4CV8A

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
279
structure length
255
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
total genus 72
structure length 255
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cv8A01
2CGUA 3R7OA 2W9FB 5BVKA 1FMKA 3ALOA 4RQVA 2R3RA 3GI3A 1NA7A 3HKOA 5KZIA 4HW7A 3S1HA 3JY9A 3PSBA 3LXPA 3AC2A 4JQ7A 1E9HA 5AM7A 4MNFA 2EB3A 3EZVA 3ATTA 5ITAA 4U80A 4MBJA 3Q9XA 2O63A 4DYMA 5KMOA 4KKEA 4WUNA 2W1IA 4QMLA 2W96B 4LRJA 1PYXA 4QMYA 2RL5A 5C8KA 5FTGA 4M84A 2H8HA 1IA8A 4JG6A 3FMJA 4YLKA 3GC0A 4U6RA 3W1FA 4D1ZA 3LJ0A 3DB6A 1W8CA 4QTBA 5E91A 2GS7A 2B4SB 1Q8YA 1CSNA 3F7WA 3KVWA 3R21A 3DZQA 2AUHA 2XYUA 2QHNA 3G0EA 3Q52A 3FYKX 4RIXB 1LUFA 2R7IA 3MTFA 4JG8A 5FDXA 4PDSA 4KBCA 4U41A 4JIAA 2YM6A 4YU2A 1CMKE 3C4ZA 3D5XA 1Q8UA 3UDBA 4LFIA 5E1EA 3POZA 4CFVA 4WUAA 3SXFA 3ORXA 3DXNA 4EOIA 5IQDA 5I3RA 2AYPA 4ZSAA 2XKCA 4AZFA 5E8TA 1WBNA 1UA2A 3QHRA 4IACA 3BGQA 3EN5A 3ZHPC 4C58A 4W8EA 4WRSA 3QHWA 4EKLA 5AP1A 2WQEA 1OMWA 2PUIA 3MTLA 3FPMA 3SAYA 3BV2A 4FEUA 1GY3A 4CCUA 4I5MA 4RJ6A 2Z7LA 3A7HA 4YHTA 1Q61A 5FEEA 2QONA 4L67A 4BWKA 2HOGA 4MNEA 5AX3A 2WMVA 4DEGA 2PUPA 4FTIA 3LKMA 4ZTNA 3D5WA 5L8KA 4FNWA 4L53A 3KEXA 4EH6A 4WNOA 4YTCA 4DA5A 3E92A 3DBCA 4GIIA 4KBKA 4B4LA 3S3IA 5BQ0A 3MH3A 3R8UA 4HVDA 4FKUA 2CKEA 4FZDB 4IMYA 4FR4A 4OGRA 4Y95A 3QC4A 4NCTC 5BVFA 3EYHA 4EC9A 1BYGA 4DEEA 3EMGA 3O7LD 4EYMA 3TT0A 2VV9A 3E3BX 4J8NA 2XK4A 4ZJIA 4AACA 4J7BA 3P7AA 2OG8A 4EHEA 4GFGA 5FRIA 2O64A 4FTLA 3ZLYA 3IGGA 4ZK5A 3BGZA 4LGGA 3AD5A 3L9MA 4CKRA 3EQFA 1YXXA 4R7HA 2XK8A 5AP7A 5FM3A 4F0FA 5AAGA 2QO7A 3ZOSA 2PZRA 5HLNA 4OTPA 4CRLA 3ALNA 3CEKA 2PVMA 4HNIA 3VBQA 1YXTA 2YDIA 3KKVA 1B39A 4YO6A 1GJOA 2QCSA 2ZAZA 3OT8A 4GVAA 3TKHA 4TNDA 3KMWA 2DUVA 3QYWA 5L6PA 2QG5A 3U4WA 3UOLA 2PWLA 3FL5A 5J1VA 3UGCA 5CYIA 3V04A 3TUDA 3ZFXA 2BR1A 3SD0A 4JL9A 3G9LX 4G3FA 4XYFA 4F1OA 3CJFA 2VNYA 3R7GA 4I41A 1Q5KA 1U59A 1W83A 2FSLX 3EFWA 5FM2A 2J0LA 3ZO2A 2W1EA 4LQMA 1JKLA 2RGPA 