4CD0A

Structure of l1196m mutant human anaplastic lymphoma kinase in complex with 2-(5-(6-amino-5-((r)-1-(5-fluoro-2-(2h-1,2,3-triazol-2- yl)phenyl)ethoxy)pyridin-3-yl)-4-methylthiazol-2-yl)propane-1,2-diol
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
308
structure length
295
Chain Sequence
PNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title The Design of Potent and Selective Inhibitors to Overcome Clinical Alk Mutations Resistant to Crizotinib.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 295
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cd0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cd0A01
2X7OA 5FBOA 3LXPA 4UV0A 5I3OA 4M84A 1FGKA 3E7OA 4CRLA 4PUZA 1ZARA 1A48A 4GUBA 1WBTA 4BCQA 3VHEA 2ONLC 4DTBA 3FL5A 1Q3DA 4FG8A 3A61A 3AC3A 3DU8A 2ZV8A 3FZSA 3JVSA 3KKVA 3NYOA 3EZRA 2J9MA 4I93A 4LUDA 5CI7A 1UVRA 5FXRA 2C6LA 3LZBA 3ZUVA 4EQMA 2HXLA 4G3FA 5CYIA 2C0IA 4GJ3A 4FNWA 4MQ1A 3QZIA 2IWIA 2OIDA 5JZJA 3S0OA 3FXXA 3P86A 3EYGA 3FKOA 4KIKB 4EH8A 3V01A 4UMRA 1E9HA 4UXQA 2BFYA 4YJSA 5K0KA 4YHJA 2ETMA 4CZYB 1JKKA 2WQBA 2PYWA 2VTTA 4XRJA 5DHJA 5B2MA 1REKA 4A7CA 3G5DA 3SHEA 3IS5A 2QR7A 2FYSA 3D0EA 4MBIA 4WBOA 5AIKA 3FMKA 3AT4A 2PTKA 5CT7A 3KXHA 1FOTA 5DR2A 3VBYA 2BIKB 3FLWA 4I0RA 1VR2A 4OTQA 3VS3A 4CYIA 2RSVA 2JDTA 2YDIA 3TUCA 2FSMX 4ZJJA 3O0GA 4KS8A 2OIQA 3E8EA 3H9FA 4OTDA 4AA4A 2O8YA 5GZ9A 2WXVA 3OWJA 1J1CA 2IZTA 5CY3A 4CZTA 4Y85A 1MP8A 4AWIA 3FJQE 3QA8A 3MY0A 4CFXA 4O21A 2CSNA 2F4JA 3CPCA 2QOOA 4HVIA 2ITUA 1TQMA 3FMEA 5EKOA 2CGUA 4OBQA 4FKSA 5EK7A 4MXCA 5CEIA 5BPYA 4M68A 4FZFB 2H8HA 2YCSA 4WA9A 1K2PA 1BL7A 3ZSIA 2X8DA 2H9VA 2PMNX 3MVMA 1YWRA 5AV3A 3U9NA 2Y6OA 3WE4A 4CGAA 3CGOA 2W5BA 2WMRA 3GOPA 5CEPA 3F3ZA 3DZOA 3UIBA 3E87A 3W2RA 4EH3A 3OBJA 2VTLA 3AMBA 3LCSA 3AC8A 3QQFA 1M52A 2VGOA 3DAEA 3FDNA 4NM3A 3PXRA 3OT8A 5ETCA 5A4LA 3RI1A 5AAEA 3VBTA 4DAWA 4UN0C 5IEYA 2ZM1A 4EOQA 1GZOA 4EL9A 4C57A 2RKUA 4BWPA 5AR4A 3HV7A 4EH5A 4YJNA 1OL5A 4BL1A 4YO4A 4Y5HA 5F1ZA 4MBJA 2QHMA 3QTXA 3ZFYA 2CMWA 1PXMA 4G6LA 2X8EA 3OWLA 4H3BA 4XG7A 3DNDA 4EH9A 4GW8A 2R3NA 2OO8X 3PXQA 4IX5A 4Z16A 1QPDA 2JDVA 3R22A 3VJNA 1TQPA 3DCVA 4AX8A 1Y6BA 4Z7GA 1R0PA 3HMNA 2VTMA 1OIUA 3EQPA 3P0MA 4IZAA 4JQEA 4K8AA 4XHKB 1WMKA 1OUYA 3KF7A 3PXYA 5DI1A 2J5EA 3MBLA 1AQ1A 1OITA 3PJ2A 4M67A 5KMMA 3SXFA 5L8KA 2BRGA 4BKYA 3BQRA 2ERZE 2XA4A 4PL3A 3FMJA 2EB3A 4NIFA 3ZLSA 4B9DA 4BWXA 4L43A 2IW8A 3AGMA 3FBVA 3R6XA 4JNWA 4DLIA 2WPAA 3P9JA 2QKRA 4DFLA 1JSUA 4Z3VA 2YFXA 2W4KA 4QTAA 3ENHA 4L01A 5EM6A 4QYEA 2GHMA 5D7VA 5G1XA 4CMOA 5C4LA 3KEXA 4RLLA 1XQZA 4IAAA 2R0IA 4QMPA 5CEQA 2XK8A 3MS9A 2JITA 1QPEA 3LHJA 5CX9A 3RP9A 4D0XA 4F0FA 3IDBA 5D1JA 4WKQA 4RSSA 3BHYA 2ZB1A 3NUNA 3Q9XA 4YJQA 4G3GA 2UZBA 2XIXA 2FA2A 4OLIA 4II5A 3PE1A 3TKUA 3V5WA 3OC1A 5KKRB 5L2TA 4YZNA 4DT9A 2OZAB 2CLXA 3LCDA 3BYMA 3C7QA 4HVHA 2QLUA 4CFNA 3HZTA 4QO9A 4FUXA 4FYOA 3TJCA 3R30A 5M4FA 3NUSA 3GENA 3C1XA 2AYPA 2W7XA 3R04A 1LEZA 3O23A 1M2RA 2PULA 5AUWA 4CT1A 5F95A 3RCJA 3VBXA 2UW7A 3TT0A 3NAXA 5B0XA 3V8WA 2Q0NA 1Z9XA 4HPTE 2FUMA 2BRMA 3ZM4A 4KIQA 3R02A 3UP2A 4MNFA 4E93A 3OBGA 1YRPA 2HXQA 4IB3A 5L2QA 4RT7A 2WB8A 3A7HA 4X7QA 2QOBA 3OCGA 5C03A 3IW4A 4KIPA 1DI9A 5D10A 4DTAA 3PSBA 4DLJA 1URWA 4IADA 3KY2A 4H1JA 1DAYA 4AZSA 4DCAA 5EM7A 2BVAA 4J95A 2X39A 4L3LA 3ZC5A 4YPDA 4YURA 4ZZNA 2PVYA 3C4EA 5EHOA 4F0IA 2JKKA 2Y6MA 3VWAA 3G2FA 4Y8DA 3IG7A 3QXOA 4FTOA 4U81A 3ZEPA 4C3RA 4C4EA 4QP4A 2HZNA 3TI1A 2JDOA 3TUDA 4O82A 3KFAA 5E91A 3VS1A 1YDSE 1MRYA 5CU2A 3HNGA 5AP1A 4F0GA 2WMXA 5HG9A 5M53A 4BCKA 4OGRA 2E2BA 2QO2A 3P1AA 4JDHA 4BR3A 5C1QB 5JFVA 3O8UA 4G3DA 1ZY4A 4HNIA 5KHWA 4TNDA 3CKWA 4O1OA 2R3RA 3GQLA 4GVAA 4XMOA 5CXHA 2UW4A 1WBWA 1ZOEA 2JGZA 2I0HA 3D4QA 3NS9A 5D11A 4AACA 4IHPA 4BTKA 3OWPA 1V0OA 5HI2A 3G51A 3W55A 3WBLA 4ERWA 3SG8A 5GIOE 2B4SB 4RA4A 3OF0A 3PPJA 2W1HA 4FOCA 3EQHA 4BCGA 3BWFA 5CEKA 2G2FA 3D7TA 3NRMA 5KMNA 5B2KA 4OT6A 4BRXA 2ESMA 4F70A 4BZOA 2WQMA 2UW8A 2BIYA 4ZTQA 2BROA 4GKIA 3HP5A 3RPSA 5FTOA 2UW5A 4RWIA 3A4PA 3D83A 2GFSA 2C3IB 3VBQA 3QC4A 2O3PA 4TKSA 4XYFA 3VIDA 1GZNA 2VWBA 4ZAUA 2IZRA 1PW2A 4F9AA 4NCTA 5HE1A 4E6AA 3SW7A 4XS2A 3F3VA 3BHTA 3LFFA 4BTJA 1W98A 2FH9A 2IVTA 3I5NA 3PP1A 3Q04A 4O7ZA 4DITA 5DN3A 2KULA 2G15A 3K54A 3QC9A 5A6OA 5HE0A 4NT4A 3WOWA 4IJPA 3BYUA 2C3KA 4D9UA 5JGDA 3F9NA 2Y4IB 5DVRA 5HIBA 3KQ7A 5DOSA 4FNXA 3H0YA 3Q2JA 1ZWSA 3PXFA 4BTMA 5TO8A 4RRVA 1XR1A 3EN6A 4ID7A 4B8MA 5L6PA 3UNJA 1MUOA 2XIZA 2OF4A 4JAIA 3GUBA 2JFLA 4EUUA 4U3ZA 2C68A 1E1VA 3GC0A 1JOWB 3QKMA 3BX5A 4J7BA 2VTPA 3PVUA 4WUAA 3EL7A 4X6RA 2XRWA 3DXPA 4EKLA 4IIRA 4BDEA 3OD6X 3DLZA 2QU5A 3HDMA 5E8XA 5GHVA 2VO0A 3H10A 2XEZA 3OFMA 2Y0AA 4FSWA 4JQ7A 3RINA 5E8SA 4FV8A 2VWIA 3DJ5A 3ZS5A 3G6GA 4FV3A 3OCTA 4BHNA 2P2IA 4RWJA 3R8ZA 2RG6A 2ZAZA 3KRXA 4TYIA 2VWUA 2V22A 3COMA 1AD5A 1Z5MA 2BAQA 5LVLA 3QUEA 3EKKA 3FLQA 2WZJA 3DB6A 1U5QA 4HGEA 4NM0A 4PNKA 3FY2A 1OKYA 3ORNA 4F1MA 4JRNA 1OPKA 2IVUA 4I22A 3G6HA 3QFVA 2VTIA 5IMXA 5HIDA 2O63A 3TIYA 4M66A 4JR3A 4K11A 2CPKE 3U6JA 2PVHA 4O0UA 5A6NA 4QD6A 4JG8A 3BLRA 4BIEA 5LJJA 3TUBA 4PTCA 5BUEA 2P33A 1UWJA 