3JS2A 4L9IA 3N4VA 2O64A 4FSNA 5LWMA 2YM8A 4G6LA 2OIDA 2J4ZA 2VO3A 3ULZA 1F3MC 2UW6A 3BKBA 1M52A 3O7LB 4QP1A 4XLIA 4ZLYA 1JKSA 4I24A 1QPEA 2DQ7X 2XS0A 3ZC6A 4O27B 1Y6BA 2C5VA 2E9UA 3QD3A 4U44A 4ZZOA 5J7HA 2BRNA 3QA0A 2NPQA 4YJUA 5FXRA 4YLJA 3HYHA 4N4SA 4HZSA 3NGAA 3F3UA 5HCXA 5M09A 4AZFA 3HL7A 3RCDA 3DB6A 3QTZA 5FQDC 4A9RA 2CNVA 3GCQA 3QYWA 2PVNA 2V5QA 2W17A 2WQOA 4AGCA 3M11A 4Y5HA 2PUPA 1BI8A 3GGFA 4QT1A 2GU8A 2ETKA 3ORNA 3S4QA 4FI1A 3ZSGA 5M44A 5M4FA 4C4FA 4DA5A 3FHIA 3R1YA 5ANDA 2HZ0A 1BUHA 4DEHA 3GCUA 2R3NA 4OTIA 1XWSA 2ZVAA 3KRWA 4EOSA 1SMHA 2R3QA 4DEGA 4JQ7A 2ONLA 5AV2A 3QALE 3E8EA 1YWVA 2OWBA 3O8TA 4R5SA 5EHOA 3LCDA 1AQ1A 1UU9A 3GB2A 4FIEA 2CMWA 3FI8A 2C6LA 3W33A 1L3RE 4M84A 3U51A 1R3CA 4PRJA 2R3OA 3LIJA 2XJ2A 2YM4A 3VUHA 3P1AA 4LGGA 4I4FA 3ALOA 4FZAB 4ZSEA 3SX9A 3U87A 3COMA 5KKRC 3LKMA 2BALA 2IPXA 2CNQA 2WOTA 3OEZA 4GFMA 4C4JA 4Q5EA 2ZJWA 2J0KA 3KVXA 3R7OA 1PYEA 5IEVA 2FUMA 3EB0A 2B1PA 2C4GA 1OVEA 2BHEA 4YC3A 5ETFA 2ZB0A 4I5HA 3DA6A 5L6WL 3UODA 4WNOA 2VTAA 1PRYA 2PZ5A 3G51A 5AR8A 5BUIA 4IADA 4PP9A 3BI6A 4MBJA 3DBQA 4HJOA 4XEYA 3E7OA 4RIWB 3VS1A 1T46A 3BQRA 2CGWA 4FX3A 4XRJA 2VX3A 4U5JA 5AFVA 4Z9LA 2IO6A 5M06A 2UZEA 4MK0A 3TM0A 3QKKA 5C27A 5EW3A 4DN5A 2VGPA 1XH6A 2BIKB 2CPKE 3TCPA 4JIKA 2OF4A 4UEUA 3O23A 3QTIA 5HCYA 1U59A 3FMNA 3WF6A 2I40A 3C4CA 4NJ3A 4CV8A 3D2IA 1ZLTA 2O2UA 4OUCA 3UMWA 5KUPA 5IUIA 3AC1A 1UU8A 4PNKA 5IDPA 4XV9A 3VS5A 3PXZA 4PL4A 5FEDA 4XLVA 4WOVA 1ZMVA 2HWOA 3OUNB 2Y4PA 5HE1A 4EOIA 2XK8A 4W4XA 2F9GA 4IB5A 4E4NA 4PP7A 3TUCA 2XK7A 3BYSA 5EOLA 1WCCA 3RHKA 3L8SA 5DHJA 2YAKA 3AC3A 3Q9WA 4RC3A 4N6ZA 3SOAA 4I3ZA 3FMDA 1QPJA 4PTGA 3UTOA 4DTKA 2PUNA 3PVWA 5J95A 2AUHA 1LR4A 5JEBA 4HPTE 4DBNA 4ENYA 3ET7A 3D94A 3KVWA 2P55A 5A4TA 4MXCA 2P0CA 3FZSA 3OWKA 3ZUVA 1WBVA 4FEQA 4LRKA 2XUUA 2KULA 2XRWA 3Q9YA 2B9IA 3BEAA 4PPBA 4IB1A 4JG7A 4YZMA 2BFYA 3H9OA 3KULA 3RCJA 4QYYA 4BYJA 4W4YA 2ERKA 4QTCA 3D0EA 4I20A 3QKLA 5JMSA 1OIYA 5CNOA 2PWLA 2X7OA 2C6KA 2CGXA 2JDVA 3FLNC 3CKXA 4O7YA 5AIKA 5FTOA 3Q4UA 2Q0NA 2VNYA 3OEFX 3WARA 4AZVA 5H3QA 2WTCA 1BL7A 3E8CA 4K11A 4D2TA 4Z55A 4HGEA 2WTVA 2HENA 3IOKA 4AOIA 5HZNA 4DE4A 3EZRA 3ID6C 5EM8A 3BCEA 3R1SA 1SVGA 3R28A 3A8XA 5JKGA 2PK9A 4EOLA 4HVIA 3LFQA 3PG1A 4GU9A 4RVLA 2OLCA 4K33A 3ORZA 4TYHB 3OWJA 3HAMA 4IJ9A 4M68A 4WD5A 4FV2A 3LM0A 2XEZA 4O22A 5FP6A 4ANBA 1V0BA 4PPCA 3ZM4A 3ZXZA 2PMOX 3LQ8A 4S32A 2IZUA 3CQWA 4E26A 3ORIA 2YLFA 5GZ9A 1YOMA 3F2NA 3UVPA 4LOPA 2XH5A 2QU5A 3A8WA 5BPYA 5H8GA 3VBTA 3PJ3A 2PMNX 5H8EA 4JQ8A 3O50A 4JR3A 4FEUA 4NK9A 5DI1A 4RG0A 3LCKA 2J51A 3DKCA 2WMUA 3EOCA 1L8TA 3ATTA 2YIRA 4YPSA 3K3JA 4UBAA 4HGSA 4FV8A 3NLBA 2JFMA 2R4BA 1TQIA 3PXKA 1RQQA 3FLYA 3IW8A 4CG8A 1E1XA 4D4YA 5IQAA 5IA5A 1LPUA 2BRMA 4IWQA 1ZMUA 3IDBA 4R3CA 3EKNA 3PJ2A 5B0XA 4BDBA 1ZARA 4D1SA 4AGDA 3P7CA 3ACKA 1LUFA 1SNXA 2JDRA 3MY0A 1GZOA 2CN5A 4RJ6A 2FYSA 3FMMA 3PXRA 4P5ZA 4R3PA 3REPA 4BBFA 2H96A 4WT6A 3FJQE 4PDYA 3GQIA 3DDQA 4AXAA 1Q8UA 3QUDA 2ZV2A 3HGKA 5A4EA 4F1OA 3R22A 1M7QA 3ZO4A 4A9UA 1AGWA 4EBWA 4K18A 4O6LA 4YZ9A 4UMPA 3DV3A 4GYIA 5L8LA 5C4KA 3VBQA 2C1BA 2ITUA 2JIVA 3ZLSA 1XH7A 4MVFA 3QTQA 4X2JA 5AAEA 2A27A 3R9RA 5C4LA 1SM2A 2GNLA 2UVXA 3FKOA 4FTLA 4TZRA 4GFGA 4MBLA 3RPOA 4X7QA 4C4IA 3VQHA 4S33A 1J7IA 5CEOA 1KE6A 1IA8A 3DNDA 4TNDA 4MHAA 2YM7A 3AGLA 3ERKA 3F3WA 2OICA 2ZYBA 3I6UA 4EEVA 4DH5A 1T45A 3LXPA 5BVDA 3II5A 1XBBA 3BBTB 2Y8OA 1Q8WA 3DAKA 3R1NA 2QOHA 4FTMA 2AC5A 4I21A 3SG9A 5HNGA 3EQIA 4K77A 3QQKA 4JQEA 1KUTA 4LQMA 2C47A 3QHRA 4I0SA 1H1WA 3KRJA 2CCIA 4S30A 4AF3A 2FSLX 4QMYA 2J0IA 2WMSA 4MXYA 3W18A 3R1QA 3ZFXA 3KREA 3LFNA 3CTHA 2PZPA 3DCVA 4XV2A 3PP1A 4RPVA 3DJ5A 4U3ZA 2VTQA 5LOHA 1Q3WA 1RDQE 4F08A 4RA5A 4C37A 4K0YA 1PXNA 4NT4A 3C13A 1Y91A 1Z5MA 4D2VA 4E4XA 2UUEA 4EKKA 2EXEA 3PA5A 3WIKA 4E6DA 5CAPA 4MQ1A 4J7BA 4A06A 1TQMA 3DTWA 3G5DA 3D5XA 4YU2A 2Y4IC 4CLIA 4FE2A 3EFKA 5HEZA 4CCBA 4YBJA 3HAVA 2UZOA 3FI2A 2ZV7A 4NM5A 3E63A 4IAAA 3D7ZA 4YSJA 1IRKA 4L7FA 4JX7A 4ZS4A 4CFVA 3FZPA 4NEUA 2C5XA 2VTSA 3BQCA 2RFNA 2C3LA 1M17A 3HV3A 1J91A 3M1SA 3Q32A 4LFIA 4MTAA 4WNKA 3ZLYA 4YUQA 1Q8TA 1QPDA 3CPBA 3NNWA 1ZOHA 3VVHA 4J96A 5A4QA 1QMZA 4GJ2A 4LMUA 1RJBA 4LUEA 2UZBA 5KZIA 4D9UA 4ZSAA 5I9XA 5KCVA 3UPXA 1PY5A 3VUKA 3QF9A 4ZP5A 4FTOA 3A7HA 5CWZA 3W8QA 5DMZA 2BZKB 3HLLA 1ZXEA 3QRIA 3GQLA 4YJSA 3MV5A 4ITIA 4HVDA 4AS0A 4O38A 4WNMA 4A4LA 5I9ZA 4JRNA 4JG6A 4C4EA 1H0VA 4NTSA 3PVUA 2BUJA 2C6DA 5TE0A 5KO1A 1FGKA 4XG7A 2RFSA 4ITJA 4CFFA 3UP2A 2GNHA 2YEXA 4WBOA 2BTSA 2FSOX 1NT2A 4O7ZA 5JK3A 2ITQA 4F99A 5GIOE 2YZLA 5HE0A 3MVLA 5LXMA 1Q97A 4IC8A 4FEWA 4F1MA 4O7WA 1OL1A 4F9BA 5L3AA 2R2PA 4QP4A 4FTTA 4TYIA 4GIHA 3C50A 5JGBA 3DFAA 4FNWA 3SC1A 3S0OA 