4J95A 4U42A 4X2JA 3E88A 3ZBFA 3ZSIA 2Y4PA 2XIZA 4K1BA 5CSPA 4IVCA 1QPEA 3PPKA 2VX1A 4KIKA 4U43A 5CF4A 3F9NA 4QPAA 4CV9A 3KF7A 4MWIA 2I0VA 2P3GX 2RF9A 3P9JA 1G3NA 3D94A 4WG5A 2CJMA 3MH0A 4IWPA 3RNIA 2NPQA 3W55A 3AGLA 1M14A 4DLJA 3UZPA 3BYUA 3Q4ZA 4EOMA 2YZAA 4DHFA 3HX4A 1PMUA 1PXOA 2WTIA 3BRBA 3D9VA 1RDQE 3L8SA 3I0OA 3PJ8A 4PX6A 4XP0A 4FE2A 2XRWA 2JDVA 3MJ2A 5CEPA 4Q5EA 4O7YA 5CWZA 4CFUA 5HE2A 3A7IA 5AUXA 5EG3A 2YN8A 5BYZA 3RK7A 1PKDA 3R9OA 4AW5A 3KXHA 4D1XA 4FT3A 4AUAA 4EK3A 2JIUA 3UE4A 2QO2A 1YI3A 4FYNA 4JBQA 3VRZA 1M7NA 3OWPA 1BL7A 4E4NA 5F20A 2HXQA 2XP2A 4DGMA 4UB7A 3PSDA 4NT4A 1UWJA 1SNXA 4CKJA 5CXZA 4FZ6A 1YXVA 3P0MA 4Y83A 2PHKA 5C4KA 2W5BA 2OJGA 2B1PA 3EQDA 3NYVA 4D28A 4R6VA 2VTSA 2YACA 4RA4A 3FEGA 3HLLA 2DYLA 3UVQA 3V51A 1QPJA 2UW3A 3NVKI 1H1RA 5BUIA 5EQYA 4JJRA 3R0TA 5IF1A 3O96A 1CKIA 2WXVA 4QMTA 4MAOA 5CAPA 3PPZA 5EDRA 4CTBA 2BDFA 4I5HA 2XA4A 2UW7A 2HZ0A 2RFEA 4NW5A 1BKXA 3PVBA 5HCYA 1T45A 4G34A 4GT5A 4XV3A 5CVHA 1G5SA 3HDMA 4NIFB 5I9XA 4RZWA 3W2SA 1DS5A 1NW1A 3WI6A 5FBNC 5HD7A 4W4YA 3GENA 5D7VA 4CNHA 3AD6A 2CDZA 3QL8A 3EL7A 1U5RA 3NUXA 3QRTA 4LUDA 1Q24A 3ZUVA 5HE3A 2GNFA 5LVOA 2CLQA 2PPQA 3EQHA 4TN6A 3PY3A 4GT3A 2YWVA 4XS2A 3DGKA 4QP6A 5GZ8A 4OBPA 4RX9A 3PIZA 4IJPA 3RM7A 4GYGA 1H8FA 3E5AA 2UV2A 2I1MA 2Q0BA 1FOTA 3EQBA 3E8NA 3PWYA 3VBYA 4BWPA 3OCTA 4NFNA 4QPSA 3GB2A 4I3ZA 4EOJA 2C6LA 3E93A 4G9CA 4EQUA 4BCMA 4AOTA 1BMKA 2QNJA 2UW8A 1KE5A 1UVRA 4R8QA 2G2IA 1MQ4A 2NP8A 4I0SA 5IA2A 5IH5A 3OXZA 3JVSA 4GG5A 4A4LA 5EQEA 4UXLA 3UODA 4NH1A 5J1WA 2OKRA 4IVAA 4RX7A 3IOKA 2XJ0A 5AM6A 3JS2A 3VUDA 3UPZA 1Y6AA 1G8SA 4USDA 5L3AA 4ANLA 4M69A 3ZFMA 5D41A 3AD4A 1YHSA 3R1YA 4XV1A 4RA5A 3WE4A 4O0UA 3F61A 2CPKE 3QD2B 4CLJA 3R9HA 3AXWA 1UKIA 4YJTA 3NZ0A 4X2NA 3DKCA 2BCJA 2GHLA 3A8XA 3Q04A 3K3IA 3VBTA 3FHIA 4AN2A 4AFJA 3SG8A 5J95A 4RC4A 3UBDA 5J8IA 4DEBA 2WFYA 3GUBA 4EC8A 4QP1A 2B9FA 3G33A 4TT7A 3VNTA 3I6UA 4XP2A 3E7VA 3R6XA 5CSHA 4CMOA 4DT9A 3TIYA 4FEXA 3AMYA 4FEVA 