2OWBA 4G31A 3WF8A 4RC2A 2XNNA 4NEUA 3NNVA 3OHTA 3RNIA 2UW9A 4MBLA 5KE0A 3VHKA 4MKCA 1GIJA 3JYAA 3PRIA 4RBLA 3JS2A 1CTPE 3BLQA 4QYFA 5CNOA 4I21A 2WMBA 2WMVA 3ORKA 4Y46A 4QMWA 4NJDA 2X9FA 4OUCA 4DC2A 3HDNA 1O9UA 2BMCA 1PXNA 1Q8YA 3SXRA 4XEYA 3MFUA 4A9YA 1RE8A 5E90A 4AZFA 4NIFB 4R7IA 3GGFA 5EOBA 4LOPA 4AN3A 4EUTA 4PP7A 4ZLOA 1WVXA 4FK3A 5EDPA 4IWPA 5BMMA 4YO6A 2BZHB 2WTKC 3FMDA 4YSJA 5ACKA 5K4JA 3QRUA 4FV4A 4DH5A 3V5LA 5AV0A 1OUKA 5HQ0A 4JG7A 3ZO4A 4MH7A 3QZHA 3F5UA 3G33A 3A8XA 2ZV7A 2JBOA 3LFEA 3SDJA 3VS4A 1H27A 1OBDA 1FBNA 4EOOA 2VWWA 3TCPA 4PDOA 2XYNA 3AD5A 4RFYA 4UXLA 4P7EA 4YJOA 3TNQB 1CSNA 1GJOA 4RIXB 5IA2A 1H01A 3MPTA 3RAHA 5KHXA 3K3IA 3FZ1A 4GIHA 5AWMA 3CIKA 3OROA 4ITJA 2UV2A 5I9UA 4RJ5A 4XLIA 4EK5A 3R7UA 2C0OA 5CASA 3PLAE 3RWPA 5KMJA 2B55A 1P4OA 3R7OA 4M8TA 2WD1A 3ZM9A 4DFYA 2XKEA 4JS8A 4O7LA 4BKZA 1AGWA 2YA9A 4PDYA 3BE2A 3KRRA 4I4FA 4IB5A 4I94A 4X0MA 3DQXA 1WCCA 4B0GA 4QP9A 5IA0A 4TNBA 4ERKA 2PMOX 5JK3A 3PVBA 4E1ZA 2GS2A 4AZWA 3FHIA 1KV2A 4YU2A 5KMKA 2B53A 2HY0A 4BBEA 4EQUA 4HGTA 3KK9A 5CSXA 3EJ1A 2C1AA 3H9OA 4L53A 2X2KA 5BVEA 3T9IA 4YMJA 4FV7A 2J90A 5F20A 3DV3A 2R3HA 4CD0A 3NIEA 2XB7A 4KBCA 4FVRA 3FEGA 4M69A 4KRDA 4DH3A 2UZLA 2WU6A 2XIRA 1X8BA 4NTSA 4BDHA 3WZJA 2DWBA 3PYYA 2YAAA 1IR3A 2JAVA 5EH0A 2RF9A 3FQEA 4IZ7A 2A0CX 1XJDA 3R7GA 3O8PA 4IM2A 3GQIA 3QF9A 4YZDA 2BAJA 2UZUE 5DR6A 4Q5HA 4D4VA 5IA3A 3CY3A 3UMXA 1HOWA 4LMUA 5KMLA 3OZ6A 4EOMA 2YEXA 4BCMA 2ZVAA 3GCQA 1WBSA 3S3IA 2ITOA 4G3EA 3GCPA 4N6ZA 3E8DA 4E20A 1CMKE 2YJSA 3SOAA 2XMYA 3EQGA 3LXKA 3QQJA 4QMYA 4U97A 2YISA 3P7AA 2JDSA 4D2WA 3QRJA 3IOPA 1LUFA 3D7TB 1YXVA 4IEBA 5EQPA 4QMNA 3R2YA 5AUYA 4DG3E 1BL6A 1H0VA 5IG1A 3L9LA 2A4LA 4NH1A 1JKSA 1F3MC 4OTWA 4O1PA 3VQUA 5IDNA 4W4WA 2UZNA 5IQEA 4DH1A 3TNPC 2VTQA 2YIXA 4LRMA 4FA2A 4CFVA 4QP8A 4ZTLA 2F9GA 3F2NA 3L9PA 2IW9A 1GY3A 3LW0A 2XNBA 4W9XA 1A06A 3ACJA 2CNQA 4FKRA 3D5WA 3RM7A 3ULZA 4CMUA 4YUQA 3CPBA 3QTQA 3S1HA 5CAQA 4BGHA 4GFOA 4FZ6A 3RVGA 4BCHA 4HVDA 5TKDA 4K2RA 4UB7A 4UMPA 5JKGA 4L44A 4I92A 1WAKA 4BDAA 1TQIA 3UNKA 5K0XA 3REPA 4P5QA 4R78A 3UC3A 4FIJA 4F9BA 2ZM3A 5C01A 1UA2A 4CSVA 3B8QA 2J7TA 3ZHPC 3TV7A 4K6ZA 2CNVA 1H1SA 1XKKA 2XKFA 3BGPA 4J98A 5BX0A 4BZNA 2RFNA 4O84A 2IN6A 4FYNA 3VUIA 4BB4A 4QMSA 4YZBA 2C3LA 1NY3A 2BPMA 2YIRA 4D2VA 2BKZA 1W8CA 2RIOA 5AA9A 3LQ5A 3FWQA 4ZLYA 3NEWA 3VUTA 3VUKA 1Y91A 5KX8A 4K77A 2PSQA 5EW9A 5IKWA 3MJ1A 3GP0A 3MH3A 3FZTA 3QRTA 5E8WA 4FTJA 5F9EA 5HNBA 3WE8A 1PMEA 3G9NA 3QKLA 3ZZWA 1EH4A 4ASEA 4L6QA 5FTGA 1JVPP 1MRVA 1F0QA 3UPZA 3FE3A 4EHVA 3V04A 5I5ZA 2J0JA 1XO2B 3CTHA 3QA0A 4GG7A 1ATPE 5AV1A 5A3XA 3UYSA 1KOBA 5AP2A 3S00A 1V1KA 4UY9A 4C4HA 1WVWA 4I23A 4E4NA 2OK1A 2X7GA 2IPXA 1KE6A 3CQWA 3MW1A 4IWOA 3UQGA 2G9XA 3P78A 4BN1A 3LKMA 1O6LA 5GNKA 1SYKA 5FLFA 2OJJA 2JIUA 4U5JA 3LVPA 4MVFA 4QP7A 2WIHA 2YLFA 3NW7A 4M0YA 4RFMA 5CT0A 4BHZA 4BKJA 3IDPA 4OBOA 3DJ7A 3K3JA 5AR8A 4FKTA 4FEUA 2XP2A 1BI8A 3IGOA 4AZEA 3D14A 2HENA 4C34A 2BRHA 5L6OA 1IEPA 3Q9WA 2CDZA 4FSTA 2WTCA 3O17A 4JIAA 4XOYA 3HL7A 4FTNA 2W1CA 5T3QA 5LCKA 4MEDA 5ICPA 2Z7LA 3CCNA 4OTIA 2ITZA 3D94A 3E64A 3Q6WA 5IISA 3SG9A 5HTIA 4UWCA 1YOLA 3EIDA 5EDQA 5BVWA 3TJDA 3N9XA 3DBQA 2BDWA 4IFCA 4KAOA 5HLNA 4RX9A 3F61A 5KCVA 4I24A 1UKHA 1YKRA 4F1TA 5J5TA 3PE2A 2W1EA 4V0GA 4CQEA 4DN5A 3LFSA 4GFMA 5CAVA 3NPCA 1F5QA 1NVSA 4LOOA 3AOXA 2ERKA 2ITXA 3QTZA 4V05A 4BGQA 5AUUA 3MTFA 4ZY6A 2CNUA 4AZVA 2Z2WA 4FF8A 5HESA 4O7SA 1ZZ2A 1Y8GA 2ZJWA 2B9JA 1DAWA 3NUXA 4CFFA 5KBRA 4EOJA 3B2TA 4JDJA 3H0ZA 3E63A 3POOA 3Q3BA 3HMMA 5CLPA 2WTJA 1P2AA 3IONA 4F1OA 4QNYA 2R7BA 5E8TA 3FKNA 1I09A 4QTBA 4WNOA 4QPAA 3OUNB 3HX4A 3HECA 5DYJA 5HD4A 3JPVA 2VX3A 4XRLA 4HYSA 4U0IA 3U51A 1M7NA 4BWKA 4QQJA 2YDJA 3PSCA 4E4XA 2W05A 4RIWA 5J9ZA 3TN8A 2O0UA 2A2AA 4FTMA 4NYEA 3UGCA 4XOZA 1H08A 4TYHB 2BCJA 4PX6A 2JKMA 5HE3A 4K0YA 5CQUA 4ZS0A 3R1YA 4M69B 3EN7A 3RPRA 4GT4A 4D0WA 4ZTMA 5CU3A 3OUKA 3Q5ZA 3SXSA 2OXXA 4DE4A 4ZOGA 4TWNA 3QXPA 4XUFA 3C4FA 4G16A 4M12A 4TWOA 4DEDA 2P55A 5LVPA 3L8SA 3C4WA 2WEVA 4ZXTA 2HWPA 4HZRA 5H8BA 4O7NA 4AQCA 1SMHA 3MWUA 4C02A 2XNOA 3RJCA 4WIHA 1FPUA 3F2AA 3GXLA 3PY1A 5EHLA 2QODA 5EHYA 5HNGA 4AN9A 4NM5A 2VN9A 5BYLA 3VRZA 2X6EA 3R9OA 1IASA 3N4TA 3ZSGA 4JT3A 3MVHA 4CLJA 3SW4A 4XP3A 1ZYLA 4ARKA 5HCZA 4DEEA 4QNAA 5LXMA 4R6VA 3TV6A 4LRKA 4F6SA 3F5XA 2IVVA 3NWWA 5HD7A 1RW8A 2R7IA 3FSKA 4HCVA 4ZJVA 2ZV2A 3DKGA 1PY5A 1PYXA 2C1BA 3C4ZA 1Q8ZA 4PRJA 5L8JA 3TV4A 5EKNA 2CKOA 2OGVA 2YIYA 3W2PA 3HMOA 1FINA 3O51A 4TRLA 4IWDA 4PDSA 3TWJA 2YACA 3WF7A 2C4GA 4E8AA 1OM1A 4F9WA 3UOHA 2NNWB 1OPJA 1Q99A 4EHZA 1LPUA 2QOCA 2RFEA 3BHVA 2YWVA 2BHHA 5IA4A 4ANMA 4C36A 3FYKX 4O83A 3DBEA 1B6CB 1ZY5A 3O8TA 4UX9A 2QOHA 3QQUA 4IW0A 5DG5A 5EYDA 2X7FA 4DEBA 1JAMA 5CU0A 5FXQA 4FC0A 3AQVA 4XG2A 2FVDA 1SNUA 5AUZA 3VAPA 3PIXA 3WIGA 3AC5A 1KSWA 3G0EA 3UO6A 1BMKA 1VYWA 1ZYJA 2Z7RA 4XV9A 1WBNA 4BDJA 3KGAA 3U6IA 4YC3A 4H3PA 2OU7A 3BKBA 3NCGA 4AOTA 4USEA 1YI3A 2IJMA 5CALA 4X2NA 4L00A 2C3JA 4RC4A 2OJ9A 2ZOQA 3LCOA 2W06A 3BI6A 4RWKA 5E8YA 3AC1A 4XG6A 3EOCA 4E5BA 1IAJA 4R3PA 5IEVA 3NUUA 5IMEA 3M2WA 4IWQA 3FYJX 3PVGA 4IZ5A 2YZAA 3UZTA 3RK5A 