5HTBA

Crystal structure of haspin (gsg2) in complex with bisubstrate inhibitor arc-3353
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
328
Chain Sequence
b'GPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase haspin
publication title Co-crystal structures of the protein kinase haspin with bisubstrate inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 115
structure length 328
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5htbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5htbA01
4L9IA 4FSWA 4N4SA 4K77A 4MEDA 4RC4A 5TR6A 2G15A 2I0VA 2WEIA 4WUAA 4YC6A 2VWZA 4AN3A 4C3FA 2VX0A 2XK4A 2NO3A 2IO6A 3PY1A 2QOCA 4IWQA 3C51A 1W82A 4FTQA 5HI2A 3IDBA 4AZWA 4BWPA 4BZNA 4E8AA 4ANMA 1JSTA 3DBDA 4KIQA 3PJ2A 3LW0A 3CJFA 1S9JA 3F3TA 5ICPA 2ONLA 4RJ5A 4IWOA 3ZFYA 5CEKA 4BDBA 4DYMA 4RGJA 5IQBA 4DINA 5G6VA 5ANKA 2NRUA 3GC0A 4AF3A 2QI8A 3QXOA 4G9CA 4QPSA 5M4CA 2VWWA 1MRUA 3AMYA 2X7OA 5JGAA 1WVYA 4CFXA 4CLIA 3BU6A 5HX6A 4ASEA 1OL2A 5M06A 3V5TA 2ITNA 5L2QA 2QKRA 4DGGA 3O71A 2R3LA 1BI7A 3PRFA 4PF4A 1KE8A 1WBNA 3H0YA 5F4NA 4R1YA 2HW6A 3UZRA 3BIZA 4FOBA 1GNGA 1VYWA 2VU3A 4EQUA 1M2PA 3F61A 1ZYCA 5AFVA 2XKFA 5D11A 2CCHA 3BGZA 4JLCA 4ZTNA 4BIEA 2R3OA 4AA0A 1KWPA 4RG0A 3EH9A 4RC3A 4UWBA 4RWJA 4USFA 2RIOA 5AR8A 5C8KA 2F2CB 3ZZWA 2J0KA 4FX3A 4FZ6A 3ZONA 4P4CA 3LMHA 3HV6A 2QURA 4PL3A 3NCGA 4ALVA 4YMJA 3FZ1A 4U3YA 1H24A 4OR5A 5FEDA 5BVNA 5J7BA 4OTWA 5FM2A 3DKFA 3VS4A 2YITA 3EN6A 4F99A 3UVPA 3LJ1A 1STCE 4CYJA 4F0FA 3KXHA 1ZMUA 4NEUA 3V5LA 3COKA 5IQEA 2BZJA 5J87A 2YZLA 1S9IA 2BVAA 2YIYA 2FVDA 2PVYA 4KBKA 3LFSA 3VBVA 3MDYA 3ZLXA 4FEQA 3UOHA 5K3YA 4GT3A 3WF8A 2BDFA 2YHVA 3MWUA 3PIZA 4WBOA 3UP2A 4AACA 2IZTA 3TDWA 3WF6A 4ZS0A 4CZYB 4UN0C 2VAGA 2OXYA 4NK9A 2WGJA 4BL1A 3ROCA 4RFYA 4Z55A 2W9ZB 4O0YA 1YHVA 2QU6A 4G9RA 3CP9A 4V01A 5K9IA 4DEAA 3UO4A 2OIDA 4H1MA 5M53A 3VBYA 3GU5A 5IQCA 4KSQA 5GZ9A 1WMKA 3NNVA 4RJ6A 3C4FA 4UWCA 3ZC6A 2VWVA 3NCZA 3V8TA 1UKHA 2O0UA 4FVQA 3EQGA 4M12A 4QO9A 5D7AA 2WOTA 4Z3VA 3BEAA 1GAGA 1UU3A 1YWNA 4CMOA 3QC4A 4CCUA 2VTRA 5CAOA 4EWHA 4YP8A 3FJQE 4J8NA 3GQIA 4J99A 4L3JA 3VHKA 3WF5A 4UMUA 4JDKA 4K1BA 2XYUA 3R8LA 4BGHA 1OIRA 3QZGA 4F70A 3OXTA 2UZDA 3QUPA 4LOQA 4RA4A 4FIHA 3AC4A 5L6WL 4L3LA 3RK9A 2QU5A 2H96A 1GIJA 3QRJA 3AD6A 4DGOA 5E8WA 3P79A 2FH9A 4YBJA 1Y91A 4AUAA 4QP7A 4D4SA 4EH2A 5HX8A 1G3NA 3FZRA 3GCPA 4DH5A 4AGWA 2BPMA 4LM5A 5ETCA 5FRIA 3E5AA 3D7ZA 4GVJA 5CI7A 4CKJA 5HVYA 3EKKA 2QQ7A 4A7CA 3DQWA 4O6LA 5I3RA 2C5XA 5AR3A 3GP0A 4NCTA 4FTIA 1H0WA 2XKCA 2CMWA 5J1VA 3UODA 3HA8A 4QMTA 3ZU7A 4BKZA 4CTBA 2WQOA 3MVMA 1U5RA 3II5A 5FG8A 3VQHA 5HTCA 4I5PA 2PVNA 2VNYA 3IDPA 3QYWA 1IR3A 4JS8A 3S4QA 3IGGA 4H3BA 5HO6A 3WZEA 4FV4A 1LEZA 2OI4X 1XBCA 2XM8A 5AV1A 3HKOA 4E93A 2E9OA 3H10A 4PQNA 3NYXA 5GINE 2UW8A 2C6EA 2PHKA 4JR3A 4HZRA 1Q3WA 4QOXA 4YHJA 4O0SA 2VRXA 3FLYA 3FXXA 4BCFA 3O8UA 4R3CA 3A8XA 4TRLA 4KABA 2CNUA 3BKBA 4F0IA 3U51A 5EOBA 3BPRA 5HO7A 3UMXA 2CLXA 3LM5A 4OT6A 5IA0A 3QCQA 4APCA 5KKRB 3B2WA 2YJRA 4P5ZA 4R78A 1H1SA 4QMLA 4XG3A 3UQGA 2VTLA 4BZOA 5EKOA 4MBIA 1W0XC 1REJA 3TI1A 3U4UA 1JKLA 3PA4A 4GCJA 4F65A 3N4VA 4FKRA 4RC2A 4DITA 4DTAA 3FMEA 2OU7A 3MTLA 4I5MA 5HIEA 3MH0A 3ODZX 2C6OA 4ANNA 3I79A 1UNHA 3OCSA 4XRJA 5DYJA 3R8ZA 2RL5A 2B53A 2PVRA 5FP6A 5A4CA 3BHVA 4P7EA 1IA9A 3R8MA 1ZOEA 4P90A 2QO2A 4O84A 2ITXA 1REKA 3PWYA 5DN3A 5F94A 3IS5A 1ZWSA 5DG5A 4CRSA 5C1QB 3KK9A 4DEDA 5K5NA 2XBAA 4E1ZA 1Q62A 4RSSA 4DFBA 1RDQE 3LXLA 2A0CX 2OGVA 2VNWA 2WQBA 3F66A 3PPZA 4XV3A 1OL1A 4PPAA 3QWJA 2VN9A 4IACA 1YWRA 1VR2A 4L67A 2ESMA 4B6LA 2BFYA 3FUPA 1NVQA 2O64A 4C7TA 5M51A 2X2KA 2W4OA 3IONA 4QP2A 5I9WA 4JG6A 3MYGA 1WVWA 2C6LA 1YDRE 3SLSA 3SA0A 3GGFA 3MGYA 1GOLA 1ZYDA 1M7QA 4FSZA 3R83A 4D5KA 3ODYX 5GIPE 3RAKA 5ANOA 2HY0A 1PJKA 4FKJA 3RGFA 1W8CA 3DK7A 3OHTA 4A07A 4GKHA 3FWQA 3BLQA 2OK1A 3NUYA 3EL7A 5CNNA 3HMNA 4C3PA 3FLWA 4TYHB 3I81A 4MYGA 3W10A 4QTBA 2BR1A 4KIPA 4ZSJA 2I1MA 3CTJA 4M97A 4IM3A 3T8OA 3MPAA 4X3FC 4DE4A 1JWHA 3P08A 4X2NA 5CENA 3A62A 5CU4A 4LUEA 4B9DA 1PYEA 3QF9A 3LMIA 4Y5HA 3FMJA 5CSVA 1O6LA 2C3IB 2VZ6A 4TWNA 2GNJA 1Z57A 3C7QA 5AMNA 4EH8A 3KXXA 3PY3A 3RZBA 4EK4A 1JOWB 2JBOA 2R4BA 3FKNA 5GJFA 2QOOA 3G15A 3BQRA 4JDHA 5DR2A 4E4MA 1QPDA 2J7TA 3OUKA 3FPMA 2IW8A 3SX9A 4KRCA 4IVDA 4LL0A 3K5VA 4YLJA 4B99A 4YGAA 2PPQA 1TQMA 3E93A 3E64A 4QP6A 3FDNA 5TF9A 1WBTA 3LFNA 2OWBA 1L8TA 2PUNA 3VS3A 2UW6A 4KIOA 4C2VA 4FSMA 4BCJA 2H34A 3G90X 4M13A 3G33A 4YSMA 3RZFA 5CAQA 3F5PA 3POZA 4EJNA 3R1NA 4O1OA 5EYDA 2IVTA 1PMEA 4WT6A 4BDIA 3FSFA 2VWUA 4BCPA 4PP9A 2PZYA 2O3PA 4NKAA 3RNIA 4BHNA 3OWLA 2UW9A 3LXNA 1KOAA 2ETMA 2ZV7A 4XBUA 2EVAA 5F20A 3KMUA 4ZLZA 5DBXA 2BAQA 4JG7A 4DLIA 2F7ZE 1XKKA 3AG9A 3OW3A 3KVXA 5A54A 3LFAA 4CFVA 2WTKC 1APME 1MP8A 1Q24A 4IM2A 3ROYA 4EZ3A 1VJYA 4PPBA 5EW3A 3DJ5A 1OPKA 2BTSA 4I6HA 3ZRMA 5DRDA 4ZTLA 2CGVA 1VZOA 3MPMA 4V04A 1F3MC 4IHPA 2V5QA 3HRCA 3UGCA 5I9ZA 3TZ9A 3TUDA 2UW4A 3EOCA 3D7TA 3UNJA 4O0WA 3SXRA 4BHZA 4C4IA 4LRKA 4ZZOA 3I7CA 3NYVA 4EOOA 2W1DA 4KIKB 1E9HA 4FV3A 1GIIA 5AP1A 2LAVA 2YCSA 2C5NA 3EN7A 2OFUA 3DLSA 4TW9A 3BBWA 3EJ1A 3CR0A 