1SVEA 2HW6A 3LXNA 4LUEA 3NLBA 5GZAA 1IG1A 3VF8A 4LL5A 1OUKA 2PMIA 3FV8A 2WELA 2C4GA 5L4QA 5AP2A 2VAGA 4G1WA 5AUVA 3BYVA 2GNLA 4WD5A 3NEWA 4NM5A 3S0OA 4L6QA 3WARA 4DFXE 5FQDC 3QLGA 2WMQA 3NUUA 4DN5A 5AIRA 4EJNA 4FKWA 3W2RA 2PYWA 4TYJA 3HA8A 4YLLA 4GMYA 5K5NA 3NR9A 4XLIA 4IWDA 3RAWA 4TWCA 3A99A 3UC3A 3P5KA 4IZ7A 3KVXA 4L68A 4MTAA 3VJNA 4KRDA 1ZY5A 4PMSA 2WOUA 4CLIA 3TXOA 3UTOA 4G16A 2OK1A 4YBJA 3ZO4A 4C3FA 4RWIA 4JOAA 3FUPA 2WOTA 4GRBA 1ZOGA 4PL5A 4I23A 5CEQA 4JIKA 5DRBA 3LHJA 1WMKA 5JZNA 3FMHA 5DFPA 5HX6A 5E7RA 4EK4A 2V7OA 4F63A 1Q8ZA 4ERWA 5JFXA 5KHWA 2FH9A 4TYEA 2V7AA 3G15A 4PDOA 2ESMA 1TQIA 3S00A 3L8PA 2A0CX 1P4OA 2W17A 5T3QA 4M3QA 3JY0A 1ATPE 3OXIA 1Q8TA 2WQMA 4QMSA 4C4FA 4JAJA 1U5QA 4UV0A 3ZCLA 4BDKA 1KE7A 2VO7A 3BBTB 1YWNA 3PLAE 3RP9A 4QP9A 4XG7A 5EYKA 1Y8YA 4TWNA 5HE1A 3KU2A 4DEAA 5JK3A 3VHEA 2PULA 1R0EA 2G2FA 2XZSA 3HUCA 2OBJA 3DKGA 4BDAA 3EJ1A 3W2OA 3Q53A 3GP0A 2W06A 5I9VA 5HBJA 2VN9A 1UNHA 4BTMA 5LMKA 3RAKA 3HGKA 3BELA 2FYSA 4GJ2A 3CIKA 3LLAA 2GPHA 2V62A 4F0GA 3AC3A 3KK8A 2OF4A 4A4XA 2PVRA 4FKPA 3A60A 4E1ZA 3KXXA 3C0HA 4JR3A 4FIEA 3VC4A 4JVGA 2VX3A 3MFRA 2GS2A 5JFVA 5HQ0A 3LVPA 4H3BA 5J7HA 5L2IA 4G3GA 1WVYA 3Q6UA 4BDBA 4FSUA 4YBKA 5KMIA 4FNYA 2YM3A 4DH5A 2B54A 4OR5A 3CBLA 5CNNA 4UWYA 5IEVA 3NGAA 3R02A 2BZIB 5M53A 2WGJA 3V3VA 5E8VA 5ACBC 3F2AA 3CP9A 3KN5A 3HMOA 3PY1A 4Q9SA 5J79A 4CTCA 4RLKA 4ZXTA 3ORPA 3O8TA 5LJJA 3EOCA 2ZB0A 4IX6A 4DG2E 2AC5A 3RPYA 3TM0A 3NVMB 5K4IA 4IVDA 2JITA 3F3UA 4FT5A 4WNMA 5EYCA 3CY2A 2PUUA 4APPA 4AN9A 1OBDA 3RINA 3Q2JA 2O2UA 5CVFA 5HO7A 4JG7A 3WIGA 5L2SA 4RWJA 1YKRA 3HEGA 1LEWA 2ZM1A 2GFSA 2I0EA 4FVRA 1XJDA 3I4BA 2R3QA 4ACDA 2E9NA 2QO9A 1NVQA 1Y8GA 3FL4A 2XK9A 4FSNA 1YRPA 2PVNA 4FV2A 4Y5HA 1W0XC 3A4OX 3QTSA 5CI6A 2P55A 3BE2A 2XNMA 3Q4UA 4ID7A 1DI9A 2R3FA 4JT3A 4USEA 5IQBA 3MPMA 4YC8A 2ITVA 5IDNA 4Y85A 3MFTA 3QZIA 3MVJA 3PDTA 1JAMA 5CU4A 3BU5A 3PE2A 4FZ7A 5DPVA 5HICA 2ITOA 3LFQA 4QYYA 2XCHA 4EWQA 4QQCA 3MS9A 1PXLA 3PIXA 4G5PA 