2CKQA 4C61A 3D2IA 2J4ZA 2KTYA 1OBGA 2QCSA 3QD3A 2OF2A 3SVVA 2CCIA 2WQEA 2IO6A 5AX3A 2C69A 3M42A 4J99A 4DEHA 3P7BA 3AT3A 5LWNA 4AW2A 5IH4A 5HU3A 2BZIB 4NK9A 4RC3A 2PUNA 2HW7A 2UVZA 4C37A 4IAKA 4KINA 3KULB 1OPLA 2B9IA 2IW6A 1JSTA 5GJFA 3LIJA 4YBJA 3LM0A 4XV1A 3AC2A 5C9CA 3QHRA 3E7VA 4W8DA 3FZRA 1ZMUA 1YI6A 2YCFA 2GQSA 2PZYA 3EYHA 4FEXA 5IA1A 4Q9ZA 2E9VA 1A9UA 4JI9A 3CD3A 2OXDA 3QWKA 5BVOA 4LMNA 3O96A 3FKLA 4FL3A 2EUFB 2XKDA 3QU0A 4G9RA 4LUEA 3V5JA 4DEGA 3ORIA 3G15A 3U4WA 2C6IA 4EOSA 3PP0A 3HLLA 3W8LA 4C4GA 1UU3A 3CEKA 4ACMA 4DG0E 5I0BA 1GIIA 5M4UA 4G2FA 4PPAA 2F2UA 1Y57A 3D5XA 2DYLA 1XBBA 3E3BX 3PXZA 3NX8A 2UW0A 4LV8A 4AW0A 4DEAA 2OBJA 2WEIA 4Y83A 3ORPA 5IH6A 5HICA 3EWHA 2X6DA 2PVKA 4I6HA 4XG8A 4CV9A 4MYGA 4FKUA 2CKPA 3E8NA 4FSQA 4FE2A 3DXNA 4C8BA 5ANGA 3FQHA 4YJVA 3BIZA 1LEWA 3QALE 4YTHA 5HVKA 4USDA 4FKJA 4XP0A 2C30A 3QWJA 4NU1A 3I0OA 3PY0A 3ZSHA 3F88A 4DCEA 4YZCA 4XH6A 2BHEA 3W2OA 3V5QA 4FEWA 3VNTA 2PWLA 5DFPA 4MD9E 3QYWA 1DI8A 3ORZA 4V0GB 4DYMA 3PPZA 1OKZA 1M14A 1UU8A 1DS5A 3PLSA 2J5FA 2QOFA 4UZHA 3HUCA 4FTAA 1NVQA 4YJPA 2XCKA 2GHGA 4D55A 3OOMA 5IU2A 5I3RA 4NUSA 2A1AB 5ANKA 4C33A 4EOIA 1U54A 3PVWA 4QYGA 3DXQA 4FSMA 3CTQA 2BTSA 2UZEA 2FO0A 5DWRA 5ANDA 3KN6A 3MA6A 2WIPA 2XBJA 5IA5A 3LQ8A 4GKHA 3A7JA 3EKNA 3DLSA 4R7BA 2R3MA 5EDRA 4O0YA 2GCDA 3TM0A 1XHAA 3T9TA 2WMTA 3KVXA 5A4CA 2Y4IC 3LJ2A 2IZSA 3ROYA 3ZXTA 1WFCA 2WO6A 3R01A 4D4RA 4RIWB 4JBPA 3RPOA 3KREA 4XJ0A 2GNIA 2W1IA 4YTIA 2VO6A 3KRJA 4BCOA 2PVMA 4U6RA 5HKMA 3P79A 2X9EA 5CU6A 4KD1A 1G5SA 3BGZA 1OIRA 1PKGA 3C9WA 3E88A 3SAYA 2CHLA 5ANJA 3MFRA 3F69A 5CF4A 3R73A 3MA3A 3R1NA 2V55A 1R1WA 3DT1A 4ANLA 3MTLA 5LMKC 3HV4A 4A9SA 2YITA 1MRUA 3N4UA 4C0TA 2R3PA 4ENXA 1YHWA 4NZWB 4W4YA 5CTPA 4K33A 3R7IA 2BFXA 2C6DA 4FKIA 2BUJA 2VO7A 3LFCA 2H34A 4PPBA 5L3AA 3RPVA 4A07A 1YW2A 4RZVA 2PE2A 2PE0A 3ALOA 4KBAA 5LVNA 3OMVA 5ETAA 3CTJA 4MD7E 2QU6A 3ZO3A 3LFAA 1T45A 3QQKA 4G3CA 4XBRA 3FC1X 3PDTA 2OW3A 4ASZA 3E93A 4IDVA 2ZM4A 4QMZA 5EG3A 5J1VA 3BYVA 4PQNA 2I7QA 3PWDA 4JG6A 3TL8A 1YOMA 4CEGA 2CGVA 4BGGA 5AR5A 3SLSA 2Y8OA 4C3FA 2QOIA 1YXXA 3LCTA 5C8KA 2W9FB 4CCUA 3DOGA 4RJ7A 3PUPA 3PG3A 4EBVA 5JRSA 5AJQA 2UZTA 4FZAB 1PMVA 4M7IA 4Q9SA 1OL7A 3P7CA 5CVGA 1XH8A 2C6MA 4AS0A 5IQCA 4KB8A 3B2WA 4G6NA 1PYEA 1YQJA 4JX3A 2CN5A 5HHWA 2HZ0A 3ANRA 2E9OA 3TXOA 3E5AA 3NUYA 3ZCLA 4AUAA 2Z7QA 3A2CA 3CY2A 4FG9A 5K4IA 3SX9A 4EK4A 2UW3A 3SRVA 2BKKA 3EHAA 3NCZA 4AT4A 3LXLA 4IE9A 3I5ZA 3P4KA 3RAKA 1H1PA 2PU8A 3HUBA 4H36A 2PVRA 4RG0A 1ZMVA 4EWQA 3BV2A 3A62A 3PIYA 4YJRA 2V7OA 3U4UA 2H96A 5DT0A 3HMIA 2XEYA 3RCDA 3ORXA 1QL6A 2QKWB 4FTKA 2XK7A 4NW6A 2J51A 3OP5A 2OFUA 3VVHA 4EJNA 2WMQA 3WF5A 3F2RA 4X2JA 4DG2E 4U42A 2XKCA 2QNJA 4CKJA 4E4LA 2O65A 2QQ7A 3UQCA 2VUWA 2OIBA 4XV2A 2ITVA 5I4NA 4MTAA 1KE9A 2R3KA 4L3JA 2BRNA 1J1BA 5EI8A 2Z8CA 2YCQA 4WSQA 4ANQA 4J52A 3WZEA 3LE6A 2X4FA 2CJMA 3DAJA 4IX3A 5JSMA 3EN5A 3QX2A 4UWYA 5CENA 4QQCA 4ALWA 5FP5A 3MFTA 4ENYA 5AV4A 2E9UA 4JLCA 4BVUA 5J5SA 3Q4CA 5HBJA 5I9ZA 2JC6A 4BCJA 4EZ7A 2NO3A 3O7LD 4RIOA 4F9CA 4FIFA 1OI9A 4LGDA 4CXAA 4FGRA 3IGGA 2EU9A 5KZ0A 4DGMA 4JQ8A 4GT5A 3PSDA 3LPBA 3TKHA 4C2WA 3ATTA 1YXTA 4A06A 3DTCA 4O38A 4O2ZA 2C6TA 4AW5A 5C26A 4KIOA 3ROCA 3EZVA 1PXJA 3ODYX 4O0RA 4S30A 3UYTA 3WI6A 5CEOA 1OB3A 1PXPA 3GVUA 4CMTA 5JQ8A 1APME 3HKOA 1OIYA 4PMPA 4HYHA 2VWXA 2R3FA 4IZYA 3COIA 1JLUE 4PMSA 2PHKA 3BV3A 2P4IA 4D2TA 5CS6A 2PZIA 4U43A 3IOKA 5CWZA 3ZU7A 4EK3A 2WOUA 4BI1A 3NVKI 4E6DA 3VW8A 1PXKA 3R8MA 3CR0A 4JDIA 4CG8A 2I0EA 1H24A 3LQ3A 3KXMA 3L8XA 4FGBA 1PKDA 2Q83A 5JGAA 2HK5A 4EH4A 2YABA 3KVWA 3OY1A 2B1PA 2QOKA 4QOXA 4NW5A 3CBLA 4S32A 4YHFA 1QMZA 2R3QA 3BBWA 3BPRA 4GV1A 2ZMDA 3D15A 5ITAA 2W5AA 5JFSA 4AT3A 3TZMA 4I5HA 4ZK5A 1V0PA 1KE5A 1YOJA 2YERA 1FVTA 1U54B 4MNEA 2WQOA 4B99A 4F09A 4YTCA 3W33A 1B38A 3TACA 4BYJA 4B4LA 3F7ZA 5B2LA 4BYIA 3KU2A 5CF5A 2Z02A 4IBMA 4U41A 4YHTA 3DBFA 3TTIA 2UZWE 1U5RA 4FT7A 3R1QA 4AAAA 4ZSLA 3R21A 4MAOA 4O0VA 5GJGA 3W1FA 1YI4A 5AIRA 1J91A 3C5UA 3M1SA 2XNMA 5A4TA 3MPAA 4D1XA 5J79A 3D2KA 5KO1A 3SOCA 3DK6A 1XH9A 3TTJA 5AR7A 2GNJA 4F7SA 1NXKA 4IC7A 1FMKA 4IX4A 3Q96A 3FLZA 4OT5A 2B52A 4M14A 5L6WL 4USFA 3HAMA 1JBPE 5CZHA 5AP4A 2YIWA 4FR4A 3W2SA 2A19B 3ANQA 4I41A 4E26A 4E73A 4FKQA 4L67A 4C58A 3RPYA 2R64A 3W18A 4X3FC 3GEQA 4L7FA 3F5GA 4QYHA 5AR2A 4F6WA 4S33A 4TN6A 3FAAA 3QAME 4JBOA 1ZYSA 4GU9A 4C2VA 4KRCA 3I60A 3FLYA 5A4QA 4RZWA 1G8SA 3FXWA 4QMXA 5FEQA 5T6KA 4CV8A 2IZUA 5ANOA 5HE2A 2HIWA 1Y6AA 3EQFA 3KN5A 4FKGA 1PXOA 4RFZA 5EFQA 4ZLZA 3HP2A 3H3CA 4I0TA 2EXCX 4NSTA 3KMMA 5TOZA 4H05A 4IAIA 4R3RA 1K3AA 2HOGA 4AA5A 4B6LA 4LG4A 5ETFA 5J9LA 3C5IA 2PK9A 3GOKA 4JXFA 4QQTA 3EFLA 4YTFA 4HCTA 4O7RA 1IAHA 3SGCA 2GS7A 2R4BA 3BQCA 1J7IA 2PUPA 2JFMA 3ET7A 4IB0A 2YJRA 2R3IA 3FI4A 2F2CB 4TTHB 4W9WA 4AE9A 2EB2A 5J7HA 3R9RA 4QMUA 5AV2A 2FSTX 2J0IA 4QQ5A 4CYJA 3BLHA 5CXZA 5D7AA 3AMAA 1P4FA 2B54A 2JLDA 3R00A 2BDFA 3UBDA 4EOKA 5HNIX 4YZ9A 4LRJA 3A7IA 3QD0A 2RL5A 2PMLX 4O0SA 4BDGA 5BYYA 4AP7A 2PVNA 1XWSA 3EMGA 3I4BA 5DT3A 3VUMA 3ZUTA 4J71A 4O7VA 3F82A 3R28A 3O50A 3QUPA 2Y4PA 3PJCA 3MDYA 3R9DA 1L8TA 4A4XA 4OTPA 3NYXA 