4XLIA 3UO6A 4I5HA 3DAJA 3RTPA 1R78A 5D41A 4XV9A 1YVJA 1M2QA 5AR5A 4BCMA 2VTSA 2XZSA 5DI1A 2W0JA 3TIYA 3CCNA 4OBOA 2JIIA 4OTIA 3A4PA 4PDSA 4CRLA 4U80A 4TN6A 2I0EA 3SD0A 3ENMA 3N4UA 3OCBA 1PXIA 2OZOA 2B1PA 3NRMA 5H2UA 1VEBA 4IVAA 5AADA 1QPEA 2ITWA 3KB7A 5CU6A 5DT3A 3HMOA 2YDJA 2ZOQA 5D10A 2W1FA 3R9NA 5LMKA 4QTEA 3EFJA 2FSMX 3F6XA 4TYEA 4RJ7A 5ETAA 3RK5A 1I09A 2J5FA 3QRIA 1U59A 3P78A 5DEYA 1CSNA 1YDTE 2V55A 3TUCA 4ZSEA 4ZJIA 4W4WA 3DLZA 1KE9A 1TQPA 4L6QA 4BWKA 4FT3A 1P4OA 2A1AB 1YDSE 4G3CA 3V01A 5CU0A 4MD8E 1UWHA 2XJ0A 3ZO4A 3U54A 4MBJA 3BWJA 2HIWA 3ORTA 5E4HA 2ONLC 3IW6A 4DT9A 3KU2A 4FIGA 2Y4PA 2W9FB 4A9TA 3FZOA 4Y95A 5JK3A 1OL7A 4L3PA 5HCYA 4Y5QA 5BX0A 4G2FA 2UZBA 2CDZA 4GVAA 2QOIA 3CY2A 4F64A 3FY0A 4FKPA 4IAYA 4N57A 4LV8A 3NPCA 3RPVA 3D7TB 2Z7LA 4F9WA 1YHWA 1BYGA 4I5CA 4EJ7A 2GNHA 1Y57A 2OO8X 5M57A 3VAPA 2YWVA 3RVGA 4QYEA 1ZYLA 1UNLA 5A6NA 4FVRA 5AUVA 4Z16A 3DCVA 2E9UA 2J0IA 5TOZA 2GFCA 3OXIA 1PYXA 3K3IA 4QMWA 3QGWA 4TKSA 3LQ8A 3VC4A 4TT7A 4P2KA 5JSMA 3VF9A 2YM4A 4WG4A 5CNOA 2PVHA 3DK3A 4NM0A 4FZAB 5E9EA 3PE2A 3TXOA 4BC6A 3KN6A 3A7JA 3Q3BA 4MTAA 3UPXA 1ZXEA 4UX9A 4U79A 2R3FA 3FE3A 4R3PA 1G5SA 2UZWE 4EH5A 1G8SA 4YUQA 5CX9A 4EZ5A 5EK7A 1E1XA 1UVRA 3QQLA 3IO7A 4CVAA 2XNPA 2Y4IB 2QLQA 3R28A 2AUHA 5A4TA 4IB1A 4KS8A 4H05A 4EONA 4RZVA 3E8CA 4QP1A 3DFAA 4E7WA 2JIVA 3BE9A 3RAIA 4O7SA 4YJVA 1TKIA 5IDNA 3PYYA 5GJDA 5ANEA 4S33A 4K6ZA 3ZO3A 4BDHA 3EB0A 3W2CA 4NIFA 4QMQA 4GT5A 4GYGA 4YURA 2ITUA 4LGDA 3MVHA 4O1PA 3BHYA 3W8LA 4D4RA 1LPUA 3C0GA 4RIXA 3UPZA 5C4KA 1Q97A 4UEUA 5HCXA 3UJGA 3TM0A 5GNKA 4J53A 4AGCA 5CF6A 2GHMA 4X3JA 2ITQA 4AT3A 3AQVA 1W83A 1OI9A 3IW7A 3D15A 2I7QA 4QMOA 4RX8A 2OKRA 5HESA 2XIYA 4RVKA 3MBLA 3BWFA 5ANGA 3ID6C 3LXKA 4KS7A 4K9YA 3HAVA 5GHVA 3MN3A 2YAKA 3T9TA 1CKPA 1H08A 3PUPA 4F09A 2BALA 4QMUA 4HJOA 4IE9A 5FTOA 2Z2WA 3M11A 3RCJA 4CNHA 3FHRA 3HA6A 2AYPA 4FIIA 1KE5A 2B4SB 3FI4A 3IDCA 2PL0A 2UZNA 3BGQA 4FKGA 4UB7A 4O21A 1JSUA 2C3LA 4GS6A 4JX7A 4E5BA 2XBJA 2CNVA 2PSQA 3TKIA 1OKYA 3U6IA 5AEPA 2PZRA 4X6RA 5HNBA 3VHEA 4DG2E 5M08A 2C3KA 3PVBA 1J7UA 2H8HA 2H6DA 2VO6A 5J5SA 4BF2A 1OIYA 4TYJA 2BIKB 2XRWA 5E8TA 4EOKA 3S95A 2W1HA 4QNAA 2B55A 5IQAA 4LMUA 2E2BA 2CHLA 2QOQA 4HYSA 3R00A 5HLPA 4EOSA 4TL0A 3Q32A 5K4JA 2QG7A 3E8EA 3QTQA 4YBKA 4I24A 4C62A 3R7OA 4FG9A 4RIOA 2GQSA 1GY3A 3RAHA 4NCTC 4F0GA 4L44A 4J7BA 4O0VA 4ZEGA 4IADA 3ZZEA 4TXCA 2UVZA 4I3ZA 5J9ZA 3E7OA 2R3QA 3OT3A 2HENA 4JG8A 2NNWB 1U4DA 4FEWA 4ZMFA 2WFYA 3R7VA 3G6GA 3IPHA 4NIFB 5IMEA 4NFNA 1BL6A 3GBZA 1G8AA 2JDRA 3BELA 1ZZLA 3DZOA 3MESA 3AOXA 3WZDA 5K4IA 1XBAA 2CN5A 4Z9LA 5EM6A 4G3DA 3DGKA 3BEGA 1URCA 4BDFA 1YKRA 4YTCA 4FV6A 1KOBA 4NTSA 3ZUTA 4BWXA 1PMVA 4IX6A 3EKNA 2FSLX 2OF4A 4J52A 3R9DA 2QOHA 3LKMA 5BVFA 5BVEA 5L8KA 3A8WA 4WSQA 3QX2A 2HW7A 3P5KA 2WMBA 3HUCA 4YO6A 2PYWA 1ZMVA 3EN4A 4RVLA 4ITIA 1CM8A 3FMNA 2P2HA 5CTPA 4GEOA 2QOKA 3M2WA 3UVQA 2PMOX 4R7IA 1Q5KA 3TZ7A 4BTMA 3MY0A 5AIRA 2BCJA 1H25A 4F7SA 5CASA 4KUJA 4DH7A 4DA5A 4OGRA 1Y6BA 4R7HA 3W32A 3WF9A 4U41A 3RALA 3VS2A 4FL3A 3OCGA 1MUOA 3RKBA 4EHGA 3NAYA 2HZ0A 4LOPA 4QQTA 1QCFA 2ETKA 1YI3A 3LLTA 2HZ4A 1PKGA 4M84A 3NLBA 1YI4A 5CT7A 2Y6MA 3QTSA 4QTCA 3HNGA 4YNOA 1OUKA 3VBQA 3QD2B 1UU7A 3VRYA 5L6OA 2BRNA 2XYNA 4EYMA 4AZTA 4FV1A 5BNJA 2ZM1A 3LHJA 5CXHA 1A06A 2W99B 2YIQA 4IM0A 4FL2A 2W4KA 1YXTA 3M42A 4O96A 3CQWA 3L8SA 3FPQA 5IF1A 5M56A 3GU6A 5IISA 1A48A 5CQUA 5HLWA 2C30A 3OOGA 3LQ3A 4BKJA 1PMUA 3SVVA 2NPQA 3F82A 1WVXA 3FL4A 2ZM3A 4ZLOA 5LVNA 4B8MA 3DNEA 4R8QA 3AT4A 2W5HA 3NYNA 3QLGA 4XS2A 4EH9A 4EOLA 4TPTA 4XG9A 1OUYA 4H39A 4ZSGA 2X81A 3L9PA 4HCVA 3RPYA 3AMBA 2JDVA 5FLFA 3ORXA 4V0GB 3RHXA 4YJPA 2Z7QA 3W2QA 3D14A 3EYGA 3KKVA 2PY3A 4LI5A 4JIKA 3DXPA 3MB7A 5ANJA 4PRJA 4WO5A 3QC9A 2ZB1A 3W8QA 4IVBA 3OY1A 5DPVA 5FD2A 1GJOA 1XR1A 4I6BA 3IOPA 1OBDA 4ALUA 5BMSA 5IG1A 5AX3A 4BI2A 3KXGA 2QR7A 2PVJA 3F7WA 4UZHA 3QYZA 4GMYA 4I0SA 4ARKA 4CV9A 5L2SA 5CWZA 4I21A 4Y73A 3N51A 1IA8A 2J6MA 5D7VA 2BDJA 3LOKA 5CZHA 3SXFA 3NVMB 4B8LA 4HPTE 4E6AA 3EIDA 4YPDA 2KTYA 3KC3A 3VJOA 4D4YA 2YZAA 3MH1A 1KV1A 3BX5A 4BIDA 3LLAA 4WUNA 2WU6A 5TT7A 3QQJA 3AMAA 3N9XA 4G5PA 3C4CA 2X7GA 1B38A 3QHWA 5DLSA 5CQWA 3TNPC 4IAKA 1ZLTA 3HZTA 1ZARA 4PTGA 4XG6A 1W7HA 5FP5A 4AW0A 2HOGA 5BVKA 4FI1A 4MCVA 4QRCA 4AW1A 2G9XA 3KN5A 4U81A 4AAAA 3R04A 4OTHA 3MA6A 4RQVA 3PSCA 4DFZE 5AUTA 4W9XA 2WTKB 4XUFA 2WIHA 3GVUA 4GK4A 4CT2A 1CTPE 1URWA 2REIA 3A61A 5LCJA 4MWHA 1LR4A 3QALE 1KUTA 4PUZA 1SNXA 5JQ8A 5J79A 2OJJA 5KZIA 3R1SA 3PPKA 1IG1A 1WFCA 3G5DA 4O6EA 4FEUA 3QTZA 5CAVA 3PVUA 5HG9A 4YSJA 2BZHB 3Q4ZA 5IEYA 1F0QA 1KSWA 2R3HA 3QGYA 3O17A 2QOBA 3PJCA 3GNIB 3OOMA 2UZLA 2OG8A 2JKKA 3SXSA 4FTRA 3TNWA 2WTIA 4BYIA 4ZLYA 2XK8A 3E87A 3Q5IA 3CSVA 1PRYA 2ZYBA 4NM3A 5D12A 4ACGA 1DI9A 2YM7A 3QQGA 3T3VA 4EBVA 3EN5A 4R6VA 5C26A 5IH5A 4FZDB 4GKIA 3PSBA 1EH4A 4XOYA 2JFLA 2R2PA 3RHKA 2IZRA 3ZLYA 2DS1A 4W8EA 1M14A 4AGUA 5HNIX 5EKNA 4USEA 5HORA 3HV4A 3FC1X 2OIQA 3FMMA 3ZDIA 4AZSA 2CGXA 4PTEA 4X7QA 5DWRA 1FQ1B 2VO3A 2VD5A 2X8EA 3QBNA 5I4NA 5FEEA 5IMXA 3KRXA 4X2FA 4BDAA 2RFNA 1R0PA 3H4JA 4G1WA 2B9HA 2R0UA 4MD7E 4CSVA 4AS0A 