3MA6A 2ZMCA 4X3JA 2PPQA 4DT8A 2YM3A 3Q9ZA 2RIOA 4EZ5A 4O81A 3UPZA 1PMEA 2QLUA 3PA4A 3QBNA 5C8KA 4BICA 2OJJA 2WGJA 3E8NA 1FMOE 1LEZA 2X7GA 3EIDA 3SDJA 4OTDA 1B6CB 5D1JA 5IQEA 3TZ8A 4E6AA 1JKKA 3COIA 1XH5A 3I4BA 4FIHA 2E9OA 5A4LA 4RWKA 4Z3VA 5LMBA 3VIDA 2JKKA 1H1RA 2UW3A 3FXXA 5M08A 3IPHA 3L9PA 4V04A 3HA6A 5BYLA 3A60A 3C4EA 2O5KA 3LFBA 2ZAZA 3R8MA 4F0GA 3A99A 2GS6A 2YWPA 5AP6A 2WU7A 4PF4A 4BY9E 2GTNA 2W9ZB 3GUBA 4MXXA 3RNIA 4BCJA 5FXSA 1GIJA 3F3ZA 1UVRA 3L9LA 3Q2MA 2X1NA 5CQWA 3PUPA 4M0ZA 5AUVA 4BI0A 4IWDA 5HBEA 1WBWA 3PWDA 2R3FA 3HP2A 4LOQA 3WI6A 5HBJA 2XVDA 1H00A 2JKQA 2OIQA 3JXWA 4NCTC 4ZTSA 3R8UA 5D7AA 5HVKA 5JT2A 1KE9A 2X2MA 3V3VA 4EK5A 2H8HA 5M51A 4K6ZA 4BL1A 3UZRA 1GIIA 3LMHA 4BWPA 2WD1A 1FVRA 3C9WA 1GIHA 3DBCA 3OWLA 3P9JA 4N70A 5E7RA 5CEPA 4O7RA 4F1TA 5J5TA 3LFEA 3NVMB 5DE2A 5AM7A 3V04A 5K9IA 4PTCA 3S00A 4O7SA 5IISA 4IIRA 3ZBFA 5FTGA 1GAGA 3BYUA 4ZIMA 5LJJA 4IAYA 3R8VA 5AP1A 5HX6A 5GHVA 2VTLA 4YZBA 3ANRA 4E5WA 4O83A 1MP8A 5L2SA 2YCSA 2W1CA 4U3YA 4EH5A 2VWVA 1KE8A 2W5HA 4DFNA 5CALA 3BYOA 2PSQA 1J1CA 3A61A 3KFAA 4O0WA 3MS9A 3U9CA 5L2TA 3KRRA 4NU1A 3VUIA 5L8KA 5E8SA 1R0PA 4OTHA 1QCFA 2XNPA 4QP2A 3A7JA 1PW2A 5DFPA 3ZSIA 4W8DA 5BVKA 2XA4A 4D4VA 2JIIA 4MXZA 1DAWA 2WELA 4RJ7A 3TACA 4RGJA 1DI9A 4DGLC 2HIWA 4CKJA 4FGRA 2BKZA 5JGDA 4QMPA 1UNGA 3D7TB 2BHHA 3DLSA 3ZLWA 3RWQA 2H9VA 3Q6WA 4EHZA 3KXGA 4Y8DA 2XIRA 3AC5A 2WTKB 2ZM3A 3H0YA 3HV5A 5HTBA 3QRTA 3QA8A 3AMBA 5KMIA 1I44A 2J0MB 3N4UA 3C4FA 2OK1A 3U8WA 4BCIA 4ZTRA 3MH3A 5AIRA 5M53A 3R9HA 3BU6A 4ZJJA 2YCQA 1JNKA 2QR7A 3F3VA 1XR1A 4ZTHA 2B9HA 4CSVA 4DLIA 5EDQA 5KHXA 5AP3A 4EOMA 4EH8A 4OTFA 1ZY4A 3R8LA 3DT1A 4PUZA 4ZSLA 2I0EA 5CSXA 3CY2A 4HYUA 5AUWA 5AR5A 4KBCA 4M15A 4BDCA 3CQUA 4F63A 4JRVA 4HZRA 3P4KA 3POOA 3VS3A 2B9FA 3RHXA 2VUWA 4EK6A 4E6QA 3LXKA 5EHLA 5LCJA 3Q60A 2BRGA 3CCNA 4MBIA 1J7LA 5DT0A 1M2QA 5GZ8A 2GHLA 2R9SA 5HE3A 1PKDA 3D4QA 3FHRA 2VTHA 3HRBA 4IAKA 1OBGA 2XKEA 3I7CA 4RWLA 4BDGA 2ITVA 4BTFA 4DYMA 5FBOA 5A6NA 3LMIA 5HCZA 2R64A 1UKHA 2PYWA 4UN0C 2JKMA 3QFVA 2WMBA 1WBTA 2BRBA 4J97A 1Y8YA 3NUSA 4IH8A 3W32A 1YVJA 5J79A 4FT3A 4YNOA 1M14A 5CXZA 1XKKA 1YDTE 5AADA 5CZHA 1WMKA 3BX5A 1OM1A 3EL7A 4IDVA 5IQCA 2ITYA 3DAEA 5J1VA 3ZEPA 2VWYA 4E5BA 3ZO2A 4BI1A 4XG8A 5ANEA 2VWXA 4OGRA 1HCKA 4ZXTA 4CV9A 4J98A 3W2QA 1OGUA 4CKRA 2QU6A 3QQLA 4AE6A 4R7HA 1CMKE 4DFUA 1W7HA 2IVVA 3BPRA 3SKCA 4FKRA 4M66A 3MYGA 4ERWA 3UG1A 3LCTA 2P2IA 2XNBA 1BI7A 4CTCA 2UZNA 4D2WA 3NUNA 2WOUA 3MTFA 4PTEA 5JRQA 2F2CB 5AV3A 2PVJA 4CNHA 5DBXA 3SGCA 4WBBB 3C5UA 4B99A 3IDPA 2B54A 3KULB 4P2KA 4L67A 5I9UA 4ANSA 1KSWA 4RFZA 2R3PA 4WNPA 2W1EA 5LWNA 4OTGA 2AYPA 5FEQA 4GKHA 4EOPA 1MRYA 3DXQA 4DFLA 3I5NA 2QVSE 1WZYA 5IKWA 5J9ZA 3E3BX 1VYZA 2WPAA 2OFUA 5CSVA 1REJA 2WMQA 2WEVA 3D5VA 3E64A 2WO6A 3EFWA 5CEQA 3ZSHA 3VBXA 4C38A 4U79A 3HZTA 5FXQA 4BCHA 5IEYA 2X2LA 2VX1A 2R3RA 3Q04A 4PDSA 3AT4A 5CI7A 1SZMA 1ZYLA 3DJ7A 5E9EA 4GUEA 2O3PA 3QGYA 5HOAA 3LLTA 4MNEA 4MXAA 4FKUA 5GJFA 3WBLA 4O86A 4H3PA 3Q53A 3Q9XA 3DAJA 3NCZA 3TIYA 5EFQA 4JR7A 1OIUA 1H1PA 1W8CA 4RIOA 1OPKA 3DPKA 2VD5A 3DXNA 5I0BA 5L6OA 2CGUA 2ZV8A 5M57A 5DRDA 3NNXA 4C4HA 3UVRA 2VWWA 2VTRA 5EW9A 2CCHA 2YJRA 4ZZMA 2F2UA 4PPAA 1OKVA 4FNYA 2JBOA 3B8RA 3V8SA 2C0IA 2X7FA 2PUUA 3EYHA 4I92A 4ZTNA 4JI9A 3PSBA 3MGYA 5JZNA 5LVLA 4EK4A 4QMWA 3AQVA 1JBPE 2VO7A 3R8PA 3ZBXA 4FKOA 1UNLA 5H9BA 3WE4A 4X3FA 2BKKA 4KNBA 4IANA 3RI1A 2QOOA 4EHEA 4YZDA 3S3IA 4OTRA 3VC4A 3DGKA 2W05A 2A4LA 4K2RA 4Q5HA 3DQWA 4G3FA 4BIDA 2PVLA 5IU2A 4FTIA 1OUKA 4MAOA 3P08A 5FEEA 3UJGA 1TVOA 4XJ0A 1PXJA 3SD0A 2W1IA 3FMLA 4YNEA 5E4HA 4CXAA 4EQUA 1FQ1B 3AG9A 3G9NA 1UA2A 2ZM1A 2IW8A 1F5QA 4RLKA 3RK9A 1H01A 2GNJA 3FMJA 3G0FA 2HAKA 4FZFB 4U6RA 5DG5A 2R3JA 3N51A 3TDVA 2JBPA 3ZU7A 1YOLA 3FI3A 3SOCA 2XNEA 5EI2A 1BMKA 2YIQA 3EQFA 3GOKA 5C1QB 5J7BA 4F09A 3C0HA 3P23A 2WQEA 4O0YA 2QHNA 3OT8A 3V6SA 3KQ7A 3KXMA 3OFMA 3GC8A 3V5LA 4O0UA 4CMUA 2PVHA 4RWJA 3EN6A 4GIIA 4GL9A 4NM0A 1P4FA 2PZIA 3RKBA 4F65A 4I41A 2C5NA 4IACA 4I4EA 4EHGA 3E88A 4HOKA 4C61A 3NCGA 4H05A 5EQPA 2XM9A 4MD8E 4DH8A 2QKRA 5CU0A 3PZEA 3EWHA 4BTJA 4DGNA 5AUTA 3H3CA 5J87A 4O21A 3C4XA 1XBAA 3RK5A 2YIXA 2PVYA 4I6HA 4XV3A 5HX8A 4BF2A 4HVHA 3UNKA 4RIYA 4U40A 3QXPA 3QC4A 2BVAA 4LMNA 1GZ8A 4L00A 2XK3A 1FINA 3FQEA 5DR6A 2XEYA 2JEDA 4QMUA 3QHWA 4RQVA 4BBMA 5GINE 2HW7A 3ZS5A 4F9CA 2ACXA 3OY3A 2YERA 4MH7A 5BVWA 3ZMMA 3RPRA 2XZSA 1PXLA 4LRJA 4FKGA 3E62A 5IQHA 3FDNA 4RC2A 1XH9A 2HZNA 1B38A 2WQNA 3E8DA 4J99A 4CYIA 5HLPA 3PPZA 4ACMA 1SVHA 3NPCA 3ZFMA 2UW7A 3WZUA 1GNGA 2I0HA 2J5EA 2VTJA 4PY1A 4ID7A 4CZTA 3KF7A 2P3GX 3FLSA 5E8VA 4FKTA 4YSMA 3OOGA 2G01A 5CU2A 4E20A 2XBJA 3EN9A 3A7FA 3GU6A 5E90A 3TKHA 5B7VA 