3VRYA 3ZLXA 5M51A 5IQFA 2WTKB 3CS9A 1ERKA 4Q2AA 3TNHA 3QD2B 2FSOX 4MHAA 4DFZE 4IMYA 2QR8A 5HO7A 2PL0A 5LOHA 4J1RA 1OZ1A 4S34A 4AGWA 1UV5A 2W4JA 4N70A 4OBPA 3LLAA 4KBKA 4AF3A 3CGFA 4EKKA 2XS0A 3EQDA 2GSFA 1YXUA 2HWOA 4TL0A 2YM3A 5E8VA 5E1EA 5HCXA 5EM5A 2XF0A 3Q60A 3R7VA 2GFCA 4I1ZA 5HCYA 4CFMA 3NZ0A 3QHWA 5ACBC 5B7VA 4R77A 5JEBA 5K3YA 5C8NA 4LOQA 4GT3A 2WKMA 3ORTA 4RVTA 3D9VA 3DK7A 3T3UA 1Y8YA 3UIUA 3ZFXA 4ZY4A 1R3CA 5CF8A 2ITQA 4DA5A 2REIA 5I9XA 2QO9A 2GNLA 3F3TA 2HYYA 4XBUA 2VAGA 4C62A 2PPQA 4E4MA 1GAGA 4YLLA 1LP4A 3AD6A 4U79A 4DF3A 4QMLA 4M15A 5HLPA 3ULIA 5CU4A 4GU6A 5LARA 1WVYA 1ZYDA 1UU7A 1G3NA 1WBVA 4QMOA 3CJFA 4U44A 3OT3A 4AGUA 1H25A 3UG1A 4QPSA 3GCVA 4YGAA 2WQNA 5FM2A 3KXGA 5J95A 2DQ7X 2R3LA 4WD5A 2F7XE 3ZRMA 4D1SA 5K9IA 5FG8A 1WBPA 4J8MA 2ETKA 3DKFA 3OEZA 3U55A 4DFBA 4DFUA 2FSLX 4IACA 4IVBA 3DJ6A 4L68A 4AOIA 3BGQA 3V8TA 4AW1A 2ACXA 5DT4A 1YDTE 4EYMA 4KUJA 4N4SA 3G90X 2YM8A 3BHHA 2PZRA 4C4JA 3GU8A 3RM6A 3TNWA 4O22A 5EI6A 2Z60A 4BDDA 3OCBA 2J50A 3MFSA 3IECA 5M07A 5AMNA 4EZ3A 4QP3A 1UWHA 3MY1A 3UO4A 5CSVA 3SA0A 4D5KA 3MVLA 5FP6A 3BRBA 3WF9A 2ZV9A 1FMOE 4RIYA 4M0ZA 4V04A 5FBNC 4ANNA 4F9YA 2QI8A 2V0DA 2VX0A 3AD4A 3OY3A 3PG1A 1ZRZA 4G9CA 3HA6A 4IM3A 2ZDUA 4NWMA 5FRIA 5IQAA 3QQHA 4BBFA 1UU9A 2OZOA 2R3OA 4M97A 3LFBA 2QONA 2YM4A 3BU3A 1OGUA 3BYOA 4IB1A 2YHVA 4PTEA 3KMUA 2HW6A 2VZ6A 3EH9A 3NNXA 3PY3A 3RWQA 3OXZA 5JFXA 4FTLA 3KXZA 4O0TA 3KMWA 4FV9A 1M2PA 4O27B 2PUIA 5KNJA 4ZZOA 3P08A 4FOBA 5C4KA 2BZJA 2HY81 4F08A 5D12A 3EL8A 4OAVB 4C3PA 4BCIA 5M56A 4WBBB 2WMAA 5GIPE 3MV5A 4RWLA 3OTUA 4W8EA 3GC8A 4YLKA 3S2PA 4P5ZA 2YWPA 4TXCA 3RAIA 3SKCA 3UVQA 3VW6A 5CAPA 1Z57A 3NMUF 2Y7JA 2WGJA 5BVKA 5HGIA 3UP7A 4CFWA 5A4EA 4Z9LA 4JR7A 5HG5A 5IUHA 4WT6A 3Q32A 4TYJA 3O7LB 1ZZLA 3G9LX 1IA8A 4Y95A 5M55A 4ALVA 2ITTA 3FL4A 2A27A 5M4CA 2GHLA 3ZMMA 3F3UA 3O2MA 4CT2A 2I0VA 4RX7A 3H9RA 3QTWA 2OJGA 1KV1A 2WTVA 4MXZA 3NYVA 4AFEA 4Z7HA 1FGIA 5IQDA 4BCFA 2ITPA 4RGJA 1PJKA 2NP8A 2VTRA 1VZOA 2UZOA 5CSWA 3AGLA 2BR1A 1GOLA 5HX8A 2VRXA 1JPAA 1QPJA 3LMHA 2YM5A 3DAKA 4OTHA 4UMUA 2FGIA 3P5KA 1DM2A 1VEBA 3UVRA 3UO5A 4FIGA 1GZ8A 2CGXA 4L52A 2OKRA 4KNBA 5K5NA 2O5KA 3BHUA 4R3CA 4QMVA 4N6YA 1BYGA 2GNGA 2J2IB 4RJ8A 4QTDA 5AUTA 3ZXZA 4J53A 4BI2A 2F57A 4GIIA 3UOLA 2XIKA 5E9EA 4HPUE 4RQKA 5CVFA 3GU7A 4H58A 4L8MA 3THBA 2F7ZE 3QCXA 2VWZA 4BFMA 5CAUA 3BELA 3NIZA 3K5UA 3ZBFA 2BRBA 3KC3A 5HEZA 2HELA 4BDCA 2OH0E 3IDCA 5JH6A 4FT0A 2W96B 3RAWA 3EN4A 4GL9A 4RPVA 3NGAA 4RJ6A 3ZH8A 2R0UA 4D5HA 4FTCA 4OTRA 4RVKA 3AG9A 2X0GA 4V01A 5FDXA 3R8PA 4IVAA 4DBNA 4FV5A 4O91A 3QTUA 3TNIA 3PJ1A 3LJ0A 4NJ3A 5JQ5A 3HA8A 1Q97A 5DEYA 4X3JA 5JMSA 3RBWA 5IF1A 4E6QA 3JVRA 2XK3A 3MH2A 5C27A 2PUUA 3BE9A 1H1RA 4KKEA 4C38A 4FNYA 3H30A 4FTUA 5EI2A 4PMTA 5EYCA 4XCUA 3MH0A 1NA7A 4WNKA 4P90A 4M3QA 2R3JA 1LR4A 4ANOA 3DKCA 3V51A 4ZS4A 3R0TA 5J8IA 3F3WA 1PMNA 5DLSA 4O7WA 3QL8A 4GYIA 1H1QA 3FC2A 4X2GA 3COKA 5IPJA 3V8SA 5L2SA 4G34A 3ORMA 3B8RA 3GCSA 2XBAA 3UC4A 1XBCA 4E5WA 5A9UA 4S2ZA 3MB7A 3IKAA 3UMWA 3CXWA 3ITZA 3FI2A 4DGGA 2GS6A 1M7QA 1NW1A 4BIBA 5BMSA 1H26A 4HYUA 1QCFA 1Q3WA 5FGKA 1YDRE 3Q6UA 1YHVA 3FHRA 4NFMA 4O6EA 5M57A 4H39A 4F99A 4XG3A 1J3HA 1YVJA 5CANA 4AU8A 2IG7A 3CKXA 4GYGA 5AM7A 5DMZA 4WG4A 4ANSA 4C59A 3CSVA 4PPCA 5K5XA 3IO7A 4IXPA 2NRUA 3ACKA 4EONA 2NRYA 4NFNA 4UZDA 4CG9A 4KS7A 5E8ZA 2RFDA 4YZMA 5KKRC 4S31A 2XJ1A 5EW3A 2BAKA 2DUVA 3A7GA 3EFKA 4UALA 4RJ3A 5AP0A 3Q2MA 5J9YA 2W9ZB 3VS0A 3QZGA 2XUUA 3MVJA 3S95A 2X2MA 3DNEA 4HYIA 4L3PA 4L42A 4MF1A 3R8VA 2PVLA 3QQGA 5EW8A 1XH7A 3KRLA 2X2LA 4I5PA 3OWKA 5E8UA 2OLCA 3MH1A 3RK9A 4BTFA 1CKIA 2W17A 4LQMA 5TE0A 1H4LA 3UZPA 4CQGA 1CDKA 2XK6A 5IQGA 4ZTRA 1TVOA 2I0YA 1VYZA 4IANA 2R9SA 2I6LA 5AX9A 3ZTXA 3KK8A 2RGPA 3ZO2A 5M4IA 4MK0A 4F7NA 4ZTSA 2WMWA 1Q5KA 4X6QC 3NW6A 2C5OA 3EQCA 3TZ7A 4EEVA 2UZVA 4FZ7A 4E7WA 4F7LA 1Q41A 2P3GX 5AFVA 4MXYA 2C47A 3RZFA 3ORLA 5A46A 5LMKA 4DTKA 4B8LA 1UKIA 4BICA 4ZMFA 1M17A 2ETRA 3CLYA 4ZTNA 1W84A 5A14A 2G1TA 4CLIA 5H3QA 4ZSJA 2X81A 2YM7A 2HZIA 2C5NA 1IRKA 2OH4A 5DRBA 1PF8A 3RK7A 3DBDA 3I0QA 3SC1A 3T8OA 1KWPA 4MQ2A 4FSRA 4RIYB 3DBCA 4IC8A 4TW9A 4N57A 3DDPA 5FM3A 3CJGA 2XM9A 3WZUA 2WTWA 3VS2A 5FTQA 2F49A 5J7BA 3QKKA 2I1MA 4GMYA 3UJGA 1SVEA 4JBQA 5CVHA 3DS6A 4D4SA 2OJFE 4O0WA 3VUDA 5JZNA 4LYNA 1XH6A 1E1XA 4FKVA 3E92A 3WIKA 4UYAA 4OTGA 4RX5A 2W1DA 5EM8A 5FUTA 1XH5A 3GU4A 3HGKA 1H28A 4IM0A 4JDKA 2WNTA 3O71A 4ACDA 4BY9E 2G2HA 3ZRLA 1W82A 4WRSA 2VO3A 4EI4A 4BC6A 4KA3A 4KABA 4C4IA 5IUGA 2VTOA 3R71A 4GK2A 3UG2A 2QD9A 1OIQA 3JXWA 2JKQA 1BLXA 5TT7A 2WELA 2VWYA 4HGSA 4JIKA 3F6XA 3V5TA 2V7AA 2QC6A 4BDKA 5DNRA 5HBEA 5DPVA 3OXTA 3LFQA 2YCRA 2BALA 3DFCB 2QLQA 2WMSA 4E3CA 4TT7A 4A9TA 5LWMA 3IPHA 5DBXA 2XNGA 4TYGA 2W5HA 1URCA 2WU7A 3E8CA 3U54A 3PFQA 5D41A 2VGPA 2CLQA 2O2UA 2RFSA 3GFEA 3FQSA 3TIZA 4AN2A 3DQWA 3F5PA 3NR9A 4GFGA 4MXXA 3BWJA 3C4XA 3ETAA 4EHGA 5I9VA 1S9IA 3DTWA 2CCHA 4QMQA 5HO8A 5HVJA 4K9YA 5GZ8A 4D1ZA 3C13A 3LMGA 2JD5A 2V62A 3CQUA 2VX1A 2UVYA 3HRBA 2OXYA 5BVDA 3BYSA 5IEXA 4Y5QA 3Q52A 4NL0A 4ZMEA 2HAKA 4EORA 4RIXA 1JKLA 4E5AX 4HGLA 4AOJA 1ZLTA 3U6HA 5HU9A 5CI6A 4MWHA 2ITNA 