3GCPA 3RPOA 4FT0A 4F4PA 1UU7A 4FIJA 2QURA 4LOQA 3QALE 4YLJA 2WZJA 2FGIA 1UKHA 5HKMA 2BMCA 3CPCA 2R4BA 5CAUA 3DAKA 2BVAA 4N6ZA 2E9VA 2ITZA 2X81A 4FKQA 2LAVA 4ALVA 2YJRA 4E5BA 1XH5A 5IQIA 1U4DA 2WMUA 4DGGA 3UP7A 4RQKA 4F7NA 2GMXA 3F2RA 3RAHA 2XH5A 4Y5QA 4UMQA 3EQGA 4H58A 2UZWE 4BGQA 2RFSA 3UIUA 4YJNA 2X9EA 2PVFA 2I6LA 4J97A 1MRUA 2J51A 2QOQA 4BF2A 5AWMA 1KE6A 4BCFA 4MNEB 4E7WA 4GIHA 5CANA 4YUQA 1V0PA 2X8EA 3TN8A 4AZEA 4P90A 3SQQA 3O50A 1OPLA 3Q5ZA 2QKWB 3M11A 3QD0A 4RT7A 4CRSA 4DCEA 2IZUA 1ZY4A 2R3PA 3BZ3A 4AT5A 3HDNA 5BVOA 1FGIA 3IONA 4FK6A 4FOBA 3E62A 2JBPA 2HWOA 4FUXA 3LE6A 3UG2A 2XKFA 4IM2A 4NYEA 1ZAOA 4NZWB 4GS6A 5EFQA 5ANEA 5G6VA 3UVPA 3WF9A 5EKNA 4DFLA 3KFAA 3D14A 1JVPP 3DK3A 4NWMA 4GJ3A 4X7QA 3R7EA 1J7IA 4A9UA 3VS3A 3MH2A 1DI8A 5DOSA 2I7QA 4O21A 4AF3A 4F6WA 2J0JA 2PMLX 3TV4A 5D1JA 4LV5A 4XH6A 3HMNA 3EB0A 5HNIX 3HRCA 4IAKA 5HO8A 4BDJA 4ZSGA 4K77A 5IA0A 3NUSA 1YDSE 3PE1A 1XBCA 2OICA 3NAXA 3WYXA 4BTFA 5BUEA 3H9FA 3D2IA 3IKAA 3CTJA 3NYOA 2OH4A 4L44A 4C2WA 3TNQB 4DH3A 5BMSA 3F69A 4M67A 4GKIA 4FI1A 2C6KA 1E1XA 5CAOA 3DXPA 3W32A 1P14A 5HI2A 4WA9A 4C7TA 1KOBA 3BHHA 2PY3A 1XH4A 1BL6A 3TDVA 5FBOA 2OJJA 4GH2A 4YNOA 3UZTA 4AW0A 4IAFA 3MI9A 4MWHA 3UOHA 3K3JA 5JH6A 1SVHA 5G1XA 3GOKA 1YW2A 4L8MA 4II5A 2IJMA 2QOHA 4YHJA 3OWKA 5I9UA 3TEIA 3FZTA 5HLPA 4GK4A 1A48A 2F7XE 2HAKA 3KL8A 4NEUA 3NRMA 3ZH8A 4MQ1A 4C4HA 3BKBA 4EH3A 4QYEA 1M2RA 3MSSA 2OU7A 5E8YA 5L8JA 3U51A 4BTKA 4E4LA 1Y6BA 4BYIA 4O1OA 4FTTA 5ICPA 2VGOA 5HLWA 3VS1A 2XF0A 3NCZA 5K5XA 4CCBA 2G15A 4FSQA 2R3IA 2G9XA 4I94A 4FG8A 3EKNA 4IAIA 4X3FA 4RJ7A 2F2CB 3ZRMA 4ZEGA 3GXLA 1KE8A 2PVLA 3EWHA 2C5NA 3BLQA 4D2SA 3BPRA 2X7FA 3ANQA 3HAVA 4FEWA 4QMVA 3LAUA 3GCSA 5E8XA 2HZIA 3VULA 3BWJA 3H0ZA 4AE9A 3FMNA 4FTAA 1M7QA 4LOPA 4D4VA 2PZPA 1BI7A 1XQZA 2XNBA 4BZDA 3QRKA 5AP3A 4CGAA 4M66A 4O2ZA 4BDDA 4BCHA 2UZEA 4BDCA 3O17A 4F65A 4APCA 4AU8A 3QA0A 5DGZA 3TDWA 2F4JA 3A62A 3FLWA 3K5UA 1FVRA 4QP8A 1R0PA 3KA0A 3DKFA 4E6QA 2Y8OA 