4FV7A 3FY0A 3GU8A 1VR2A 4D4RA 2OSCA 4F0IA 3IW7A 3BGZA 5HGIA 2W7XA 2AC3A 5DN3A 3IW5A 3I1AA 3LQ3A 3VF8A 3VW6A 2NRYA 3UQGA 4RIXA 2RKUA 4TYGA 5IEXA 5EM6A 2WMXA 5L8JA 3WYYA 4YC6A 3V5JA 3KXHA 4TYJA 4L46A 4AX8A 4DGMA 2ZB1A 2X9FA 5AX9A 3QD0A 1H1SA 2JAMA 5GNKA 3OD6X 5HNBA 1W82A 4L53A 4PMMA 4QMXA 4NYEA 1CKPA 4FK3A 2F57A 5LCKA 3UBDA 3PJCA 4RX7A 2J5FA 1BLXA 4BDKA 3MJ1A 1W0XC 4B6LA 3EN4A 4Z16A 1JKTA 2J9MA 3C0GA 4RVTA 2QOBA 3RM7A 1NVRA 3K5VA 3MH0A 4QPSA 4WUAA 4ZSJA 5FLFA 5TO8A 1GOLA 3OG7A 3V51A 4AE9A 2Z7LA 5JQ8A 2H6DA 5EYCA 2G15A 1MUOA 3KEXA 4RX9A 3LQ5A 4R1YA 1YW2A 5AV0A 5CAUA 4UX9A 1A9UA 2HZ4A 4XH6A 4BZOA 4YJPA 2GHMA 1UWJA 2VU3A 3FZRA 4CD0A 5BNJA 1Q3DA 4MXOA 4M7IA 2W4JA 4QP9A 3ORPA 2ZMDA 3AOXA 2BZJA 3ZO1A 3IGGA 4H1MA 5JFSA 4F7JA 2IVSA 4GJ3A 2WTJA 4S2ZA 5CSPA 4AOJA 2YACA 4FTAA 4IHPA 1ZOGA 2XIKA 4FV9A 3R7YA 5AV4A 2OXDA 3MPTA 4IWOA 5CASA 3I6WA 3MVHA 5IQGA 2VO6A 4BDEA 4QMTA 3UDBA 1H26A 1JLUE 3F5XA 3EQRA 3OS3A 4FKWA 4BWKA 3GOPA 3SQQA 3TNQB 2XYUA 3R73A 2WQBA 2FO0A 4JXFA 4U9AA 3U54A 1O9UA 1SVEA 4XG2A 5T3QA 4BC6A 3FUPA 1FOTA 3O2MA 4DINA 4LL5A 3QD2B 3LJ1A 2E9VA 3RK7A 3FI4A 2CKEA 4KA3A 4DFXE 4GSBA 3QX2A 4JVGA 4YTFA 3UOJA 3NX8A 4RWIA 4C33A 1HOWA 3EZVA 1JAMA 3QL8A 3UMXA 2BDWA 4CVAA 3GU5A 5AP0A 3EQDA 2ITTA 3FL4A 4XBUA 5E92A 2JLDA 5FDPA 2GPHA 1OL5A 4KSPA 4XG3A 1OKYA 1Z57A 2OGVA 4XOZA 3ZONA 3AT2A 4BDFA 1NW1A 4D55A 5AEPA 4IVCA 3GCVA 4FC0A 5HI2A 3UIUA 2J2IB 5C9CA 2OJ9A 3S2PA 3FEGA 4L42A 5ANJA 4XBRA 4BKZA 1F0QA 3VS0A 4BDIA 4U97A 2EXCX 4UXQA 3MWUA 5E8UA 2BAKA 3ZUTA 5ANIA 4N0SA 2WTWA 3CD8A 5IQDA 3PTGA 4I22A 3TJDA 4ASXA 4QMQA 4FSZA 4A4OA 5BVOA 4G9CA 5M4CA 4W9XA 2YWVA 5IPJA 2V62A 3G6GA 3SAYA 3V8WA 3VS6A 3KB7A 4JIAA 1ZOEA 3O51A 4OW8A 4EHVA 1YQJA 3QQJA 4DC2A 2DWBA 2GNIA 3KCFA 2QKWB 2BDFA 2R3IA 1ZZLA 5AR3A 3BGPA 3R04A 3ZFYA 3F9NA 4F9YA 4GCJA 5L2QA 4RFYA 3SXSA 4ACDA 4E6CA 4FOCA 3KC3A 5HIDA 2A1AB 2EU9A 3I79A 3BHTA 4MYGA 4TTHB 5CANA 5KBRA 2OKRA 2VO0A 2IN6A 3AC4A 2XKDA 4EJNA 3PXQA 3QZIA 4FV1A 2BTRA 3GVUA 4BR3A 5E1SA 1U5RA 4FBXA 4CQGA 4ZJVA 4BWXA 3P86A 2V22A 3RAWA 4NIFA 2R5TA 1XHAA 4F9WA 4UWYA 1ZRZA 3HKOA 4G6OA 2Z02A 4EWHA 5CQUA 4B0GA 5BUEA 3QKMA 3DS6A 3W1FA 4Q9SA 5A46A 3QQUA 3RINA 2XJ1A 4KIQA 2UW9A 5E8WA 5CF5A 4DGGA 4DEEA 4UY9A 3DXPA 5EW8A 4H3QA 3QWJA 3QRKA 1H08A 4PNIA 4E4LA 3SVVA 2B52A 2VWIA 3QU0A 2G2HA 5ICPA 5DGZA 4P7EA 3UZTA 4MWIA 5C01A 4BCMA 4EOOA 4BKJA 5I3OA 4FNZA 1JOWB 5K5NA 2J50A 3MPAA 2WMRA 3OXTA 3IOPA 3DY7A 4JS8A 4X2GA 4FIGA 4J8NA 4DH7A 2VGOA 3FLQA 3NIZA 4A4XA 4E73A 3ORLA 3LHJA 1V0OA 2UZTA 3MFUA 4TWPA 2WNTA 4ARKA 4LV5A 1IAHA 3FLZA 5DWRA 4FIIA 3ELJA 4NTTA 2VWBA 1IEPA 4L7SA 4KKEA 2A0CX 5HESA 2UVYA 2YJSA 3RP9A 3M2WA 4Q9ZA 4O7TA 4KBAA 3Q2JA 3VWAA 3CEKA 5FBNC 3ATSA 1BL6A 3FLWA 4QRCA 4XP3A 4RQKA 2XMYA 2R3KA 3O7LD 2IG7A 2BROA 2X8IA 4DGOA 2OH0E 2CDZA 4BZDA 3LOKA 5EOBA 3W2RA 5KMKA 5ANGA 2OJFE 2E9NA 4GG7A 3HP5A 3OZ6A 4LGDA 4YJRA 5C26A 2ONLC 3KF4A 1PJKA 3A2CA 4Y83A 2WTKC 4GW8A 2GQRA 3DB8A 3IW6A 3PJ8A 4NWMA 4D28A 3CGOA 2YZAA 3C1XA 5I5ZA 2IZTA 2XCKA 3ENMA 5HG7A 3WE8A 4I0TA 1R39A 4WRGA 2PVKA 5CZIA 4HYSA 4F0FA 1YRPA 3PYYA 3HRFA 5DT3A 3WF9A 3TNWA 5LMAA 3F5UA 4MF0A 3OOMA 3G9LX 5DH3A 2C3KA 2YIWA 4KBKA 5LQFA 2OO8X 4TL0A 3R2BA 3ODYX 1FBNA 2X4ZA 4O84A 3VHKA 3F7WA 4OTPA 5D7VA 2JDTA 4FL3A 2GTMA 2PE0A 1OL6A 2HWPA 4UMQA 3UIMA 2PVRA 3M42A 3LFCA 3MY5A 3OF0A 2V7AA 4JBOA 5DRBA 2WEIA 2JAVA 3BYMA 5IMEA 3V5QA 4NKAA 3UNZA 4FVQA 4MNEB 1H07A 2OU7A 4XS2A 3NIEA 4QPMA 4Y85A 5JN2A 2GHGA 4BRXA 2ZM4A 3NWWA 4EZ7A 4BGHA 4DG2E 4F64A 4C0TA 2PY3A 3KXZA 3NSZA 3R63A 3QWKA 3OC1A 3C0IA 2XB7A 3R21A 3S1HA 4KRDA 2Q0BA 3CC6A 1H1QA 2PVMA 2BDJA 1OIRA 2CSNA 2V0DA 5LMKA 3MPMA 4FZ6A 4BB4A 2C69A 4R1VA 5JRSA 4C59A 4APPA 4YR8A 3BBWA 3MH2A 4QYEA 5CYIA 4QMNA 2ITNA 2W5AA 4J52A 3EYGA 4EH2A 2ITXA 3WF8A 4ZMFA 4M14A 4FV6A 1WVWA 4X3FB 3OCGA 3BHYA 5EYKA 1REKA 4ZY4A 4X2NA 5HD4A 4NSTA 2XIXA 3OCBA 3FYJX 2WKMA 5BMSA 5A9UA 4KB8A 3R0TA 3DZOA 3GT8A 2W1ZA 4EI4A 4FV3A 2ZDUA 3EQHA 4L43A 3FMEA 2X81A 4MWHA 3BHUA 4IAIA 2O8YA 4IX4A 4EH4A 2PMIA 2YISA 4BGGA 4ALVA 5I9WA 4ANMA 1Q8YA 3AMAA 3FKLA 1ZWSA 4V01A 2CKQA 1OZ1A 3IS5A 1R1WA 3NAYA 3QX4A 5CU4A 4Y72A 2C6TA 5E8ZA 3UGCA 4AW2A 3FZTA 4C3PA 5BX0A 1OB3A 3DZQA 2UZDA 4PDOA 2YA9A 3EQCA 2LAVA 3VRYA 4AN2A 4FEVA 3BGQA 3F88A 3FE3A 4GUBA 3UG2A 3QTWA 4F9AA 5HG5A 1WVYA 3QCSA 3LXNA 3NYXA 2BIYA 3H30A 1IG1A 3IDCA 4EKLA 2Z7SA 2I1MA 3BV2A 3NRMA 1P14A 3MB7A 2HZIA 2B0QA 5TF9A 3IGOA 2VTTA 4DHFA 2A19B 4QTDA 2IVUA 3PE1A 2QHMA 4WKQA 3RVGA 3ORTA 4RVMA 5J8IA 4FYOA 4FIJA 4CZYB 3O0GA 3RAIA 5LVMA 1V0PA 5EHYA 4X2KA 5TR6A 4M13A 5AUXA 2ZV9A 3CLYA 5HG9A 1OKWA 4QP7A 3NUYA 4RLLA 3UOLA 5GJGA 5EG3A 4L3JA 4O7NA 3TNHA 3BIZA 5HKMA 5TKDA 3K5UA 4ANNA 2IZRA 1MRVA 