5DEWA 4MF0A 4XG4A 4HOKA 3TZ8A 3WARA 5HIEA 4HCUA 5HTBA 2QG7A 3GI3A 4IH8A 2E9PA 3IW7A 4CVAA 1NVRA 4ZZMA 1BUHA 1REJA 4RLKA 5AUXA 4ZSAA 2RG5A 1IG1A 5BVNA 1Q8UA 2VTJA 4BCPA 3KCKA 3R9NA 5HTCA 1V0BA 3EQRA 3U8WA 4FIIA 1P14A 5I9YA 5J87A 3IW5A 3I81A 3R8UA 1T46A 2VTSA 4I6FA 2G2IA 4NKAA 4FODA 4FMQA 4FT9A 5DH3A 1K9AA 4ACHA 4F6UA 4YR8A 4D9TA 4OR5A 4YNEA 1U59A 3KF4A 4L45A 4DEIA 4ITHA 5HG7A 3ID6C 2ZMCA 3FMHA 4DH7A 3AT2A 3AXWA 2X8IA 4PL4A 2XNPA 2B9FA 3MJ2A 4IJ9A 4EYJA 1GIHA 3QX4A 4YLJA 5FQDC 1BX6A 3UZRA 2J0MB 2UVXA 2W4OA 3UOKA 2PE1A 3MGYA 1OL1A 2VTHA 3QGWA 3CQEA 3HV5A 1RJBA 3HVCA 4HJOA 4LI5A 5DRDA 3WZDA 3MB6A 3OW3A 4FKWA 5HVYA 4R5YA 3ZLYA 3UDBA 4YC6A 3IK3A 3ATSA 3ELJA 2I40A 2Q0BA 5FEEA 4EH6A 3PJ8A 4J97A 4CFUA 2JKOA 4ONAA 4EH7A 3FI8A 2B0QA 2C5YA 3NNUA 2XYUA 4G6OA 4EC9A 5F94A 4YC8A 3LFNA 3Q53A 2C5VA 5AEPA 2VTAA 4IAZA 2C5XA 3CC6A 4RJ4A 3OG7A 2O64A 5FD2A 1FQ1B 4X2FA 4DT8A 5L8LA 3ZZEA 2YM6A 4KKHA 3GU6A 4EJ7A 5M09A 4W4VA 4CNHA 3PTGA 4XV3A 3HEGA 3A4OX 2AC3A 4TWCA 4BCNA 5H8GA 5J1WA 3E3PA 4LL5A 4I5MA 3A60A 4G17A 4O7YA 3ODZX 3C0IA 3K5VA 4OTFA 5BVFA 4FIEA 4AA0A 3JY9A 2WOTA 3KA0A 2C6KA 4IQ6A 3WF6A 3JUHA 3MY5A 3EN9A 5HO6A 2BDJA 1U4DA 4EQCA 1OVEA 3ZLWA 1W7HA 5BYZA 5I9WA 2H6DA 3ZFMA 1Q8TA 1SNXA 4AT5A 3PWYA 3DDQA 2GPHA 3DK3A 3LJ1A 3NNWA 3GFWA 3HV6A 3R8LA 2C0TA 2J0LA 3OCSA 5CSHA 3C0GA 3PA3A 5KZIA 4EWHA 4D2SA 1I44A 4Q5EA 1J7UA 3KB7A 3RALA 5IQBA 3RNYA 5HG8A 3CE3A 3SQQA 1GZKA 4NM7A 4WHZA 2YDKA 4QP1A 1H1WA 4PTGA 4WNMA 4BF2A 2UUEA 4CKIA 5CZIA 5JGBA 3NDMA 1KE7A 4FV2A 4YJUA 2GNHA 5AAGA 2YN8A 3MIYA 3EFJA 4TPTA 2PY3A 4CCBA 3VQHA 5JT2A 2NPQA 4PWNA 1SZMA 2R5TA 4DFNA 4C35A 4O86A 3DA6A 4Y72A 2JEDA 1SVHA 4MCVA 4ASDA 2EXEA 5H8EA 2OFVA 3RHKA 3QD4A 4FT5A 4MD8E 4EK8A 4AE6A 4X3FA 2B7AA 4WRGA 4C4FA 5KUPA 1H00A 3I6UA 4HNFA 4EH2A 3QCSA 3EB0A 4D4YA 1O6KA 3SD0A 2VNWA 4EZ5A 5LCJA 2PZPA 3ZUUA 4U9AA 4QYYA 3GU5A 1MQBA 4GG5A 1Q4LA 3HMPA 3T3VA 4ANBA 1IA9A 4R7HA 1S9JA 4L9IA 4GH2A 2ZDTA 3DGKA 4WUNA 2JIIA 4F65A 3DKOA 1QPCA 3QLFA 5D9HA 4PP9A 4QTEA 5EQEA 4ITIA 4KKGA 4ZTHA 3PZHA 3Q4TA 4A4LA 2QVSE 3D5UA 5CF6A 5GZAA 3E62A 4JAJA 4RA5A 4DGNA 3FY0A 3EQIA 4CTBA 2AC5A 2BILB 2OICA 4GEOA 4XNEA 1BI7A 4DBXA 2QG5A 3QYZA 5HOAA 4XX9A 5JFWA 4FG7A 4I6BA 4RX8A 4F4PA 2GNFA 4NCTC 5AA8A 2VU3A 3D5VA 5CEMA 5LQFA 3Q5IA 3Q9YA 4PNIA 3BBTB 3VS5A 2EWAA 3TKIA 2R3GA 3LM5A 3FLSA 3TDWA 3QGYA 2YAKA 5IDPA 4J96A 4ZEGA 2VWVA 5KMIA 4R1VA 2PVJA 3UOJA 4J8NA 4K18A 2EXMA 3FMMA 1ZYCA 4JJRA 4FSNA 5DGZA 2B9HA 4IAYA 5E4HA 4FV1A 4O0XA 5AUVA 4FV6A 1RDQE 4Y73A 3VBVA 1ND4A 3TDVA 4QT1A 3L1SA 4GRBA 3TZ9A 3UVPA 3VJOA 4AFJA 1KOAA 1FVRA 2GDOA 2JIVA 3HAVA 5GINE 3GB2A 4PF4A 3I7BA 5HBHA 3NAYA 2ITWA 3A7FA 4JVGA 2ITYA 4QRCA 5T68A 1W0XC 4Z55A 3NW5A 5F4NA 3KXXA 3ALNA 2HZ4A 4MX9A 5AR3A 1YWNA 5TF9A 3V5PA 1JSVA 4APPA 4AG8A 3BZ3A 3PXKA 4D58A 4EK6A 5L2WA 4M13A 4QTCA 5KBQA 1CKJA 3MI9A 5HLWA 2PZ5A 4D2PA 2YZLA 2F7EE 5CNNA 3RKBA 3WZKA 5AP3A 2DS1A 3QCYA 4I6QA 3W2CA 3IW8A 4G1WA 5G6VA 3VO3A 3JY0A 3L8PA 4A9RA 4WNPA 1MQ4A 1YWVA 4QPMA 4F63A 2QHNA 1PXIA 3HV3A 4FTIA 2QOQA 1OECA 3BCEA 5GJDA 3RTPA 4QMTA 1ZOGA 4UMQA 4U3YA 1RQQA 2WHBA 3DY7A 3VS7A 3G0FA 3POZA 5IQHA 1YXSA 3ZDIA 3PRFA 3QCQA 5FXSA 3JR1A 3M11A 2PVFA 1PHKA 3HYHA 3R9HA 1HCLA 2WAJA 4HZSA 1H8FA 3ZEWA 4TYHA 1M2QA 4DFXE 1OL2A 4U7ZA 3FPQA 2XJ0A 2JAMA 3S4QA 4EBWA 2PMIA 4FTTA 1BKXA 5JRQA 3QZFA 3I1AA 4W4XA 3NVMB 2ZB0A 2R2PA 2V5QA 3UNZA 3VF8A 4RMZA 1HCKA 4PMMA 4DHFA 4I5CA 3LXNA 4MXAA 3LMIA 1R0EA 1PXLA 3PJ3A 5DE2A 4XP2A 4BI0A 4EHEA 3NSZA 5AM6A 4TYEA 3TG1A 2YLEA 4GK4A 4IX6A 2XVDA 4H1MA 2XCHA 4TZRA 4GS6A 4LM5A 3HRFA 2IVSA 3WYYA 3PIZA 2SRCA 2CKEA 3MN3A 3MSSA 4GSBA 4TWPA 4UEUA 3RHXA 3ENMA 2GTMA 4CKRA 3UIMA 4IVCA 4GJ2A 3QTSA 4KSQA 5DR9A 3WILA 1JQHA 4FSZA 2JBPA 3MPMA 4YJTA 3NYNA 4P4CA 3FZOA 2QOLA 5JN2A 4WO5A 4XLVA 3RZBA 3SRVB 5FEDA 4MXOA 3OXIA 5HZNA 3DB8A 4WOVA 4R1YA 3K2LA 3MIAA 3QRKA 4IDTA 4FTQA 4BDIA 3NUAA 4ZIMA 2GQGA 3GBZA 2W1ZA 3L9NA 4KSPA 2GU8A 3OW4A 4O6LA 5AP6A 4NTTA 5TR6A 4ASXA 4FICA 4ZJIA 4D2RA 4FEQA 3ZYAA 4FV0A 3CD8A 3QRIA 1OMWA 2UZDA 4ACCA 5A54A 5IQIA 3ERKA 3C51A 1JWHA 3IQ7A 3LAUA 2LAVA 3R2BA 1L3RE 3ZBXA 4KIKA 5CSPA 5M44A 3ZO1A 5M06A 4OW8A 2J6MA 4FL1A 3UTOA 1VJYA 3FMLA 5EOLA 2VV9A 5LVMA 2W0JA 4ZSEA 3IW6A 4MWIA 4N0SA 3FMNA 3Q9ZA 1XBAA 1UNGA 3U9CA 5E7RA 1YHSA 1R78A 2W99B 1U46A 3GNIB 2VD5A 3KL8A 3OOGA 4JOAA 4O96A 4FSUA 4O2PA 4TY1A 4BBMA 3COHA 5HX6A 3R1SA 5DA3A 5CAOA 5E1SA 3VULA 3UQFA 3Q4ZA 3QQLA 4RVLA 3R7EA 2QO7A 1SVGA 2WFYA 2LGCA 3FI3A 3PA4A 4FUYA 2OI4X 3GC9A 1SM2A 1ZXEA 5BUJA 4OAUC 5HORA 2WTDA 4F7JA 4I4EA 4APCA 1FVVA 4CZUA 3UE4A 3HRCA 1OKVA 2OSCA 1CM8A 4R5SA 4R8QA 3KRWA 2GTNA 4G5JA 4U40A 1H07A 4FBXA 3L8VA 1J7LA 2UW6A 2GQRA 4P2KA 3KXNA 2VTNA 4YNOA 2XZSA 2GMXA 3I6WA 3VC4A 3II5A 3OS3A 4O7TA 4X3FB 5CQWA 4A4OA 3LFDA 3F7WA 4AXAA 5IUIA 2XH5A 4CRSA 2XJ2A 3I7CA 5ETIA 3KULA 3UPXA 5FWKK 3ZRKA 4UMTA 1JNKA 3A8WA 3FLNC 3LCKA 4BZDA 4HW7A 2HCKA 4FZDB 1W83A 4QMMA 4DGOA 4FK6A 2P0CA 2X4ZA 3NLBA 4FKPA 3ZDUA 1OL6A 1NT2A 3FZPA 4FSYA 4ALUA 4FTRA 3FPMA 1G8AA 1KUTA 4YP8A 3W2QA 5LMBA 3CP9A 3UIXA 5EYMA 3ZC6A 5E92A 4AGDA 1UNLA 4BIDA 5L4QA 3MYGA 2ZYBA 4GCJA 4HVSA 5L2IA 