2FH9A

Structure and dimerization of the kinase domain from yeast snf1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
274
structure length
255
Chain Sequence
LADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKGRIEREISYLRLLRHPHIIKLYDVIEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords Snf1 kinase
publication title Structure and Dimerization of the Kinase Domain from Yeast Snf1, a Member of the Snf1/AMPK Protein Family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 68
structure length 255
sequence length 274
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2fh9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2fh9A01
1Y6BA 3WE4A 3GCSA 3ITZA 4FOBA 5I3OA 2QCSA 3QQHA 3REPA 1FQ1B 5M08A 4DEDA 4I5MA 1PXIA 4EZ3A 3AC2A 1PW2A 5DNRA 4OTRA 4C59A 4EKLA 5JEBA 4AWIA 4F9YA 3EIDA 5JRSA 4QQJA 3QYZA 3PLAE 2ZYBA 2IW6A 4QO9A 3L1SA 2Q0BA 3UO4A 3DB6A 4IB5A 3D5WA 3BV2A 5A4TA 1LEWA 3N4UA 1FVRA 3Q5ZA 3EQCA 5DMZA 4LGDA 3BQCA 3FLWA 4IADA 4IM2A 4OW8A 5ANKA 3KULA 2BVAA 4L01A 3PY1A 3MH0A 4TWNA 3QZIA 4IC7A 3VQUA 4BWKA 5GHVA 3NVKI 1Y91A 4CT2A 4QPSA 1WZYA 2DWBA 4ITIA 4E8AA 3QWKA 3C0IA 4ZS0A 4H36A 4FNWA 5KUPA 1XR1A 4QMXA 3TNPC 3OWLA 4KIOA 1U54A 5E8XA 3DKFA 3ZLXA 2I7QA 2HAKA 1IA9A 1W82A 2IVVA 2XKDA 4FIHA 2J2IB 4F70A 4PQNA 4O84A 4KSPA 1QPJA 3HRBA 4DH8A 3NVMB 4CCUA 3ORXA 4BN1A 3RHKA 2XIRA 2V62A 1OITA 3EB0A 3ULZA 4D1XA 3E8CA 5K0XA 4O7NA 3VF9A 4FC0A 5AV3A 3UPZA 4DCAA 2CJMA 3A8XA 2B53A 3IOPA 3WZDA 3UIXA 2PVNA 2C0OA 5AP6A 4BIEA 3TV4A 4LQMA 1OKYA 4G3CA 5TT7A 2XCKA 2RFEA 4DFBA 1KUTA 2UVXA 2VTRA 3GUBA 3QUEA 3IPHA 5CAVA 5F9EA 3JYAA 2F4JA 4NEUA 3RHXA 3DBFA 4QNAA 4X3JA 5IH4A 4ZY5A 2UUEA 4ID7A 3C9WA 4V0GA 4DHFA 4IFGA 2IWIA 3DZOA 4ZY4A 5M56A 2VNYA 4AQCA 1YI6A 5TOZA 3HUBA 3QU0A 2W06A 3DTCA 2QOCA 3QZFA 2O0UA 3FV8A 3L9LA 4IVAA 3OBJA 4V05A 4O0TA 3TG1A 2CGUA 5DI1A 4XYFA 3EQFA 3K3IA 1HOWA 4DGOA 3A8WA 4UZHA 2J9MA 4DLIA 3IS5A 2F7ZE 3IO7A 4H05A 3EKKA 5GZ8A 4YLJA 2XKCA 3C4FA 5I3RA 5JH6A 4KIPA 2B1PA 3JY0A 4RC4A 3UNZA 5CWZA 1JKLA 2QHMA 1KOAA 2PVLA 4YJRA 2JAVA 3DB8A 3OT3A 1Q8TA 3SW4A 3F2AA 3WYXA 3QRKA 4ITHA 2Z7RA 5AAFA 3FZRA 2QODA 2F7XE 4UXQA 3SV0A 1JBPE 3FKOA 1PF8A 4K33A 1H0WA 2UW6A 3LQ3A 5FDPA 3NR9A 1XH8A 1RE8A 4QQCA 3MY0A 3ORLA 5KMIA 4DFUA 5ETIA 3DK6A 3PLSA 2WELA 1JKKA 5BX0A 4BGQA 3TUBA 2YM7A 3D7TA 4ZZMA 1OL5A 2BDWA 3Q4UA 1WBTA 3BE9A 5KMJA 5HTCA 3ZRKA 4XG3A 4IAYA 2FSTX 3E7VA 2XKFA 3FPMA 3UQGA 2YAAA 3ZLWA 3MWUA 4BF2A 4IZ5A 3F3ZA 1JAMA 4FT0A 5EYMA 2VV9A 4IMYA 3A99A 3ZUUA 5CF8A 3I0QA 4BZDA 4V04A 5CT7A 4NYEA 2R3LA 3BE2A 4YJPA 4WT6A 3AMBA 2KULA 4FTAA 4R3RA 4KA3A 2O64A 4FIGA 2WTIA 4AOJA 4EH2A 1REKA 4PPAA 4BHZA 4IM0A 1BL7A 3AC5A 2EXCX 2QKRA 3SAYA 4Y73A 4B4LA 2UZWE 5AUYA 4UMRA 4ZTHA 5C27A 1B6CB 4K18A 3GU4A 5AA9A 5EI8A 1PXJA 3Q52A 2V7AA 2WOUA 3SQQA 4D2WA 4QYYA 3I4BA 4DGMA 3ODYX 4XUFA 5HORA 4IQ6A 4O0RA 4EZ7A 5KMKA 2CCIA 4DG3E 2AC5A 2QLUA 1ZMVA 2ZDTA 4I23A 4PWNA 5AIRA 3UJGA 5I9ZA 5C01A 3MYGA 5IA4A 4I1ZA 1M2RA 3UIBA 1T46A 3HMOA 4G31A 3QX4A 2Y4IC 3BGQA 4S2ZA 2XEZA 3W32A 2CNVA 2JDSA 4JQ7A 3KXHA 3MPMA 4MNEA 5HBEA 5EG3A 2X1NA 5TKDA 2GHGA 2X39A 5CF5A 1APME 3H9RA 4FKGA 4BCQA 4BHNA 4IZYA 3DCVA 5DRDA 1CKIA 5J9LA 4LRJA 5L2QA 1BLXA 4UMPA 4GVAA 4DBXA 3ANRA 4O96A 4UV0A 1ZY4A 2CGWA 4RLKA 4C0TA 4FSTA 4YZDA 4ZMFA 1Q4LA 4J71A 4A9TA 4J95A 4B0GA 3QTQA 4QTEA 4GEOA 4YJOA 3UODA 4FICA 1DI8A 4DTAA 4YNOA 4D0WA 4EK8A 2OJGA 2ZVAA 4NM3A 1NVQA 5JZJA 3QQKA 1BUHA 3ZDUA 4C4HA 1PY5A 5CS6A 4HYUA 3ELJA 4AZVA 1TKIA 1YHSA 4TTHB 4ASXA 3SGCA 4MD7E 4PDYA 5J79A 4M68A 4O0WA 4EK3A 3C7QA 3ZC5A 4DITA 2I1MA 5D7VA 2BHHA 3NMUF 4G9CA 3MS9A 3TACA 3VBVA 4I0SA 2OJJA 2GNJA 2QOFA 2WHBA 4UWBA 3WYYA 3GVUA 1XBAA 4E1ZA 2A4LA 1YOMA 2W5BA 2WFYA 3BI6A 4GFGA 4P4CA 2BKKA 1OECA 3RPVA 4ORKA 3WF6A 4KD1A 5HG9A 3V51A 2QOHA 3PZHA 2XKEA 2J5EA 4A7CA 4FEWA 4WNMA 3NUNA 2RFDA 3BRBA 4IIRA 3WZJA 3WZUA 4NZWB 4EKKA 3DJ7A 3FMMA 2ZV9A 4KINA 1KOBA 5GINE 3PJ1A 5HG8A 4AZFA 4BZNA 4W4YA 3FKNA 3RK7A 3LCDA 4GK4A 2BUJA 4K77A 2YM3A 4OTQA 3BELA 3LOKA 3T3UA 3O96A 2VZ6A 4YC8A 4FNXA 3R8PA 4EBVA 5CSHA 4GFMA 4BTJA 4MXAA 5EOLA 1BX6A 3N4TA 4WNKA 5EKNA 2QU6A 2IG7A 3HEGA 4DGGA 4FTIA 4NUSA 5EI6A 3QCQA 3ZEPA 4IAKA 3KC3A 2OWBA 1FOTA 3UC4A 5E9EA 3W16A 5CVFA 2GSFA 2VWVA 3VS7A 4M69A 2F7EE 4I6BA 2ITUA 4JBPA 4CRLA 2JDVA 3DFAA 5CXZA 3F3TA 3PDTA 2PVJA 5T6KA 4F7JA 3EHAA 3N4VA 3IW4A 1OI9A 3KVXA 1FVTA 5JZNA 5DT4A 2F9GA 3D7ZA 5DVRA 2UW4A 1PMUA 3O8PA 5FD2A 2OFVA 4O0SA 5EI2A 1PMNA 4F0GA 3P79A 1EH4A 5GIPE 3LFNA 4GKHA 3FSKA 2PVRA 4NKSA 4TN6A 2PHKA 3C0GA 5AR4A 3SD0A 2GHLA 2W1CA 3NNWA 2Z7SA 2PZ5A 5JMSA 2X7GA 4JS8A 3A7GA 3OD6X 2X6EA 2JBOA 3HYHA 2XK6A 1DAYA 3QTIA 3D5UA 2C5NA 3EN5A 3GT8A 4ANOA 4EH8A 5JSMA 4C4JA 2XNOA 3QZHA 4CSVA 2I0YA 4IE9A 1ZY5A 3E8NA 2WQNA 3TV6A 3ZDIA 3PE2A 2CPKE 3QRUA 2YACA 4AW0A 3Q4ZA 2HENA 4PF4A 3W10A 4EOPA 2OW3A 5IQEA 5HG5A 4BKJA 1OUKA 2VTMA 4TY1A 4NCTC 2X81A 5LMAA 4FTTA 3RAHA 4AGUA 3PTGA 2YZAA 4C37A 3LFEA 5HQ0A 5KZIA 5CVGA 4FV5A 3H0YA 3BBTB 5J7HA 3SHEA 5G6VA 4RIYB 4DEAA 3TJDA 2EUFB 3LAUA 3QLGA 1OIRA 2YLEA 4RFZA 2BRNA 3G51A 4FMQA 4E6QA 1WAKA 4M67A 3HAMA 2C6IA 3HVCA 2R64A 4CNHA 