5H8BA 3LCOA 4QMZA 3DLZA 2QG7A 2EB2A 3E87A 3QZGA 4RIYB 5AWMA 3DJ6A 3VBWA 2Z60A 4FMQA 5JH6A 4YURA 2ITZA 2X6EA 4FV5A 2ETMA 4GVJA 1YXSA 3BWFA 3TUDA 4CFMA 1IASA 3HUCA 3UQFA 4PMPA 3CJGA 2C6MA 4FOBA 3FC2A 4I1ZA 4MKCA 4ZTQA 5FM3A 4X0MA 2QCSA 3BELA 2UW4A 3GP0A 5HICA 4AG8A 1OPJA 3GC9A 3LXLA 4MD7E 4C2WA 2OZAA 4TPTA 2C6EA 2WTDA 3N9XA 2PVFA 4QP3A 5H2UA 1OBDA 4BDHA 5EK7A 3WOWA 4DCEA 5FDXA 3GU7A 2CLXA 1OMWA 3QUPA 2OI4X 2UW8A 3ZZWA 4CCUA 5IMXA 3G0EA 1BKXA 4IVAA 4LOOA 5F1ZA 4ANLA 4JAIA 1H24A 1OIQA 4OLIA 4RMZA 3PXFA 4TYHA 4UMRA 3K54A 5EYDA 5E8YA 4G3DA 3VW8A 1EH4A 3EJ1A 4USFA 4NKSA 2PL0A 3MTLA 3OW4A 4FR4A 5D41A 1CSNA 4ACHA 3RALA 5I4NA 2VTNA 5M4UA 4ZTLA 3JR1A 4RIXB 1DI8A 3O17A 4AW1A 3JY0A 4FKVA 5AAFA 3VF9A 5CT7A 5L6PA 3PRFA 2G2IA 2W0JA 4S34A 5CEMA 3BU3A 4NUSA 4U45A 4K9YA 4ZY5A 4X6RA 5GIPE 4KSQA 4PQNA 2PUIA 3VULA 4E7WA 3G2FA 4QNYA 2R3MA 4NJDA 4UV0A 3FBVA 4D2RA 1NA7A 4UYNA 3QUEA 1YHWA 3RGFA 4LM5A 2C3IB 4TY1A 2IJMA 3PLAE 3QCYA 4KIPA 2FVDA 3ZCLA 4XX9A 4XRLA 4JLCA 4QQCA 4CG9A 4BYIA 2YCFA 5JQ5A 3Q4ZA 3V6RA 3PJ1A 4EC9A 4M12A 5DT4A 4RT7A 5FG8A 1VEBA 4TN6A 2GCDA 1STCE 1BX6A 2C3JA 4YHJA 1U54A 1NVSA 5KMMA 4G5JA 3TL8A 3KMMA 2XBAA 4FV4A 4O91A 4KIOA 1YI4A 4CQEA 2GS7A 5HO7A 4R77A 1ZMWA 4BCNA 4AW5A 3WZEA 3GEQA 2JC6A 1Q61A 2OZOA 4JBVA 3FQHA 5CEKA 2V7OA 2J90A 4M8TA 4XP2A 5LVOA 3WYXA 3BEGA 4I6QA 3VS7A 4LG4A 3MVMA 5HORA 4BFMA 4L52A 4GK3A 3VUMA 5KMNA 4Y46A 1OUYA 4BCPA 2V55A 2GSFA 3LJ0A 1VJYA 4C02A 3RAHA 5IUHA 5K5XA 4QTBA 3Q5IA 3SA0A 5JFXA 3D5WA 4LGHA 5HLNA 3OXIA 3ROCA 2PMLX 1OECA 4EK8A 3HV6A 3EFLA 2Z7RA 4GMYA 5AP4A 5HQ0A 4MF1A 3W2PA 5CNNA 4JX3A 1W84A 4FL1A 4L3LA 5D10A 4G34A 4YO4A 2YABA 4XHKB 3DBEA 3W10A 3F7ZA 3DBDA 4RA4A 2CJMA 4TYEA 4CEGA 3QRUA 4B8LA 5FUTA 2QO7A 3R7EA 1YXVA 3ZDIA 1U4DA 4JL9A 4YBKA 1Q24A 4RJ5A 3VO3A 3ALNA 2R7IA 3UOKA 5HE2A 3A62A 4RC4A 3TTIA 4MD9E 4KS7A 2C68A 1UWHA 5CY3A 2LGCA 2NP8A 2XNMA 3AT3A 4GT4A 5GJDA 5DIAA 2FSTX 5F95A 3CE3A 1S9JA 4U43A 2VV9A 5L4QA 5HVJA 3LFSA 4KD1A 3EQGA 2B7AA 4BDDA 3Q4CA 2Q83A 3CTQA 2Y7JA 4OAUC 4WSYA 3LLAA 2ESMA 2JD5A 4GH2A 1R78A 3L8VA 4W4WA 4DT9A 2VX0A 2SRCA 3HMNA 5DA3A 3R30A 1Q8ZA 2QOQA 4XG6A 5I9VA 2CN8A 3MJ2A 3ANQA 5HG8A 4IEBA 3MFSA 4JDJA 2XF0A 4MQ2A 4X21A 3PA3A 4IXPA 1SYKA 4HVSA 3TDWA 3BHHA 4C62A 2XNNA 3UOHA 3POZA 4AZWA 5IF1A 4D5KA 4D0WA 3TKUA 3BLRA 3DK7A 4M3QA 4Y5QA 3KMUA 4IDTA 4DTBA 4II5A 4AT3A 3LVPA 3PVBA 3Q3BA 4FUXA 3OCTA 4L6QA 2J0JA 4PX6A 4AFJA 1XO2B 4FTCA 4GVAA 3HA8A 5EI8A 5M55A 4EL9A 4YTCA 1TQPA 3COHA 2C5YA 5CENA 4O6EA 3PWYA 5E91A 1E1VA 2O0UA 2QQ7A 4ANQA 4ASEA 2YLEA 4FKIA 5K4JA 3D83A 2QLQA 3PSCA 1YWRA 3DOGA 5CS6A 4CFNA 5KHWA 4TWNA 4YPDA 4A9YA 4FSTA 4YGAA 1YI3A 2UZWE 5E8TA 3HMMA 3PY0A 3TZ9A 3ULIA 4ZK5A 4G2FA 4NIFB 1Y57A 5ANOA 2OF2A 3CKWA 4S31A 4D58A 3E93A 1URWA 4YHTA 2F49A 4FTQA 2BRHA 3VBVA 4D1XA 4BN1A 4E3CA 4HYHA 4QP8A 1BYGA 3R01A 2IW6A 5LARA 2GQSA 2DUVA 2FSMX 4FTNA 4QD6A 5BMMA 2BZHB 3NW6A 4DEAA 1E9HA 3TIZA 3PY3A 4G1WA 3KCKA 5K3YA 3UQCA 2EB3A 5C03A 5M4IA 3UYSA 3PLSA 3UO5A 4P90A 3EL8A 3FSFA 4AOTA 4O0VA 5AUZA 4G16A 4IVBA 3MVJA 4IM0A 3BRBA 3LJ2A 1FMKA 1YXTA 2BCJA 3FV8A 1YI6A 4KKGA 1M7NA 1W98A 1WBPA 4R6VA 1G8AA 4KIKA 4DCAA 5EYMA 4BTKA 5ETIA 5E8XA 3CSVA 3ZH8A 2XCHA 4IJPA 2JFLA 4G3GA 3ORXA 4IAFA 4JOAA 3I60A 3OP5A 3MH1A 4M97A 3HMPA 3IO7A 4PMSA 3F5GA 3OROA 4FF8A 4NW5A 2HYYA 4FYNA 3RAKA 3SW7A 1MQ4A 3PDTA 4ASZA 1ZAOA 4ZZNA 3R2YA 3UIBA 4YJNA 4IZ7A 3PIYA 1JSUA 3OW3A 2QOCA 4JDHA 3U9NA 4U41A 2W5BA 4X6QC 2E2BA 3GCSA 4B9DA 3HNGA 4D4SA 2W4OA 5L2WA 3SW4A 3EQBA 3F61A 3ENHA 4FNXA 4V05A 3R9DA 4X2FA 3SRVA 4FKLA 3RM6A 4AQCA 4F6WA 5AP7A 3WIGA 5AX3A 4YZCA 4CMTA 4DG0E 4BTMA 1W83A 4K8AA 5CF6A 5ETCA 2GNFA 5J9LA 2WTIA 3D15A 4P5QA 2R3HA 4HGLA 5CVGA 5M07A 4YLLA 2HELA 2WIHA 3A7GA 3V5TA 2ITPA 1R0EA 4ZOGA 4FG9A 5I3RA 3P7BA 2JDSA 2XNGA 4HPUE 1Q5KA 4UMUA 3ZRLA 3U55A 3DDPA 4D0XA 3HUBA 2X8DA 3QTXA 5KBQA 3OY1A 4E8AA 3KK8A 4I5CA 4IVDA 5K0XA 2X6DA 4FSMA 3C7QA 5HD7A 2CHLA 3TXOA 5BYYA 3NUPA 1ZY5A 3QXOA 4MX9A 2RSVA 1NY3A 4U42A 5BVNA 2NO3A 1PHKA 2G1TA 4FT0A 4FIFA 3TKIA 3ETAA 4DAWA 3R71A 3LE6A 3A4PA 4Y95A 3CY3A 4EONA 5AR4A 2XRUA 4Y73A 3NS9A 4LV8A 2VRXA 2GFCA 4IM3A 1J1BA 3THBA 4NM7A 3ZRMA 4ENXA 5M56A 1FVTA 2JITA 5KE0A 2Z8CA 4XNEA 4UYAA 5EH0A 3RMFA 4ZLOA 2JKOA 4AN9A 3MBLA 3EN5A 5AUUA 1X8BA 4FT9A 3RTPA 3D7TA 4Z7GA 3MI9A 3PZHA 4MCVA 4BCFA 2CGVA 2OIBA 3E3PA 5IQIA 1H28A 4H39A 2QO2A 3U4WA 2BR1A 1A06A 1Q62A 1U5QA 4W8EA 2C30A 3HVCA 3W2SA 4MEDA 4QPAA 4H36A 3R6XA 4KS8A 2Z7QA 2R0UA 4CFXA 4HW7A 4M69A 3KXNA 4DF3A 4IX3A 3OXZA 2I0VA 2IW9A 4IWPA 4F7LA 3GU4A 4AA0A 4O0RA 3P78A 4L44A 4R7BA 1YHVA 3OBJA 3N4TA 3UO4A 3OMVA 5CF8A 4HYIA 4ITHA 4QYFA 4I5PA 2XP2A 3L8XA 4IQ6A 3OBGA 3RPYA 3SV0A 4G3EA 1CDKA 2EVAA 