3DNEA 4D9TA 4HVSA 4WHZA 3VUTA 1Q3DA 3CQEA 4ZLZA 3MA6A 2H6DA 4CQEA 3SKCA 2IVSA 3EQPA 4G3CA 5BYLA 4FSRA 3NCGA 4QQTA 5KX8A 4I6HA 4YHFA 4FEQA 4P5QA 4RJ4A 2Y6OA 4C57A 4O7LA 3DJ5A 4WT6A 5KO1A 5BVDA 4ZMEA 4U79A 3OOGA 3DOGA 3UQCA 3ZLWA 4EI4A 4XCUA 2IZRA 4FV5A 4WNKA 4YZBA 3I5NA 3ROCA 4AA4A 2H9VA 2PVHA 4O22A 5AFVA 4O0VA 4AN3A 3P7CA 5JRQA 4Z9LA 4FV3A 3F3ZA 5AA9A 2BIYA 3HNGA 3T8OA 3DA6A 5LVPA 4L45A 2IW6A 2IVUA 4JR7A 5TE0A 3VHKA 3R2BA 2XNGA 1H1WA 1YOLA 2RFNA 3QTXA 2W1ZA 2J50A 4IAAA 5H8BA 1VZOA 4ZZMA 2PE0A 5JZJA 3LJ1A 3C0IA 4UEUA 5HVYA 4AW1A 3P4KA 2W1FA 2W05A 3AT3A 1ZLTA 2ZDTA 4CMUA 1QPDA 2JEDA 3JR1A 4QTDA 4BCNA 3QRUA 1YQJA 3HECA 4CXAA 1GNGA 1I09A 5J9ZA 5JQ8A 5LCJA 3H4JA 3NW6A 4P5ZA 3I1AA 2GU8A 3WZDA 2CGWA 1AQ1A 3ORMA 4X3JA 3CQUA 3EFLA 4RJ3A 3SHEA 4EYJA 4AOJA 4C4JA 4P2KA 1H26A 1XH7A 4D2WA 3IPHA 5B2MA 3QQHA 2XUUA 4O0TA 2V0DA 4IFGA 5I3OA 4OW8A 4AT3A 3P23A 1TVOA 2YABA 4D2RA 2CCIA 3DBEA 4QTAA 5ANOA 1Q62A 3VUGA 2GQRA 3IG7A 3FPQA 4QO9A 1F5QA 4DGNA 5BPYA 3HP5A 5TO8A 4MEDA 3BEAA 4IIRA 3V5WA 3K5VA 4JXFA 1YI4A 4DBXA 4NU1A 4Z55A 4ZS4A 2CKQA 3ZEWA 4HVHA 3EN9A 4FZAB 4W8DA 4LG4A 3II5A 4GKHA 4UMTA 4J99A 2XMYA 2WQNA 1ZZLA 4M69B 3M2WA 3QGWA 1Z57A 4RSSA 2VNWA 4YJQA 3T9TA 3LQ8A 4D4SA 3MVLA 3WBLA 4FBXA 4AZTA 4FV1A 2QHMA 2J0IA 3HV7A 4F6UA 2WKMA 4NM3A 1Q99A 3FMKA 4I4EA 3PYYA 5L2TA 1O9UA 5A4LA 4E6AA 2W5HA 1NY3A 4IQ6A 3I5ZA 3WF6A 4BCPA 1BI8A 3BGPA 3HP2A 3PP0A 2P2HA 4FTUA 3R00A 3KY2A 5E8UA 5GNKA 4ALWA 4BCGA 3NYXA 3LMHA 2FA2A 3PJCA 4CFXA 3AT4A 5IUIA 2W0JA 2X6EA 2GNIA 2QOOA 4FKOA 4MK0A 3VWAA 5TR6A 3LFCA 1ZMUA 2CGXA 5ANDA 3RPRA 4L9IA 5KHXA 5HHWA 5DR2A 3PVWA 5IPJA 1FVTA 3NUAA 2XYNA 5JGBA 4QP3A 3VS2A 1JSUA 4FNXA 3R8ZA 4HZSA 4V04A 3RMFA 3GFWA 4M7IA 2QR7A 3OCBA 3GNIB 3S2PA 2OH0E 5B7VA 4ITJA 4DBNA 4F70A 3VBVA 3I60A 5A4CA 4HPUE 4MKCA 2C5OA 4EOOA 3LMGA 3OCGA 5JSMA 5K0XA 5HTCA 4MYGA 3QTWA 3KXMA 4RBLA 3CKXA 2J5FA 1KUTA 1H1PA 2I0HA 4B7TA 4D2VA 4ZLOA 2A1AB 4ERKA 1H0WA 1BUHA 4BDGA 3PG1A 2OFUA 1GZNA 5ANGA 