3PY0A 2QO9A 3IOKA 4PRJA 3ZYAA 4F9BA 3ROCA 3NAYA 2GMXA 4AA0A 4IWQA 4ZSEA 3TXOA 5HCXA 1GOLA 4A4OA 3MB7A 3VHKA 4FSQA 3ZOSA 4C38A 2YCRA 5EW3A 4AW1A 3UNKA 2CKOA 4EH4A 4D4RA 1PXMA 2HYYA 2WTVA 2X9EA 2BIKB 3O23A 4X2GA 4BZOA 5L6PA 3LM5A 4YLKA 2ITYA 4EUTA 3R01A 5JFWA 4E20A 3LVPA 3KEXA 3HA6A 3L9MA 3R0TA 2VO7A 2Z02A 2QU5A 4MWHA 4C57A 4R1VA 2P4IA 3ZS5A 4BIBA 2PPQA 4I41A 4FG7A 4FEXA 1OZ1A 5HHWA 1YWRA 3MJ1A 1BYGA 1NY3A 2R9SA 4P90A 3FKLA 4XG6A 5E1EA 4YBKA 3DAEA 4KS7A 1PJKA 5KZ0A 4XLVA 3O7LB 4FZ7A 3ANQA 4YUQA 2XNPA 3VN9A 4IB0A 1H07A 2B9IA 2RGPA 3E93A 2OU7A 3LZBA 5CALA 3CBLA 2HOGA 2P3GX 3VUMA 3JR1A 4I0TA 4XX9A 4Y46A 5CZIA 2IVTA 4YJUA 3GXLA 2Y7JA 2XP2A 3MIAA 3QRTA 3DXPA 3RBWA 3Q2JA 3FLNC 2OKRA 4G3EA 4X2FA 3IGGA 4BCIA 3H9FA 1TQMA 1YW2A 2P33A 2I0EA 2G9XA 3KQ7A 1H4LA 3FZ1A 4FIFA 4Z9LA 3FMDA 4C2VA 2W1DA 4DA5A 3ORTA 2PMNX 3EQGA 3CGFA 4CTBA 1MQBA 4I5PA 4X2KA 3AT2A 4PL3A 3AD5A 3VHEA 5FTGA 3A62A 3KK8A 4FSUA 4PNIA 3KK9A 3AMAA 4J52A 5CF6A 3Q60A 5LMKA 5IQCA 5CTPA 4LRKA 4FK6A 2XH5A 1TQPA 5EQEA 1ERKA 4ZTLA 5IEVA 3BEAA 3ID6C 3PYYA 4F1MA 2UW3A 1CSNA 4IHPA 3L8VA 4BBFA 4S34A 4R7IA 3KFAA 3GC7A 4C3PA 1MRVA 4DC2A 5BVEA 3CR0A 1ZWSA 1Q8YA 1JOWB 4I92A 5KKRC 5BYLA 4HW7A 4QMQA 4LRMA 5HU9A 4X6RA 5DG5A 1P14A 3CCNA 4K8AA 4EH7A 2O5KA 4DTBA 5AAGA 2VX3A 4YJVA 3FUPA 4FV1A 4MD8E 3VAPA 2V0DA 3I6UA 3MPTA 2CCHA 3I81A 4BR3A 2YCSA 3D5VA 3KXGA 4FVPA 4CG9A 5ETAA 1CDKA 4FZAB 3O8UA 5AA8A 2FYSA 2QR7A 4WBBB 3ORNA 5CXHA 1UU8A 3OVVA 3QZGA 5AP3A 2RL5A 2WO6A 2YWPA 4MEDA 3BLQA 5KMOA 3VW8A 1GIJA 4FKPA 3V5LA 5HEZA 4UMUA 3FHIA 4QMLA 3W8LA 4GV1A 4RJ4A 4YBJA 1ZOHA 4YPSA 4JT3A 5DWRA 4FSZA 4AGWA 1J7IA 2Y8OA 4ZSGA 5ANIA 1H27A 3FLQA 4F1OA 4PNKA 4OUCA 4CRSA 4DT8A 1O6YA 4LUEA 5A6OA 3HP2A 3EN4A 4WBOA 4FVQA 4GFOA 1Z5MA 3E3BX 3QFVA 2YERA 4JXFA 4DH3A 4AX8A 2UW7A 3BWJA 3QTUA 4JDJA 4ZOGA 4LGGA 5DHJA 1E9HA 4ENXA 4DEGA 4Y95A 2VWBA 3KN6A 1OL2A 3NSZA 4D4VA 2A27A 2R3KA 4Y72A 2BCJA 3OROA 1B38A 4FIIA 4QMVA 4ASEA 4YZBA 2ZV2A 4YLLA 3TNHA 2VAGA 2WMXA 3LMHA 4R1YA 3W2OA 4O7LA 4UXLA 2QOLA 4Z3VA 2BZJA 4BCOA 3TUCA 4WA9A 1OPJA 5CQUA 2IW8A 3ZFYA 5KNJA 5HTBA 3FEGA 1NVRA 3EMGA 3C5UA 5J1VA 3N9XA 3SX9A 4OTDA 2OZOA 4D2VA 2GCDA 1GAGA 4GUBA 4BDJA 3VW6A 4J96A 2XIZA 2R3FA 2VN9A 3RP9A 3VUTA 4D2TA 4R6VA 2ZV7A 2UZEA 5AP5A 4N6YA 3O7LD 2ITQA 4MWIA 4U44A 3LKMA 5K0KA 3MB6A 5B7VA 3QHRA 4RIYA 5EYDA 4DEEA 1OM1A 2ACXA 5HTIA 3KMMA 3HV3A 3BHHA 5IQDA 4YC3A 1UU7A 4OBOA 4W4WA 5EHLA 5FBNC 4IVDA 3W2QA 4A06A 4HCUA 4JVGA 5E7RA 4TWOA 5CVHA 1BMKA 4AE9A 4FV8A 2B52A 4FNZA 3LJ0A 2RG6A 2EWAA 4TWCA 3OS3A 5CANA 3PA4A 2WU6A 1H25A 4IJPA 2GNFA 4G5JA 4H3QA 5EW9A 5J8IA 4F7NA 3HV7A 2HXQA 4JG8A 4KIQA 4AZWA 4GJ2A 4RJ3A 5JGDA 4KKEA 1XKKA 3IW6A 4WUAA 5IA2A 4WRGA 5KBRA 5LVMA 4I3ZA 3WIKA 4XV3A 2YJRA 3LMGA 1Y8GA 5E92A 2PMIA 3ZCLA 4O2ZA 3OT8A 4A4XA 3U87A 4OGRA 2PYWA 3C5IA 3IW8A 2WTKC 2YCFA 4JRVA 4HNIA 4NKAA 4F0FA 4RRVA 2W0JA 2FB8A 2I0VA 3R7YA 2W7XA 2YISA 5CU4A 3ZM4A 3QF9A 4E4LA 4NFNA 2B54A 2C6DA 5ETCA 2IO6A 4CEGA 5HO7A 1KE7A 4M3QA 3I5NA 3S0OA 3ZO4A 1LP4A 1CKJA 2JIVA 1F0QA 3BHUA 1KV1A 1SVHA 1ZXEA 2C0TA 2C5OA 3PWYA 4RWLA 4JOAA 4YZ9A 5FGKA 3RPRA 4D55A 5HG7A 2BTRA 4QP8A 2VTSA 3M42A 3L9PA 4UWCA 4YZCA 3RPOA 3A4PA 1H1PA 3E64A 4CYIA 4ZP5A 1B39A 5EH0A 3VBQA 1H00A 2B4SB 5CSWA 5D1JA 2R4BA 2JFMA 3ZXTA 2X6DA 1M17A 5M4IA 1A9UA 2HK5A 5BVWA 3FI4A 3VS4A 2GFCA 4ASZA 4JQ8A 5I9XA 3LFFA 4FUYA 5FP5A 2XBJA 5J5SA 3GOKA 3BU3A 1OKVA 2G2HA 2ERZE 3H10A 4IAZA 3NPCA 4BBMA 4WD5A 3VUIA 2W1HA 4ZS4A 3LHJA 5IF1A 4MBJA 3GC9A 3HKOA 3V04A 4L53A 1DI9A 3B2TA 1UU9A 5IUIA 4EONA 2UZOA 3K3JA 2JKMA 4FGBA 4BDAA 3ZSIA 4EJNA 2IPXA 2VTTA 4FT9A 4NTTA 3UOLA 4D5HA 1Q5KA 3FHRA 3GU7A 3D0EA 5EOBA 5K5XA 1J1CA 3ZLYA 3F2NA 3MY1A 2C30A 3LLTA 3R22A 4KWPA 4DEIA 1VYWA 2XZSA 3RAKA 2QI8A 2R2PA 3N51A 3MW1A 3Q6WA 4GU9A 4QMUA 4AACA 2Y4IB 4DINA 5AUTA 3UTOA 4TYHB 3KRWA 4BRXA 4IAAA 3WOWA 4MQ2A 4AW5A 2FO0A 3KKVA 3E63A 4I6FA 4RMZA 4F0IA 4GMYA 4AZTA 5CEPA 4CGAA 3I7CA 3NW6A 2XBAA 4OT6A 3BGZA 1OPKA 4YTIA 4BFMA 5JKGA 3PE1A 4FKUA 1XH9A 2A0CX 2C69A 3RVGA 4N0SA 3GCQA 2PZYA 3I6WA 4IJ9A 1U5RA 3RAWA 2PY3A 3FMNA 4YJSA 4YHJA 1RW8A 3G6GA 3IGOA 3W33A 2W9ZB 4LUDA 3UOHA 1J91A 3OCSA 2FSLX 1J1BA 4F09A 4IWDA 1HCKA 5TR6A 1QCFA 4KRDA 1OL1A 2YLFA 3AMYA 3LJ2A 4YJNA 4IFCA 3Q3BA 4UY9A 5E8WA 5BVOA 5HBJA 5JT2A 3TDVA 3TM0A 5J95A 3R04A 2X2LA 3AC3A 3Q9ZA 3HA8A 4RC2A 3ZLSA 3HECA 4EQCA 4M84A 2QOKA 3E7OA 1W8CA 3ORIA 1OGUA 3F5GA 4KIKB 5A4LA 4YU2A 4YJQA 4K6ZA 3P5KA 2DS1A 2J4ZA 4FIJA 3RM6A 1P2AA 3E5AA 3EQHA 3B8RA 4HGSA 3V3VA 3RPYA 3ZONA 4BCJA 4BWPA 4AZSA 1NT2A 5ACKA 3PVGA 4NFMA 3OHTA 5H8BA 4CT1A 2UW0A 4JL9A 4O6EA 4ZJIA 3QL8A 4CVAA 3ET7A 1QMZA 3H3CA 3FY2A 4NSTA 4CFVA 2BAKA 5ACBC 3FXXA 5J7BA 4RIWB 1AQ1A 4ZMEA 2WMTA 4APPA 5FEQA 3AD6A 3FL4A 1WBVA 3KN5A 4QMOA 1R1WA 3GGFA 2HXLA 4FSNA 5AP7A 4NWMA 4JX7A 3HMPA 4DAWA 4EOJA 1WBNA 3FXWA 4MX9A 3I60A 1GY3A 4XMOA 5LVLA 4USEA 2HY81 2PVHA 1YDRE 4F64A 2EU9A 4FV7A 4PDSA 2WQEA 2XM9A 1K3AA 3LFQA 3R8UA 2P0CA 3H0ZA 5IEXA 3RNYA 4IVCA 4OBQA 4HYHA 2YFXA 4L46A 3QKLA 3CTHA 1UNGA 4JAJA 4YTHA 4DLJA 4KABA 4LG4A 4F1TA 2BILB 1UNHA 2BFYA 2Y9QA 3DJ5A 3F7WA 2WEVA 3QD0A 3EQRA 3RJCA 