4C8BA 3W2OA 4DFYA 5LVNA 3GC7A 1G5SA 3CS9A 1MQBA 4RX5A 2VWUA 3BE9A 4IB3A 3PIZA 4RJ8A 4F7NA 2W99B 4L68A 4PWNA 1Q99A 2HK5A 4CMOA 4GEOA 2VN9A 4FKPA 3DK3A 3JPVA 4UB7A 3MA3A 4YC8A 3L9MA 4DH3A 5HU9A 4AWIA 3MIAA 4IX6A 2GS2A 2PZRA 3KKVA 1VYWA 4IFCA 2KTYA 4U8ZA 4XUFA 3HRCA 1H8FA 3TV6A 3TN8A 3Q96A 5A54A 1CKJA 4WIHA 3EMGA 3EFJA 3Q5ZA 2RGPA 3PXYA 4R5YA 4GFOA 3C51A 5BQ0A 3LM5A 5GZAA 3A7IA 3BWJA 1GY3A 4ALWA 4TWCA 3KRXA 2Y9QA 3R7UA 2UZLA 5ACKA 3ORKA 3PP0A 4DLJA 5JFWA 2R3LA 2BMCA 2QI8A 3UO6A 2PU8A 3QTSA 4DITA 3WZKA 4D9TA 1IA9A 2PE2A 3TNPC 2C6IA 1OL2A 2C0TA 3R9OA 4IM2A 4PDPA 5J1WA 2XNOA 4D2SA 4O7VA 4DH1A 2RL5A 3R8ZA 1ATPE 4JNWA 3CIKA 1KE5A 5AAGA 1JSVA 4KWPA 4EWQA 4GRBA 1I09A 4JDKA 4FVRA 3FXWA 3NUUA 5AMNA 4O0SA 3HX4A 3UE4A 2QONA 2HXLA 1IR3A 1JQHA 2B53A 3T3UA 5CT0A 4ZLZA 4BIEA 1PKGA 5DYJA 4EORA 4WO5A 3C4ZA 4XP0A 5KMOA 4TNBA 4OR5A 4APCA 4AP7A 4RX8A 5DR2A 4BDJA 2VWZA 5ETAA 3QC9A 2OZAB 3DU8A 5IG1A 3JVRA 3VQUA 3BLQA 4BIBA 5B2KA 2E9PA 3COKA 4L8MA 4X3FC 2R7BA 3RJCA 3TTJA 2RG5A 2PE1A 2DS1A 3F6XA 4O0TA 1ZYJA 3L1SA 3NDMA 4WG3A 4C35A 4C36A 4FVPA 2XJ0A 1Z9XA 3QLGA 3DKOA 2QNJA 2WFYA 1A48A 3F5PA 3RWPA 1XH4A 4NCTA 3FPQA 5CU6A 3NAXA 1H0WA 3R83A 2JIUA 1VZOA 4OBPA 3V8TA 5IA1A 2WMWA 4FZ7A 3H9FA 2BILB 4EOQA 1XH8A 5JGAA 1YKRA 2QO9A 2YM6A 3QRJA 3V01A 4FV0A 4L01A 4QP6A 3K3IA 4FZDB 4D1ZA 1FPUA 4G31A 4R8QA 3GFEA 5TOZA 2ZDTA 4ANOA 1M2PA 3FY2A 4DTAA 5IH5A 4AGWA 3G6HA 2XKFA 5HO6A 5A6OA 2RG6A 1KV2A 2P2HA 5I9YA 4KUJA 2I0YA 4G3CA 4G9RA 4D5HA 4YLKA 3GBZA 3UVQA 4EYMA 5B2MA 4AA5A 2GFSA 5AP5A 3DBFA 3F2AA 5IZFA 1GJOA 4IFGA 1PXOA 5LVPA 3EN7A 3CJFA 4ZJIA 3W8LA 3AMYA 2WMTA 4TRLA 5D12A 4OBQA 1LP4A 4NL0A 2F7EE 4AACA 3I0QA 1ZYSA 1U54B 4CRLA 2VNWA 5HLWA 3R7IA 4B4LA 2PZYA 3GC0A 3HV7A 4LRMA 4RRVA 4EH6A 5JFVA 4J53A 1JSTA 2JDOA 1M2RA 4ACGA 3MB6A 2QR8A 3CP9A 3E7VA 4OBOA 4FSQA 4UWBA 3R7VA 2GMXA 2IWIA 4GV1A 2EXMA 3H0ZA 3WF5A 3VUDA 3MIYA 3TV7A 1H27A 2IZSA 4QMLA 4ERKA 5F4NA 4EH9A 5KKRB 2FGIA 4FG7A 5TT7A 2R0IA 3ROYA 4DEBA 4AZEA 5A4CA 1WAKA 4V0GA 4Q2AA 4E1ZA 5CAOA 2HY0A 3CQEA 1KWPA 3GI3A 4FTKA 4QO9A 4USDA 3FPMA 4FK6A 1ZZ2A 2XYNA 2BAJA 2A2AA 3NYVA 5CSHA 4ZTMA 4YTHA 5BVEA 1KOAA 3IKAA 2NRUA 4G6NA 2W1DA 3FMHA 4H58A 1H25A 2W06A 3MFTA 4HCVA 3O71A 2REIA 3QQGA 3T9IA 3UP7A 3MY1A 4QMSA 5HNIX 2QOFA 5HO8A 5EI6A 5IUGA 1UNHA 3GNIB 1J3HA 3EQPA 2C6OA 4HNIA 4QQ5A 1OKZA 3ZXTA 3LFFA 4WG5A 1FVVA 5FM2A 5DOSA 3AXWA 5G1XA 4FA2A 4A07A 5EDPA 4DBXA 2YDIA 4IB0A 4M0YA 2QOLA 3TJCA 3LMGA 4O96A 5HBHA 3R9NA 3DK6A 3OT3A 4JG8A 2O63A 2QODA 4N6YA 1UU3A 5CSWA 3GENA 4OAVB 3ITZA 4FODA 2EWAA 3OWPA 4KINA 5HTCA 4AZSA 4JDIA 5HU3A 4XOYA 3TZMA 4FTUA 3D5UA 4YJQA 2FA2A 3DFCB 2RFDA 2GNGA 4J95A 5JSMA 3ACJA 4BHNA 5DVRA 2WU6A 4L3PA 4KRCA 1K9AA 2YITA 4ZEGA 3JYAA 3S95A 4F4PA 3OCSA 2UV2A 4F70A 3NZ0A 3MN3A 5HIEA 5AJQA 1UV5A 3LFAA 4FUYA 2HCKA 4EJ7A 1PF8A 3P0MA 5FD2A 3TNIA 2X9EA 2CNUA 3OTVA 4NW6A 1PYXA 3FQSA 3FZ1A 2HOGA 2VTIA 3I7BA 3KY2A 4EQCA 4H3BA 3U6IA 3HMIA 3WF7A 3D2KA 4RBLA 5B2LA 1P2AA 4QNAA 5K0KA 4IC7A 4UZDA 3W55A 4ONAA 2W4KA 4RVKA 4F6SA 4FKJA 2PTKA 2QURA 4CZUA 3BHVA 2B55A 1YDRE 5FWKK 5AUYA 3DTCA 3PG3A 2W96B 3EHAA 4FKQA 4BCOA 1PMVA 1APME 4XV1A 4AFEA 1O6YA 3TT0A 3IONA 2OBJA 3KU2A 5BYZA 1OPLA 5CLPA 2H34A 4HNFA 5IQBA 2QG5A 4IZAA 4NM3A 3SXFA 1RW8A 2Y6OA 2J7TA 4EOJA 3G33A 4PV0A 3AC2A 3IG7A 5K4IA 1CKIA 3KGAA 3LPBA 3HDMA 3OTUA 3PSDA 3PY1A 3QCXA 4CFWA 3Q52A 4NZWB 2B9JA 3ODZX 1XQZA 2OW3A 3I0OA 4K1BA 4DG3E 4HGTA 3PE2A 4CKIA 4BCGA 3SXRA 1WFCA 2WZJA 3ZRKA 4EQMA 4RIWA 2QC6A 3IQ7A 3BYVA 3PFQA 1ERKA 4TKSA 3BLHA 5DPVA 4RSSA 2I6LA 2XM8A 4IBMA 3QZHA 2CKPA 2YAAA 2FB8A 3AGMA 4OTWA 4RZWA 4XG4A 4USEA 4IZ5A 4QTAA 4XYFA 3VJOA 3QQHA 2DYLA 2F7XE 3IW4A 3D9VA 2J6MA 4UZHA 4ZMEA 4EK3A 4FG8A 4C58A 3TZ7A 3NNVA 3JUHA 3QQFA 4R3RA 3I5ZA 4RJ4A 4UALA 3V5PA 4OT6A 3FC1X 4LUDA 2XK9A 4IAZA 4I5MA 1MRUA 1G8SA 2ERZE 3LZBA 4RFMA 2PULA 2EUFB 5F9EA 4KIKB 1YXUA 2X0GA 3AD6A 1WVXA 3KL8A 4R7IA 3VUTA 2JGZA 5KMLA 4G17A 3T9TA 4BKYA 3TG1A 4JBQA 3HEGA 3CGFA 2BFXA 2QOIA 4WRSA 5AR7A 3NMUF 5DR9A 2G9XA 4O2ZA 3UC3A 4FSWA 3DKGA 3UIXA 4FSUA 4BBEA 3QZFA 2YDJA 2X4FA 1RE8A 1YXXA 3AC8A 1YHSA 4WG4A 3P7AA 4G5PA 4FSRA 5CVFA 4AAAA 4QQTA 3BU5A 3GXLA 3PVGA 4P4CA 2Z2WA 4WUNA 3RZBA 4RZVA 2UW5A 1NXKA 3FL5A 3TV4A 4C34A 4AW0A 4ZSGA 4QYGA 3VBYA 3QAME 1K3AA 1XBCA 4I94A 4AUAA 3SRVB 2WB8A 4O82A 4CFUA 4KKHA 3GFWA 2VTMA 5CI6A 4ORKA 5HIBA 4UXLA 4YHFA 5EDRA 2YCRA 2VTOA 1ZYCA 2XIYA 3WZJA 4WSQA 2I7QA 4EOKA 3P5KA 1PMNA 1JPAA 5AA8A 3BV3A 2HW6A 3HDNA 2C5OA 4H1JA 4LYNA 5IH4A 4DEDA 3FKNA 1H4LA 4M67A 4GK2A 4BCKA 3O8UA 3R7GA 4ASDA 1YDSE 2XIZA 2OXYA 4WHZA 5A14A 5C8MA 3OVVA 3HECA 4I6BA 1JWHA 3FMKA 4FL2A 4IE9A 1JKLA 3LFDA 4MNFA 1U46A 3T8OA 2YIYA 4E93A 2GDOA 3KXXA 3ZO3A 3ZEWA 4FT5A 4NFMA 1ND4A 4CLJA 5FGKA 3VS4A 3DQXA 5HTIA 3CPCA 1LEWA 4GG5A 4BI2A 2OJIA 4FSYA 4QMMA 3KA0A 3U6HA 5IQFA 5HHWA 4U7ZA 3F2RA 3DNEA 3VNTA 4GU6A 2NNWB 4O0XA