3QRUA 1FMOE 4E20A 4FNYA 4O0XA 2ITPA 4L42A 4IAAA 1HCKA 4FGBA 4F7LA 1RJBA 2B0QA 4AU8A 3VS1A 2PMLX 2OBJA 3CLYA 4YLLA 4YNEA 3RI1A 4AA4A 4MNEA 1XWSA 4IW0A 3ZTXA 3Q04A 2Y4IC 5KMNA 4RT7A 3PIXA 2X6DA 2B9IA 5LMKC 5KMOA 4FSRA 4ZTQA 3PG3A 4ZSLA 3UQFA 3QKMA 5J8IA 1T46A 3WOWA 5DR9A 2Y7JA 4IX4A 4U0IA 5KMJA 4MVFA 2GHLA 4H58A 4NUSA 3NIZA 4FTOA 4UALA 4BCHA 2VO0A 1DI8A 5L6PA 1H1QA 3F7ZA 3OUNB 3V5QA 4BFMA 4HVIA 5IA3A 4EKLA 3Q2MA 1XHAA 4ONAA 1BX6A 3W2OA 3ORPA 5CU2A 2R3PA 2QCSA 3EFWA 3MB6A 4FKIA 4YPSA 5EDRA 5A6OA 5CSPA 3ZM9A 2PUIA 4ZIMA 3U9NA 5BVDA 4BCOA 1LP4A 3ZO2A 2BUJA 4D9TA 4O83A 3D5WA 3FQHA 3PA3A 4IJ9A 4OLIA 2Y8OA 3ORIA 3NUAA 5JQ5A 3CKWA 3IK3A 3KXMA 4FTTA 3JR1A 2X39A 4F1TA 1CMKE 5EHOA 2I40A 5AUWA 4PPCA 1Y8GA 4MAOA 2XNNA 3KRJA 2C0IA 2C0TA 2JAMA 3FMLA 4X21A 3TWJA 3JS2A 4D1ZA 3KEXA 5IU2A 4ENYA 4LQMA 3JVSA 1JSVA 1JNKA 4KBCA 5KMIA 4M15A 4BY9E 5JT2A 4RWKA 1YXVA 5LVPA 4I4EA 3EQFA 2ITTA 2JIUA 2VTTA 3HVCA 4IZAA 3VF8A 4B4LA 2A4LA 2WOUA 3C1XA 2PE2A 4LFIA 3W16A 4NU1A 2GNGA 3E8NA 5M55A 1OZ1A 2PWLA 3THBA 4EHVA 3FZTA 3L9NA 3SOAA 4PDYA 2V0DA 5A4EA 2FO0A 1FMKA 4G3EA 1OECA 2QO7A 5EM5A 3UOLA 4BVUA 4CXAA 4FIEA 4HOKA 4FK6A 5H8BA 3RPRA 5CAPA 2UV2A 3VW6A 4DHFA 5KNJA 3HDNA 5FXSA 5GZAA 4AT4A 1JLUE 2XEZA 4MH7A 4O7RA 5BPYA 4KINA 4BICA 1NY3A 3ZHPC 4CD0A 4D4VA 1M7NA 3F5XA 2OH4A 2OIBA 1VYZA 3OFMA 4ZK5A 2B9FA 4M7IA 2R64A 5I9UA 3PVWA 3ZEWA 4BDGA 4HCTA 3U6HA 1BMKA 2QHNA 3E62A 5E8ZA 2XNEA 4HCUA 3BYOA 2FB8A 3LCSA 5B2KA 2EXEA 2J5EA 2Z60A 3W2SA 4M8TA 4O0TA 3DB6A 4JOAA 4DH3A 1Q8WA 1ERKA 4L7SA 3DBQA 5J1WA 3EQHA 2GTMA 4EI4A 2GU8A 3OWPA 1PHKA 2HXQA 2YACA 3GQLA 4NJ3A 3NIEA 5A4LA 4UYNA 5IEXA 2ITVA 3NNWA 4AW2A 4BI0A 4C3RA 3FLSA 3LAUA 3OP5A 4IIRA 4G34A 4MX9A 2UZTA 5LMBA 4BDKA 2C6MA 4EWQA 3LZBA 2C69A 3TG1A 3PXQA 4JBPA 2WTWA 1JKSA 4FVPA 4C38A 4I6QA 2X0GA 3QRTA 2PK9A 2XEYA 5CANA 2BILB 3BI6A 5EI6A 3PJ3A 4X2GA 4C35A 5AUZA 5J5TA 4UBAA 4NYEA 1PXNA 1ZZ2A 5ANIA 5IQDA 4U40A 3SRVA 1F5QA 2V7AA 4XJ0A 3V8WA 3A60A 2R5TA 2VTNA 2QC6A 2WMQA 2XA4A 3CXWA 3C4ZA 3FI3A 3P7AA 1T45A 5JH6A 1O6KA 2O8YA 4AWIA 2FSOX 4ANQA 3RWPA 4E6DA 4FV9A 5CXZA 1J3HA 1ZOHA 2A27A 4FT7A 5DRBA 5B2MA 3CPCA 2JFMA 4JQEA 4JL9A 4KWPA 3EZRA 4RMZA 5I3OA 1GZKA 4ITJA 5H3QA 2VTOA 2JDOA 1M52A 3FAAA 1K9AA 4C57A 5CEQA 3QD4A 4K8AA 3DAKA 3KMWA 3V8SA 1V0PA 3LQ5A 1YW2A 1YOLA 3FMDA 4IWDA 5AUXA 3QZHA 2OH0E 3EWHA 3F88A 4FTLA 5A14A 4S32A 3ZM4A 4F9BA 3O7LD 4ZP5A 4TTHB 5CF8A 3NYOA 2RFEA 4KA3A 2PMIA 5BQ0A 4M66A 4YC3A 5AM7A 3R7IA 4FKTA 1DS5A 4UXQA 1W84A 4O2ZA 4PL5A 4EUTA 5LWMA 5HVJA 2QO9A 3TV4A 3TACA 3C13A 3TZMA 2CGWA 3ALNA 3NWWA 4QP8A 4GW8A 1J1CA 4XLVA 4F1OA 2BROA 3QCXA 3LCOA 3DS6A 2YCFA 3ZEPA 2XCKA 4FYNA 4F6UA 1H1WA 2IVVA 5KZ0A 4GFGA 2PE0A 4JAIA 4F9YA 4PMPA 1WBVA 3WILA 4TY1A 5AR7A 1R1WA 2J0JA 3D9VA 2KULA 4IAFA 3E7VA 2JBPA 5DT4A 4E5AX 3DK6A 3NEWA 3KRRA 4M69A 3CGFA 4RFMA 4YC8A 4E4NA 5HBJA 2WQMA 2HAKA 3UOKA 5LQFA 1Z9XA 5EW8A 4GYIA 1Q99A 4FT5A 2F9GA 4CKIA 5GJGA 4FTCA 1M2RA 1W98A 3DKCA 1J7IA 2J0MB 4G6LA 2VWBA 2YM3A 3ALOA 2VTMA 4NM7A 5CVGA 5AWMA 3ZFXA 5KHXA 1IAHA 3BU3A 4D2WA 3ANRA 3AC3A 5BMMA 4EL9A 3GENA 3IW4A 2I0YA 2UVXA 5HG5A 2XK6A 4Q2AA 4DEBA 3SHEA 4V05A 2ZMCA 4HZSA 4A9YA 3G6HA 3I6UA 3CPBA 4F7JA 2X8DA 2IW9A 3PDTA 1HOWA 4ANLA 4XG4A 2ZV8A 2QG5A 3E3PA 2XMYA 2W1GA 2XNOA 3O23A 1H07A 1OIUA 1PXKA 2WELA 4FZFB 1H00A 4IC7A 5A3XA 3KXNA 4TWCA 4D0XA 4BCGA 4IWPA 4Z7HA 3R30A 1E1VA 3I7BA 4FIJA 5I5ZA 4YZNA 4LYNA 2VGOA 3BYSA 2OJ9A 2XF0A 3DU8A 3U87A 4F4PA 3QUDA 5HGIA 4L01A 2WMSA 5LARA 3ZO1A 2YERA 4O7WA 4DF3A 2ETRA 4QMZA 4F7NA 3IKAA 2HZNA 2WMUA 3A4OX 4FSUA 4JNWA 4U43A 3QCSA 4KB8A 4G16A 5FEQA 4CFNA 3OCTA 4A9SA 2WIPA 3W55A 4C34A 3PP0A 1SVGA 2RSVA 2IVUA 4I0RA 2F49A 4DH1A 4HVDA 4IFCA 2XJ1A 4YZ9A 5EQYA 2ZB0A 4H36A 3FKLA 3F2RA 3DAEA 3KXZA 4CG9A 5L2WA 5GIOE 3W18A 2VGPA 2IJMA 5HZNA 4FEXA 2G2HA 3I1AA 5M07A 5I9VA 2XIZA 4CT1A 3C5UA 3L9MA 4XH6A 4ASZA 3QX4A 2QODA 4JDJA 5HVKA 4M69B 1U54A 4FTKA 3ZUVA 2UW7A 3PRIA 1FGKA 5EQPA 3HV3A 3Q9WA 5L8JA 2BDWA 4BIBA 4FT9A 4D5HA 3LVPA 3MVJA 3UIBA 5AUUA 3BYMA 4Y46A 3T3UA 4ACMA 4FGRA 5HD7A 3NX8A 4HYIA 3R8VA 4BDCA 1R39A 2C1AA 2WTDA 3GOKA 2YEXA 3H0ZA 2PMNX 3COHA 3TV7A 4D55A 3MJ2A 4HGTA 1A9UA 4AT5A 5JFXA 4AFJA 4M68A 4E4LA 3VUDA 3F3UA 4OAVB 2OZAA 3L8XA 4W4XA 1PW2A 2GQRA 3VUTA 3GC7A 4O27B 4ZZNA 4D2VA 4O7TA 3PZHA 1DAYA 2I0HA 4FMQA 4X2KA 3A7FA 1FVVA 2WAJA 4FF8A 4QP9A 3QQHA 4U5JA 3HP2A 1V1KA 1SM2A 4X6QC 2GNLA 2W1EA 4Y72A 4EK5A 4QYGA 5HD4A 3OWJA 4YJTA 2PTKA 5HIDA 3WARA 4FG7A 4OT5A 4AE6A 3MFSA 3VRZA 3HECA 5IA4A 4XP3A 4ANBA 2BKKA 3B2TA 3C0HA 3P7BA 2W1CA 3TUBA 3QXPA 4ALWA 3QZIA 5H8GA 3QLFA 5CEIA 4HVGA 5BUIA 4A06A 4YJSA 4D2PA 4C61A 4L00A 3R8UA 2Y6OA 2QOLA 1H26A 3QAME 3Q9ZA 4IZ5A 4CFUA 2R3RA 1U46A 5TO8A 3RK7A 5C9CA 1CKIA 3NUNA 3QTRA 4NSTA 4UMQA 4EEVA 4ANSA 3I0OA 4QYHA 1RW8A 4QTAA 4ERWA 4ACHA 3COIA 3KY2A 4FNWA 4XV1A 3WE4A 3RWQA 4EK3A 4YR8A 4EOJA 1TQIA 4HNIA 1OL6A 4IAIA 4QYYA 5KE0A 4R3RA 4C0TA 4PP7A 3AXWA 5T6KA 3TNHA 1KE7A 3HMPA 2ERKA 2OSCA 1BL7A 3DTWA 3Q4UA 3UE4A 4QMXA 5E8XA 4DBNA 2ZJWA 4AW5A 2YISA 2PZ5A 5AUYA 2R3NA 1AD5A 4UMPA 5FXRA 3LXPA 5EW9A 3VNTA 1U54B 4J1RA 4AZEA 5E8VA 2O63A 