5GNKA 2PVFA 3LW0A 3GQLA 4TRLA 3C4WA 5FEEA 5AUXA 3QRIA 4O21A 4KSQA 4TL0A 1U59A 2W1GA 1WBPA 2X7OA 5EW8A 2EB3A 3O71A 3R1SA 1BKXA 1FVVA 4L45A 4F6SA 1NA7A 5AR8A 3VUKA 4LOOA 3HDMA 4ZLYA 2BDJA 3TT0A 3WI6A 4RZVA 5J5TA 2VWYA 5AWMA 4AA5A 5C4KA 5HX8A 3BV3A 4YO4A 5LWMA 1H1RA 5CAQA 2GS7A 2F49A 2OI4X 5IH5A 3LCOA 3FJQE 4BIDA 2OF2A 3G0FA 3UIMA 3UOJA 4DT9A 2XYNA 5LWNA 4HYIA 2YWVA 4KRCA 3QTXA 4WO5A 2QNJA 3UQFA 2QQ7A 3NUXA 4WG3A 5M06A 4BDIA 3HRCA 4ACCA 5I0BA 5L2SA 4O7ZA 3PSDA 3OG7A 4ZY6A 3ZH8A 3T8OA 2FSMX 4USDA 2YEXA 2UZDA 5HO8A 2PWLA 5HE0A 5AUUA 3PRIA 4OT5A 5AR7A 3DZQA 1Q24A 4FOCA 2OXYA 5CY3A 3FBVA 3NYNA 4QTDA 3D14A 2OBJA 4CCBA 4EK5A 4ANNA 3PPJA 4FIEA 3D15A 3NUSA 2UVYA 1ND4A 5AADA 5AAEA 2ITOA 5DE2A 3PZEA 2F2CB 4FKIA 1Y57A 3TKHA 3F7ZA 4EOSA 5CEMA 4FKWA 1OIUA 3P23A 3Q9WA 2OG8A 1YXTA 4AZEA 4BL1A 1IR3A 5LXMA 3F6XA 4Z7GA 1DS5A 2W4JA 3CJGA 4U7ZA 4ZIMA 4YSJA 5EK7A 2X4ZA 4CFXA 3NDMA 4F08A 4ITJA 4H1JA 3ZFXA 1QPCA 4QMYA 3A7HA 5D7AA 4DFNA 4RGJA 4FTCA 4UEUA 5CAOA 4AOIA 4ZSLA 4U97A 4HVSA 5IH6A 2JD5A 4X2NA 3PIXA 4BI1A 1FPUA 4D5KA 3QQFA 3ORZA 3FDNA 2VGOA 4WHZA 2E9VA 3R9OA 4CFFA 1PYXA 3OUKA 4QYGA 3KA0A 1WFCA 1KE9A 3POOA 3TZMA 3C0HA 1XH6A 4CKJA 3MVLA 4NM0A 4PPBA 3BIZA 2JKKA 5A46A 2EB2A 1VJYA 4FA2A 2O3PA 4BCFA 4BCPA 2UV2A 2OK1A 1G8AA 2PMOX 3DKOA 1YXXA 3ZO1A 4GG5A 1FGIA 5CAPA 5KMLA 2J50A 3GBZA 5HGIA 2RG5A 1Q3DA 2QKWB 2QC6A 3WBLA 2NP8A 3CD3A 3NAXA 5EYCA 1H26A 3MH1A 1PKDA 2WMQA 3I5ZA 2C6TA 3FL5A 5DT3A 4CFNA 1OL6A 4BVUA 4FKQA 3ZHPC 4ANMA 1SVGA 3ORMA 1YHVA 1YWNA 4RSSA 3VUHA 3EJ1A 3GOPA 4YTCA 3MA6A 2X4FA 5K3YA 4R5YA 5EQPA 3JS2A 3SXFA 5BYYA 1SYKA 2VRXA 4QYEA 1JSUA 2J90A 4MK0A 2C6EA 3ZEWA 3VVHA 2CLQA 2ITTA 2ZB1A 3EZRA 1G5SA 2WPAA 3SXSA 5KBQA 3NZ0A 1URCA 4E26A 4FV3A 3F82A 3G9NA 4YTFA 4CKRA 3PXRA 4EL9A 3GQIA 4ZTSA 2ONLC 4JQEA 4XG7A 3MN3A 3ZRLA 4EWQA 3V5PA 3OFMA 4AT5A 4BICA 3UZRA 3O8TA 3OUNB 4KB8A 3JVRA 1V0OA 2ZM3A 3NNVA 2UW9A 1H0VA 3E92A 3RPSA 5L8JA 2R3JA 4TT7A 4A4LA 5J87A 3R71A 3F61A 5AUZA 5CEKA 1OB3A 4KIKA 4M66A 5IQGA 5DR2A 2BRBA 3BBWA 4YZMA 3BYOA 2XK7A 3QUDA 4JIAA 4ZAUA 5E8SA 1OBGA 4GU6A 4KS8A 3P08A 5KKRB 3PXZA 3NUPA 4EOLA 3ACKA 4RIWA 3TNWA 3R30A 4FX3A 2WOTA 4JBVA 5AJQA 5HIBA 4E4XA 2AUHA 3QYWA 4RWJA 4DH1A 4BDKA 4YMJA 2YM5A 5IA1A 2VTOA 3DXNA 3EYGA 4YHTA 2ITNA 3A60A 4PY1A 5HI2A 3ZSGA 4BGGA 4IW0A 1E1VA 1YHWA 3EQIA 4A9RA 3R9RA 2BPMA 4DFXE 3RMFA 3FI2A 1P4OA 5M4FA 4QQ5A 4BCNA 3UG1A 2JC6A 2I40A 3DQWA 3DQXA 3HUCA 2FVDA 3R1NA 4MXCA 4Q5HA 4CZUA 5LJJA 3BHYA 3IONA 4AFJA 1ZYSA 1IASA 2BAQA 5DIAA 2C6OA 1YXSA 2CKPA 5TO8A 3DS6A 1A06A 3LE6A 5LMBA 3AC8A 4CZYB 4MYGA 1OKWA 4F9AA 4E5AX 2XIXA 4FYNA 5HVKA 2OIQA 4M14A 3P78A 1H01A 4RG0A 3LCSA 2BDFA 1K9AA 4C3RA 4ZSAA 3UOKA 4W8EA 5FM2A 4ZJJA 3JUHA 3AQVA 4JDIA 4KKHA 4D2RA 4C4GA 3QC9A 3HZTA 3KMWA 1RDQE 3CS9A 2BROA 4XV9A 4F7LA 5M55A 5H8GA 3FQSA 5CF4A 5A6NA 4FT5A 4NM5A 2B9FA 2PUNA 5IQBA 5F20A 4FODA 2OJFE 5BPYA 2KTYA 2VTIA 5HO6A 2W4OA 1OVEA 4HGEA 5EM6A 2J0MB 3PVWA 5C03A 2OSCA 5J9YA 3VS6A 2YIXA 2QHNA 4O81A 3HX4A 3QGYA 4FKOA 3RM7A 4TXCA 2PE1A 3SA0A 4TYEA 4QT1A 2QOQA 5HD7A 2C3JA 2F57A 4GG7A 4RX8A 4E3CA 5I9UA 3COHA 5ANDA 2QVSE 3VO3A 3NGAA 4V01A 5CI6A 5FP6A 2ZB0A 3RALA 4C3FA 2B0QA 4Q9ZA 2C4GA 4FKSA 4BY9E 5L2WA 4BYIA 2NPQA 4E5WA 4NCTA 3FI3A 5I4NA 3C50A 4EJ7A 4QD6A 3VUGA 1ZOGA 1W83A 2GTMA 5AEPA 2DUVA 5IMXA 1YI4A 4QP6A 3VJOA 3O2MA 3GFWA 4C2WA 4U40A 4FG8A 1I44A 3NW7A 3KXZA 3SVVA 2B9JA 5F1ZA 3CTQA 3F5PA 4FT3A 2W4KA 3W8QA 5I5ZA 3KRJA 4JDHA 3LPBA 3QTWA 3V5JA 4L7FA 4MXZA 3UMXA 3OWJA 4QYHA 3OEZA 1WBWA 2G2FA 5H3QA 5D41A 1VYZA 1TQIA 3AT4A 3DLSA 5DEYA 3UYTA 5JFXA 4CV9A 5DN3A 4C35A 3F5XA 2PE2A 4S31A 2LAVA 1IA8A 3ULIA 5GIOE 3ZUVA 4AGCA 3TZ8A 2JEDA 3Q6UA 4Y83A 4BI0A 4PMTA 2R0IA 2C47A 2ZMDA 3NCZA 3UPXA 3R1YA 1R0PA 4U8ZA 4EZ5A 3PP1A 4UBAA 3FYJX 1SVEA 2YIYA 3W2PA 3BYMA 3HMNA 3BYVA 4TZRA 3RKBA 3ZC6A 3K2LA 3PG3A 5E8UA 4C8BA 3QLFA 5FTQA 2JFLA 4A9YA 3RAIA 3Q9YA 3RTPA 5TF9A 3PIZA 3FWQA 2CHLA 4FTJA 3EL8A 3Q4CA 4L67A 1Q8UA 4XHKB 1Q3WA 2WTKB 3COIA 4B8LA 2A2AA 3PIYA 5ICPA 5C4LA 4APCA 1UVRA 2XCHA 5HNIX 2YM8A 4S30A 1LEZA 5TE0A 2PU8A 1VZOA 4CFMA 4BWXA 4EWHA 5C8MA 3G33A 4X7QA 5BUJA 3EFLA 4DGLC 4I93A 1GZKA 4I22A 4U6RA 1O6KA 2Z60A 3R2BA 1Q8ZA 4MCVA 3DK7A 3OMVA 5IKWA 2PZIA 2UZBA 4E4MA 2C1BA 1OIQA 4HZRA 3UC3A 2VTPA 1PMVA 1S9JA 3QKMA 5KHWA 3NUYA 3C51A 3PJ2A 3MTLA 4RPVA 5AP2A 5AV0A 3RWPA 5EM7A 3WZKA 1UU3A 3GB2A 3QTRA 3NIEA 4LI5A 3UDBA 3EFKA 2HELA 4QMWA 5I9WA 3AC4A 4PPCA 4XRJA 4BDFA 4BGHA 5IUHA 5M53A 1Q8WA 4MXXA 2O65A 2QURA 4RIXB 4BYJA 5KMMA 3FLSA 5JFVA 3W2RA 4MVFA 4X21A 2BFXA 3ROYA 3OC1A 3P7AA 4K9YA 4RA5A 2XIKA 4AT3A 4GH2A 3VS2A 1FMOE 2GTNA 5L3AA 4W4VA 3NYVA 5IG1A 3NWWA 2V7OA 3UVPA 2IW9A 3I7BA 3EZVA 3QQUA 3SDJA 4D9UA 2OICA 3NS9A 1YXUA 1PXLA 4ERWA 1XWSA 3FY0A 2GDOA 4FKRA 3ZO3A 3UO5A 5A3XA 3FQHA 2E9NA 1IRKA 3F9NA 3S4QA 2VTLA 1Q41A 4RJ6A 4ZK5A 3VUDA 2XK8A 3ENMA 4GIIA 3GFEA 4LV8A 2XNNA 5IDPA 4E6DA 4D9TA 2VWZA 3K5VA 3WF9A 3EN7A 3P1AA 2Z8CA 2UZVA 5FQDC 2RSVA 2Z7LA 5BNJA 3TKUA 3C4XA 2VUWA 3VBTA 2OIDA 2Y6MA 3O50A 1AD5A 3FMEA 5IEYA 3EFJA 3GC8A 2WIPA 3MTFA 4AA4A 3MPAA 4W4XA 1ZRZA 2DYLA 2VWIA 3EWHA 4NT4A 5AMNA 