chains in the Genus database with same CATH superfamily
5AP2A 2P4IA 2P33A 4HCTA 3MSSA 2OH4A 4IX5A 2UZVA 4QTEA 2YDKA 3R02A 4J71A 3VAPA 1DS5A 4A9SA 4GYGA 4E5AX 2X2KA 4YTIA 2ITOA 3E5AA 5A3XA 3L9NA 3ZZEA 4AU8A 2Y4IB 4B7TA 3T3VA 3B2WA 3W2CA 4AN3A 3PIXA 4C57A 1Y6AA 4F78A 3VRZA 4GK4A 3RPVA 4FTRA 3JY9A 4M69B 3AD5A 5HVYA 4C7TA 2PHKA 3F82A 3GCPA 3RBWA 2IVTA 4AGUA 1PXKA 4YMJA 3FXZA 4FEXA 4QQJA 3TI1A 4C2VA 5ANKA 2O65A 1OL7A 4JBPA 2FH9A 3VN9A 4DEIA 3FZOA 2QD9A 3HV4A 3PPJA 4BVUA 3L8PA 5CF4A 2YN8A 3R00A 2BZIB 5IA2A 1J7UA 3AKJA 3FAAA 3TYKA 4DDGA 1V1KA 5CVHA 4CGAA 4R78A 3ZM9A 3HMOA 1Q4LA 2XK6A 3ZYAA 3NYNA 3NEWA 2J0LA 3VHEA 3BZ3A 4IW0A 2F4JA 4ZAUA 2BAQA 4YJVA 2CLQA 4OTQA 4DHJA 3LAUA 4U80A 4FICA 1TKIA 5CU3A 2WIPA 4J8MA 5EM5A 3NW5A 5FP5A 5E1EA 2XKCA 3F3TA 4J1RA 3ZHPC 4E4MA 3SG8A 1WBNA 5F20A 1FGIA 5CEIA 3RNYA 3LCSA 4CT1A 3NUXA 3ZTXA 4BGQA 5IA0A 3QD4A 3W16A 2XK4A 3U6JA 4EH3A 5IA3A 3RZFA 1IAJA 3PRIA 4WA9A 1G8KA 3B8QA 1GZNA 4KABA 2YFXA 4AT5A 5CAVA 4U81A 5DEYA 1KV1A 2WAJA 4JJRA 4UMTA 3B2TA 3RPSA 5G6VA 3WZDA 3ZUUA 3QLFA 4CYJA 3UC4A 4IMYA 4PL3A 3ZLXA 4EC8A 4C3FA 1AD5A 2GQGA 4AZTA 4I23A 4BHZA 4BCQA 5AA9A 2X39A 4TW9A 2UVZA 3H4JA 3UZPA 3G15A 4LL0A 1O6LA 3CR0A 4O1PA 3NVKI 2VTPA 3TEIA 1URCA 3F66A 1KE7A 3KRLA 4I0RA 3UNJA 4ZS0A 1JVPP 3C5IA 2Y6MA 3QGWA 4TWOA 4A7CA 4A9TA 5CAQA 4GKIA 5KX8A 4XCUA 4OT5A 4BZNA 3UDTA 4W4VA 2HXQA 4EUUA 3BE2A 5EKOA 3OUKA 3QYZA 3MDYA 3UYTA 4LI5A 3KN5A 3CTJA 3K2LA 5CX9A 4XG9A 5AM6A 3ZC5A 5LMKC 2W1FA 5F94A 2IF8A 4O7LA 4JAJA 4U0IA 4IZYA 1CM8A 3IECA 4O1OA 2RFEA 4AA4A 1YOJA 4QMVA 4GT3A 5C8NA 4NFNA 1GZKA 4YO6A 4RJ3A 3I81A 1QPCA 4UWCA 4EBVA 3W0PA 1K2PA 5FRIA 1UKIA 3CBLA 3EKKA 2UZUE 1WBSA 3F69A 2YM5A 3SHEA 4KAOA 3VUGA 2ITWA 4JT3A 4YJTA 4B8MA 1NVQA 2Y0AA 3H9RA 3QTRA 5BVFA 4AT4A 1B39A 1OITA 3KN6A 3Q4TA 4TXCA 2C0OA 4QMOA 5DEWA 2WHBA 1O6KA 3EH9A 4EH7A 1PXPA 1CTPE 4BDAA 2OXXA 3PPKA 5FTQA 4CTBA 3MESA 1DAYA 1SNUA 2BPMA 1Y8GA 4O2PA 3KMWA 4PMTA 1KOBA 4L45A 2X8EA 3ZDUA 3KK9A 3W0SA 1QL6A 3FWQA 3MW1A 5T6KA 4D2PA 5EKNA 4YZNA 4F6UA 4EUTA 2WMAA 1TZDA 3OHTA 1ZYDA 2WXVA 3NR9A 5IDNA 4N57A 5J5SA 4NH1A 2OFVA 1P5EA 5ACBC 3LW0A 3MFRA 2W1GA 3V5WA 3NYOA 4DFBA 2RF9A 3D14A 1PMUA 3SLSA 3TWJA 4CRSA 4ACCA 4EYJA 2R3GA 2WQMA 2OG8A 3FYKX 3BLAA 2OJGA 2C1AA 3CXWA 3ORMA 4I93A 4C4GA 4W9WA 5KMJA 3DKFA 3C4WA 5KZ0A 3NNUA 4ZY6A 3VJNA 3H10A 3U4UA 3E92A 5ITAA 4FT7A 5BUJA 5EQEA 3TUBA 5T68A 3ZOSA 3A4OX 1G3NA 3VS2A 4Z7HA 1OI9A 3O96A 4QYHA 1WBOA 1UU7A 4HVGA 4GT5A 4F7SA 3QTUA 3Q6UA 5EQYA 3CD3A 5IA4A 1P4OA 5KNJA 2VZ6A 1XMMA 1S9IA 2YHVA 5EM7A 4DFZE 5L2IA 2CKOA 4QOXA 4TT7A 2B4SB 3O8PA 4GS6A 3FSKA 5J9YA 5D9HA 3IK3A 5D11A 4V0GB 4YJOA 4HCUA 5CTPA 5JZJA 4LDTA 2HY81 2ZOQA 1PXMA 4EZ3A 2W9FB 5IH6A 2UW0A 3G90X 3JVSA 1Q41A 1HCLA 3WILA 3AD4A 2W1HA 3P79A 5AV1A 3NUAA 1XJDA 5AR2A 4ALUA 2ETRA 2G2FA 4XMOA 5DNRA 5DLSA 4CT2A 2QOKA 4I6FA 4YP8A 2WMVA 4C3RA 4PL5A 3NW7A 1YWNA 3QCQA 2F7ZE 1DM2A 4FGBA 4FKSA 5CXHA 4FTJA 2VAGA 1PXIA 3JS2A 4L9IA 3N4VA 2O64A 4FSNA 5LWMA 2YM8A 4G6LA 2OIDA 2J4ZA 2VO3A 3ULZA 1F3MC 2UW6A 3BKBA 1M52A 3O7LB 4QP1A 4XLIA 4ZLYA 1JKSA 4I24A 4AXFA 1QPEA 2DQ7X 2XS0A 3ZC6A 4O27B 1Y6BA 2C5VA 2E9UA 3QD3A 4U44A 4ZZOA 5J7HA 2BRNA 3QA0A 2NPQA 4YJUA 5FXRA 4YLJA 3HYHA 4N4SA 4HZSA 3NGAA 3F3UA 5HCXA 5M09A 4AZFA 3HL7A 3RCDA 3DB6A 3QTZA 5FQDC 4A9RA 2CNVA 3GCQA 3QYWA 2PVNA 2V5QA 2W17A 2WQOA 4AGCA 3M11A 4Y5HA 2PUPA 1BI8A 1ST0A 3GGFA 4QT1A 2GU8A 2ETKA 3ORNA 3S4QA 4FI1A 3ZSGA 5M44A 5M4FA 4C4FA 4DA5A 3FHIA 3R1YA 5ANDA 2HZ0A 1BUHA 4DEHA 3GCUA 2R3NA 4OTIA 1XWSA 2ZVAA 3KRWA 4EOSA 1SMHA 2R3QA 4DEGA 4JQ7A 2ONLA 5AV2A 3QALE 3E8EA 1YWVA 2OWBA 3O8TA 4R5SA 5EHOA 3LCDA 1AQ1A 1UU9A 3GB2A 4FIEA 2CMWA 3FI8A 2C6LA 3W33A 1L3RE 4M84A 3U51A 1R3CA 4PRJA 2R3OA 3LIJA 2XJ2A 2YM4A 3VUHA 3P1AA 4LGGA 4I4FA 3ALOA 4FZAB 4ZSEA 3SX9A 3U87A 3COMA 5KKRC 3LKMA 2BALA 2IPXA 2CNQA 2WOTA 3OEZA 4GFMA 4C4JA 4Q5EA 2ZJWA 2J0KA 3KVXA 3R7OA 1PYEA 5IEVA 2FUMA 3EB0A 2B1PA 2C4GA 1OVEA 2BHEA 4YC3A 5ETFA 2ZB0A 4I5HA 3DA6A 5L6WL 3UODA 4WNOA 2VTAA 1PRYA 2PZ5A 3G51A 2X0PA 5AR8A 5BUIA 4IADA 4PP9A 3BI6A 4MBJA 3DBQA 4HJOA 4XEYA 3E7OA 4RIWB 3VS1A 1T46A 3BQRA 2CGWA 1TFFA 4FX3A 4XRJA 2VX3A 4U5JA 5AFVA 4Z9LA 2IO6A 5M06A 2UZEA 4MK0A 3TM0A 4AXCA 3QKKA 5C27A 5EW3A 4DN5A 2VGPA 1XH6A 2BIKB 2CPKE 3TCPA 4JIKA 2OF4A 4UEUA 3O23A 3QTIA 5HCYA 1U59A 3FMNA 3WF6A 2I40A 3C4CA 4NJ3A 4CV8A 3D2IA 1ZLTA 2O2UA 4OUCA 3UMWA 5KUPA 5IUIA 3AC1A 1UU8A 4PNKA 5IDPA 4XV9A 3VS5A 3PXZA 4PL4A 5FEDA 4XLVA 4WOVA 1ZMVA 2HWOA 3OUNB 2Y4PA 5HE1A 4EOIA 2XK8A 4W4XA 