4WG3A 4ZSGA 2WTIA 4B7TA 4PY1A 5AADA 4WSYA 4G5PA 4LGHA 2BZKB 2X1NA 4NKSA 3AC4A 4L46A 4K1BA 3FUPA 4U45A 3P23A 4FVPA 2J0KA 4E6CA 1TKIA 2Y9QA 4ZP5A 4AZTA 1WZYA 1Q24A 4U80A 4GUEA 3C0HA 4MNEB 4LL0A 4FKOA 4I20A 3QTRA 5H2UA 4UWBA 3R7YA 3V6RA 3GT8A 4DINA 5BQ0A 5BUIA 3DFAA 4FI1A 3UODA 4YBKA 3QTIA 4ACGA 3BEGA 4O81A 3RGFA 2XIYA 5ANIA 3VF9A 3LOKA 2JDRA 3C4CA 3KCFA 3PA5A 5ANEA 4YSMA 4C7TA 4JRVA 5BNJA 5EQYA 2C6EA 2C6OA 2VNYA 4DGLC 1P5EA 3QUDA 5M08A 4EOLA 4FVQA 1ZMWA 2CGWA 2ONLA 3VS6A 4CTCA 4ORKA 5AP5A 2CN8A 4DH8A 3LLTA 1Q8WA 3WYXA 4QP2A 2FB8A 4X21A 3OVVA 1CKPA 3OEFX 4KWPA 1B39A 5KMOA 4LV5A 4XG9A 4JL9A 3PZEA 3Q4UA 1UNHA 2W1FA 4IAFA 4RVMA 2P2HA 2Z7SA 3W8QA 4ZY5A 4FL2A 4FNZA 3DZQA 3R83A 4LFIA 1R39A 4U8ZA 4PDPA 3R63A 4H3QA 1ZOHA 4A9UA 3I79A 4WG5A 3PPKA 4RQVA 3EQBA 4IFGA 4UBAA 3VN9A 4F64A 1H0WA 2XK9A 1PRYA 3VUHA 4D28A 3BEAA 1WBOA 3DPKA 4GVJA 4PV0A 3ZOSA 3GCUA 2OZAA 3AMYA 3MESA 3FV8A 2E9NA 3ZONA 1KE8A 1OKWA 3VUGA 4UYNA 4PL5A 4X2KA 4JX7A 2XRUA 3FXZA 4FEVA 2XK4A 4EC8A 3FSFA 2W1GA 3N4VA 1PMUA 4L7SA 3V6SA 4BDBA 1Q61A 3U87A 4AGCA 4LGGA 4QP6A 4GK3A 1O6YA 1Q62A 2G01A 3OTVA 4IVDA 3H4JA 4JBVA 3W10A 2EVAA 5LVOA 3W16A 3SV0A 3VBWA 2AUHA 5FDPA 4FT3A 3TEIA 4FIHA 2BTRA 5IZFA 5C8MA 2WMUA 4I0SA 2QURA 3BU6A 1JKTA 4HVGA 3N51A 2XM8A 5AP7A 3L9MA 4EOPA 3QLGA 5IH5A 1GNGA 2OJIA 4I3ZA 4FX3A 3F66A 3V3VA 3D7ZA 1ZAOA 5H9BA 2OG8A 3NUPA 1XH4A 1STCE 5EYKA 5AAFA 3GC7A 5LMAA 3C50A 3EFWA 4YPSA 3RMFA 3W32A 3QBNA 2YIQA 3A99A 4BDFA 3BU5A 5DIAA 4FKLA 2XNEA
chains in the Genus database with same CATH superfamily
2X7OA 5FBOA 3LXPA 4UV0A 5I3OA 4M84A 1FGKA 3E7OA 4CRLA 4PUZA 1ZARA 1A48A 4GUBA 1WBTA 4BCQA 3VHEA 2ONLC 4DTBA 3FL5A 1Q3DA 4FG8A 3A61A 3AC3A 3DU8A 2ZV8A 3FZSA 3JVSA 3KKVA 3NYOA 3EZRA 2J9MA 4I93A 4LUDA 5CI7A 1UVRA 5FXRA 2C6LA 3LZBA 3ZUVA 4EQMA 2HXLA 4G3FA 5CYIA 2C0IA 3KIOC 4GJ3A 4FNWA 4MQ1A 3QZIA 2IWIA 2OIDA 5JZJA 3S0OA 3FXXA 3P86A 3EYGA 3FKOA 4AQKA 4KIKB 4EH8A 3V01A 4UMRA 1E9HA 4UXQA 2BFYA 4YJSA 5K0KA 4YHJA 2ETMA 4CZYB 1JKKA 2WQBA 2PYWA 2VTTA 4XRJA 5DHJA 5B2MA 1REKA 4A7CA 3G5DA 3SHEA 3IS5A 2QR7A 2FYSA 3D0EA 4MBIA 4WBOA 5AIKA 3FMKA 3AT4A 2PTKA 5CT7A 3KXHA 2XAMA 1FOTA 5DR2A 3VBYA 4BJJB 2BIKB 3FLWA 4I0RA 1VR2A 4OTQA 3VS3A 4CYIA 2RSVA 4QDEA 2JDTA 2YDIA 3TUCA 2FSMX 4ZJJA 3O0GA 4KS8A 2OIQA 3E8EA 3H9FA 4OTDA 4AA4A 2O8YA 5GZ9A 2WXVA 3OWJA 1J1CA 2IZTA 5CY3A 4CZTA 4Y85A 1MP8A 4AWIA 3FJQE 3QA8A 3MY0A 4CFXA 3P5JC 4O21A 2CSNA 2F4JA 3CPCA 2QOOA 4HVIA 2ITUA 1TQMA 3FMEA 5EKOA 2CGUA 4OBQA 4FKSA 5EK7A 4MXCA 5CEIA 4AXCA 5BPYA 4M68A 4FZFB 2H8HA 2YCSA 4WA9A 1K2PA 1BL7A 3ZSIA 2X8DA 2H9VA 2PMNX 3MVMA 1YWRA 5AV3A 3U9NA 2Y6OA 3WE4A 4CGAA 3CGOA 2W5BA 2WMRA 3GOPA 5CEPA 3F3ZA 3DZOA 3UIBA 3E87A 3W2RA 4EH3A 3OBJA 2VTLA 3AMBA 3LCSA 3AC8A 3QQFA 1M52A 2VGOA 3DAEA 3FDNA 4NM3A 4DDIA 3PXRA 3OT8A 5ETCA 5A4LA 3RI1A 5AAEA 3VBTA 3PFYA 4DAWA 4UN0C 5IEYA 2ZM1A 4EOQA 1GZOA 4EL9A 4C57A 2RKUA 4BWPA 5AR4A 3HV7A 4EH5A 4YJNA 1OL5A 4BL1A 4YO4A 4Y5HA 5F1ZA 4MBJA 2QHMA 3QTXA 3ZFYA 2CMWA 1PXMA 4G6LA 2X8EA 3OWLA 4H3BA 4XG7A 3DNDA 4EH9A 4GW8A 2R3NA 2OO8X 3PXQA 4IX5A 4Z16A 1QPDA 2JDVA 3R22A 3VJNA 1TQPA 3DCVA 4AX8A 1Y6BA 4Z7GA 1R0PA 3HMNA 2VTMA 1OIUA 3EQPA 3P0MA 4IZAA 4JQEA 4K8AA 4XHKB 1WMKA 1OUYA 3KF7A 3PXYA 5DI1A 2J5EA 3MBLA 1AQ1A 1OITA 3PJ2A 4M67A 5KMMA 3SXFA 5L8KA 2BRGA 4BKYA 3BQRA 2ERZE 2XA4A 4PL3A 3FMJA 2EB3A 4NIFA 3ZLSA 4B9DA 4BWXA 4L43A 2IW8A 3AGMA 4AXEA 3FBVA 3R6XA 4JNWA 4DLIA 2WPAA 3P9JA 2QKRA 4DFLA 1JSUA 4Z3VA 2YFXA 2W4KA 4QTAA 3ENHA 4L01A 5EM6A 3W0QA 4QYEA 2GHMA 5D7VA 5G1XA 4CMOA 5C4LA 3KEXA 4RLLA 1XQZA 4IAAA 2R0IA 4QMPA 5CEQA 2XK8A 3MS9A 2JITA 1QPEA 3LHJA 5CX9A 3RP9A 4D0XA 4F0FA 3IDBA 5D1JA 4WKQA 4RSSA 3BHYA 2ZB1A 3NUNA 3Q9XA 4YJQA 4G3GA 2UZBA 2XIXA 2FA2A 4OLIA 4II5A 3PE1A 3TKUA 3V5WA 3OC1A 5KKRB 5L2TA 4YZNA 4DT9A 2OZAB 2CLXA 3LCDA 3BYMA 3C7QA 4HVHA 2QLUA 4CFNA 3HZTA 4QO9A 4FUXA 4FYOA 3TJCA 3R30A 5BV3A 5M4FA 3NUSA 3GENA 3C1XA 2AYPA 2W7XA 3R04A 1LEZA 3O23A 1M2RA 2PULA 5AUWA 4CT1A 5F95A 3RCJA 3VBXA 2UW7A 3TT0A 3NAXA 5B0XA 3V8WA 2Q0NA 1Z9XA 4HPTE 2FUMA 3W0PA 3AKLA 2BRMA 3ZM4A 4KIQA 3R02A 3UP2A 4MNFA 4E93A 3OBGA 1YRPA 2HXQA 4IB3A 5L2QA 4RT7A 2WB8A 3A7HA 4X7QA 2QOBA 3OCGA 5C03A 3IW4A 4QEBA 4KIPA 1DI9A 5D10A 3UDZA 3PSBA 4DLJA 4DTAA 1URWA 4IADA 3KY2A 4H1JA 1DAYA 4AZSA 4DCAA 5EM7A 2BVAA 4J95A 2X39A 4L3LA 3ZC5A 4YPDA 4YURA 4ZZNA 2PVYA 3C4EA 5EHOA 4F0IA 2JKKA 2Y6MA 3VWAA 3G2FA 4Y8DA 3IG7A 3QXOA 4FTOA 4U81A 3ZEPA 4C3RA 4C4EA 4QP4A 2HZNA 3TI1A 2JDOA 3TUDA 4O82A 3KFAA 5E91A 3VS1A 1YDSE 1MRYA 5CU2A 3HNGA 5AP1A 4F0GA 2WMXA 5HG9A 5M53A 4BCKA 4OGRA 2E2BA 2QO2A 3P1AA 4JDHA 4BR3A 5C1QB 5JFVA 3O8UA 4G3DA 1ZY4A 4HNIA 5KHWA 4TNDA 3CKWA 4O1OA 2R3RA 3GQLA 4GVAA 4XMOA 5CXHA 2UW4A 1WBWA 1ZOEA 2JGZA 2I0HA 3D4QA 3NS9A 5D11A 4AACA 4IHPA 4BTKA 3OWPA 1V0OA 5HI2A 3G51A 3W55A 3WBLA 4ERWA 3SG8A 5GIOE 2B4SB 4RA4A 3OF0A 3PPJA 2W1HA 4FOCA 3EQHA 4BCGA 3BWFA 5CEKA 2G2FA 3D7TA 3NRMA 5KMNA 5B2KA 4OT6A 4BRXA 2ESMA 4F70A 4QDVA 4BZOA 2WQMA 2UW8A 2BIYA 4ZTQA 2BROA 4GKIA 3HP5A 3RPSA 5FTOA 2UW5A 4RWIA 3A4PA 3D83A 2GFSA 2C3IB 3VBQA 3QC4A 2AEGA 2O3PA 4TKSA 4XYFA 3VIDA 1GZNA 2VWBA 4ZAUA 2IZRA 