1YI6A 3F2AA 5IZFA 5CLPA 3VW8A 2ERZE 5FXQA 4TWPA 5J9LA 2WKMA 3K54A 4WD5A 4L52A 3CTQA 1U5QA 1YQJA 4OTFA 1XH9A 1J91A 3P86A 4YZMA 4ZXTA 2GCDA 5DR6A 2JKOA 3CQEA 3DB8A 3L9LA 4C4EA 3PY0A 3L8PA 4IEBA 5LJJA 1WBPA 1XH5A 2YABA 3D94A 2I6LA 2OZAB 2X6EA 4XMOA 3PJ8A 3DDQA 5C01A 3TJDA 3ZCLA 2XM9A 5L2TA 3NS9A 4UXLA 3MSSA 2HWOA 3VWAA 3DJ7A 2DUVA 3NNUA 4TYIA 3VBXA 4E4XA 3PXFA 2W1IA 2YLFA 4GU9A 2UZUE 3QA0A 3P1AA 1OKZA 3LCTA 4TWOA 3AGLA 5DVRA 3FY2A 2OXXA 4MF1A 2VTIA 3DKGA 5J9YA 1SYKA 2VTHA 5AP0A 3DV3A 4JBQA 2RF9A 4R7BA 5T68A 2OJIA 3Q2JA 3AC1A 4MXCA 5HE1A 2CKQA 4MBLA 4RWLA 3PXRA 2ZV2A 3R22A 2P2IA 5HBHA 5LWNA 3TJCA 2PUPA 4ZTSA 4YHFA 3NSZA 3OY3A 3V04A 3NR9A 4E73A 1PMNA 2PULA 5ETIA 3NMUF 5JRQA 4R77A 4N6YA 1JKKA 4EYJA 3UNKA 3DKOA 3ENHA 3EN9A 4X0MA 4CZUA 5IUHA 2GTNA 4PDOA 4MQ1A 5AP7A 1OPLA 1DM2A 2HCKA 2ZVAA 3D2KA 3GCQA 3PXYA 5CEPA 4IB3A 5A9UA 3ZBXA 4AN2A 5HG8A 3H3CA 1AGWA 3PLAE 4CV8A 4C4JA 5A4QA 1M17A 1YXUA 4AN9A 4QMNA 3BYVA 4FTJA 1SVHA 3KK8A 4FL1A 3QQKA 2X2LA 4UMTA 3UTOA 3R73A 3UO5A 5J7HA 3SOCA 4JI9A 2UW5A 3OD6X 3ZXZA 2WD1A 4I4FA 3WZJA 4CMTA 5M4UA 2B7AA 2JC6A 3MH3A 4O0RA 3ZSGA 3VS6A 3PE1A 1GIHA 1H28A 2W7XA 4J8MA 4A4LA 4FKLA 3ZXTA 5JGDA 4XG2A 2VWYA 5B7VA 1NVSA 4EORA 3P4KA 4GU6A 3WZUA 3KREA 3W33A 5AP5A 2BRGA 3OVVA 1ZY4A 1IEPA 1UU9A 2ZV9A 3LIJA 3MFUA 4IC8A 4F08A 3LJ2A 4LV5A 5FTQA 3FHIA 3UVRA 4PWNA 4Q9ZA 3RAWA 2GPHA 1YXSA 2C5YA 3U8WA 4JRVA 4MD9E 5AV3A 3VBTA 3ORKA 4EH7A 1ATPE 4RIXB 3CQUA 5TKDA 4WSYA 2IVSA 4F9AA 3C4EA 5B0XA 1XH6A 3TEIA 3UYTA 4K11A 4UY9A 4DGLC 5J95A 2E9PA 5DEWA 5JGBA 1XH8A 5EDPA 3SDJA 3Q4CA 3F5UA 3TV6A 4DFXE 4G6OA 4CQGA 4EOPA 1IASA 2C6TA 4IFGA 4XHKB 2W17A 3QTWA 4G3FA 4FV5A 3MY5A 4DGNA 2JITA 4JX3A 3LE6A 3ORZA 2XVDA 2O2UA 4YJRA 3E63A 4S31A 3ZRKA 4ZTHA 3U6JA 1QPCA 3A99A 4O86A 3MFTA 4BN1A 4W8DA 3FLZA 3LFCA 2UZEA 3UOJA 1PXMA 1WZYA 3GU7A 4PDPA 1JQHA 3C4XA 4PTCA 3SW7A 5JFVA 1BKXA 3HMIA 1OIQA 2IZUA 5EDQA 3D5VA 4IB5A 3VN9A 3D5XA 4LUDA 4F1MA 3Q5ZA 3ZRLA 5AAGA 4HVHA 4BRXA 2UW3A 1YOJA 2NRYA 4K2RA 3S0OA 4FZ7A 2RFSA 2UUEA 2R7BA 1IRKA 3OC1A 4U8ZA 1OBGA 5KBRA 1MQ4A 2BRBA 2IW6A 4E26A 3EQPA 3KGAA 1IAJA 4RIYA 4EQCA 4RBLA 1PXOA 4YLKA 3S1HA 3KVWA 5I0BA 4BCIA 2BRHA 4AQCA 2BHEA 4PV0A 2YA9A 5JEBA 5JKGA 5HBEA 3PG1A 4IDVA 4OBQA 5IA5A 3BV3A 3DFCB 2XK9A 1SNUA 2X9EA 1K3AA 2VTAA 3FQSA 4R5SA 4DG3E 2CCIA 4WRSA 4MHAA 5CZIA 2CPKE 5IA2A 4GRBA 3LCDA 2W96B 3AGMA 3EMGA 4XG7A 5M44A 2WMWA 2V7OA 1V0BA 4ITHA 3WYYA 4DFUA 4FSQA 5DT0A 5DMZA 4BTFA 4D1SA 2W5BA 4S30A 5ACKA 4ID7A 4OAUC 3QCYA 2P3GX 3ULIA 3C5IA 5CS6A 3NGAA 3GI3A 4DG0E 2O5KA 3UZTA 2Z7SA 2UZVA 2IPXA 3ACJA 3R7GA 4DEHA 3HRBA 1LUFA 3CJGA 3FLQA 1KE6A 1JAMA 2OXDA 2WQEA 4FV7A 3MY1A 5AV2A 2R3IA 3RINA 4HGSA 4BDDA 3V5JA 1SMHA 2YIXA 3FZPA 3Q53A 3F3VA 3OTVA 3DA6A 3P0MA 3RPOA 2HYYA 4QTDA 4DFYA 4NW5A 3POOA 5LCKA 3R71A 5JN2A 3BCEA 4C4HA 4ZOGA 5GZ8A 3Q6UA 4GK3A 4IDTA 3RBWA 4WRGA 3ZYAA 5L8LA 4DCEA 5C27A 2WTJA 3I5NA 5AP3A 3OXZA 4NT4A 5AM6A 2B54A 4FUXA 2B52A 4QPAA 1GZ8A 2G1TA 4RIWA 4BTKA 2WZJA 4N6ZA 2JGZA 3EFKA 5LXMA 4R1VA 5AX9A 3GFEA 1P4FA 3BLHA 3ZOSA 4PMTA 4ZY6A 4PNIA 4IZ7A 4XBRA 2HELA 3G51A 4I1ZA 4NFMA 1BUHA 3DXNA 4HNFA 5CY3A 4FV0A 4CZTA 1SZMA 4BBMA 4PX6A 5LVOA 4ZTRA 3F3WA 4EK8A 3A7GA 3LJ0A 4KKEA 3EFLA 3GCUA 4W4VA 2HZIA 2WNTA 3IECA 2FYSA 2ITYA 1V0OA 3HAMA 2BMCA 4TNDA 5EOLA 4ZS4A 1GZNA 4AZVA 3BQCA 2CKPA 5IUIA 2XJ2A 3FV8A 2PVKA 2NP8A 4D2SA 3MTFA 5CYIA 1OVEA 1NVRA 3O8TA 3VQUA 2C4GA 2R3MA 4XRLA 3R63A 3LFQA 3PIYA 3ORNA 3VJNA 3R2YA 3VBWA 3PLSA 4MXAA 2A19B 4ZTMA 4AXAA 3SG9A 1XH7A 4UV0A 1XQZA 3BU5A 4JR7A 4PL4A 3KA0A 3FYJX 3KF7A 4YTHA 1JKTA 3Q9XA 5C4LA 5DNRA 4HGEA 3EYHA 5CVHA 2GMXA 4DEIA 4HYUA 5IQGA 3RMFA 4EOQA 4CFWA 5E90A 3H9FA 3HUBA 4K18A 3ZSHA 4QMMA 4EH3A 2QONA 3AC8A 3DOGA 3U4WA 3SGCA 4D28A 2G2FA 3O0GA 3DQXA 4RLKA 5I9YA 1P5EA 3Q52A 3UNZA 4W4YA 4F63A 3DXQA 4FOCA 2XNBA 3GCVA 5JMSA 3QWKA 2WB8A 4KRDA 5ACBC 1R3CA 2JDTA 2WPAA 4GJ3A 4IJPA 3GB2A 4XOZA 4JRNA 4RJ8A 2FGIA 5CF5A 2HK5A 4FC0A 3COMA 3KFAA 1Y8YA 4RIWB 3UC4A 2E9NA 3WIKA 2B9JA 4D2TA 4WNOA 3I6WA 3O96A 3VS5A 4ZAUA 3QKKA 2XK7A 4YZDA 4DAWA 1P2AA 3BBTB 2BFXA 4OTDA 4U3ZA 1UU8A 3ZMMA 3A7IA 3QUEA 1UNGA 4USDA 3QQFA 2CSNA 5B2LA 3SKCA 4FT0A 5T3QA 4IX5A 4DN5A 2IWIA 4S2ZA 5FWKK 4QP4A 3UQCA 3ELJA 3GC8A 4CCBA 4FBXA 4IMYA 4BCKA 3GT8A 3OEZA 4C4FA 3PZEA 4E6QA 5CEMA 2XK3A 5FUTA 3BZ3A 1H8FA 4JJRA 2XRUA 3IGOA 1OKWA 4FKVA 3FI8A 4BBFA 3R1YA 1TVOA 3UIUA 4O7VA 2C68A 4A9RA 3UDBA 4QD6A 4AOIA 4GFMA 4J97A 1WBSA 3FLNC 5E8YA 2J0LA 3RM6A 3ZFMA 4BGGA 2BAKA 3K2LA 2CGUA 5E92A 3Q96A 1Y6AA 4KKGA 4FNZA 3DPKA 4RLLA 5HU9A 2Z02A 2J4ZA 3O51A 2UZOA 5E8SA 4QT1A 3TT0A 5L4QA 3TIZA 4OTRA 3DBEA 3MS9A 4MXXA 1YOMA 2X1NA 5ETFA 4C4GA 4YO4A 4RX7A 4FR4A 3GFWA 4Q5HA 3A7HA 1OB3A 5DFPA 3BLRA 2V22A 4O81A 2EUFB 4OUCA 3WF7A 1UV5A 3TTJA 2JD5A 5DA3A 3EQIA 5AAFA 4U44A 2RG6A 4I41A 2Y0AA 2YN8A 4O7YA 4WNPA 4BB4A 4L8MA 2WHBA 5CT0A 2G2IA 3QRKA 4FNXA 5HU3A 3F5GA 4FTMA 4FE2A 4L68A 5CALA 2RKUA 3FSKA 3VUIA 2PVMA 4U42A 3ZUUA 3CEKA 4GH2A 4IB0A 4FTAA 3R7YA 4FYOA 4O0UA 3P23A 4AG8A 2O65A 2ZM4A 4D2RA 3QA8A 1SVEA 5H9BA 4CEGA 3R9RA 2GFSA 4JQ8A 2GSFA 3PPJA 3F69A 1OMWA 4JT3A 4MNEB 4YJNA 