4PMMA 5BNJA 2PE1A 2PZYA 3MFSA 3VS6A 3AG9A 4X3FC 4KUJA 4BDHA 3FDNA 5I4NA 5ACKA 4ZTSA 2VD5A 1JKTA 3BLHA 1OL7A 3CE3A 3OFMA 5C27A 3TNPC 1Q8WA 2PZIA 3OF0A 5J5SA 2VWVA 2YM8A 4RJ8A 4D58A 1XH8A 3HUBA 1W82A 2VTAA 2OSCA 3K54A 4CZUA 5JT2A 1NVSA 2YCFA 4O38A 4QTEA 5LOHA 4UWBA 1A06A 3IDBA 3MH1A 1URCA 4S34A 4BI1A 1LEZA 2BDWA 2IZTA 3DDPA 4WKQA 3CQWA 2UZOA 4Q5HA 2R7BA 4PMTA 4RG0A 2NNWB 4MXZA 2WHBA 1TKIA 4FT9A 2BHHA 4DFNA 4G9RA 3QLFA 4IADA 2Y6MA 1G8AA 5DT3A 3ZDUA 3SW4A 3CR0A 4YJVA 2C1AA 5HG8A 3ERKA 2YITA 3G9NA 4LL0A 5TF9A 4AGUA 4C0TA 5HE0A 2JDTA 3IDCA 3RHKA 2YDKA 3ZYAA 3E63A 2C6MA 3E87A 4Q2AA 4C02A 5CU0A 4FSZA 3D4QA 2ITQA 2H34A 3LFEA 4EQMA 4DFUA 3SVVA 4PRJA 4IE9A 3G90X 4DINA 4A9TA 1FINA 2AC3A 2CN5A 3OEZA 3PA4A 4I0TA 4IX4A 4TPTA 4FT7A 4IFCA 4YJUA 4L46A 3UMWA 2I0YA 1M17A 2YEXA 3P08A 4OTWA 3R7VA 4YJRA 4YSMA 1O6KA 4BBMA 4AW2A 2C0OA 4EOKA 3UVRA 5HO6A 4XG9A 4DE4A 4WG3A 4XG8A 1S9JA 3C5IA 2YIWA 3FKNA 3AT2A 5DVRA 4AGWA 4U3YA 5JMSA 4GYIA 3Q32A 4N4SA 3VN9A 2YLEA 2B55A 4LM5A 3QUPA 3ET7A 4X21A 4JI9A 3T9IA 4EUUA 4F9CA 3CY3A 4FG7A 5FUTA 4B6LA 2SRCA 2XIYA 3TZMA 5FWKK 5CTPA 2HY81 2QVSE 4R3RA 3PTGA 3EL8A 5CQUA 3ZZEA 1XBAA 2OZAA 4X6RA 3VS7A 1GIJA 4FTCA 3U6HA 2WMBA 1PY5A 4CEGA 2UUEA 3F5UA 4O0XA 3PG3A 2Z02A 1MRVA 2W1HA 5ETAA 2VTHA 3OMVA 2WIPA 4PV0A 2NRYA 2BIKB 5IH4A 3PP1A 2PE2A 4QP7A 4JLCA 5CT0A 5DNRA 3RPVA 1VYZA 1WBWA 3QU0A 4RVLA 4LI5A 4XX9A 3VUHA 2ITXA 3C4XA 4BIDA 2UW9A 3DQWA 1DAYA 4GK3A 4IXPA 5HNGA 1R1WA 2XJ1A 3ODYX 4BRXA 4BR3A 3CLYA 4EJ7A 1VR2A 5CY3A 3OP5A 3R8PA 1PW2A 3TCPA 3TUBA 1F3MC 3DS6A 3FAAA 3V6SA 1O6LA 3ZZWA 1IRKA 4X2FA 4C59A 3NS9A 3O7LB 3QX4A 3H9OA 4Y46A 5M09A 5JFSA 4G6NA 1JLUE 4K8AA 3COKA 5IEXA 4O0SA 1JKKA 3G2FA 2VU3A 4PWNA 4V01A 3RAIA 1WAKA 1LPUA 2KTYA 4K9YA 3G6HA 1F0QA 2XJ2A 4K0YA 2JGZA 2QU5A 4MD8E 2HCKA 3A8WA 4HVGA 3MESA 4EHVA 2WEVA 3GC9A 4TRLA 5DBXA 2WIHA 2YCQA 2VRXA 3QKMA 3W2QA 2ZOQA 3FY0A 3PZHA 4YJPA 2YCRA 4KIQA 4C4IA 2Z2WA 4O83A 2W9ZB 3B2TA 4GFMA 4Z7GA 1WZYA 3DLSA 3NNXA 5CZIA 