2Q83A 2WGJA 4IAFA 2PMLX 3OZ6A 3OF0A 4MF0A 3ZXZA 1W0XC 4MKCA 4AAAA 3A4OX 4R3CA 5B2KA 1H8FA 3AOXA 2JLDA 4L7SA 3I79A 4BDDA 1Y8YA 4FL3A 5IQHA 3F5UA 3D9VA 5FTOA 1PMEA 2ERKA 3TEIA 2BAJA 1OMWA 4FTLA 4AOTA 4FSRA 3SXRA 5IU2A 2BHEA 3LIJA 2C5XA 2WQOA 4X3FC 5HU3A 3VRYA 3RWQA 5BUIA 2BALA 4AN9A 4IDTA 3EQBA 4IXPA 4QMZA 4W9XA 4A9UA 5HX6A 4FSWA 4RQVA 1ZOEA 3QQGA 4FKJA 4K0YA 4D1ZA 3WF5A 5CEOA 4KBKA 2VX0A 4FTRA 4N70A 3NEWA 4L3LA 5T3QA 1PXPA 5CX9A 4ARKA 3COMA 1SZMA 5IPJA 4QMPA 3ZO2A 3A2CA 5FUTA 5E91A 4ALUA 5L6OA 5L2TA 3V01A 4A07A 1V0BA 1KWPA 2WMAA 3KRLA 3FMKA 3MH2A 4CKIA 3U9CA 3F3UA 5AP4A 5BVFA 2G15A 2VU3A 3ATTA 5CLPA 4PP9A 3SRVB 5HLPA 4FNYA 2BR1A 4J97A 5DEWA 3R83A 3JPVA 4EK4A 5KHXA 4O82A 3HDNA 3KL8A 4DG2E 3T3VA 3U8WA 4LL5A 5E1SA 3Q4TA 4IAIA 4YPDA 3QAME 5B2LA 4JAIA 4U41A 3CXWA 4TKSA 3RCJA 4O0VA 2WZJA 1U5QA 5FLFA 3P7CA 4GKIA 4F99A 3TV7A 3LMIA 4QTBA 3ETAA 5E8YA 2WMSA 2R3PA 4J1RA 5CAUA 3RZBA 2W17A 5GJDA 4G16A 2WQMA 4RWIA 1F3MC 4RT7A 1PXOA 1QL6A 4L3JA 3V5WA 3WIGA 4ALVA 3BLRA 4FV0A 4RVTA 4N57A 2QO7A 4F4PA 4BCHA 4XEYA 3BQRA 4GS6A 4LYNA 5HCZA 4ACDA 1SMHA 2P2IA 2LGCA 1YKRA 3R9HA 4RX7A 3ALNA 2WTDA 4O7TA 5LVPA 4ZSJA 2IN6A 2YN8A 1JSVA 2X2MA 4QOXA 5AUWA 3U4UA 1GZNA 2CGXA 3F3VA 2WMVA 2EVAA 2OXDA 2XJ2A 3KF4A 3VNTA 4G5PA 1AGWA 2XEYA 3DAKA 4QPMA 3Q32A 3OWPA 2C6LA 3RI1A 4CD0A 4WKQA 5AX3A 3FPQA 1JNKA 3NUUA 4M15A 2R3HA 3MDYA 4AP7A 5CSXA 3QA0A 4JJRA 1P4FA 4FF8A 3HMIA 5C8NA 3OCBA 5DH3A 1Q99A 2WKMA 5DBXA 4O7YA 4MTAA 4B9DA 4D2SA 4KNBA 3QUPA 2W1FA 4QMTA 3R9DA 2QO2A 4YGAA 2R7IA 4E6AA 3B8QA 5B2MA 4LFIA 3SLSA 3LCKA 1U46A 3G90X 1R3CA 3HRFA 5FBOA 4PL5A 3TWJA 3AGMA 2CSNA 5ANOA 2I0HA 5BMMA 3ZRMA 2IZUA 3RINA 4Y8DA 1URWA 2J0JA 4AN2A 4DTKA 4CG8A 4LGHA 4XBRA 1WMKA 3VJNA 1ATPE 4DN5A 2IVSA 5JN2A 2H9VA 4PTEA 4U3ZA 2OGVA 3LFBA 3R02A 3VQHA 5FEDA 4LOPA 2Z7QA 3ZUTA 5L8LA 1XH4A 3A7JA 4E93A 2X8DA 4EOMA 1ZAOA 4EOQA 2QG5A 2VNWA 4QMMA 5EHOA 3BKBA 4KUJA 4DFYA 3AD4A 1NVSA 3QALE 1PRYA 4YP8A 1JKSA 4U0IA 5FXRA 1V1KA 3MA3A 1H28A 2G01A 3GNIB 2VWWA 4OLIA 4ANQA 3RK9A 4RIXA 3IDCA 1WVWA 4JI9A 4FSMA 2VWUA 3W2CA 5CT0A 4CYJA 3PPZA 3FE3A 1OPLA 4H39A 4DYMA 3C4EA 4YNEA 1W98A 5FDXA 5C8KA 2XM8A 3KF7A 1MRUA 4IH8A 3OXZA 4RLLA 5CNNA 4NU1A 5CU0A 3CY2A 2FA2A 3SG8A 2VWXA 2YDKA 3VS1A 3F69A 1UKIA 2UVZA 2WNTA 3MY5A 4RVKA 4EH6A 3S1HA 1R39A 3OY1A 3CE3A 4RC3A 4I6QA 5AR5A 3MFUA 3BX5A 1G3NA 2CN8A 2WMRA 3OY3A 3FYKX 1YOLA 4J53A 3ZZEA 1W84A 4UN0C 4R7HA 2JKOA 3QTZA 3ZSHA 2YHVA 4E73A 2QOOA 2VTQA 4TNBA 4WSYA 3RGFA 3HAVA 2XK9A 4EH9A 3DLZA 2GS2A 2B55A 4U5JA 2YA9A 2WXVA 3EQDA 3QD2B 4U80A 5ITAA 4JG6A 2PULA 4XG8A 2JBPA 2CN5A 4NM7A 4IX6A 4HGLA 4E7WA 4PTGA 3PVBA 4HPTE 4D28A 4RJ8A 4O7RA 1P5EA 4HPUE 2PZPA 4O86A 2W5AA 3OCGA 3CTJA 5LCKA 4XOYA 4TW9A 5DA3A 4DFZE 2ZM4A 1GIHA 4I21A 1GNGA 4GW8A 2ZAZA 3QGWA 3II5A 4JNWA 5EDQA 1G8SA 2ITZA 4ZTRA 3HMMA 3IECA 4G3GA 5HLWA 3EN9A 1JSTA 3I0OA 2PUPA 3R63A 4IC8A 4IX5A 4TYJA 4I20A 3PJ8A 3DAJA 3SOCA 3DXQA 4PDOA 3GCPA 2UZUE 2B9HA 3ALOA 4RFYA 5HE3A 3BHTA 3W55A 3ZU7A 4C4FA 3R7IA 4BB4A 4Q9SA 4Y5QA 2F2UA 3E87A 4MBLA 1IAHA 5AM6A 4BTMA 1MQ4A 5AV1A 1ZYJA 3IDBA 4GYIA 1KE8A 4NJ3A 3TDWA 1M52A 4M97A 4U42A 3FSFA 5JK3A 5FXQA 1CMKE 4WNPA 5CEQA 4B7TA 4NIFB 5AX9A 3FLYA 1F5QA 5G1XA 4OTGA 5HCYA 2BZHB 1RQQA 1M2PA 5FXSA 4R77A 4UMQA 4O0XA 3A7IA 3FZOA 1VEBA 2XNMA 1YRPA 4H58A 4RZWA 3SRVA 4D0XA 3ZM9A 3TCPA 4B6LA 3G6HA 4UWYA 3S3IA 3SOAA 4H3BA 3PXYA 3C13A 2PVMA 3KRXA 4TPTA 1YXVA 2XK3A 3BYUA 4BI2A 1YI3A 3WF8A 1JLUE 2GHMA 2R3GA 3V8WA 4ENYA 4ZTMA 3QQJA 2IVUA 3OOMA 4GVJA 4LV5A 4ZTQA 3RK5A 4OTHA 2ZMCA 4U3YA 3DJ6A 3LLAA 3PXKA 4FVRA 3G0EA 5IISA 3EYHA 3V5QA 1ZARA 5CU3A 4G17A 3CKXA 2JDOA 1GJOA 4FYOA 4XH6A 3BPRA 3CQWA 4CLIA 3PXQA 2X7FA 2FGIA 3VS5A 3LCTA 3GU8A 5M07A 3EN6A 2VD5A 3RNIA 1U4DA 1JWHA 5D10A 3L8PA 4BDBA 2H6DA 3CEKA 4A9SA 5BQ0A 5E8ZA 3UP7A 2BZIB 4HGTA 2C3KA 1JQHA 4EUUA 2J51A 5EHYA 4RJ7A 2WAJA 5D12A 2XJ0A 3P0MA 4H1MA 5JFSA 2JAMA 3R2YA 3U4WA 4CMTA 4YR8A 5A14A 3FC2A 3IDPA 3DBEA 4I94A 4AE6A 2W05A 3PRFA 4JG7A 1S9IA 3NNXA 4M69B 2NO3A 5ANGA 4C4IA 4CFWA 3TI1A 2IZTA 3VS0A 3CP9A 5HNGA 4FKTA 1YDTE 3V8TA 2YAKA 5L8KA 2WQBA 4RX9A 5HIEA 2Y0AA 4FV6A 4FZ6A 4QP7A 2R0UA 4QNYA 2XRWA 4GK2A 4HVDA 3OCTA 3PA3A 4GL9A 2JIIA 2PL0A 2WTCA 4LOQA 2Q0NA 1WVXA 4RQKA 4AXAA 4DBNA 4IANA 4JIKA 4JX3A 5EDPA 3TN8A 2O8YA 4L44A 5B0XA 1ZYLA 3RZFA 2CNUA 4UX9A 1DM2A 2E2BA 3KVWA 2JKQA 3P7BA 3LQ8A 2OH0E 4AF3A 4BTFA 2E9OA 3BEGA 3DNEA 3EFWA 2FH9A 2XK4A 4FL2A 2SRCA 1NW1A 4G1WA 4ZXTA 4RFMA 3QCSA 4Z55A 1YDSE 2RFNA 3NYOA 2YDIA 3Q5IA 5I9VA 4GT4A 4Z16A 1R78A 4CLJA 3MH3A 5C1QB 3UBDA 5IQFA 3IQ7A 3VWAA 5M57A 1J7LA 4EH3A 3ATSA 2IZSA 4CQEA 1J7UA 4E4NA 5F95A 2J7TA 4II5A 2JDRA 5E8VA 2IZRA 2G1TA 2VX1A 3DDPA 4FKVA 5T68A 4ZLOA 1XBBA 2QOIA 2XYUA 4OTPA 4QMNA 2UZTA 4I4EA 2EXEA 4LM5A 3O0GA 3WARA 2XNEA 4MD9E 3B2WA 3O51A 3ZTXA 3CPCA 4BC6A 2PE0A 3P9JA 5FG8A 5HICA 2J0IA 3D2KA 1KE6A 4F6WA 2YITA 4W9WA 1PHKA 5E4HA 4UMTA 3Q2MA 4C34A 2BRHA 4GRBA 2ETKA 2NNWB 1X8BA 4GSBA 1UWHA 4DGNA 2R5TA 5AUVA 4AU8A 2GFSA 2GQSA 1MP8A 4F6UA 5DYJA 4HVHA 4K11A 4M0ZA 4DEBA 4AS0A 1OIYA 2BTSA 2BZKB 4FUXA 4G6LA 4M8TA 3PUPA 4MXOA 4M0YA 3WILA 2OZAB 4P7EA 