2BZKB 5C03A 2YM5A 3QD3A 4QPMA 4YZCA 3W2PA 5EI8A 2X8IA 2EXMA 2VUWA 3NW6A 4QMVA 3ZC5A 4G17A 4MXZA 4MQ2A 2W05A 2FSTX 4QYFA 4DLJA 3VUMA 1JVPP 3O2MA 2WO6A 2F57A 4LGHA 4FICA 4PY1A 5JZJA 3FL5A 1MRVA 2QNJA 3UP7A 4CFFA 2C1BA 1Q8TA 3VO3A 4AFEA 2GNFA 4AZFA 3MV5A 3TKUA 3NNXA 3BE2A 4FUYA 4BDEA 2PZPA 3KL8A 4D1XA 5AA9A 5DH3A 3FI2A 2P55A 3FQEA 4MK0A 1WBWA 5ITAA 3N4TA 3BRBA 4TYHA 3VUKA 3AT3A 3IW5A 3O50A 2YDKA 3OG7A 3R21A 3SC1A 2GNIA 4FODA 3VUHA 4ZSAA 5KMLA 3QTIA 3IW8A 3Q4TA 3SAYA 3ULZA 3OBGA 1MQBA 1AQ1A 2WTCA 3OWKA 3UIMA 2YJSA 5H8EA 4EUUA 1PXJA 1ZRZA 2F7XE 3PTGA 5DHJA 3R8PA 3VULA 3HYHA 3JVRA 4WA9A 5FTGA 3AC2A 4QMSA 3V51A 2Q0NA 1OPJA 1UA2A 3BHHA 3PSDA 3L8VA 4DTBA 3NUXA 4LGGA 4LMNA 4JQ7A 2HY81 3IOKA 4Y8DA 4YJUA 4O38A 2C6IA 4NW6A 5FM3A 2YIWA 2XB7A 4QQ5A 4RPVA 4D0WA 4HW7A 2VV9A 3HP5A 3MW1A 4MWIA 2A2AA 3AC5A 4RWIA 4LG4A 4G31A 5HNGA 3SG8A 4W9WA 2C0OA 5M4FA 4WG5A 4RX5A 3EL8A 4KD1A 5HE2A 1H1PA 4N0SA 5CVFA 3OT8A 3R01A 2XH5A 1Q41A 5EM8A 3S3IA 2F7EE 5AP4A 2R3GA 4L45A 2PUUA 3B8RA 5BVOA 3FEGA 3TN8A 3KCFA 3R0TA 2C5OA 4GFOA 3TTIA 4XCUA 1Q61A 3CE3A 3UZPA 3MIAA 3HMMA 5IA1A 3DT1A 3QKLA 2BRMA 4TZRA 4F9CA 4O82A 4O7NA 5F9EA 5BYLA 1NXKA 2W1ZA 2YFXA 4FTNA 4MNFA 5EG3A 5IH6A 1XBBA 3NVKI 2UW0A 3DDPA 3FMHA 2QD9A 3OW4A 4M67A 5DIAA 5AAEA 1PXPA 3OTUA 4I6FA 3ITZA 2C3JA 3FC2A 4FKQA 4FSNA 3TL8A 3TNQB 5EYMA 4ZZMA 3RNYA 3D4QA 2W4JA 3VS0A 1MRYA 3ANQA 4DT8A 2XNMA 3B8QA 4NM5A 5AA8A 4FEVA 2OJGA 3MVLA 3QL8A 4ZJJA 3MA3A 1CKJA 1X8BA 4C02A 4EHZA 4WBBB 2LGCA 3VIDA 2X4FA 1YHSA 4FV8A 4WNMA 3MI9A 4BTJA 5M09A 2P33A 5FQDC 3V5PA 5FDXA 4OW8A 5BUEA 1OM1A 4KIKA 3Q6WA 2R7IA 3P7CA 4WHZA 3HX4A 2QHMA 3FZSA 5FBNC 5KUPA 1Z5MA 3WE8A 2Y9QA 3PVGA 4CG8A 4YU2A 4NTTA 2EXCX 3VS7A 3DJ6A 3ZLWA 4QQCA 4WOVA 4RFZA 5HO8A 2RGPA 4BCNA 3UIXA 3G0EA 3RCDA 4Q5EA 5HICA 4HVSA 4I23A 4QNYA 5M4IA 4KBAA 4IXPA 2OF2A 3DBFA 3ORLA 4QQJA 4X2JA 3OROA 4FA2A 3SRVB 5EFQA 5EHYA 1Q8UA 4C2WA 5AV4A 5LVMA 3HRFA 5CAUA 2ZAZA 5EM7A 4BR3A 3BHTA 3F3ZA 2GS6A 4Q9SA 3R2BA 5KMMA 1ZMWA 4IQ6A 2WU7A 4II5A 3H30A 3CTHA 3TCPA 4JBOA 5AV0A 4EZ7A 2J50A 3GOPA 4FKUA 3GEQA 2YCRA 3KMMA 4O7LA 2XIRA 3D0EA 3V5WA 3K5UA 3W2RA 3ZH8A 5K0KA 1YXXA 3QFVA 4ANOA 4ZMEA 3EZVA 4XX9A 2WXVA 2PE1A 1KV2A 4BKYA 3K3JA 2DYLA 2J2IB 5IKWA 2GS2A 3UMWA 2OLCA 5JFWA 5CF4A 2VX1A 3H9OA 3JY9A 4DBXA 4IANA 4HPUE 4A4XA 4EH4A 3KF4A 2VWIA 2HXLA 3OEFX 2C47A 2AC5A 4O7ZA 5CEOA 5IDPA 5HOAA 2PZIA 3EQCA 1PF8A 5D1JA 3HV5A 3CGOA 1FINA 3FMKA 3MFRA 4N70A 3OZ6A 5EHLA 1PKDA 2QVSE 3TDVA 3GU4A 4R5YA 3JY0A 4H3QA 3R6XA 4ASXA 3TNIA 3U55A 4JBVA 4J98A 3ET7A 4JDIA 4L53A 3V3VA 4DEGA 3NDMA 1QPJA 1H4LA 3JPVA 2WMVA 5F95A 3WI6A 4GT4A 2BTRA 4J71A 4EQMA 4U7ZA 2V62A 3CS9A 3E92A 5IQIA 4U9AA 4ACDA 1H0VA 1FBNA 5DGZA 4AX8A 4DGMA 3PWDA 3TZ8A 4MKCA 3EQDA 4XYFA 3ZBFA 3OS3A 3IG7A 4QP3A 3R7EA 2PVFA 4L7FA 1R0EA 1NW1A 2J51A 3D5UA 4CKRA 5KCVA 4CFMA 4EOMA 3R9HA 4I94A 4MXOA 4APPA 2JEDA 2WQNA 4FKOA 4AP7A 2XKDA 3QD0A 3ETAA 4E6CA 4CGAA 4EOIA 2Z8CA 4AE9A 3D83A 3WYXA 3AD4A 3MIYA 1RE8A 4GK2A 1JBPE 4GIHA 4J95A 2IN6A 3AD5A 4RVTA 4AOTA 2XIXA 2OFVA 2BHHA 3DBCA 4XG8A 4EHEA 4UMRA 4CLJA 5HQ0A 3H9RA 5FBOA 4DCAA 2ITZA 4HGLA 4JVGA 2VX3A 2VTJA 2VWXA 5HEZA 2WEVA 3PJ1A 3W1FA 4YTIA 4ZY5A 3LFBA 4XNEA 2ACXA 2R0IA 5EYCA 3BYUA 5LOHA 1ZYSA 1HCLA 2VO7A 3G2FA 4E5WA 5L3AA 4C58A 5JFSA 4G5JA 3Q9YA 3V6RA 3E88A 4A4OA 4C8BA 5EH0A 4EH6A 3FXZA 4AGDA 3HLLA 4RJ3A 3P9JA 5HIBA 3CKXA 1ZY5A 3FKOA 3PXZA 2DQ7X 1H27A 2R3JA 2X9FA 5CSWA 4UWYA 4JXFA 1PY5A 3CD8A 5C8MA 3CY3A 3QTXA 3D2IA 3E8DA 3NUUA 4GV1A 3L1SA 4QMYA 4TYGA 5C8NA 4YZBA 5G1XA 3O7LB 4K0YA 3OBJA 2X2MA 4ZY4A 3UG2A 2JLDA 4F6SA 2WTVA 4Y83A 2GHGA 2SRCA 3G9LX 3I4BA 3S2PA 5L2IA 2X7FA 3DNDA 1XH4A 3R1QA 2W5AA 5KX8A 4CTCA 2X4ZA 3A2CA 5A46A 3QTUA 4YJQA 2ZDTA 5CSHA 1WCCA 5LVLA 4GUBA 2ZMDA 3AT2A 3CIKA 4YTFA 3GC9A 1OKVA 3JUHA 3E3BX 4D58A 5HHWA 4NH1A 3LMGA 5IH4A 5E8UA 1DAWA 5CU3A 2QLUA 4F6WA 2F4JA 4DFNA 1UWJA 5JZNA 2VTPA 5IPJA 3REPA 4FKWA 3GUBA 4EC8A 1Q4LA 5BVWA 4O2PA 2F2UA 4M0ZA 5HG7A 3C0IA 4BCQA 1ZYJA 2P4IA 3KCKA 4TNBA 2XIKA 4OTQA 4C59A 4B7TA 4G6NA 4NKSA 3KULA 4KKHA 4U97A 4IZYA 4NZWB 3HL7A 4FK3A 4KSPA 2RFDA 4AOJA 3C4WA 4GIIA 5BUJA 4CQEA 2XCHA 5KKRC 3GXLA 1XO2B 4IH8A 4EKKA 5FDPA 5TE0A 4PMSA 3F2NA 2QR8A 2GQGA 3EHAA 3GCSA 4FG8A 4IVCA 4B0GA 1ZAOA 5F1ZA 3SW4A 4BDJA 4RQKA 1GZOA 3LM0A 3S00A 5DOSA 2GDOA 1PXLA 4ACCA 5LMAA 2C5VA 2DWBA 3HDMA 3JYAA 3QU0A 1FPUA 4DH8A 2JDSA 2YWPA 1FVRA 4NWMA 3WIGA 3QHRA 5K5XA 2FA2A 4GSBA 3ZSIA 2QKWB 4YJOA 1QMZA 2WMTA 3NUSA 4WNKA 3QQUA 4LRJA 2XUUA 2EB2A 4FSYA 1Q8YA 5EYKA 5K0XA 1H1RA 5IQHA 4YHTA 4WG3A 4XV2A 3T9IA 4ENXA 2OW3A 2PU8A 2AC3A 4GJ2A 4IAZA 3G0FA 1ZOGA 4OTGA 4Z7GA 4L43A 4CMUA 4OTPA 1RQQA 2JKQA 2PVLA 4IBMA 1O9UA 4O91A 2Q0BA 1FVTA 2YIRA 1J7LA 3KRLA 4O22A 4C36A 4XP2A 4GG7A 4I20A 2YLEA 1Q3DA 4I92A 3RM7A 3SV0A 1UKIA 4QMPA 4S34A 4WKQA 2W06A 4RJ4A 3GU8A 2J90A 2FUMA 3Q60A 4GL9A 2WMAA 1OITA 5DE2A 3IQ7A 5D9HA 4A9UA 3PFQA 4X3FA 4M14A 3I0QA 2Q83A 4G3GA 1J1BA 2CJMA 3ZDUA 5AIKA 5IEVA 4FKSA 1NA7A 2R3KA 3CBLA 2OJFE 3JXWA 4MXYA 4RA5A 3UYSA 3V6SA 5IUGA 1QL6A 2J9MA 3ATSA 4IX3A 2XNGA 4JIAA 3UG1A 5HE0A 5AR2A 3I60A 4V0GA 3DY7A 3LPBA 3PA5A 