3EQRA 3GGFA 5AR4A 2QQ7A 3P1AA 5CS6A 3S4QA 3TNIA 2IW9A 5AAFA 3UO5A 2J4ZA 3DU8A 1OIYA 4TXCA 4PP7A 1V0OA 3MBLA 4D5HA 4QYGA 2GFCA 1H0VA 5CEKA 4YPDA 3OZ6A 3TIZA 4E73A 2EWAA 2JC6A 3R8LA 2YWPA 3C4WA 5LWMA 3KREA 1CM8A 3EH9A 2WO6A 3O71A 4PUZA 3EQCA 3PLSA 4G17A 4BWXA 5CU3A 2YISA 3N9XA 4JDHA 4ONAA 3WILA 1H08A 5CF6A 3QQUA 4UBAA 3UG1A 1JBPE 5EI8A 4EH4A 4OTFA 3RM6A 2CSNA 4QTCA 4AGCA 1WBPA 2BPMA 5CALA 3SA0A 4CYJA 4YURA 2X4ZA 3V5LA 5EI6A 4KIPA 4H39A 3ZXZA 4H36A 4O7NA 4FYOA 4U5JA 3KQ7A 4XEYA 5D10A 3ZU7A 3BIZA 5TOZA 5IA4A 1K9AA 3P86A 2V55A 3KRXA 3ZUUA 3OBJA 3COIA 5CI7A 4EWHA 3RPSA 3LPBA 3PXYA 4BCKA 2A19B 5AX9A 4M12A 5JEBA 3LCSA 3OTVA 2GDOA 1PXKA 1GAGA 4ZTMA 4YGAA 1ZOEA 4ZSLA 3REPA 3KMMA 4M68A 2CHLA 3VAPA 4JQ8A 3JUHA 3DJ6A 3KCKA 5C8NA 5CX9A 1XR1A 3KB7A 1M52A 3QCYA 4YTIA 4IBMA 3WF5A 3ID6C 2EXCX 3FI2A 5E8SA 3LOKA 4H3PA 2UZUE 3IQ7A 2F7ZE 4X3FB 4F08A 5CQWA 4OAVB 3R73A 5AV0A 2ZB1A 1OIQA 2YM5A 3E8CA 4XG2A 1OM1A 2C3KA 4R77A 3LLTA 3FYJX 1T46A 4EL9A 3GT8A 2YIRA 3OW3A 3F82A 2X1NA 3H3CA 3KRWA 4QMPA 1SYKA 3R01A 2WMWA 3LCDA 3LZBA 4PL3A 3WYYA 3SXRA 1YXUA 4RVKA 4B99A 3CKWA 2VTLA 4IWQA 2JKOA 4R7IA 4DH7A 2XK7A 4EQCA 3MPTA 3VUKA 1OI9A 3V8TA 2PVJA 4BCIA 4EONA 4FA2A 4RFYA 1UWHA 4WNPA 3DQXA 3C13A 4MVFA 4O0YA 3AC5A 3SDJA 3U4UA 4JBPA 2VO6A 4I1ZA 3ZO3A 5HCZA 5KMMA 4DG0E 1H01A 5L6OA 4IC7A 3O8PA 2X9FA 5M4CA 2R3JA 3V5PA 4RIWB 4BDFA 1RW8A 3H0YA 4BIEA 5FXQA 5CU2A 3QQKA 1V1KA 3DV3A 2PSQA 5IQFA 3ZUTA 2KULA 3THBA 3ZSHA 3NSZA 2GNJA 3IW5A 5CEOA 2WQBA 3ZLSA 3KK9A 4PQNA 1H1QA 3N51A 4DAWA 1TQMA 2PZ5A 4IJ9A 4QMXA 5A9UA 3ENHA 5CAQA 3A7JA 4AA5A 3U6IA 4R3CA 2O3PA 4UMRA 5HX8A 4F9BA 4S2ZA 3RWQA 2JDSA 3WZJA 4OTHA 2YIYA 3DFCB 3WF8A 2BRNA 1KSWA 3F5XA 4FKTA 2BTRA 2PVYA 4RIOA 4X2GA 3KF4A 3ORTA 5E8ZA 2VGPA 4FICA 3PPJA 1APME 3GQIA 2BDJA 3QTIA 4ACMA 2C1BA 3UMXA 3PA3A 1FGKA 1ZMWA 2HZNA 4FUYA 3MA3A 4WBOA 4RVMA 2QR8A 5HIBA 2OXYA 5I9YA 2W7XA 3KC3A 2X2KA 4PTEA 3VIDA 2ITYA 3DBQA 3LIJA 3Q4TA 4G3EA 5K3YA 4F09A 4NM7A 4XOYA 3ORLA 