3DKCA 2GS6A 4WNOA 5A4CA 3KXXA 2PVKA 5CU2A 5AP0A 3ZMMA 3D4QA 3KCKA 3C1XA 3O17A 3NW5A 3HL7A 4MBIA 3KB7A 4RVMA 4TYHA 4XRLA 5K9IA 5JRQA 5BVDA 5F94A 4XG2A 2XMYA 4TYGA 4P5ZA 1DAWA 1QPDA 3D83A 4N6ZA 4ZTNA 3E3PA 2WMWA 3T9TA 2J5FA 5LARA 3BCEA 2QONA 4JBQA 1QPEA 5DPVA 4O83A 2HW7A 3JVSA 3FXZA 2WB8A 3S00A 4FTOA 4JLCA 5AR2A 4O0UA 4FGRA 2W9FB 5IQAA 4QP4A 3C4CA 2FSOX 3F88A 4HVIA 2QLQA 3NRMA 4TYIA 3H9OA 1VR2A 4U79A 4XJ0A 4CMOA 1GZOA 5CNOA 3JY9A 1O6LA 2GNIA 5F4NA 3E8EA 4C61A 3SW7A 4FEUA 4NL0A 3FQEA 3UYSA 2WD1A 2NRUA 4B99A 4O0YA 4QP9A 3HV4A 3GEQA 3HLLA 2HWOA 3Q96A 2ONLA 3R7VA 3LJ1A 2C6KA 4HVGA 2CNQA 2C0IA 5E8TA 4HYSA 2VTAA 3VRZA 2O63A 5AP1A 4FZDB 4GK3A 4I4FA 3QTSA 3GU6A 4QTCA 5BVNA 4F9WA 4L00A 2XS0A 1O9UA 4K1BA 4XCUA 3TKIA 2FUMA 5E90A 3TTIA 3DPKA 2HCKA 2YIQA 4EORA 3BLHA 2PK9A 3BU6A 4ZZOA 4E6CA 1XH5A 3R8LA 3G9LX 4NIFA 3UP2A 1PYEA 4Q2AA 4DF3A 4UALA 4MQ1A 3UO6A 4ALWA 2C68A 4O1PA 3SG9A 4J98A 4EOKA 2XRUA 3ZFMA 4RWKA 5DRBA 4O2PA 2YIWA 3SKCA 3QXPA 4S32A 3PJ3A 4GT3A 4DFLA 3R28A 1YQJA 3KXMA 1JVPP 2WIHA 5K5NA 4C36A 5D11A 2YABA 3PA5A 1PKGA 4JR3A 2CLXA 4N4SA 4L52A 5IMEA 3QCYA 4H3PA 4GUEA 1M2QA 4QP3A 1K2PA 1STCE 4ASDA 1WVYA 4PTCA 5IUGA 5CEIA 1MRYA 5BUEA 4P2KA 2B7AA 3AC1A 3KY2A 4X3FB 4FEVA 2ITWA 3LM0A 4PX6A 3QXOA 4EI4A 2CDZA 2XIYA 4G9RA 4NH1A 2XJ1A 4R8QA 5D9HA 2P2HA 4WUNA 1BL6A 2X0GA 4RVLA 5EKOA 4CMUA 5IQIA 1ZMUA 4NTSA 3TIYA 4IB3A 4U9AA 1YVJA 2Y4PA 1UWJA 3U51A 3HNGA 4EHGA 4EYMA 4Z7HA 5BYZA 5AFVA 3D5XA 4UYAA 2WTJA 4FTKA 5BMSA 2G2IA 2XNBA 2X2KA 4Q5EA 3OXTA 3U6IA 2JITA 2UZLA 3VBYA 4USFA 5CYIA 5HE1A 3TZ7A 4BKZA 4OTWA 4TNDA 5A9UA 5CSPA 3UGCA 2W99B 4Y5HA 4CFUA 2ITVA 4L8MA 3U55A 3L8SA 3RCDA 2HZIA 3KXNA 5CU6A 5DOSA 4DG0E 3R7UA 5M4CA 3FZSA 4L9IA 2J0LA 3F66A 4FTUA 4KAOA 4PMPA 3QBNA 2JGZA 4OBPA 3K54A 1XH7A 2O2UA 3G2FA 1CTPE 1OL7A 2R3NA 1WBSA 4C62A 1WBOA 4GJ3A 5FRIA 5J1WA 3KCFA 4G6NA 5KMNA 3OOGA 5DFPA 3UZTA 2ETMA 4JBOA 5HVYA 5CENA 1PXNA 3U54A 3AG9A 1ZZLA 2ETRA 1FMKA 4ONAA 2VTNA 4S33A 3L8XA 4IX4A 2W1EA 3A7FA 1NXKA 1M14A 2HY0A 2W96B 3DBQA 3NCGA 2OLCA 3CKWA 3OXIA 2VO3A 4RIOA 2HZNA 3BZ3A 2A19B 1LPUA 4IEBA 4L3PA 1REJA 3KU2A 4BBEA 5IA3A 3MGYA 5K4IA 2HIWA 3POZA 3KMUA 4X6QC 3CSVA 5ANEA 4IVBA 5EQYA 4MH7A 1H1SA 3DNDA 4FTMA 3ENHA 4FV2A 5LVNA 2PUUA 3CY3A 3R7EA 2WEIA 4YSMA 4XG9A 5JQ8A 4J8MA 4IDVA 4U81A 5CQWA 3MESA 2E9UA 3MFSA 4O22A 1XO2B 3DTWA 3EOCA 3P4KA 1Z9XA 3PSBA 4IBMA 3U6HA 4WSQA 3COKA 3GI3A 4FTNA 1CM8A 4BCGA 5HZNA 1BI7A 4EBWA 3GC0A 4LMUA 2VO6A 1SM2A 1UNLA 2R3RA 4HCVA 3VF8A 4D4YA 4IX3A 2PTKA 5HD4A 3G15A 3IKAA 4KKGA 3FZPA 4GCJA 4O7SA 5HOAA 2H96A 2RF9A 1JKTA 4FKLA 3IG7A 4F7SA 4R7BA 5AV2A 3V8SA 4HOKA 4FT7A 3MI9A 4E5BA 3PVUA 2ZV8A 1TVOA 3LFCA 3VS3A 2OZAA 4D1SA 2HZ4A 3MV5A 4CV8A 3WE8A 4TWPA 3OTVA 4WG4A 4EEVA 3R8MA 3VULA 4EQUA 3CLYA 3CQUA 4J7BA 4R78A 3KREA 4NJDA 5HLNA 1FBNA 2OJ9A 3A61A 4ZEGA 2HWPA 4O7WA 3KGAA 3AXWA 3Q53A 4BDGA 3UQCA 4AG8A 2QG7A 2RIOA 4RA4A 4DH7A 4X2JA 4XP0A 4BDHA 2R3OA 1Y6AA 4EK6A 3R9NA 1LUFA 5M4UA 2XA4A 4PL4A 3CGOA 4FR4A 3R00A 3IW5A 5ANJA 1JPAA 4PUZA 4XS2A 3S2PA 4LL0A 3DFCB 2ITXA 3CPBA 4FG9A 3V6SA 3VBXA 1SNXA 4IZAA 2BRGA 4YJTA 2CMWA 5EM5A 2E9PA 4BKYA 1GZ8A 2PSQA 3NNUA 4XOZA 1OBDA 2R3IA 2EXMA 3CQEA 1H1WA 5EM8A 4RBLA 5H8EA 4JR7A 2GNGA 4J8NA 3NIZA 4QYFA 3DDQA 3JXWA 4XNEA 2JDTA 1SNUA 4AUAA 4EC8A 4F65A 4RJ5A 3OEFX 3T9IA 5IZFA 2GPHA 5GJFA 2XF0A 5JQ5A 3R6XA 4HNFA 5J9ZA 1FGKA 3UVRA 3QX2A 5EYKA 5LMKC 3L9NA 1V0PA 3QWJA 3QKKA 3LQ5A 3PY3A 3AGLA 4FI1A 2GQGA 5AM7A 3IW7A 3DT1A 1IEPA 4YC6A 4YZNA 4U43A 4QPAA 4UZDA 4OAVB 3IK3A 3LFAA 4L68A 4WOVA 4D58A 5HKMA 2YM4A 1L3RE 1XHAA 1ZYDA 4DCEA 5KCVA 4FL1A 5L4QA 4EHZA 2Y6OA 3FC1X 3QQLA 4GYGA 4IZ7A 3ZBXA 4MNFA 3PJCA 2NRYA 4XP3A 3MVHA 4AGDA 2YIRA 3TTJA 3MFRA 2OIBA 1Q61A 3I1AA 3MBLA 3R7OA 1M7NA 3DU8A 4G3FA 2QR8A 3PSCA 4FTQA 1CKPA 3FMLA 4NW6A 3V5TA 2ESMA 4I5HA 4J99A 4KBCA 5LCJA 1A48A 4YURA 1T45A 2XB7A 4EHVA 4O6LA 1H24A 2VGPA 2H8HA 5HE2A 3DK3A 4X3FA 2C6MA 3BU5A 3E62A 3QA8A 3QRJA 4C7TA 4OAUC 1FINA 3R1QA 4FZFB 4FV4A 2GNLA 4Y85A 5EFQA 4BCKA 4ZLZA 5JGAA 1Q62A 2C3LA 2Z2WA 3R7GA 3TL8A 3LFSA 3DBCA 4XG4A 2RKUA 2OFUA 4XP2A 4JDKA 2ZM1A 4M12A 4F9CA 5IA5A 4QTAA 1E1XA 2AYPA 3ERKA 3QCXA 2QOBA 3KULB 1LR4A 3AT3A 3PXFA 4I24A 2R3MA 4C58A 3V6RA 2REIA 4ANSA 3DA6A 4WRSA 2X8IA 3LXPA 4I6HA 4ACMA 4CXAA 1I09A 3E88A 5CASA 3DV3A 3M2WA 5GJGA 2OJIA 1Z57A 4FE2A 1U54B 4PDPA 3E8DA 4FBXA 4L6QA 2P55A 1OKZA 4ACHA 3H30A 3R21A 4X0MA 5DR6A 4NK9A 5L2IA 2WTWA 2ZDUA 3TNIA 5C26A 4ANBA 5DR9A 3BGPA 3R8ZA 5M44A 3M11A 1H08A 2RFSA 3P86A 2R3QA 3ORPA 2OH4A 4QRCA 5AIKA 5FWKK 2C5VA 4O27B 3U9NA 3OWKA 3HV5A 1UKHA 5HNBA 2YCQA 5H9BA 2BMCA 4C33A 2YM6A 5FM3A 2W1IA 3K5UA 3LFDA 1KE5A 2R7BA 3WF7A 2WU7A 4ANLA 3EH9A 3CIKA 4P5QA 3TUDA 3OW3A 4XLIA 2CGVA 4UB7A 1OUYA 3UNJA 4PMSA 5CSVA 4EOIA 3GCUA 4NW5A 4V0GB 4QQTA 5HBHA 4I0RA 1XJDA 2C3IB 2WMBA 3LXLA 5C9CA 4UYNA 1UA2A 4PV0A 2V55A 3W1FA 3DOGA 3FLZA 4IB1A 2WMUA 3OW4A 4PP7A 3QD4A 2V5QA 4BDCA 4AT4A 3FAAA 4OTFA 3QD3A 3FMHA 5L6WL 4DH5A 5H2UA 4HJOA 2HW6A 4JRNA 4O91A 4EC9A 3UG2A 1MUOA 4QP1A 4I5CA 2UW8A 2W1ZA 5CI7A 1XBCA 3S95A 4EYJA 1R0EA 3PP0A 4GIHA 5A4QA 3WZEA 3QC4A 1UV5A 5GZ9A 2PZRA 