2F9GA 4IB5A 4E4NA 4PP7A 3TUCA 2XK7A 3BYSA 5EOLA 1WCCA 3RHKA 3L8SA 5DHJA 2YAKA 3AC3A 3Q9WA 4RC3A 4N6ZA 3SOAA 4I3ZA 3FMDA 1QPJA 4PTGA 3UTOA 4DTKA 2PUNA 3PVWA 5J95A 2AUHA 1LR4A 5JEBA 4HPTE 4DBNA 4ENYA 3ET7A 3D94A 3KVWA 4O4CA 2P55A 5A4TA 4MXCA 2P0CA 3FZSA 3OWKA 3ZUVA 1WBVA 4FEQA 4LRKA 2XUUA 2KULA 2XRWA 3Q9YA 2B9IA 3BEAA 4PPBA 4IB1A 4JG7A 4YZMA 2BFYA 3H9OA 3KULA 3RCJA 4QYYA 4BYJA 4W4YA 2ERKA 4QTCA 3D0EA 4I20A 3QKLA 5JMSA 1OIYA 5CNOA 2PWLA 2X7OA 2C6KA 2CGXA 2JDVA 3FLNC 3CKXA 4O7YA 5AIKA 5FTOA 3Q4UA 2Q0NA 2VNYA 3OEFX 3WARA 4AZVA 5H3QA 2WTCA 1BL7A 3E8CA 4K11A 4D2TA 4Z55A 4HGEA 2WTVA 2HENA 3IOKA 4AOIA 5HZNA 4DE4A 3EZRA 3ID6C 5EM8A 3BCEA 3R1SA 1SVGA 3R28A 3A8XA 5JKGA 2PK9A 4EOLA 4HVIA 3LFQA 3PG1A 4GU9A 4RVLA 2OLCA 4K33A 3ORZA 4TYHB 3OWJA 3HAMA 4IJ9A 4M68A 4O4DA 4WD5A 4FV2A 3LM0A 2XEZA 4O22A 5FP6A 4ANBA 1V0BA 4PPCA 3ZM4A 3ZXZA 2PMOX 3LQ8A 4S32A 2IZUA 3CQWA 4E26A 3ORIA 2YLFA 5GZ9A 2X0OA 3AKKA 1YOMA 3F2NA 3UVPA 4LOPA 2XH5A 2QU5A 3A8WA 5BPYA 5H8GA 3VBTA 3PJ3A 2PMNX 5H8EA 3W0RA 4JQ8A 3O50A 4JR3A 4FEUA 4NK9A 5DI1A 4RG0A 3LCKA 2J51A 3DKCA 2WMUA 3EOCA 1L8TA 3ATTA 2YIRA 4YPSA 3K3JA 4UBAA 4HGSA 4FV8A 3NLBA 2JFMA 2R4BA 1TQIA 3PXKA 1RQQA 3FLYA 3IW8A 4CG8A 1E1XA 2ZFYA 4D4YA 5IQAA 5IA5A 1LPUA 2BRMA 4IWQA 1ZMUA 3IDBA 4R3CA 3EKNA 3PJ2A 5B0XA 4BDBA 1ZARA 4D1SA 4AGDA 3P7CA 3ACKA 1LUFA 1SNXA 2JDRA 3MY0A 1GZOA 2CN5A 4RJ6A 2FYSA 3FMMA 3PXRA 4P5ZA 4R3PA 3REPA 4BBFA 2H96A 4WT6A 3FJQE 4PDYA 3GQIA 3DDQA 4AXAA 1Q8UA 3QUDA 2ZV2A 3HGKA 5A4EA 4F1OA 3R22A 1M7QA 3ZO4A 4A9UA 1AGWA 4EBWA 4K18A 4O6LA 4YZ9A 4UMPA 3DV3A 4GYIA 5L8LA 5C4KA 3VBQA 2C1BA 2ITUA 2JIVA 3ZLSA 1XH7A 4MVFA 3QTQA 4X2JA 5AAEA 2A27A 3R9RA 5C4LA 1SM2A 2GNLA 2UVXA 3FKOA 4FTLA 4TZRA 4GFGA 4MBLA 3RPOA 4X7QA 4C4IA 3VQHA 4S33A 1J7IA 5CEOA 1KE6A 1VLRA 1IA8A 3DNDA 4TNDA 4MHAA 2YM7A 3AGLA 3ERKA 3F3WA 2OICA 2ZYBA 3I6UA 4EEVA 4DH5A 1T45A 3LXPA 5BVDA 3II5A 1XBBA 3BBTB 2Y8OA 1Q8WA 3DAKA 3R1NA 2QOHA 4FTMA 2AC5A 4I21A 3SG9A 5HNGA 3EQIA 4K77A 4AQKA 3QQKA 4JQEA 1KUTA 4LQMA 2C47A 3QHRA 4I0SA 1H1WA 3KRJA 2CCIA 4S30A 4AF3A 2FSLX 4QMYA 3W0QA 2J0IA 2WMSA 4MXYA 3W18A 3R1QA 3ZFXA 3KREA 3LFNA 3CTHA 2PZPA 3DCVA 4XV2A 3PP1A 4RPVA 3DJ5A 4U3ZA 2VTQA 5LOHA 1Q3WA 1RDQE 4F08A 4RA5A 4C37A 4K0YA 1PXNA 4NT4A 3C13A 1Y91A 1Z5MA 4D2VA 4E4XA 2UUEA 4EKKA 2EXEA 3PA5A 3WIKA 4E6DA 5CAPA 4MQ1A 4J7BA 4LV7A 4A06A 1TQMA 3DTWA 3G5DA 3D5XA 4YU2A 2Y4IC 4CLIA 4FE2A 3EFKA 5HEZA 4CCBA 4YBJA 3HAVA 2UZOA 3FI2A 2ZV7A 4NM5A 3E63A 4IAAA 3D7ZA 4YSJA 1IRKA 4L7FA 4JX7A 4ZS4A 4CFVA 3FZPA 4NEUA 2C5XA 2VTSA 3BQCA 2RFNA 2C3LA 1M17A 3HV3A 1J91A 3M1SA 3Q32A 4LFIA 4MTAA 4WNKA 3ZLYA 4YUQA 1Q8TA 1QPDA 3CPBA 3NNWA 1ZOHA 3VVHA 4J96A 5A4QA 1QMZA 4GJ2A 4LMUA 1RJBA 4LUEA 2UZBA 5KZIA 4D9UA 4ZSAA 5I9XA 5KCVA 3UPXA 1PY5A 3VUKA 3QF9A 4ZP5A 4FTOA 3A7HA 5CWZA 3W8QA 5DMZA 2BZKB 3HLLA 1ZXEA 3QRIA 3GQLA 4YJSA 3MV5A 4ITIA 4HVDA 4AS0A 4O38A 4WNMA 4A4LA 5I9ZA 4JRNA 4JG6A 4C4EA 1H0VA 4NTSA 3PVUA 2BUJA 3UDSA 2C6DA 5TE0A 5KO1A 1FGKA 4XG7A 3W0MA 2RFSA 4ITJA 4CFFA 3UP2A 2GNHA 2YEXA 4WBOA 2BTSA 2FSOX 1NT2A 4O7ZA 5JK3A 2ITQA 4F99A 5GIOE 2YZLA 5HE0A 3MVLA 5LXMA 1Q97A 4IC8A 4FEWA 4F1MA 4O7WA 1OL1A 4F9BA 5L3AA 2R2PA 4QP4A 4FTTA 4TYIA 4GIHA 3C50A 5JGBA 3DFAA 4FNWA 3SC1A 3S0OA 3MA6A 2ZMCA 4X3JA 2PPQA 4DT8A 2YM3A 3Q9ZA 2RIOA 4EZ5A 4O81A 3UPZA 1PMEA 2QLUA 3PA4A 3QBNA 5C8KA 4BICA 2OJJA 2WGJA 3E8NA 1FMOE 1LEZA 2X7GA 3EIDA 3SDJA 4OTDA 1B6CB 5D1JA 5IQEA 3TZ8A 4E6AA 1JKKA 3COIA 2XALA 1XH5A 3I4BA 4FIHA 2E9OA 5A4LA 4RWKA 4Z3VA 3BL9A 5LMBA 3VIDA 2JKKA 1H1RA 2UW3A 3FXXA 5M08A 3IPHA 3L9PA 4V04A 3HA6A 5BYLA 3A60A 3C4EA 2O5KA 3LFBA 2ZAZA 3R8MA 4F0GA 3A99A 2GS6A 2YWPA 5AP6A 2WU7A 4PF4A 4BY9E 2GTNA 2W9ZB 3GUBA 4MXXA 3RNIA 4BCJA 5FXSA 1GIJA 3F3ZA 1UVRA 3L9LA 3Q2MA 2X1NA 5CQWA 3PUPA 4M0ZA 5AUVA 4BI0A 4IWDA 5HBEA 1WBWA 3PWDA 2R3FA 3HP2A 4LOQA 3WI6A 5HBJA 2XVDA 1H00A 2JKQA 2OIQA 3JXWA 4NCTC 4ZTSA 3R8UA 5D7AA 5HVKA 5JT2A 1KE9A 2X2MA 3V3VA 4EK5A 2H8HA 5M51A 4K6ZA 4BL1A 3UZRA 1GIIA 3LMHA 4BWPA 2WD1A 1FVRA 3C9WA 1GIHA 3DBCA 3OWLA 3P9JA 4N70A 5E7RA 5CEPA 4O7RA 4F1TA 5J5TA 3LFEA 3NVMB 5DE2A 5AM7A 3V04A 5K9IA 4PTCA 3S00A 4O7SA 5IISA 4IIRA 3ZBFA 5FTGA 1GAGA 3BYUA 4ZIMA 5LJJA 4IAYA 3R8VA 5AP1A 5HX6A 5GHVA 2VTLA 4YZBA 3ANRA 4E5WA 4O83A 1MP8A 5L2SA 2YCSA 2W1CA 4U3YA 4EH5A 2VWVA 1KE8A 2W5HA 4DFNA 5CALA 3BYOA 2PSQA 1J1CA 3A61A 3KFAA 4O0WA 3MS9A 3U9CA 5L2TA 3KRRA 4NU1A 3VUIA 5L8KA 5E8SA 1R0PA 4OTHA 1QCFA 4QDEA 2XNPA 4QP2A 3A7JA 1PW2A 5DFPA 3ZSIA 4W8DA 5BVKA 2XA4A 4D4VA 2JIIA 4MXZA 1DAWA 2WELA 4RJ7A 3TACA 4RGJA 1DI9A 4DGLC 2HIWA 4CKJA 4FGRA 2BKZA 5JGDA 4QMPA 1UNGA 3D7TB 2BHHA 3DLSA 3ZLWA 3RWQA 2H9VA 3Q6WA 4EHZA 3KXGA 4Y8DA 2XIRA 3AC5A 2WTKB 2ZM3A 3H0YA 