1WBOA 3EQBA 3DZQA 4RVMA 3RP9A 1JPAA 4EK6A 2QOFA 3KULB 3EQRA 1FGIA 4Y85A 5AP2A 5AR4A 3WZKA 5E7RA 4AA5A 5CI6A 5FGKA 3PXKA 2CLQA 4UYAA 3DTCA 2YAAA 3LCKA 5KO1A 3MJ1A 4BI1A 5E1EA 3FXWA 4CYIA 4I22A 2CKOA 3UC3A 2UVYA 3U9CA 1YWVA 2BIYA 2XS0A 1H01A 3HEGA 4LL5A 4XEYA 3NW7A 4OBPA 1L3RE 1BLXA 2RG5A 4FSTA 1LEWA 3CD3A 1WAKA 2EU9A 2YM6A 4BYJA 4FIFA 4U45A 3O8PA 2P0CA 3BHUA 3TKHA 4J96A 3RPSA 4MF0A 3BV2A 3LFDA 4BZDA 3ACKA 4E3CA 2VTQA 5CSXA 3I5ZA 4ZJVA 3ORMA 3KQ7A 2GS7A 3NUPA 2G01A 3M1SA 4C37A 5HE3A 3RJCA 3OMVA 1FOTA 2ZDUA 3R9OA 4M0YA 5I9XA 2C6DA 4ASDA 5ANDA 1CDKA 3ZLSA 4PNKA 2XP2A 2BKZA 4BBEA 5HTIA 4UZDA 4L46A 3ERKA 4DEEA 3G9NA 4FTUA 2EB3A 3C9WA 5E1SA 4EC9A 3LFFA 3F9NA 3SQQA 3WBLA 2CN8A 3FYKX 3UBDA 5AJQA 2BZIB 4U6RA 4ERKA 5EQEA 4JAJA 2BAJA 2WMRA 5AP6A 3NAXA 4ORKA 2Z7RA 3LFEA 2OICA 4X3FB 4RZWA 1K2PA 2IZSA 3NZ0A 3R02A 4I0TA 4NJDA 4RX9A 5IQFA 1B39A 4I93A 2JAVA 3NW5A 4KAOA 3ZS5A 1ND4A 4DFLA 4H1JA 2R9SA 5KHWA 3MH2A 5E91A 4P5QA 3VVHA 3CC6A 4GG5A 4KNBA 5KBQA 5KMKA 4NL0A 2WMXA 4DC2A 2CNQA 4DTKA 1Q8ZA 3C50A 4XP0A 3HV7A 3KRWA 2YM8A 2C6KA 2JKMA 1OGUA 4K33A 1O6YA 3MPTA 4FV2A 5HCZA 2YDIA 5HLNA 1P14A 2H9VA 4RRVA 2CKEA 1YRPA 4HYHA 4M3QA 4BGQA 2HWPA 3PP1A 3R7UA 4D9UA 1XJDA 3FBVA 4LRMA 3VUGA 4EBWA 1NT2A 2ITOA 2XKEA 4H3PA 1OL5A 3OF0A 3QZFA 5HKMA 4LOOA 4WIHA 2YCQA 1I44A 3BGPA 3HGKA 5EI2A 5JRSA 4PMMA 2E9VA 4GUEA 5HTBA 3ATTA 5BYZA 2IG7A 1B6CB 2EWAA 4RIYB 1BI8A 4C33A 5BYYA
chains in the Genus database with same CATH superfamily
4L9IA 4FSWA 4N4SA 4K77A 4MEDA 4RC4A 5TR6A 2G15A 2I0VA 2WEIA 4WUAA 4YC6A 2VWZA 4AN3A 4C3FA 2VX0A 2XK4A 2NO3A 4O4CA 2IO6A 3PY1A 2QOCA 4IWQA 3C51A 1W82A 4FTQA 5HI2A 3IDBA 4AZWA 4BWPA 4BZNA 4E8AA 4ANMA 1JSTA 3DBDA 4KIQA 3PJ2A 3LW0A 3CJFA 1S9JA 3F3TA 5ICPA 2ONLA 4RJ5A 4IWOA 3ZFYA 5CEKA 4BDBA 4DYMA 4RGJA 5IQBA 4DINA 5G6VA 5ANKA 2NRUA 3GC0A 4AF3A 2QI8A 3QXOA 4G9CA 4QPSA 5M4CA 2VWWA 1MRUA 3AMYA 2X7OA 5JGAA 1WVYA 4CFXA 4CLIA 3BU6A 5HX6A 4ASEA 1OL2A 5M06A 3V5TA 2ITNA 5L2QA 2QKRA 4DGGA 3O71A 2R3LA 1BI7A 3PRFA 4PF4A 1KE8A 1WBNA 3H0YA 5F4NA 4R1YA 2HW6A 3UZRA 3BIZA 4FOBA 1GNGA 1VYWA 2VU3A 4EQUA 1M2PA 3F61A 1ZYCA 5AFVA 2XKFA 5D11A 2CCHA 3BGZA 4JLCA 4ZTNA 4BIEA 2R3OA 4AA0A 1KWPA 4RG0A 3EH9A 4RC3A 4UWBA 4RWJA 4USFA 2RIOA 5AR8A 5C8KA 2F2CB 3ZZWA 2J0KA 4FX3A 4FZ6A 3ZONA 4P4CA 3LMHA 3HV6A 2QURA 4PL3A 3NCGA 4ALVA 4YMJA 3FZ1A 4U3YA 1H24A 4OR5A 5FEDA 5BVNA 5J7BA 4OTWA 5FM2A 3DKFA 3VS4A 2YITA 3EN6A 4F99A 3UVPA 3LJ1A 1STCE 4CYJA 4F0FA 3KXHA 1ZMUA 4NEUA 3V5LA 3COKA 5BV3A 2BZJA 5J87A 2YZLA 5IQEA 1S9IA 2BVAA 2YIYA 2FVDA 2PVYA 4KBKA 3LFSA 3VBVA 3MDYA 3ZLXA 4FEQA 3UOHA 5K3YA 4GT3A 3WF8A 2BDFA 2YHVA 3MWUA 3PIZA 4WBOA 3UP2A 4AACA 2IZTA 3TDWA 3WF6A 4ZS0A 4CZYB 4UN0C 2VAGA 2OXYA 4NK9A 2WGJA 4BL1A 4F78A 3ROCA 4RFYA 4Z55A 2W9ZB 4O0YA 1YHVA 2QU6A 4G9RA 3CP9A 4V01A 5K9IA 4DEAA 3UO4A 2OIDA 4H1MA 5M53A 3VBYA 4AQKA 3GU5A 5IQCA 4KSQA 5GZ9A 1WMKA 3NNVA 4RJ6A 3C4FA 4UWCA 3ZC6A 2VWVA 3NCZA 3V8TA 1UKHA 2O0UA 4FVQA 3EQGA 4M12A 4QO9A 5D7AA 2WOTA 4Z3VA 3BEAA 1GAGA 1UU3A 1YWNA 4CMOA 3QC4A 4CCUA 2VTRA 5CAOA 4EWHA 4YP8A 3FJQE 4J8NA 3GQIA 4J99A 4L3JA 3VHKA 3WF5A 4UMUA 4JDKA 4K1BA 2XYUA 3R8LA 4BGHA 1OIRA 3QZGA 4F70A 3OXTA 2UZDA 3QUPA 4LOQA 4RA4A 4FIHA 3AC4A 5L6WL 4L3LA 3RK9A 2QU5A 2H96A 1GIJA 3QRJA 3AD6A 4DGOA 5E8WA 3P79A 2FH9A 4YBJA 1Y91A 4AUAA 4QP7A 4D4SA 4EH2A 5HX8A 1G3NA 3FZRA 3GCPA 4DH5A 4AGWA 2BPMA 4LM5A 5ETCA 5FRIA 3E5AA 3D7ZA 4GVJA 5CI7A 4CKJA 5HVYA 3EKKA 2QQ7A 4A7CA 3DQWA 4O6LA 5I3RA 2C5XA 5AR3A 3GP0A 4NCTA 4FTIA 1H0WA 2XKCA 2CMWA 5J1VA 3UODA 3HA8A 4QMTA 3ZU7A 4BKZA 4CTBA 2WQOA 3MVMA 3NFGB 1U5RA 3II5A 5FG8A 3VQHA 5HTCA 4I5PA 2PVNA 2VNYA 3IDPA 3QYWA 1IR3A 4JS8A 3S4QA 3IGGA 4H3BA 5HO6A 3WZEA 4FV4A 1LEZA 2OI4X 1XBCA 2XM8A 5AV1A 3HKOA 4E93A 2E9OA 3H10A 4PQNA 3NYXA 5GINE 2UW8A 2C6EA 2PHKA 4JR3A 4HZRA 1Q3WA 4QOXA 4YHJA 4O0SA 2VRXA 3FLYA 3FXXA 4BCFA 3O8UA 4R3CA 3A8XA 4TRLA 4KABA 2CNUA 3BKBA 4F0IA 3U51A 5EOBA 3BPRA 5HO7A 3UMXA 2CLXA 3LM5A 4OT6A 5IA0A 3QCQA 4APCA 5KKRB 3B2WA 2YJRA 4P5ZA 4R78A 1H1SA 4QMLA 4XG3A 3UQGA 2VTLA 4BZOA 5EKOA 4MBIA 1W0XC 1REJA 3TI1A 3U4UA 1JKLA 3PA4A 4GCJA 4F65A 3N4VA 4FKRA 4RC2A 4DITA 4DTAA 3FMEA 2OU7A 3MTLA 4I5MA 5HIEA 3MH0A 3ODZX 2C6OA 4ANNA 3I79A 1UNHA 3OCSA 4XRJA 5DYJA 3R8ZA 2RL5A 2B53A 2PVRA 5FP6A 5A4CA 3BHVA 4P7EA 3W0SA 1IA9A 3R8MA 1ZOEA 4P90A 2QO2A 4O84A 2ITXA 4FJVA 1REKA 3PWYA 5DN3A 5F94A 3IS5A 1ZWSA 5DG5A 4CRSA 5C1QB 3KK9A 4DEDA 5K5NA 2XBAA 4E1ZA 1Q62A 4RSSA 4DFBA 1RDQE 3LXLA 2A0CX 2OGVA 2VNWA 2WQBA 3F66A 3PPZA 4XV3A 1OL1A 4PPAA 3QWJA 2VN9A 4IACA 1YWRA 1VR2A 4L67A 2ESMA 4B6LA 2BFYA 3FUPA 1NVQA 2O64A 4C7TA 5M51A 2X2KA 2W4OA 3IONA 4QP2A 5I9WA 4JG6A 3MYGA 1WVWA 2C6LA 1YDRE 3SLSA 3SA0A 3GGFA 3MGYA 1GOLA 1ZYDA 4QEBA 1M7QA 4FSZA 3R83A 4DHZA 4D5KA 3ODYX 5GIPE 3RAKA 5ANOA 2HY0A 1PJKA 4FKJA 3RGFA 1W8CA 3DK7A 3OHTA 4A07A 4GKHA 3FWQA 3BLQA 2OK1A 3NUYA 3EL7A 5CNNA 3HMNA 4C3PA 3FLWA 4TYHB 3I81A 4MYGA 3W10A 4QTBA 2BR1A 4KIPA 4ZSJA 4O4EA 2I1MA 3CTJA 4M97A 4IM3A 3T8OA 3MPAA 4X3FC 4DE4A 1JWHA 3P08A 4X2NA 5CENA 3A62A 5CU4A 4LUEA 4B9DA 1PYEA 3QF9A 3LMIA 4Y5HA 3FMJA 5CSVA 1O6LA 2C3IB 2VZ6A 