3UVQA 5CZHA 4ERKA 3C4ZA 2C5YA 4O38A 3MJ2A 5IA0A 3SC1A 2BIYA 3H4JA 4L42A 4AFEA 5JGBA 5M09A 3D2IA 3OBGA 4IM3A 3FZTA 4EHEA 3EKNA 3MFTA 5M51A 3UMWA 3NUAA 3THBA 5A4EA 3DBDA 4MF1A 1XQZA 3GU5A 4WIHA 5IDNA 3BWFA 3MVJA 2GQRA 4F63A 3ODZX 1WCCA 4O1OA 1M7QA 2PUIA 1RJBA 2QD9A 3CJFA 4U45A 3ACJA 4AN3A 5DT0A 1KV2A 2OXXA 5ETFA 1PXKA 4EH5A 4IWPA 4LMNA 5EDRA 2BRMA 4OR5A 5A54A 3R8VA 4R3PA 2J0KA 3GP0A 2I6LA 3U6JA 4AW2A 4MAOA 3UIUA 3D7TB 2CKQA 1ZMWA 4O7VA 4DEHA 3NX8A 4M13A 4ZJVA 3UE4A 3D94A 2DQ7X 3F3WA 3GCVA 3HGKA 3PWDA 4FV9A 2YJSA 2AC3A 3KRRA 5DLSA 4QP2A 2XNGA 4QMSA 4FK3A 4BDEA 5HIDA 1IAJA 3DY7A 1W7HA 4CZTA 1GIIA 4MXYA 3UZPA 4CTCA 5KX8A 3BYSA 2ITPA 2XVDA 4M7IA 3LXNA 3FI8A 3PG1A 3OTUA 4EOOA 3MSSA 4HZSA 4D4SA 3R73A 2BKZA 3QHWA 1HCLA 4OTIA 2OF4A 3NLBA 1YOJA 4C02A 1ZYCA 4GT5A 1H1QA 2V22A 3Q9XA 4BTKA 3PPKA 3Q04A 5I9YA 2UZNA 4G3DA 5KE0A 1IG1A 4ACGA 2ZOQA 2VO0A 3LXKA 3G5DA 4CQGA 4HCTA 3CD8A 4KBAA 3OP5A 4ZZNA 4XBUA 3BHVA 1ZLTA 4W8DA 3ZBFA 1Q97A 3MVMA 4PMMA 5BVKA 4EQMA 5LOHA 4MHAA 4FEQA 4C4EA 1L8TA 2XUUA 3NYXA 2J6MA 2H34A 1KSWA 3DGKA 2X8EA 4R5SA 3TZ9A 2YDJA 3EQPA 4FSYA 4G34A 2VTJA 4B8MA 1YWVA 3MIYA 5HVJA 4WG5A 4IACA 5K4JA 5DGZA 3TIZA 4YO6A 3M1SA 3W18A 2A1AB 5KO1A 4L43A 4G2FA 2C1AA 2HZ0A 2OO8X 2PVYA 5LVOA 2GU8A 3ZZWA 2JIUA 1ZZ2A 2GNHA 4RX5A 3TJCA 3PFQA 2VTHA 4D2PA 5GZAA 3HV6A 4G6OA 3VIDA 3ORKA 2ZJWA 5LQFA 4XV1A 2YZLA 2CKEA 3W2SA 4MNEB 3HP5A 4IWOA 1BI8A 3CC6A 1J3HA 3TNQB 5HESA 3VBWA 4BCMA 3EL7A 3GENA 2X9FA 3VC4A 5AV4A 4DE4A 3DKGA 2IJMA 3FMJA 4XV2A 2W5HA 3F2RA 4YHFA 2UW5A 4K2RA 5AR3A
chains in the Genus database with same CATH superfamily
1Y6BA 3WE4A 3GCSA 3ITZA 4FOBA 5I3OA 2QCSA 3QQHA 3REPA 1FQ1B 5M08A 4DEDA 4I5MA 1PXIA 4EZ3A 3AC2A 1PW2A 5DNRA 4OTRA 4C59A 4EKLA 5JEBA 4AWIA 4F9YA 3EIDA 4JMQA 5JRSA 4QQJA 3QYZA 3PLAE 2ZYBA 2IW6A 4QO9A 3L1SA 2Q0BA 3UO4A 3DB6A 4IB5A 3D5WA 3BV2A 5A4TA 1LEWA 3N4UA 1FVRA 3Q5ZA 3EQCA 5DMZA 4LGDA 3BQCA 3FLWA 4IADA 4IM2A 4OW8A 5ANKA 3KULA 2BVAA 4L01A 3PY1A 3MH0A 4TWNA 3QZIA 4IC7A 3VQUA 4BWKA 5GHVA 3NVKI 1Y91A 4CT2A 4QPSA 1WZYA 2DWBA 4ITIA 4E8AA 3QWKA 3C0IA 4ZS0A 4H36A 4FNWA 5KUPA 1XR1A 4QMXA 3TNPC 3OWLA 4KIOA 1U54A 5E8XA 3DKFA 3ZLXA 2I7QA 2HAKA 1IA9A 1W82A 2IVVA 2XKDA 4FIHA 2J2IB 4F70A 4PQNA 4O84A 4KSPA 1QPJA 3HRBA 4DH8A 3NVMB 4CCUA 3ORXA 4BN1A 3RHKA 2XIRA 2V62A 1OITA 3EB0A 3ULZA 4D1XA 3E8CA 5K0XA 4O7NA 3VF9A 4FC0A 5AV3A 3UPZA 4DCAA 2CJMA 3A8XA 2B53A 3IOPA 3WZDA 3UIXA 2PVNA 2C0OA 5AP6A 4BIEA 3TV4A 4LQMA 1OKYA 4G3CA 5TT7A 2XCKA 2RFEA 4DFBA 1KUTA 2UVXA 2VTRA 3GUBA 3QUEA 3IPHA 5CAVA 5F9EA 3JYAA 1VLRA 2F4JA 4NEUA 3RHXA 3DBFA 4QNAA 4X3JA 5IH4A 4ZY5A 2UUEA 4ID7A 3C9WA 4V0GA 4DHFA 4IFGA 2IWIA 3DZOA 4ZY4A 5M56A 2VNYA 4AQCA 1YI6A 2IF8A 5TOZA 3HUBA 3QU0A 2W06A 3DTCA 2QOCA 3QZFA 2O0UA 3FV8A 4AXFA 3L9LA 4IVAA 3OBJA 4V05A 4O0TA 3TG1A 2CGUA 5DI1A 4XYFA 3EQFA 3K3IA 1HOWA 4DGOA 3A8WA 4UZHA 2J9MA 4DLIA 3IS5A 2F7ZE 3IO7A 4H05A 3EKKA 5GZ8A 4YLJA 2XKCA 3C4FA 5I3RA 5JH6A 4KIPA 2B1PA 3JY0A 4RC4A 3UNZA 5CWZA 1JKLA 2QHMA 1KOAA 2PVLA 4YJRA 2JAVA 3DB8A 3OT3A 1Q8TA 3SW4A 3F2AA 3WYXA 3QRKA 4ITHA 2Z7RA 5AAFA 3FZRA 2QODA 2F7XE 4UXQA 3SV0A 4O4CA 1JBPE 3FKOA 1PF8A 4K33A 1H0WA 2UW6A 4O4FA 3LQ3A 5FDPA 3NR9A 1XH8A 1RE8A 4QQCA 3MY0A 3ORLA 5KMIA 4DFUA 5ETIA 3DK6A 3PLSA 2WELA 1JKKA 5BX0A 4BGQA 3TUBA 2YM7A 3D7TA 4ZZMA 1OL5A 2BDWA 3Q4UA 1WBTA 3BE9A 5KMJA 5HTCA 3ZRKA 4XG3A 4IAYA 2FSTX 3E7VA 2XKFA 3FPMA 3UQGA 2YAAA 3ZLWA 3MWUA 4BF2A 4IZ5A 3F3ZA 1JAMA 4FT0A 5EYMA 2VV9A 4IMYA 3A99A 3ZUUA 5CF8A 3I0QA 4BZDA 4V04A 5CT7A 4NYEA 2R3LA 3BE2A 4YJPA 4WT6A 3AMBA 2KULA 4FTAA 4R3RA 4KA3A 2O64A 4FIGA 2WTIA 4AOJA 2X0OA 4EH2A 1REKA 4PPAA 4BHZA 4IM0A 1BL7A 3AC5A 2EXCX 2QKRA 3SAYA 4Y73A 4B4LA 2UZWE 5AUYA 4UMRA 4ZTHA 5C27A 1B6CB 4K18A 3GU4A 5AA9A 5EI8A 1PXJA 3Q52A 2V7AA 2WOUA 3SQQA 4D2WA 4QYYA 3I4BA 4DGMA 3ODYX 4XUFA 5HORA 4IQ6A 4O0RA 4EZ7A 5KMKA 2CCIA 4DG3E 2AC5A 2QLUA 1ZMVA 2ZDTA 4I23A 4PWNA 5AIRA 3UJGA 5I9ZA 5C01A 3MYGA 5IA4A 4I1ZA 1M2RA 3UIBA 1T46A 3HMOA 4G31A 3QX4A 2Y4IC 3BGQA 4S2ZA 2XEZA 3W32A 2CNVA 2JDSA 4JQ7A 3KXHA 3MPMA 4MNEA 5HBEA 5EG3A 2X1NA 5TKDA 2GHGA 2X39A 5CF5A 1APME 3H9RA 4FKGA 4BCQA 4BHNA 4IZYA 3DCVA 5DRDA 1CKIA 5J9LA 4LRJA 5L2QA 1BLXA 4UMPA 4GVAA 3W0SA 4DBXA 3ANRA 4O96A 4UV0A 1ZY4A 2CGWA 4RLKA 4C0TA 4FSTA 4YZDA 4ZMFA 1Q4LA 4J71A 4A9TA 4J95A 4B0GA 3QTQA 4QTEA 4GEOA 4YJOA 3UODA 4FICA 1DI8A 4DTAA 4YNOA 4D0WA 4EK8A 2OJGA 2ZVAA 4NM3A 1NVQA 5JZJA 3QQKA 1BUHA 3ZDUA 4C4HA 1PY5A 5CS6A 4HYUA 3ELJA 4AZVA 1TKIA 1YHSA 4TTHB 4ASXA 3SGCA 4MD7E 4PDYA 5J79A 4M68A 4O0WA 4EK3A 3C7QA 3ZC5A 4DITA 2I1MA 5D7VA 2BHHA 3NMUF 4G9CA 3MS9A 3TACA 3VBVA 4I0SA 2OJJA 2GNJA 2QOFA 2WHBA 4UWBA 3WYYA 3GVUA 1XBAA 4E1ZA 2A4LA 1YOMA 2W5BA 2WFYA 3BI6A 4GFGA 4P4CA 2BKKA 1OECA 3RPVA 4ORKA 3WF6A 4KD1A 5HG9A 3V51A 2QOHA 3PZHA 2XKEA 2J5EA 4A7CA 4FEWA 4WNMA 3NUNA 2RFDA 3BRBA 4IIRA 3WZJA 3WZUA 4NZWB 4EKKA 3DJ7A 3FMMA 2ZV9A 4KINA 1KOBA 5GINE 3PJ1A 5HG8A 4AZFA 4BZNA 4W4YA 3FKNA 3RK7A 3LCDA 4GK4A 2BUJA 4K77A 2YM3A 4OTQA 3BELA 3LOKA 3T3UA 3O96A 2VZ6A 4YC8A 4FNXA 3R8PA 4EBVA 5CSHA 4GFMA 4BTJA 4MXAA 5EOLA 1BX6A 3N4TA 4WNKA 5EKNA 2QU6A 2IG7A 3HEGA 