3HV5A 5HTBA 3QRTA 3QA8A 3AMBA 5KMIA 1I44A 2J0MB 3N4UA 3C4FA 1XMLA 2OK1A 3U8WA 4BCIA 4ZTRA 3MH3A 5AIRA 5M53A 3R9HA 3BU6A 4ZJJA 2YCQA 1JNKA 2QR7A 3F3VA 1XR1A 4ZTHA 2B9HA 4CSVA 4DLIA 5EDQA 5KHXA 5AP3A 4EOMA 4EH8A 4OTFA 1ZY4A 3R8LA 3DT1A 4PUZA 4ZSLA 2I0EA 5CSXA 3CY2A 4HYUA 5AUWA 5AR5A 4KBCA 4M15A 4BDCA 3CQUA 4F63A 4JRVA 4HZRA 3P4KA 3POOA 3VS3A 2B9FA 3RHXA 2VUWA 4EK6A 4E6QA 3LXKA 5EHLA 5LCJA 3Q60A 2BRGA 3CCNA 4MBIA 1J7LA 5DT0A 1M2QA 5GZ8A 2GHLA 2R9SA 5HE3A 1PKDA 3D4QA 3FHRA 2VTHA 3HRBA 4IAKA 1OBGA 2XKEA 3I7CA 4RWLA 4BDGA 2ITVA 4BTFA 4DYMA 5FBOA 5A6NA 3LMIA 5HCZA 2R64A 1UKHA 2PYWA 4UN0C 2JKMA 3QFVA 2WMBA 1WBTA 2BRBA 4J97A 1Y8YA 3NUSA 4IH8A 3W32A 1YVJA 5J79A 4FT3A 4YNOA 1M14A 5CXZA 1XKKA 1YDTE 5AADA 5CZHA 1WMKA 3BX5A 1OM1A 3EL7A 4IDVA 5IQCA 2ITYA 3TMOA 3DAEA 5J1VA 3ZEPA 2VWYA 4E5BA 3ZO2A 4BI1A 4XG8A 5ANEA 2VWXA 4OGRA 1HCKA 4ZXTA 4CV9A 4J98A 3W2QA 1OGUA 4CKRA 2QU6A 3QQLA 4AE6A 4R7HA 1CMKE 4DFUA 1W7HA 2IVVA 3BPRA 3SKCA 4FKRA 4M66A 3MYGA 4ERWA 3UG1A 3LCTA 2P2IA 2XNBA 1BI7A 4CTCA 2UZNA 4D2WA 3NUNA 2WOUA 3MTFA 4PTEA 5JRQA 2F2CB 5AV3A 3KIOC 2PVJA 4CNHA 5DBXA 3SGCA 4WBBB 3C5UA 4B99A 3IDPA 2B54A 3KULB 4P2KA 4L67A 5I9UA 4ANSA 1KSWA 4RFZA 3PUFC 2R3PA 4WNPA 2W1EA 5LWNA 4OTGA 2AYPA 5FEQA 4GKHA 4EOPA 1MRYA 3DXQA 4DFLA 3I5NA 2QVSE 1WZYA 4O4BB 5IKWA 5J9ZA 3E3BX 1VYZA 2WPAA 2OFUA 5CSVA 1REJA 2WMQA 2WEVA 3D5VA 3E64A 2WO6A 3EFWA 5CEQA 3ZSHA 3VBXA 4C38A 4U79A 3HZTA 5FXQA 4BCHA 5IEYA 2X2LA 2VX1A 2R3RA 3Q04A 4PDSA 3AT4A 5CI7A 1SZMA 1ZYLA 3DJ7A 5E9EA 4GUEA 2O3PA 3QGYA 5HOAA 3LLTA 4MNEA 4MXAA 4FKUA 5GJFA 3WBLA 4O86A 4H3PA 3Q53A 3Q9XA 3DAJA 3NCZA 3TIYA 5EFQA 4JR7A 1OIUA 1H1PA 1W8CA 4RIOA 1OPKA 3DPKA 2VD5A 3DXNA 5I0BA 5L6OA 2CGUA 2ZV8A 5M57A 5DRDA 3NNXA 4C4HA 3UVRA 2VWWA 2VTRA 5EW9A 2CCHA 2YJRA 4ZZMA 2F2UA 4PPAA 1OKVA 4FNYA 2JBOA 3B8RA 3V8SA 2C0IA 2X7FA 2PUUA 3EYHA 4I92A 4ZTNA 4JI9A 3PSBA 3MGYA 5JZNA 5LVLA 4EK4A 4QMWA 3AQVA 1JBPE 2A98A 2VO7A 3R8PA 3ZBXA 3NFGB 4FKOA 1UNLA 5H9BA 3WE4A 4X3FA 2BKKA 4KNBA 4IANA 3RI1A 2QOOA 4EHEA 4YZDA 3S3IA 4OTRA 3VC4A 3DGKA 2W05A 2A4LA 4K2RA 4Q5HA 3DQWA 4G3FA 4BIDA 2PVLA 5IU2A 4FTIA 4QDVA 1OUKA 4MAOA 3P08A 5FEEA 3UJGA 1TVOA 4XJ0A 1PXJA 3SD0A 2W1IA 3FMLA 4YNEA 5E4HA 4CXAA 4EQUA 1FQ1B 3AG9A 3G9NA 1UA2A 2ZM1A 2IW8A 1F5QA 4RLKA 3RK9A 1H01A 2GNJA 3FMJA 3G0FA 2HAKA 4FZFB 4U6RA 5DG5A 2R3JA 3N51A 3TDVA 2JBPA 3ZU7A 1YOLA 3FI3A 3SOCA 2XNEA 5EI2A 1BMKA 2YIQA 2XAOA 3EQFA 3GOKA 5C1QB 5J7BA 4F09A 3C0HA 3P23A 2WQEA 4O0YA 2QHNA 3OT8A 3V6SA 3KQ7A 3KXMA 3OFMA 3GC8A 3V5LA 4O0UA 4CMUA 2PVHA 4RWJA 3EN6A 4GIIA 4GL9A 4NM0A 1P4FA 2PZIA 3RKBA 4F65A 4I41A 2C5NA 4IACA 4I4EA 4EHGA 3E88A 4HOKA 4C61A 3NCGA 4H05A 5EQPA 2XM9A 4MD8E 4DH8A 2QKRA 5CU0A 3PZEA 3EWHA 4BTJA 4DGNA 5AUTA 3H3CA 5J87A 4O21A 4JMQA 3C4XA 1XBAA 3RK5A 2YIXA 2PVYA 4I6HA 4XV3A 5HX8A 4BF2A 4HVHA 3UNKA 4RIYA 4U40A 3QXPA 3QC4A 2BVAA 4LMNA 1GZ8A 4L00A 2XK3A 1FINA 3FQEA 5DR6A 2XEYA 2JEDA 4QMUA 3QHWA 4RQVA 4BBMA 5GINE 2HW7A 3ZS5A 4F9CA 2XARA 2ACXA 3OY3A 2YERA 4MH7A 5BVWA 3ZMMA 3RPRA 2XZSA 1PXLA 4LRJA 4FKGA 3E62A 5IQHA 3FDNA 4RC2A 1XH9A 2HZNA 1B38A 2WQNA 3E8DA 4J99A 4CYIA 3BL7A 5HLPA 3PPZA 4ACMA 1SVHA 3NPCA 3ZFMA 2UW7A 3WZUA 1GNGA 2I0HA 2J5EA 2VTJA 4PY1A 4AAYA 4ID7A 4CZTA 3KF7A 2P3GX 3FLSA 5E8VA 4FKTA 4YSMA 3OOGA 2G01A 5CU2A 4E20A 2XBJA 3EN9A 3A7FA 3GU6A 5E90A 3TKHA 5B7VA 4FV7A 3FY0A 3GU8A 1VR2A 4D4RA 2OSCA 4F0IA 3IW7A 3BGZA 5HGIA 2W7XA 2AC3A 5DN3A 3IW5A 3I1AA 3LQ3A 3VF8A 3VW6A 2NRYA 3UQGA 4RIXA 2RKUA 4TYGA 5IEXA 5EM6A 2WMXA 5L8JA 3WYYA 4YC6A 3V5JA 3KXHA 4TYJA 4L46A 4AX8A 4DGMA 2ZB1A 2X9FA 5AX9A 3QD0A 1H1SA 2JAMA 5GNKA 3OD6X 5HNBA 1W82A 4L53A 4PMMA 4QMXA 4NYEA 1CKPA 4FK3A 2F57A 5LCKA 3UBDA 3PJCA 4RX7A 2AQXA 1BLXA 2J5FA 4BDKA 3MJ1A 1W0XC 4B6LA 3EN4A 4Z16A 1JKTA 2J9MA 3C0GA 4RVTA 2QOBA 3RM7A 1NVRA 3K5VA 3MH0A 4QPSA 4WUAA 4ZSJA 5FLFA 5TO8A 1GOLA 3OG7A 3V51A 4AE9A 2Z7LA 5JQ8A 2H6DA 5EYCA 2G15A 1MUOA 3KEXA 4RX9A 4BJJA 3LQ5A 4R1YA 1YW2A 5AV0A 5CAUA 4UX9A 1A9UA 2HZ4A 4XH6A 4BZOA 4YJPA 2GHMA 1UWJA 2VU3A 3FZRA 4CD0A 5BNJA 1Q3DA 4MXOA 4M7IA 2W4JA 4QP9A 3ORPA 2ZMDA 3AOXA 2BZJA 3ZO1A 3IGGA 4H1MA 5JFSA 2IEWA 4F7JA 2IVSA 4GJ3A 2WTJA 4S2ZA 5CSPA 4AOJA 2YACA 4FTAA 4IHPA 1ZOGA 2XIKA 4FV9A 3R7YA 5AV4A 2OXDA 3MPTA 4IWOA 5CASA 3I6WA 3MVHA 5IQGA 2VO6A 4BDEA 4QMTA 3UDBA 1H26A 1JLUE 3F5XA 3EQRA 3OS3A 4FKWA 4BWKA 3GOPA 3SQQA 3TNQB 2XYUA 3R73A 2WQBA 2FO0A 4JXFA 4U9AA 3U54A 1O9UA 1SVEA 4XG2A 5T3QA 4BC6A 3FUPA 1FOTA 3O2MA 4DINA 4LL5A 3QD2B 3LJ1A 2E9VA 3RK7A 3FI4A 1G8JA 2CKEA 4KA3A 4DFXE 4GSBA 3QX2A 4JVGA 4YTFA 3UOJA 3NX8A 4RWIA 4C33A 1HOWA 3EZVA 1JAMA 3QL8A 3UMXA 2BDWA 4CVAA 3GU5A 5AP0A 3EQDA 2ITTA 3FL4A 4XBUA 5E92A 2JLDA 5FDPA 2GPHA 1OL5A 4KSPA 4XG