4TWNA 2GNJA 1Z57A 3C7QA 5AMNA 4EH8A 3KXXA 3PY3A 3RZBA 4EK4A 1JOWB 2JBOA 2R4BA 3FKNA 5GJFA 2QOOA 3G15A 3BQRA 4JDHA 5DR2A 4E4MA 1QPDA 2J7TA 3OUKA 3FPMA 2IW8A 3SX9A 4KRCA 4IVDA 4LL0A 3K5VA 4YLJA 4B99A 4YGAA 2PPQA 1TQMA 3E93A 3E64A 4QP6A 3FDNA 5TF9A 1WBTA 3LFNA 2OWBA 1L8TA 2PUNA 3VS3A 2UW6A 4KIOA 4C2VA 4FSMA 4BCJA 2H34A 3G90X 4M13A 3G33A 4YSMA 4AXFA 3RZFA 5CAQA 3F5PA 3POZA 4EJNA 3R1NA 4O1OA 5EYDA 2IVTA 1PMEA 4WT6A 4BDIA 3FSFA 2VWUA 4BCPA 4PP9A 2PZYA 2O3PA 4NKAA 3RNIA 4BHNA 3OWLA 2UW9A 3LXNA 1KOAA 2ETMA 2ZV7A 4XBUA 2EVAA 5F20A 3KMUA 4ZLZA 5DBXA 3ML1A 2BAQA 4JG7A 4DLIA 2F7ZE 1XKKA 3AG9A 3OW3A 3KVXA 5A54A 3LFAA 4CFVA 2WTKC 4O4FA 1APME 1MP8A 1Q24A 4IM2A 3ROYA 4EZ3A 1VJYA 4PPBA 5EW3A 3DJ5A 1OPKA 2BTSA 4I6HA 3ZRMA 5DRDA 4ZTLA 2CGVA 1VZOA 3MPMA 4V04A 1F3MC 4IHPA 2V5QA 3HRCA 3UGCA 5I9ZA 3TZ9A 3TUDA 2UW4A 3EOCA 3D7TA 3UNJA 4O0WA 3SXRA 4BHZA 4C4IA 4LRKA 4ZZOA 3I7CA 3NYVA 4EOOA 2W1DA 4KIKB 1E9HA 4FV3A 1GIIA 5AP1A 2LAVA 2YCSA 2C5NA 3EN7A 2OFUA 3DLSA 4TW9A 3BBWA 3EJ1A 3CR0A 4XLIA 3UO6A 4I5HA 3DAJA 3RTPA 1R78A 5D41A 4XV9A 1YVJA 1M2QA 5AR5A 4BCMA 2VTSA 2XZSA 5DI1A 2W0JA 3TIYA 3CCNA 4OBOA 2JIIA 4OTIA 3A4PA 4PDSA 4CRLA 4U80A 4TN6A 2I0EA 3SD0A 3ENMA 3N4UA 3OCBA 1PXIA 2OZOA 2B1PA 3NRMA 5H2UA 1VEBA 4IVAA 5AADA 1QPEA 2ITWA 3KB7A 5CU6A 5DT3A 3HMOA 2YDJA 2ZOQA 5D10A 2W1FA 3R9NA 5LMKA 4QTEA 3EFJA 2FSMX 3F6XA 4TYEA 4RJ7A 5ETAA 3RK5A 1I09A 4AXDA 2J5FA 3QRIA 1U59A 3P78A 5DEYA 1CSNA 1YDTE 2V55A 3W0QA 3TUCA 4ZSEA 4ZJIA 4W4WA 3DLZA 1KE9A 1TQPA 4L6QA 4BWKA 4FT3A 1P4OA 2A1AB 1YDSE 4G3CA 3V01A 5CU0A 4MD8E 1UWHA 2XJ0A 3ZO4A 3UDZA 3U54A 4MBJA 3BWJA 2HIWA 3ORTA 5E4HA 2ONLC 3IW6A 4DT9A 3KU2A 4FIGA 2Y4PA 2W9FB 4A9TA 3FZOA 4Y95A 5JK3A 1OL7A 4L3PA 5HCYA 4Y5QA 5BX0A 4G2FA 2UZBA 2CDZA 4GVAA 2QOIA 3CY2A 4F64A 1XMLA 3FY0A 4FKPA 4IAYA 4N57A 4LV8A 3NPCA 3RPVA 3D7TB 2Z7LA 4F9WA 1YHWA 1BYGA 4I5CA 4EJ7A 2GNHA 1Y57A 2OO8X 5M57A 3VAPA 2YWVA 3RVGA 4QYEA 1ZYLA 1UNLA 5A6NA 4FVRA 5AUVA 4Z16A 3DCVA 2E9UA 2J0IA 5TOZA 2GFCA 3OXIA 1PYXA 3K3IA 4QMWA 3QGWA 4TKSA 3LQ8A 3VC4A 4LDTA 4TT7A 4P2KA 5JSMA 3VF9A 2YM4A 4WG4A 5CNOA 4I6LA 2PVHA 3DK3A 4NM0A 4FZAB 5E9EA 3PE2A 3TXOA 4BC6A 3KN6A 3A7JA 3Q3BA 4MTAA 3UPXA 1ZXEA 4UX9A 4U79A 2R3FA 3FE3A 4R3PA 1G5SA 2UZWE 4EH5A 1G8SA 4YUQA 4O4DA 5CX9A 4EZ5A 5EK7A 1E1XA 1UVRA 3QQLA 3IO7A 4CVAA 2XNPA 2Y4IB 2QLQA 3R28A 2AUHA 5A4TA 4IB1A 4KS8A 4H05A 4EONA 4RZVA 3E8CA 4QP1A 3DFAA 3AKKA 4E7WA 2JIVA 3BE9A 3RAIA 4O7SA 4YJVA 1TKIA 5IDNA 3PYYA 5GJDA 5ANEA 4S33A 4K6ZA 3ZO3A 4BDHA 3EB0A 3W2CA 4NIFA 4QMQA 4GT5A 4GYGA 4YURA 2ITUA 4LGDA 3MVHA 4O1PA 1VLRA 3BHYA 3W8LA 4D4RA 1LPUA 3C0GA 4RIXA 3UPZA 4AAYA 1Q97A 5C4KA 4UEUA 5HCXA 3UJGA 3TM0A 5GNKA 4J53A 2XALA 4AGCA 5CF6A 2GHMA 4X3JA 2ITQA 4AT3A 3AQVA 1W83A 1OI9A 3IW7A 3D15A 2I7QA 4QMOA 4RX8A 2OKRA 4O4BB 5HESA 3AKLA 2XIYA 4RVKA 1TFFA 3MBLA 3BWFA 5ANGA 3ID6C 3LXKA 4KS7A 4K9YA 3HAVA 5GHVA 3MN3A 2YAKA 3T9TA 1CKPA 1H08A 3PUPA 4F09A 3PUFC 2BALA 4QMUA 4HJOA 4IE9A 5FTOA 2Z2WA 3M11A 3RCJA 4CNHA 3FHRA 3HA6A 2AYPA 4FIIA 1KE5A 2B4SB 3FI4A 3IDCA 2PL0A 1TZDA 2UZNA 3BGQA 4FKGA 4O21A 1JSUA 2C3LA 4GS6A 4JX7A 4E5BA 2XBJA 2CNVA 2PSQA 3TKIA 1OKYA 3U6IA 5AEPA 2PZRA 4X6RA 5HNBA 3VHEA 4DG2E 5M08A 2C3KA 3PVBA 1J7UA 2H8HA 2H6DA 2VO6A 5J5SA 4BF2A 1OIYA 4TYJA 2BIKB 2XRWA 5E8TA 4EOKA 3S95A 2W1HA 4QNAA 2B55A 5IQAA 4LMUA 2E2BA 2CHLA 2QOQA 4HYSA 3R00A 5HLPA 4EOSA 4TL0A 3Q32A 5K4JA 2QG7A 3E8EA 3QTQA 4DDGA 4YBKA 4I24A 4C62A 3R7OA 4FG9A 4RIOA 2GQSA 2IEWA 1GY3A 3RAHA 4NCTC 4F0GA 4L44A 4J7BA 4O0VA 4ZEGA 4IADA 3ZZEA 4TXCA 2UVZA 4I3ZA 5J9ZA 3E7OA 2R3QA 3OT3A 2HENA 2ZFYA 4JG8A 2NNWB 1U4DA 4LV7A 4FEWA 4ZMFA 2WFYA 3R7VA 3G6GA 3IPHA 4NIFB 5IMEA 4NFNA 1BL6A 3GBZA 1G8AA 2JDRA 3BELA 1ZZLA 3DZOA 3MESA 3AOXA 3WZDA 5K4IA 1XBAA 2CN5A 4Z9LA 5EM6A 4G3DA 3DGKA 3BEGA 1URCA 4BDFA 1YKRA 4YTCA 4FV6A 1KOBA 4NTSA 3ZUTA 4BWXA 1PMVA 4IX6A 3EKNA 2FSLX 2OF4A 4J52A 3R9DA 2QOHA 3LKMA 5BVFA 5BVEA 5L8KA 3A8WA 4WSQA 3QX2A 2HW7A 3P5KA 2WMBA 3UDTA 3HUCA 4YO6A 2PYWA 1ZMVA 3EN4A 4RVLA 4ITIA 1CM8A 3FMNA 2P2HA 5CTPA 4GEOA 2QOKA 3M2WA 3UVQA 4DHIB 2PMOX 4R7IA 1Q5KA 3TZ7A 4BTMA 3MY0A 5AIRA 2BCJA 1H25A 4F7SA 5CASA 4KUJA 4DH7A 4DA5A 4OGRA 1Y6BA 4R7HA 3W32A 3WF9A 4U41A 3RALA 3VS2A 4FL3A 3OCGA 1MUOA 3RKBA 4EHGA 3NAYA 2HZ0A 4LOPA 4QQTA 1QCFA 2ETKA 1YI3A 3LLTA 2HZ4A 1PKGA 4M84A 3NLBA 1YI4A 5CT7A 2Y6MA 3QTSA 4QTCA 3HNGA 4YNOA 1OUKA 3VBQA 3QD2B 1UU7A 3VRYA 5L6OA 2BRNA 2XYNA 4EYMA 4AZTA 4FV1A 5BNJA 2ZM1A 3LHJA 5CXHA 1A06A 2W99B 2YIQA 4IM0A 4FL2A 2W4KA 1YXTA 3M42A 4O96A 3CQWA 3L8SA 3FPQA 5IF1A 5M56A 3GU6A 5IISA 1A48A 5CQUA 5HLWA 2C30A 3OOGA 3LQ3A 4BKJA 1PMUA 3SVVA 3W0PA 2NPQA 3F82A 1WVXA 3FL4A 2ZM3A 4ZLOA 5LVNA 4B8MA 3DNEA 4R8QA 3AT4A 2W5HA 3NYNA 3QLGA 4XS2A 4EH9A 4EOLA 4TPTA 4XG9A 1OUYA 4H39A 4ZSGA 2X81A 3L9PA 4HCVA 3RPYA 3AMBA 2JDVA 5FLFA 3ORXA 4V0GB 3RHXA 4YJPA 2Z7QA 3W2QA 3D14A 3EYGA 3KKVA 2PY3A 4LI5A 4JIKA 3DXPA 3MB7A 5ANJA 4PRJA 4WO5A 3QC9A 2ZB1A 3W8QA 4IVBA 3OY1A 5DPVA 5FD2A 1GJOA 1XR1A 4I6BA 3IOPA 1OBDA 4ALUA 5BMSA 5IG1A 5AX3A 4BI2A 3KXGA 2QR7A 2PVJA 3F7WA 4UZHA 3QYZA 4GMYA 4I0SA 4ARKA 4CV9A 5L2SA 5CWZA 4I21A 4Y73A 