1PW2A 4F9AA 4NCTA 5HE1A 4E6AA 3SW7A 4XS2A 3F3VA 3BHTA 3LFFA 4BTJA 1W98A 2FH9A 2IVTA 3I5NA 3PP1A 3Q04A 4O7ZA 4DITA 5DN3A 2KULA 2G15A 3K54A 3QC9A 5A6OA 5HE0A 4NT4A 3WOWA 4IJPA 3BYUA 2C3KA 4D9UA 5JGDA 3F9NA 2Y4IB 5DVRA 5HIBA 3KQ7A 5DOSA 4FNXA 3H0YA 3Q2JA 1ZWSA 3PXFA 4BTMA 5TO8A 4RRVA 1XR1A 3EN6A 4ID7A 4B8MA 5L6PA 3UNJA 1MUOA 2XIZA 2OF4A 4JAIA 3GUBA 2JFLA 4EUUA 4U3ZA 2C68A 1E1VA 3GC0A 1JOWB 3QKMA 3BX5A 4J7BA 2VTPA 3PVUA 4WUAA 3EL7A 4X6RA 2XRWA 3DXPA 4EKLA 4IIRA 4BDEA 3OD6X 3DLZA 2QU5A 3HDMA 5E8XA 5GHVA 2VO0A 3H10A 2XEZA 3OFMA 2Y0AA 4FSWA 4JQ7A 3RINA 5E8SA 4FV8A 2VWIA 3DJ5A 3ZS5A 3G6GA 4FV3A 3OCTA 4BHNA 2P2IA 4RWJA 3R8ZA 2RG6A 2ZAZA 3KRXA 4TYIA 2VWUA 2V22A 3COMA 1AD5A 1Z5MA 2BAQA 5LVLA 3QUEA 3EKKA 3FLQA 2WZJA 3DB6A 1U5QA 4HGEA 4NM0A 4PNKA 3FY2A 1OKYA 3ORNA 4F1MA 4JRNA 1OPKA 2IVUA 4I22A 3G6HA 3QFVA 2VTIA 5IMXA 5HIDA 2O63A 3TIYA 4M66A 4JR3A 4K11A 2CPKE 3U6JA 2PVHA 4O0UA 5A6NA 4QD6A 4JG8A 3BLRA 4BIEA 5LJJA 3TUBA 4PTCA 5BUEA 2P33A 1UWJA 2OWBA 4G31A 3WF8A 4RC2A 2XNNA 4NEUA 3NNVA 3OHTA 3RNIA 2UW9A 4MBLA 5KE0A 3VHKA 4MKCA 1GIJA 3JYAA 3PRIA 3W0MA 3TMOA 4RBLA 3JS2A 1CTPE 3BLQA 4QYFA 5CNOA 4I21A 2WMBA 2WMVA 3ORKA 4Y46A 4QMWA 4NJDA 2X9FA 4OUCA 4DC2A 3HDNA 1O9UA 2BMCA 1PXNA 1Q8YA 3SXRA 4XEYA 3MFUA 4A9YA 1RE8A 5E90A 4AZFA 4NIFB 4R7IA 3GGFA 5EOBA 4LOPA 4AN3A 4EUTA 4PP7A 4ZLOA 1WVXA 4FK3A 5EDPA 4IWPA 5BMMA 4YO6A 2BZHB 2WTKC 3FMDA 4YSJA 5ACKA 5K4JA 3QRUA 4FV4A 4DH5A 3V5LA 5AV0A 1OUKA 5HQ0A 4JG7A 3ZO4A 4MH7A 3QZHA 3F5UA 3G33A 3A8XA 2ZV7A 2JBOA 3LFEA 3SDJA 3VS4A 1H27A 1OBDA 1FBNA 4EOOA 2VWWA 3TCPA 4PDOA 2XYNA 3AD5A 4RFYA 4UXLA 4P7EA 4YJOA 3TNQB 1CSNA 1GJOA 4RIXB 5IA2A 1H01A 3MPTA 3RAHA 5KHXA 3K3IA 4O4BB 3FZ1A 4GIHA 5AWMA 3CIKA 3OROA 4ITJA 2UV2A 5I9UA 4RJ5A 4XLIA 4EK5A 3R7UA 2C0OA 5CASA 3PLAE 3RWPA 5KMJA 2B55A 1P4OA 3R7OA 4M8TA 2WD1A 3ZM9A 4DFYA 2XKEA 4JS8A 4O7LA 4BKZA 1AGWA 2YA9A 4PDYA 3BE2A 3KRRA 4I4FA 4IB5A 4I94A 4X0MA 3DQXA 1WCCA 4B0GA 4QP9A 5IA0A 4TNBA 4ERKA 2PMOX 5JK3A 3PVBA 4E1ZA 2GS2A 4AZWA 3FHIA 1KV2A 4YU2A 5KMKA 2B53A 2HY0A 4BBEA 4EQUA 4HGTA 3KK9A 5CSXA 3EJ1A 2C1AA 3H9OA 4L53A 2X2KA 5BVEA 3T9IA 4YMJA 4FV7A 2J90A 5F20A 3DV3A 2R3HA 4CD0A 3NIEA 2XB7A 4KBCA 4FVRA 3FEGA 4M69A 4KRDA 4DH3A 2UZLA 2WU6A 2XIRA 1X8BA 4NTSA 4BDHA 3WZJA 2DWBA 3PYYA 2YAAA 1IR3A 2JAVA 5EH0A 2RF9A 3FQEA 4IZ7A 2A0CX 1XJDA 3R7GA 3O8PA 4IM2A 3GQIA 3QF9A 4YZDA 2BAJA 2UZUE 5DR6A 4Q5HA 4D4VA 5IA3A 3CY3A 3UMXA 1HOWA 4LMUA 5KMLA 3OZ6A 4EOMA 2YEXA 4BCMA 2ZVAA 3GCQA 1WBSA 3S3IA 2ITOA 4G3EA 3GCPA 4N6ZA 3E8DA 4E20A 1CMKE 2YJSA 3SOAA 2XMYA 3EQGA 3LXKA 3QQJA 4QMYA 4U97A 2YISA 3P7AA 2JDSA 4D2WA 3QRJA 3IOPA 1LUFA 3D7TB 1YXVA 4IEBA 5EQPA 4QMNA 3R2YA 5AUYA 4DG3E 1BL6A 1H0VA 5IG1A 3L9LA 2A4LA 4NH1A 1JKSA 1F3MC 4OTWA 4O1PA 3VQUA 5IDNA 4W4WA 2UZNA 5IQEA 4DH1A 3TNPC 2VTQA 2YIXA 4LRMA 4FA2A 4CFVA 4QP8A 4ZTLA 2F9GA 3F2NA 3L9PA 2IW9A 1GY3A 3LW0A 2XNBA 4W9XA 1A06A 3ACJA 2CNQA 4FKRA 3D5WA 3RM7A 3ULZA 4CMUA 4YUQA 3CPBA 3QTQA 1W2DA 3S1HA 5CAQA 4BGHA 4GFOA 4FZ6A 3RVGA 4BCHA 4HVDA 5TKDA 4K2RA 4UB7A 4UMPA 5JKGA 4L44A 4I92A 1WAKA 4BDAA 1TQIA 3UNKA 5K0XA 3REPA 4P5QA 4R78A 3UC3A 4FIJA 4F9BA 2ZM3A 5C01A 1UA2A 4CSVA 3B8QA 2J7TA 3ZHPC 3TV7A 4K6ZA 2CNVA 1H1SA 1XKKA 2XKFA 3BGPA 4J98A 5BX0A 4BZNA 2RFNA 4O84A 2IN6A 4FYNA 3VUIA 4BB4A 4QMSA 4YZBA 2C3LA 1NY3A 2BPMA 2YIRA 4D2VA 2BKZA 1W8CA 2RIOA 5AA9A 3LQ5A 3FWQA 4ZLYA 3NEWA 3VUTA 3VUKA 1Y91A 5KX8A 4K77A 2PSQA 5EW9A 5IKWA 2NYAA 3MJ1A 3GP0A 3ML1A 3MH3A 3FZTA 3QRTA 5E8WA 4FTJA 5F9EA 5HNBA 3WE8A 1PMEA 3G9NA 3QKLA 3ZZWA 1EH4A 4ASEA 4L6QA 5FTGA 1JVPP 1MRVA 1F0QA 3UPZA 3FE3A 4EHVA 3V04A 5I5ZA 2J0JA 1XO2B 3CTHA 3QA0A 4GG7A 1ATPE 5AV1A 5A3XA 3UYSA 1KOBA 5AP2A 3S00A 1V1KA 4UY9A 4C4HA 2XALA 1WVWA 4I23A 4E4NA 2OK1A 2X7GA 1ST0A 1KE6A 3CQWA 3MW1A 4IWOA 3UQGA 2IPXA 3BLAA 2G9XA 3P78A 4BN1A 3LKMA 1O6LA 5GNKA 1SYKA 5FLFA 2OJJA 2JIUA 4U5JA 3LVPA 4MVFA 4QP7A 2WIHA 2YLFA 3NW7A 4M0YA 4RFMA 5CT0A 4BHZA 4BKJA 3IDPA 4OBOA 3DJ7A 3K3JA 5AR8A 4FKTA 4FEUA 2XP2A 2X0OA 1BI8A 3IGOA 3PUFC 4AZEA 3D14A 2HENA 4C34A 2BRHA 5L6OA 1IEPA 3Q9WA 2CDZA 4FSTA 2WTCA 3O17A 4JIAA 4XOYA 3HL7A 4FTNA 2W1CA 5T3QA 5LCKA 4MEDA 1W2FA 5ICPA 2Z7LA 3CCNA 4OTIA 2ITZA 3D94A 3E64A 3Q6WA 3O5AA 5IISA 3SG9A 5HTIA 4UWCA 1YOLA 3EIDA 5EDQA 5BVWA 3TJDA 3N9XA 3DBQA 2BDWA 4IFCA 4KAOA 5HLNA 4RX9A 3F61A 5KCVA 4I24A 1UKHA 1YKRA 4F1TA 5J5TA 3PE2A 2W1EA 4V0GA 4CQEA 4DN5A 3LFSA 4GFMA 5CAVA 3NPCA 1F5QA 1NVSA 4LOOA 3AOXA 2ERKA 2ITXA 3QTZA 4V05A 4BGQA 5AUUA 3MTFA 4ZY6A 2CNUA 4AZVA 2Z2WA 4FF8A 5HESA 4O7SA 1ZZ2A 1Y8GA 2ZJWA 2B9JA 1DAWA 3NUXA 4CFFA 5KBRA 4EOJA 3B2TA 4JDJA 3H0ZA 3E63A 3POOA 3Q3BA 3HMMA 5CLPA 2WTJA 1P2AA 3IONA 4F1OA 4QNYA 2R7BA 5E8TA 3FKNA 1I09A 4QTBA 4WNOA 4QPAA 3OUNB 3HX4A 3HECA 5DYJA 5HD4A 3JPVA 2VX3A 4XRLA 4HYSA 4U0IA 3U51A 1M7NA 4BWKA 4QQJA 2YDJA 3PSCA 4E4XA 2W05A 4RIWA 5J9ZA 2X0QA 3TN8A 2O0UA 2A2AA 4FTMA 4JMQA 4NYEA 3UGCA 4XOZA 1H08A 1W2CA 4TYHB 2BCJA 4PX6A 2JKMA 5HE3A 4K0YA 5CQUA 4ZS0A 3R1YA 4M69B 3EN7A 3RPRA 4GT4A 4D0WA 4ZTMA 5CU3A 3OUKA 3Q5ZA 3SXSA 2OXXA 4DE4A 4ZOGA 4TWNA 3QXPA 4XUFA 3C4FA 4G16A 4M12A 4TWOA 4DEDA 2P55A 5LVPA 3L8SA 3C4WA 2WEVA 