4DGGA 4FTIA 4NUSA 5EI6A 3QCQA 3ZEPA 4IAKA 3KC3A 2OWBA 1FOTA 3UC4A 5E9EA 3W16A 5CVFA 2GSFA 2VWVA 3VS7A 4M69A 2F7EE 4I6BA 2ITUA 4JBPA 3BL9A 4CRLA 2JDVA 3DFAA 5CXZA 3F3TA 3PDTA 2PVJA 5T6KA 4F7JA 3EHAA 3N4VA 3IW4A 1OI9A 3KVXA 1FVTA 5JZNA 5DT4A 2F9GA 3D7ZA 5DVRA 2UW4A 1PMUA 3O8PA 5FD2A 2OFVA 4O0SA 5EI2A 1PMNA 4F0GA 3P79A 4MUQA 1EH4A 5GIPE 3LFNA 4GKHA 3FSKA 2PVRA 4NKSA 4TN6A 2PHKA 3C0GA 5AR4A 3SD0A 2GHLA 2W1CA 3NNWA 2Z7SA 2PZ5A 5JMSA 2X7GA 4JS8A 3A7GA 3OD6X 2X6EA 2JBOA 3HYHA 2XK6A 1DAYA 3QTIA 3D5UA 2C5NA 3EN5A 3GT8A 4ANOA 4EH8A 5JSMA 4C4JA 2XNOA 3QZHA 4CSVA 2I0YA 4IE9A 1ZY5A 3E8NA 2WQNA 3TV6A 3ZDIA 3PE2A 2CPKE 3QRUA 2YACA 4AW0A 3Q4ZA 2HENA 4PF4A 3W10A 4EOPA 2OW3A 5IQEA 5HG5A 4BKJA 1OUKA 2VTMA 4TY1A 4NCTC 2X81A 5LMAA 4FTTA 3RAHA 4AGUA 3PTGA 2YZAA 4C37A 3LFEA 4AQKA 5HQ0A 5KZIA 5CVGA 4FV5A 3H0YA 3BBTB 5J7HA 3SHEA 5G6VA 4RIYB 4DEAA 3TJDA 2EUFB 3LAUA 3QLGA 1OIRA 2YLEA 4RFZA 2BRNA 3G51A 4FMQA 4E6QA 1WAKA 4M67A 3HAMA 2C6IA 3HVCA 2R64A 4CNHA 3PY0A 2QO9A 3IOKA 4PRJA 3ZYAA 4F9BA 3ROCA 3NAYA 2GMXA 4AA0A 4IWQA 2XAOA 4ZSEA 3TXOA 5HCXA 1GOLA 4A4OA 3MB7A 3VHKA 4FSQA 3ZOSA 4C38A 2YCRA 5EW3A 4AW1A 3UNKA 2CKOA 4EH4A 4D4RA 1PXMA 2HYYA 2WTVA 2X9EA 2BIKB 3O23A 4X2GA 4BZOA 5L6PA 3LM5A 4YLKA 2ITYA 4EUTA 3R01A 5JFWA 4AXDA 4E20A 3LVPA 3KEXA 3HA6A 3L9MA 3R0TA 2VO7A 2Z02A 2QU5A 4MWHA 4C57A 4R1VA 2P4IA 3ZS5A 4BIBA 2PPQA 4I41A 4FG7A 4FEXA 1OZ1A 5HHWA 1YWRA 3MJ1A 1BYGA 1NY3A 2R9SA 4P90A 3FKLA 4XG6A 5E1EA 4YBKA 3DAEA 4KS7A 1PJKA 5KZ0A 4XLVA 3O7LB 4FZ7A 3ANQA 4YUQA 2XNPA 3VN9A 4IB0A 1H07A 2B9IA 2RGPA 3E93A 2OU7A 3LZBA 5CALA 3CBLA 2HOGA 2P3GX 3VUMA 3JR1A 4I0TA 4XX9A 4Y46A 5CZIA 3W0RA 2IVTA 4YJUA 3GXLA 2Y7JA 2XP2A 3MIAA 3QRTA 3DXPA 3RBWA 3Q2JA 3FLNC 2OKRA 4G3EA 4X2FA 3IGGA 4BCIA 3H9FA 1TQMA 1YW2A 2P33A 2I0EA 2G9XA 3KQ7A 4DHZA 1H4LA 3FZ1A 4FIFA 4Z9LA 3FMDA 4C2VA 2W1DA 4DA5A 3ORTA 2PMNX 3EQGA 3CGFA 4CTBA 1MQBA 4I5PA 4X2KA 3AT2A 4PL3A 3AD5A 3VHEA 5FTGA 3A62A 3KK8A 4FSUA 4PNIA 3KK9A 3AMAA 4J52A 5CF6A 3Q60A 5LMKA 5IQCA 5CTPA 4LRKA 4FK6A 2XH5A 1TQPA 5EQEA 1ERKA 4ZTLA 5IEVA 3BEAA 3ID6C 3PYYA 4F1MA 2UW3A 1CSNA 4IHPA 3L8VA 4BBFA 4S34A 4R7IA 4DHJA 3KFAA 3GC7A 4C3PA 1MRVA 4DC2A 5BVEA 3CR0A 1ZWSA 1Q8YA 1JOWB 4I92A 5KKRC 5BYLA 4HW7A 4QMQA 4LRMA 5HU9A 4X6RA 5DG5A 1P14A 3CCNA 4K8AA 4EH7A 2O5KA 4DTBA 5AAGA 2VX3A 4YJVA 3FUPA 4FV1A 4MD8E 3VAPA 2V0DA 3I6UA 3MPTA 2CCHA 3I81A 4BR3A 2YCSA 3D5VA 3KXGA 4FVPA 4CG9A 5ETAA 1CDKA 4FZAB 3O8UA 5AA8A 2FYSA 2QR7A 4WBBB 3ORNA 5CXHA 1UU8A 3OVVA 3QZGA 5AP3A 2RL5A 2WO6A 2YWPA 4MEDA 4DDGA 3BLQA 5KMOA 3VW8A 1GIJA 4FKPA 3V5LA 5HEZA 4UMUA 3FHIA 4QMLA 3W8LA 4GV1A 4RJ4A 4YBJA 1ZOHA 4YPSA 4JT3A 5DWRA 4FSZA 4AGWA 1J7IA 2Y8OA 4ZSGA 5ANIA 1H27A 3FLQA 4F1OA 4PNKA 4OUCA 4CRSA 4DT8A 1O6YA 4LUEA 5A6OA 3HP2A 3EN4A 4WBOA 4FVQA 4GFOA 1Z5MA 3E3BX 3QFVA 2YERA 4JXFA 4DH3A 4AX8A 2UW7A 3BWJA 3QTUA 4JDJA 4ZOGA 4LGGA 5DHJA 1E9HA 4ENXA 4DEGA 4Y95A 2VWBA 3KN6A 1OL2A 3NSZA 4D4VA 2A27A 2R3KA 4Y72A 2BCJA 3OROA 1B38A 4FIIA 4QMVA 4ASEA 4YZBA 2ZV2A 4YLLA 3TNHA 2VAGA 2WMXA 3LMHA 4R1YA 3W2OA 4O7LA 4UXLA 2QOLA 4Z3VA 2BZJA 4BCOA 3TUCA 4WA9A 1OPJA 5CQUA 2IW8A 3ZFYA 5KNJA 5HTBA 3FEGA 1NVRA 3EMGA 3C5UA 5J1VA 3N9XA 3SX9A 4OTDA 2OZOA 4D2VA 2GCDA 1GAGA 4GUBA 4BDJA 3VW6A 4J96A 2XIZA 2R3FA 2VN9A 3RP9A 3VUTA 4D2TA 4R6VA 2ZV7A 2UZEA 5AP5A 4N6YA 3O7LD 2ITQA 4MWIA 4U44A 3LKMA 5K0KA 3MB6A 5B7VA 3QHRA 4RIYA 5EYDA 4DEEA 1OM1A 2ACXA 5HTIA 3KMMA 3HV3A 3BHHA 5IQDA 4YC3A 1UU7A 4OBOA 4W4WA 5EHLA 5FBNC 4IVDA 3W2QA 4A06A 4HCUA 4JVGA 5E7RA 4TWOA 5CVHA 1BMKA 4AE9A 4FV8A 2B52A 4FNZA 3LJ0A 2RG6A 2EWAA 4TWCA 3OS3A 5CANA 3PA4A 2WU6A 1H25A 4IJPA 2GNFA 4G5JA 4H3QA 5EW9A 5J8IA 1W2CA 4F7NA 3HV7A 2HXQA 4JG8A 4KIQA 4AZWA 4GJ2A 4RJ3A 5JGDA 4KKEA 1XKKA 3IW6A 4WUAA 5IA2A 4WRGA 5KBRA 5LVMA 4I3ZA 3WIKA 4XV3A 2YJRA 3LMGA 1Y8GA 5E92A 2PMIA 3ZCLA 4O2ZA 3OT8A 4A4XA 3P5JC 3U87A 4OGRA 2PYWA 3C5IA 3IW8A 2WTKC 2YCFA 4JRVA 4HNIA 4NKAA 4F0FA 4RRVA 2W0JA 2FB8A 2I0VA 3R7YA 2W7XA 2YISA 5CU4A 3ZM4A 3QF9A 4E4LA 4NFNA 2B54A 2C6DA 5ETCA 2IO6A 4CEGA 5HO7A 4AAYA 1KE7A 4M3QA 3I5NA 3S0OA 3ZO4A 1LP4A 1CKJA 2JIVA 1F0QA 3BHUA 1KV1A 1SVHA 1ZXEA 2C0TA 2C5OA 3PWYA 4RWLA 4JOAA 4YZ9A 5FGKA 3RPRA 4D55A 5HG7A 2BTRA 4QP8A 2VTSA 3M42A 3L9PA 4UWCA 4YZCA 3RPOA 3A4PA 1H1PA 3E64A 4CYIA 4ZP5A 1B39A 5EH0A 3VBQA 1H00A 2B4SB 5CSWA 5D1JA 2R4BA 2JFMA 3ZXTA 2X6DA 1M17A 5M4IA 1A9UA 2HK5A 5BVWA 3FI4A 3VS4A 2GFCA 4ASZA 4JQ8A 5I9XA 3LFFA 4FUYA 5FP5A 2XBJA 5J5SA 3GOKA 3BU3A 1OKVA 2G2HA 2ERZE 3H10A 4IAZA 3NPCA 4BBMA 4WD5A 3VUIA 2W1HA 4ZS4A 3LHJA 5IF1A 2AQXA 3GC9A 3HKOA 4MBJA 3V04A 4L53A 1DI9A 3B2TA 1UU9A 5IUIA 4EONA 2UZOA 3K3JA 2JKMA 4FGBA 4BDAA 3ZSIA 4EJNA 2IPXA 2VTTA 4FT9A 1TZDA 4NTTA 3UOLA 4D5HA 1Q5KA 3FHRA 3GU7A 3D0EA 5EOBA 5K5XA 1J1CA 3ZLYA 3F2NA 3MY1A 2C30A 3LLTA 3R22A 4KWPA 4DEIA 1VYWA 2XZSA 3RAKA 2QI8A 2R2PA 3N51A 3MW1A 3Q6WA 4GU9A 4QMUA 4AACA 2Y4IB 4DINA 5AUTA 3UTOA 4TYHB 3KRWA 4BRXA 4IAAA 3WOWA 4MQ2A 4AW5A 2FO0A 3KKVA 3E63A 4I6FA 4RMZA 4F0IA 3W0OA 4GMYA 4AZTA 5CEPA 4CGAA 3I7CA 3NW6A 2XBAA 3TYKA 4OT6A 3BGZA 1OPKA 4YTIA 4BFMA 5JKGA 3PE1A 4FKUA 1XH9A 4FRFA 2A0CX 2C69A 3RVGA 4N0SA 