3N51A 1IA8A 2J6MA 5D7VA 2BDJA 3LOKA 5CZHA 3SXFA 3NVMB 4B8LA 4HPTE 4E6AA 3EIDA 4YPDA 2KTYA 3KC3A 3VJOA 4D4YA 2YZAA 3MH1A 1KV1A 3BX5A 4BIDA 3LLAA 4WUNA 2WU6A 5TT7A 3QQJA 3AMAA 3N9XA 4G5PA 3C4CA 2X7GA 1B38A 3QHWA 5DLSA 5CQWA 3TNPC 4IAKA 1ZLTA 3HZTA 1ZARA 4PTGA 4XG6A 1W7HA 5FP5A 4AW0A 2HOGA 5BVKA 4FI1A 4MCVA 4QRCA 4AW1A 2G9XA 3KN5A 4U81A 4AAAA 3R04A 4OTHA 3MA6A 4JMQA 4RQVA 3PSCA 4DFZE 5AUTA 4W9XA 2WTKB 4XUFA 2WIHA 3GVUA 4GK4A 4CT2A 1CTPE 1URWA 2REIA 3A61A 5LCJA 4MWHA 1LR4A 3QALE 1KUTA 4PUZA 1SNXA 5JQ8A 5J79A 2OJJA 5KZIA 3R1SA 3PPKA 1IG1A 1WFCA 3G5DA 4O6EA 4FEUA 3QTZA 5CAVA 3PVUA 5HG9A 4YSJA 2BZHB 3Q4ZA 5IEYA 1F0QA 1KSWA 2R3HA 3QGYA 3O17A 2QOBA 3PJCA 3GNIB 3OOMA 2UZLA 2OG8A 2JKKA 3SXSA 4FTRA 3TNWA 2WTIA 4BYIA 4ZLYA 2XK8A 3E87A 3Q5IA 3CSVA 1PRYA 2ZYBA 4NM3A 5D12A 4ACGA 1DI9A 2YM7A 3QQGA 3T3VA 4EBVA 3EN5A 4R6VA 5C26A 5IH5A 4FZDB 4GKIA 3PSBA 1EH4A 4XOYA 2JFLA 2R2PA 3RHKA 2IZRA 3ZLYA 2DS1A 4W8EA 1M14A 4AGUA 5HNIX 5EKNA 4USEA 5HORA 3HV4A 3FC1X 2OIQA 3FMMA 3ZDIA 4AZSA 2CGXA 4PTEA 4X7QA 5DWRA 1FQ1B 2VO3A 2VD5A 2X8EA 4BJJB 3QBNA 5I4NA 5FEEA 5IMXA 3KRXA 4X2FA 4BDAA 2RFNA 1R0PA 3H4JA 4G1WA 2B9HA 2R0UA 4MD7E 4CSVA 4AS0A 3QRUA 1FMOE 4E20A 4FNYA 4O0XA 2ITPA 4L42A 4IAAA 1HCKA 4FGBA 4F7LA 1RJBA 2B0QA 4AU8A 3VS1A 2PMLX 2OBJA 3CLYA 4YLLA 4YNEA 3RI1A 4AA4A 4MNEA 1XWSA 4IW0A 3ZTXA 3Q04A 2Y4IC 5KMNA 4RT7A 3PIXA 2X6DA 2B9IA 5LMKC 5KMOA 4FSRA 4ZTQA 3PG3A 4ZSLA 3UQFA 3QKMA 5J8IA 1T46A 3WOWA 5DR9A 2Y7JA 4IX4A 4U0IA 5KMJA 4MVFA 2GHLA 4H58A 4NUSA 3NIZA 4FTOA 4UALA 4BCHA 2VO0A 1DI8A 5L6PA 1H1QA 3F7ZA 3OUNB 3V5QA 4BFMA 4HVIA 5IA3A 4EKLA 3Q2MA 1XHAA 4ONAA 1BX6A 3W2OA 3ORPA 5CU2A 2R3PA 2QCSA 3EFWA 3MB6A 4FKIA 4YPSA 5EDRA 5A6OA 5CSPA 3ZM9A 2PUIA 4ZIMA 3U9NA 5BVDA 4BCOA 1LP4A 3ZO2A 2BUJA 4D9TA 4O83A 3D5WA 3FQHA 3PA3A 4IJ9A 4OLIA 2Y8OA 3ORIA 3NUAA 5JQ5A 3CKWA 3IK3A 3KXMA 4FTTA 3JR1A 2X39A 4F1TA 1CMKE 5EHOA 2I40A 5AUWA 4PPCA 1Y8GA 4MAOA 2XNNA 3KRJA 2C0IA 2C0TA 2JAMA 3FMLA 4X21A 3TWJA 3JS2A 4D1ZA 3KEXA 5IU2A 4ENYA 4LQMA 3JVSA 1JSVA 1JNKA 4KBCA 5KMIA 4M15A 4BY9E 5JT2A 4RWKA 1YXVA 5LVPA 4I4EA 3EQFA 2ITTA 2JIUA 2VTTA 3HVCA 4IZAA 3VF8A 4B4LA 2A4LA 2WOUA 3C1XA 2PE2A 4LFIA 3W16A 4NU1A 2GNGA 3E8NA 5M55A 1OZ1A 2PWLA 3THBA 4EHVA 3FZTA 3L9NA 3SOAA 4PDYA 2V0DA 1W2CA 5A4EA 2FO0A 1FMKA 4G3EA 1OECA 2QO7A 5EM5A 3UOLA 4BVUA 4CXAA 4FIEA 4HOKA 4FK6A 5H8BA 3RPRA 5CAPA 2UV2A 3VW6A 4DHFA 5KNJA 3HDNA 5FXSA 5GZAA 4AT4A 1JLUE 2XEZA 4MH7A 4O7RA 5BPYA 4KINA 4BICA 1NY3A 3ZHPC 4CD0A 4D4VA 1M7NA 3F5XA 2OH4A 2OIBA 1VYZA 3OFMA 4ZK5A 2B9FA 4M7IA 2R64A 5I9UA 3PVWA 3ZEWA 4BDGA 4HCTA 3U6HA 1BMKA 2QHNA 3E62A 5E8ZA 2XNEA 4HCUA 3BYOA 2FB8A 3LCSA 5B2KA 2EXEA 2J5EA 2Z60A 3W2SA 4M8TA 4O0TA 3DB6A 4JOAA 4DH3A 1Q8WA 1ERKA 4L7SA 3DBQA 5J1WA 3EQHA 2GTMA 4EI4A 2GU8A 3OWPA 1PHKA 2HXQA 2YACA 3GQLA 4NJ3A 3NIEA 5A4LA 4UYNA 5IEXA 2ITVA 3NNWA 4AW2A 4BI0A 4C3RA 3FLSA 3LAUA 3OP5A 4IIRA 4G34A 4MX9A 2UZTA 5LMBA 4BDKA 2C6MA 4EWQA 3LZBA 2C69A 3TG1A 3PXQA 4JBPA 2WTWA 1JKSA 4FVPA 4C38A 4I6QA 2X0GA 3QRTA 2PK9A 2XEYA 5CANA 2BILB 3BI6A 5EI6A 3PJ3A 4X2GA 4C35A 5AUZA 5J5TA 4UBAA 4NYEA 1PXNA 1ZZ2A 5ANIA 5IQDA 4U40A 3SRVA 1F5QA 2V7AA 4XJ0A 3V8WA 3A60A 2R5TA 2VTNA 2QC6A 2WMQA 2XA4A 3CXWA 3C4ZA 3FI3A 3P7AA 1T45A 5JH6A 1O6KA 2O8YA 4AWIA 2FSOX 4ANQA 3RWPA 4E6DA 4FV9A 5CXZA 1J3HA 1ZOHA 2A27A 4FT7A 5DRBA 5B2MA 3CPCA 2JFMA 4JQEA 4JL9A 4KWPA 3EZRA 4RMZA 5I3OA 1GZKA 4ITJA 5H3QA 2VTOA 2JDOA 1M52A 3FAAA 1K9AA 4C57A 5CEQA 3QD4A 4K8AA 3DAKA 3KMWA 3V8SA 1V0PA 3LQ5A 1YW2A 1YOLA 3FMDA 4IWDA 5AUXA 3QZHA 2OH0E 3EWHA 3F88A 4FTLA 5A14A 4S32A 3ZM4A 4F9BA 3O7LD 4ZP5A 4TTHB 5CF8A 3NYOA 2RFEA 4KA3A 2PMIA 5BQ0A 4M66A 4YC3A 5AM7A 3R7IA 4FKTA 1DS5A 4UXQA 1W84A 4O2ZA 4PL5A 4EUTA 5LWMA 5HVJA 2QO9A 3TV4A 3TACA 3C13A 3TZMA 2CGWA 3ALNA 3NWWA 4QP8A 4GW8A 1W2FA 1J1CA 4XLVA 4F1OA 2BROA 3QCXA 3LCOA 3DS6A 2YCFA 3ZEPA 2XCKA 4FYNA 4F6UA 1H1WA 2IVVA 5KZ0A 4GFGA 2PE0A 4JAIA 4F9YA 4PMPA 1WBVA 3WILA 4TY1A 5AR7A 1R1WA 2J0JA 3D9VA 2KULA 4IAFA 3E7VA 2JBPA 5DT4A 4E5AX 3DK6A 3NEWA 3KRRA 4M69A 3CGFA 4RFMA 4YC8A 4E4NA 5HBJA 2WQMA 2HAKA 3UOKA 5LQFA 1Z9XA 5EW8A 4GYIA 1Q99A 4FT5A 2F9GA 4CKIA 5GJGA 4FTCA 1M2RA 1W98A 3DKCA 1J7IA 2J0MB 4G6LA 4QDEA 2VWBA 2YM3A 3ALOA 2VTMA 4NM7A 5CVGA 5AWMA 3ZFXA 5KHXA 1IAHA 3BU3A 4D2WA 3ANRA 3AC3A 5BMMA 4EL9A 3GENA 3IW4A 2I0YA 2UVXA 5HG5A 2XK6A 4Q2AA 4DEBA 3SHEA 4V05A 2ZMCA 4HZSA 4A9YA 3G6HA 3I6UA 3CPBA 4F7JA 2X8DA 2IW9A 3PDTA 1HOWA 4ANLA 4XG4A 2ZV8A 2QG5A 3E3PA 2XMYA 2W1GA 2XNOA 3O23A 1H07A 1OIUA 1PXKA 2WELA 4FZFB 1H00A 4IC7A 5A3XA 3KXNA 4TWCA 4D0XA 4BCGA 4IWPA 4Z7HA 3R30A 1E1VA 3I7BA 4FIJA 5I5ZA 4YZNA 4LYNA 2VGOA 3BYSA 2OJ9A 2XF0A 3DU8A 3U87A 4F4PA 3QUDA 5HGIA 4L01A 2WMSA 5LARA 3ZO1A 2YERA 4O7WA 4DF3A 2ETRA 4QMZA 4F7NA 3IKAA 2HZNA 2WMUA 3A4OX 4FSUA 4JNWA 4U43A 3QCSA 4KB8A 4G16A 5FEQA 4CFNA 3OCTA 4A9SA 2WIPA 3W55A 4C34A 3PP0A 1SVGA 2RSVA 2IVUA 4I0RA 2F49A 4DH1A 4HVDA 4IFCA 2XJ1A 4YZ9A 5EQYA 2ZB0A 4H36A 3FKLA 3F2RA 3DAEA 3KXZA 4CG9A 5L2WA 5GIOE 3W18A 2VGPA 2IJMA 5HZNA 4FEXA 2G2HA 3I1AA 5M07A 5I9VA 2XIZA 4CT1A 3C5UA 3L9MA 4XH6A 4ASZA 3QX4A 2QODA 4JDJA 5HVKA 4M69B 1U54