4ZXTA 2HWPA 4HZRA 5H8BA 4O7NA 4AQCA 1SMHA 3MWUA 4C02A 2XNOA 3RJCA 4WIHA 1FPUA 3F2AA 3GXLA 3PY1A 5EHLA 2QODA 5EHYA 5HNGA 4AN9A 4NM5A 2VN9A 5BYLA 3VRZA 2X6EA 3R9OA 1IASA 3N4TA 3ZSGA 4JT3A 3MVHA 4CLJA 3SW4A 4XP3A 1ZYLA 4ARKA 5HCZA 4DEEA 4QNAA 5LXMA 4R6VA 3TV6A 4LRKA 4F6SA 3F5XA 2IVVA 3NWWA 5HD7A 1RW8A 2R7IA 3FSKA 4HCVA 4O4DA 2ZV2A 3DKGA 1PY5A 1PYXA 2C1BA 3C4ZA 1Q8ZA 4PRJA 5L8JA 3TV4A 5EKNA 2CKOA 2OGVA 2YIYA 3W2PA 3HMOA 4O4EA 1FINA 3O51A 4TRLA 4IWDA 4PDSA 3TWJA 2YACA 3WF7A 2C4GA 4E8AA 1OM1A 4F9WA 3UOHA 2NNWB 1OPJA 1Q99A 4EHZA 1LPUA 2QOCA 2RFEA 3BHVA 2YWVA 2BHHA 5IA4A 4ANMA 4C36A 3FYKX 4O83A 3DBEA 1B6CB 1ZY5A 3O8TA 4UX9A 2QOHA 3QQUA 4IW0A 5DG5A 5EYDA 2X7FA 4DEBA 1JAMA 5CU0A 5FXQA 4FC0A 3AQVA 4XG2A 2FVDA 1SNUA 5AUZA 3VAPA 3PIXA 3WIGA 3AC5A 4DDGA 1KSWA 3G0EA 3UO6A 1BMKA 1VYWA 1ZYJA 2Z7RA 4XV9A 1WBNA 4BDJA 3KGAA 3U6IA 4YC3A 4H3PA 2OU7A 3BKBA 3NCGA 4AOTA 4USEA 1YI3A 2IJMA 5CALA 4X2NA 4L00A 2C3JA 4RC4A 2OJ9A 2ZOQA 3LCOA 2W06A 3BI6A 4RWKA 5E8YA 3AC1A 4XG6A 3EOCA 4E5BA 1IAJA 4R3PA 5IEVA 3NUUA 5IMEA 3M2WA 4IWQA 3FYJX 3PVGA 4IZ5A 2YZAA 3UZTA 3RK5A 2CKQA 4C61A 3D2IA 2J4ZA 2KTYA 1OBGA 2QCSA 3QD3A 2OF2A 3SVVA 2CCIA 2WQEA 2IO6A 5AX3A 2C69A 3M42A 4J99A 4DEHA 1ST4A 3P7BA 3AT3A 5LWNA 4AW2A 5IH4A 5HU3A 2BZIB 4NK9A 4RC3A 2PUNA 2HW7A 2UVZA 4C37A 4IAKA 4KINA 3KULB 1OPLA 2B9IA 2IW6A 1JSTA 5GJFA 3LIJA 4YBJA 3LM0A 4XV1A 3AC2A 5C9CA 3QHRA 3E7VA 4W8DA 3FZRA 1ZMUA 1YI6A 2YCFA 2GQSA 2PZYA 3EYHA 4FEXA 5IA1A 4Q9ZA 2E9VA 1A9UA 4JI9A 3CD3A 2A98A 2OXDA 3QWKA 4LMNA 5BVOA 3O96A 3FKLA 4FL3A 2EUFB 2XKDA 3QU0A 4G9RA 4LUEA 3V5JA 4DEGA 3ORIA 3G15A 3U4WA 2C6IA 4EOSA 3PP0A 3HLLA 3W8LA 4C4GA 1UU3A 3CEKA 4ACMA 4DG0E 5I0BA 1GIIA 5M4UA 4G2FA 4PPAA 2F2UA 1Y57A 3D5XA 2DYLA 1XBBA 3E3BX 3PXZA 3NX8A 2UW0A 4LV8A 4AW0A 4DEAA 2OBJA 2WEIA 4Y83A 3ORPA 5IH6A 5HICA 3EWHA 2X6DA 2PVKA 4I6HA 4XG8A 4CV9A 4MYGA 4FKUA 2CKPA 3E8NA 4FSQA 4FE2A 3DXNA 4C8BA 5ANGA 3FQHA 4YJVA 3BIZA 1LEWA 3QALE 4FJVA 4YTHA 5HVKA 4USDA 4FKJA 4XP0A 2C30A 3QWJA 4NU1A 3I0OA 3PY0A 3ZSHA 3F88A 4DCEA 4YZCA 4XH6A 2BHEA 3W2OA 3V5QA 4FEWA 3VNTA 3W0SA 2PWLA 5DFPA 4MD9E 3QYWA 1DI8A 3ORZA 4V0GB 4DYMA 3PPZA 1OKZA 1M14A 1UU8A 1DS5A 3PLSA 2J5FA 2QOFA 4UZHA 3HUCA 4FTAA 1NVQA 4YJPA 2XCKA 2GHGA 4D55A 3OOMA 5IU2A 5I3RA 4NUSA 2A1AB 5ANKA 4C33A 4EOIA 1U54A 3PVWA 4QYGA 3DXQA 4FSMA 3CTQA 2BTSA 2UZEA 2FO0A 5DWRA 5ANDA 3KN6A 3MA6A 2WIPA 2XBJA 5IA5A 3LQ8A 4GKHA 3A7JA 3EKNA 3DLSA 4R7BA 2R3MA 5EDRA 4O0YA 2GCDA 3TM0A 1XHAA 3T9TA 2WMTA 3KVXA 5A4CA 2Y4IC 3LJ2A 2IZSA 3ROYA 3ZXTA 1WFCA 2WO6A 3R01A 4D4RA 4RIWB 4JBPA 3RPOA 3KREA 4XJ0A 1TFFA 2GNIA 2W1IA 4YTIA 2VO6A 3KRJA 4BCOA 2PVMA 4U6RA 5HKMA 3P79A 2X9EA 5CU6A 4KD1A 1G5SA 3BGZA 1OIRA 1PKGA 3C9WA 3E88A 3SAYA 2CHLA 5ANJA 3MFRA 3F69A 5CF4A 3R73A 3MA3A 3R1NA 2V55A 1R1WA 3DT1A 4ANLA 3MTLA 5LMKC 3HV4A 4A9SA 2YITA 1MRUA 3N4UA 4C0TA 2R3PA 4ENXA 1YHWA 4NZWB 4W4YA 5CTPA 4K33A 3UDTA 3R7IA 2BFXA 2C6DA 4FKIA 2BUJA 2VO7A 3LFCA 2H34A 4PPBA 5L3AA 3RPVA 4A07A 1YW2A 4RZVA 2PE2A 2PE0A 3ALOA 4KBAA 4LDTA 5LVNA 3OMVA 5ETAA 3CTJA 4MD7E 2QU6A 3AKJA 3ZO3A 3LFAA 1T45A 3QQKA 4G3CA 4XBRA 3FC1X 3PDTA 2OW3A 4ASZA 3E93A 4IDVA 2ZM4A 4QMZA 5EG3A 5J1VA 3BYVA 4PQNA 2I7QA 3PWDA 4JG6A 3TL8A 1YOMA 4CEGA 2CGVA 4BGGA 5AR5A 3SLSA 2Y8OA 4C3FA 2QOIA 1YXXA 3LCTA 5C8KA 2W9FB 4CCUA 3DOGA 4RJ7A 3PUPA 3PG3A 4EBVA 5JRSA 5AJQA 2UZTA 4FZAB 1PMVA 4M7IA 4Q9SA 1OL7A 3P7CA 5CVGA 1XH8A 2C6MA 4AS0A 5IQCA 4KB8A 3B2WA 4G6NA 1PYEA 1YQJA 4JX3A 2CN5A 5HHWA 2HZ0A 3ANRA 2E9OA 3TXOA 3E5AA 3NUYA 3ZCLA 4AUAA 2Z7QA 3A2CA 3CY2A 4FG9A 5K4IA 3SX9A 4EK4A 2UW3A 3SRVA 2BKKA 3EHAA 3NCZA 4AT4A 3LXLA 3W0RA 4IE9A 3I5ZA 3P4KA 3RAKA 1H1PA 2PU8A 3HUBA 4H36A 2PVRA 4RG0A 1ZMVA 4EWQA 3BV2A 3A62A 3PIYA 4YJRA 2V7OA 3U4UA 2H96A 5DT0A 3HMIA 2XEYA 3RCDA 3ORXA 1QL6A 2QKWB 4FTKA 2XK7A 4NW6A 2J51A 3OP5A 2OFUA 3VVHA 4EJNA 3TYKA 2WMQA 3WF5A 3F2RA 4X2JA 4DG2E 4U42A 2XKCA 2QNJA 4CKJA 4E4LA 2O65A 2QQ7A 3UQCA 2VUWA 2OIBA 4XV2A 2ITVA 5I4NA 4MTAA 1KE9A 2R3KA 4L3JA 2BRNA 1J1BA 5EI8A 2Z8CA 2YCQA 4WSQA 4ANQA 4J52A 3WZEA 3LE6A 2X4FA 2CJMA 3DAJA 4IX3A 5JSMA 3EN5A 3QX2A 4UWYA 5CENA 4QQCA 4ALWA 5FP5A 3MFTA 4ENYA 5AV4A 2E9UA 4JLCA 4BVUA 5J5SA 3Q4CA 5HBJA 5I9ZA 2JC6A 4BCJA 4EZ7A 2NO3A 3O7LD 4RIOA 4F9CA 4FIFA 1OI9A 4LGDA 4CXAA 4FGRA 3IGGA 2EU9A 5KZ0A 4DGMA 4JQ8A 4GT5A 3PSDA 3LPBA 3TKHA 4C2WA 3ATTA 1YXTA 4A06A 3DTCA 4O38A 4O2ZA 2C6TA 4AW5A 5C26A 4KIOA 3ROCA 3EZVA 1PXJA 3ODYX 4O0RA 4S30A 3UYTA 3WI6A 5CEOA 1OB3A 1PXPA 3GVUA 4CMTA 5JQ8A 1APME 3HKOA 1OIYA 4PMPA 4HYHA 2VWXA 1XMLA 2R3FA 4IZYA 3COIA 1JLUE 4PMSA 3BL7A 2PHKA 3BV3A 2P4IA 4D2TA 5CS6A 2PZIA 4U43A 3IOKA 5CWZA 3ZU7A 4EK3A 2WOUA 4BI1A 3NVKI 4E6DA 3VW8A 1PXKA 3R8MA 1VLRA 3CR0A 4JDIA 4CG8A 2I0EA 1H24A 3LQ3A 3KXMA 3L8XA 4FGBA 1PKDA 2Q83A 5JGAA 2HK5A 4EH4A 2YABA 4I6LA 3KVWA 3OY1A 2B1PA 2QOKA 4QOXA 4NW5A 3CBLA 4S32A 4YHFA 1QMZA 2R3QA 3BBWA 3BPRA 4GV1A 2ZMDA 3D15A 5ITAA 2W5AA 5JFSA 4AT3A 3TZMA 4I5HA 4ZK5A 1V0PA 1KE5A 1YOJA 2YERA 1FVTA 1U54B 4MNEA 2WQOA 4B99A 4F09A 4YTCA 3W33A 1B38A 3TACA 4BYJA 4B4LA 3F7ZA 5B2LA 4BYIA 3KU2A 5CF5A 2Z02A 4IBMA 4U41A 4YHTA 3DBFA 3TTIA 2UZWE 1U5RA 4FT7A