3GCQA 2PZYA 3I6WA 4IJ9A 1U5RA 3RAWA 2PY3A 3FMNA 4YJSA 4YHJA 1RW8A 3G6GA 3IGOA 3W33A 2W9ZB 4LUDA 3UOHA 1J91A 3OCSA 2FSLX 1J1BA 4F09A 4IWDA 1HCKA 5TR6A 1QCFA 4KRDA 1OL1A 2YLFA 3AMYA 3LJ2A 4YJNA 4IFCA 3Q3BA 4UY9A 5E8WA 5BVOA 5HBJA 5JT2A 3TDVA 3TM0A 5J95A 3R04A 2X2LA 3AC3A 3Q9ZA 3HA8A 4RC2A 3ZLSA 3HECA 4EQCA 4M84A 1ST4A 2QOKA 3E7OA 1W8CA 3ORIA 1OGUA 3F5GA 4KIKB 5A4LA 4YU2A 4YJQA 4K6ZA 3P5KA 2DS1A 2J4ZA 4FIJA 3RM6A 1P2AA 3E5AA 3EQHA 3B8RA 4HGSA 3V3VA 3RPYA 3ZONA 4BCJA 4BWPA 4AZSA 1NT2A 5ACKA 3PVGA 4NFMA 3OHTA 5H8BA 4CT1A 2UW0A 4JL9A 4O6EA 4ZJIA 3QL8A 4CVAA 3ET7A 1QMZA 3H3CA 3FY2A 4NSTA 4CFVA 3PUFC 2BAKA 5ACBC 3FXXA 5J7BA 4RIWB 1AQ1A 4ZMEA 2WMTA 4APPA 5FEQA 3AD6A 3FL4A 1WBVA 3KN5A 4QMOA 1R1WA 3GGFA 2HXLA 4FSNA 5AP7A 1XMMA 4NWMA 4JX7A 3HMPA 4DAWA 4EOJA 1WBNA 3FXWA 4MX9A 3I60A 1GY3A 4XMOA 5LVLA 4USEA 2HY81 2PVHA 1YDRE 4F64A 2EU9A 4FV7A 4PDSA 2WQEA 2XM9A 1K3AA 3LFQA 3R8UA 2P0CA 3H0ZA 5IEXA 3RNYA 4IVCA 4OBQA 4HYHA 2YFXA 4L46A 3QKLA 3CTHA 3NFFB 1UNGA 4JAJA 4YTHA 4DLJA 4KABA 4LG4A 4F1TA 2BILB 1UNHA 2BFYA 2Y9QA 3DJ5A 3F7WA 2WEVA 3QD0A 3EQRA 3RJCA 5GNKA 2PVFA 3LW0A 3GQLA 4TRLA 3C4WA 5FEEA 5AUXA 3QRIA 4O21A 4KSQA 4TL0A 1U59A 2ZFYA 2W1GA 1WBPA 2X7OA 5EW8A 2EB3A 3O71A 3R1SA 1BKXA 1FVVA 4L45A 4F6SA 1NA7A 5AR8A 3VUKA 4LOOA 3HDMA 4ZLYA 2BDJA 3TT0A 3WI6A 4RZVA 5J5TA 2VWYA 5AWMA 4AA5A 5C4KA 5HX8A 3BV3A 4YO4A 5LWMA 1H1RA 5CAQA 2GS7A 2F49A 2OI4X 5IH5A 3LCOA 3FJQE 3TMOA 4BIDA 2OF2A 3G0FA 3UIMA 3UOJA 4DT9A 2XYNA 5LWNA 4HYIA 2YWVA 4KRCA 3QTXA 4WO5A 2QNJA 3UQFA 2QQ7A 3NUXA 4WG3A 5M06A 4BDIA 3HRCA 4ACCA 5I0BA 5L2SA 4O7ZA 3PSDA 3O5AA 3OG7A 4ZY6A 3ZH8A 3T8OA 2FSMX 4USDA 2YEXA 2UZDA 5HO8A 2PWLA 5HE0A 5AUUA 3PRIA 4OT5A 5AR7A 3DZQA 1Q24A 4FOCA 2OXYA 5CY3A 3FBVA 3NYNA 4QTDA 3D14A 2OBJA 4CCBA 4EK5A 3AKLA 4ANNA 3PPJA 4FIEA 3D15A 3NUSA 2UVYA 1ND4A 5AADA 5AAEA 2ITOA 5DE2A 3PZEA 2F2CB 4FKIA 1Y57A 3TKHA 3F7ZA 4EOSA 5CEMA 4FKWA 1OIUA 3P23A 3Q9WA 2OG8A 1YXTA 4AZEA 4BL1A 1IR3A 5LXMA 3F6XA 2X0PA 4Z7GA 1DS5A 2W4JA 3CJGA 4U7ZA 4ZIMA 4YSJA 5EK7A 2X4ZA 4CFXA 3NDMA 4F08A 4ITJA 4H1JA 3ZFXA 1QPCA 4QMYA 3A7HA 5D7AA 4DFNA 4RGJA 4FTCA 4UEUA 5CAOA 4AOIA 4ZSLA 4U97A 4HVSA 5IH6A 2JD5A 4X2NA 3PIXA 4BI1A 1FPUA 4D5KA 3QQFA 3ORZA 3FDNA 2VGOA 4WHZA 2E9VA 3R9OA 4CFFA 1PYXA 3OUKA 4QYGA 3KA0A 1WFCA 1KE9A 3POOA 3TZMA 3C0HA 1XH6A 4CKJA 3MVLA 4NM0A 4PPBA 3BIZA 3PFYA 2JKKA 5A46A 2EB2A 1VJYA 4FA2A 2O3PA 4BCFA 4BCPA 2UV2A 2OK1A 1G8AA 2PMOX 3DKOA 1YXXA 3ZO1A 4GG5A 1FGIA 5CAPA 5KMLA 2J50A 3GBZA 5HGIA 2RG5A 1Q3DA 2QKWB 2QC6A 3WBLA 2NP8A 3CD3A 3NAXA 5EYCA 1H26A 3UDZA 3MH1A 1PKDA 2WMQA 3I5ZA 2C6TA 3FL5A 5DT3A 4CFNA 1OL6A 4BVUA 4FKQA 3ZHPC 4ANMA 1SVGA 3ORMA 1YHVA 1YWNA 4RSSA 3VUHA 3EJ1A 3GOPA 4YTCA 3MA6A 2X4FA 5K3YA 4R5YA 5EQPA 3JS2A 3SXFA 5BYYA 1SYKA 2VRXA 4QYEA 1JSUA 2J90A 4MK0A 2C6EA 3ZEWA 3VVHA 2CLQA 2ITTA 2ZB1A 3EZRA 1G5SA 2WPAA 3SXSA 5KBQA 3NZ0A 1URCA 4E26A 4FV3A 3F82A 3G9NA 4YTFA 4CKRA 3PXRA 4EL9A 3GQIA 4ZTSA 2ONLC 4JQEA 4XG7A 3MN3A 3ZRLA 4EWQA 3V5PA 3OFMA 4AT5A 4BICA 3UZRA 4BJJB 3O8TA 3OUNB 4KB8A 3JVRA 1V0OA 2ZM3A 3NNVA 2UW9A 1H0VA 3E92A 3RPSA 5L8JA 2R3JA 4TT7A 4A4LA 5J87A 3R71A 3F61A 5AUZA 5CEKA 1OB3A 4KIKA 4M66A 5IQGA 5DR2A 4AXEA 2BRBA 3BBWA 4YZMA 3BYOA 2XK7A 3QUDA 4JIAA 4ZAUA 5E8SA 1OBGA 4GU6A 4KS8A 3P08A 5KKRB 3PXZA 3NUPA 4EOLA 3ACKA 4RIWA 3TNWA 3R30A 4FX3A 2WOTA 4JBVA 5AJQA 5HIBA 4E4XA 2AUHA 3QYWA 4RWJA 4DH1A 4BDKA 4YMJA 2YM5A 5IA1A 2VTOA 3DXNA 3EYGA 4YHTA 2ITNA 3A60A 4PY1A 5HI2A 3ZSGA 4BGGA 4IW0A 1E1VA 1YHWA 3EQIA 4A9RA 3R9RA 2BPMA 4DFXE 3RMFA 3FI2A 1P4OA 5M4FA 4QQ5A 4BCNA 3UG1A 2JC6A 2I40A 3DQWA 3DQXA 3HUCA 2FVDA 3R1NA 4MXCA 4Q5HA 4CZUA 5LJJA 3BHYA 3IONA 4AFJA 1ZYSA 1IASA 2BAQA 5DIAA 2C6OA 1YXSA 2CKPA 5TO8A 3DS6A 1A06A 3LE6A 1W2FA 5LMBA 4O4DA 3AC8A 4CZYB 4MYGA 1OKWA 4F9AA 4E5AX 2XIXA 4FYNA 5HVKA 2OIQA 4M14A 3P78A 1H01A 4RG0A 3LCSA 2BDFA 1K9AA 4C3RA 4ZSAA 3UOKA 4W8EA 5FM2A 4ZJJA 3JUHA 3AQVA 4JDIA 4KKHA 4D2RA 4C4GA 3QC9A 3HZTA 3KMWA 1RDQE 3CS9A 2BROA 4XV9A 4F7LA 5M55A 5H8GA 3FQSA 5CF4A 5A6NA 4FT5A 4NM5A 2B9FA 2PUNA 4QEBA 5F20A 4FODA 2OJFE 5BPYA 5IQBA 2KTYA 2VTIA 5HO6A 2W4OA 1OVEA 4HGEA 5EM6A 2J0MB 3PVWA 5C03A 2OSCA 5J9YA 3VS6A 2NYAA 2YIXA 2QHNA 4O81A 3HX4A 3QGYA 4FKOA 3RM7A 4TXCA 2PE1A 3SA0A 4TYEA 4QT1A 2QOQA 5HD7A 2C3JA 2F57A 4GG7A 4RX8A 4E3CA 5I9UA 3COHA 5ANDA 2QVSE 3VO3A 3NGAA 4V01A 5CI6A 5FP6A 2ZB0A 3RALA 4C3FA 2B0QA 4Q9ZA 2C4GA 4FKSA 4BY9E 5L2WA 4BYIA 2NPQA 4E5WA 4NCTA 3FI3A 5I4NA 3C50A 4EJ7A 4QD6A 3VUGA 1ZOGA 1W83A 2GTMA 5AEPA 2DUVA 5IMXA 1YI4A 4QP6A 3VJOA 3O2MA 3GFWA 4C2WA 4U40A 4FG8A 1I44A 3NW7A 3KXZA 3SVVA 2B9JA 5F1ZA 3CTQA 3F5PA 4FT3A 2W4KA 3W8QA 5I5ZA 3KRJA 4JDHA 3LPBA 3QTWA 3V5JA 4L7FA 4MXZA 3UMXA 3OWJA 4QYHA 3OEZA 1WBWA 2G2FA 5H3QA 5D41A 1VYZA 1TQIA 3AT4A 3DLSA 5DEYA 3UYTA 5JFXA 4CV9A 5DN3A 4C35A 3F5XA 2PE2A 4S31A 2LAVA 1IA8A 3ULIA 5GIOE 3ZUVA 4AGCA 3TZ8A 2JEDA 3Q6UA 4Y83A 4BI0A 4PMTA 2R0IA 2C47A 2ZMDA 3NCZA 3UPXA 3R1YA 1R0PA 4U8ZA 4EZ5A 3PP1A 4UBAA 3FYJX 1TFFA 1SVEA 2YIYA 3W2PA 3BYMA 3HMNA 3BYVA 4TZRA 3RKBA 3ZC6A 3K2LA 3PG3A 5E8UA 4C8BA 3QLFA 5FTQA 2JFLA 4A9YA 3RAIA 3Q9YA 3RTPA 5TF9A 3PIZA