1ZYDA 2C0TA 4FSYA 3G0FA 2B53A 4HGTA 1J7LA 2X0GA 4KINA 4LRKA 5DT4A 3RCJA 1VEBA 5BVEA 3ETAA 3FLSA 5LVLA 2JFMA 4CG9A 5EDQA 3VS0A 4R5SA 4E5WA 4L7FA 1AGWA 4KWPA 4MH7A 4YC6A 4CD0A 3R9RA 4RRVA 3F6XA 4N57A 3PUPA 3DTCA 2WTVA 4F9AA 5F9EA 4OTQA 1W84A 1B6CB 4HYUA 4FMQA 3FY2A 3K2LA 1IAJA 5L6WL 2J9MA 4PL4A 1H00A 3U55A 5C01A 2NRUA 4FGBA 4J96A 1HCLA 2WPAA 4DEDA 4XUFA 2J0MB 4EOLA 1UU3A 3E8EA 3PY0A 4M15A 1UNGA 2Z7RA 3CXWA 3FMMA 1J7UA 1PRYA 4BIBA 1IEPA 2CGVA 4HPTE 2JD5A 5EYDA 2O5KA 1IR3A 5IA1A 4C38A 2CNVA 3F3VA 2OGVA 4E20A 3SGCA 4FIIA 5IEYA 1PHKA 3OVVA 4O86A 2WMRA 3OD6X 3WIKA 3LW0A 4ANSA 4OTIA 4QYFA 3OWLA 2GQSA 4BN1A 4C2VA 3C4EA 3PXKA 3IW8A 2OIDA 4J8MA 4BI2A 4Y73A 2W4KA 3FZSA 1SM2A 4UZDA 5F1ZA 2BAKA 4FV9A 1OKVA 2BFYA 3VUMA 3IDPA 2ZJWA 3MW1A 4HCVA 1JSVA 4IB3A 1JQHA 4EZ7A 1KE9A 1H28A 2XIRA 2XNEA 1UNLA 3UO6A 1Q4LA 5HVKA 3UOJA 5IQAA 5EM7A 2XKDA 3E8DA 3MPAA 5KBRA 3PXQA 3O23A 5JQ5A 4C3RA 4N0SA 4WOVA 3ACKA 3HV6A 5JGDA 5HTBA 3MB6A 4HYHA 1OIRA 2HYYA 4QQ5A 4W9XA 3GCUA 3HV3A 5CZHA 3TZ8A 4FKRA 4RIYA 3LFAA 4FSTA 4ZJJA 3SOCA 4MD9E 2BTSA 3QF9A 4X0MA 2WU6A 4FX3A 1YHWA 3R8VA 4FF8A 2JIIA 2GS6A 3LFDA 3LJ2A 3NDMA 5C1QB 4D55A 4GU6A 4BCJA 4R5YA 4KKHA 3ZMMA 3G6GA 4ZIMA 4EOQA 2X4FA 5AP0A 5AA8A 1FPUA 3UIXA 3UYTA 4KKGA 4XHKB 1ZZ2A 5AR8A 2C6EA 3DXQA 4F7SA 3GU7A 2OI4X 2VWBA 2W99B 3WZEA 1FVVA 4FTNA 4GSBA 5C8MA 1QPCA 3R28A 2JFLA 4K6ZA 1V0BA 5FP6A 3SOAA 3OROA 3DK7A 5DEWA 3ORIA 4LMNA 2UVXA 4E26A 5IA5A 1DM2A 3BLRA 2W4OA 4YZCA 4IB0A 2HELA 2VTOA 2PUNA 2QLQA 4QMNA 4ZMFA 4ITIA 4S32A 4XMOA 3RGFA 4FTOA 3DFAA 3T3UA 4F7LA 3ZEPA 3VQHA 4XLVA 3HMPA 3LFSA 4FK3A 2X8DA 4E3CA 2OJIA 3GU6A 4PTCA 4X6QC 4CFMA 5BVNA 2P33A 4H05A 3TL8A 4O0RA 3BBWA 5F94A 2C6OA 3N4TA 1YVJA 4EH9A 5IISA 1OL5A 1R3CA 4NJDA 3CSVA 1H1SA 1SZMA 5A3XA 4ZOGA 5LMKC 3LM5A 3V8WA 4PMPA 2UW6A 2QU6A 4RWLA 4IHPA 3QUDA 3V5TA 3SXSA 3QD4A 2XS0A 4HGLA 2C3IB 4AT4A 3FI3A 2Z60A 4G2FA 4TNBA 4XG3A 1REJA 3PFQA 3ORNA 4GV1A 2HZ4A 3EIDA 4NUSA 4ENYA 4UWCA 4OUCA 1RE8A 3ZTXA 1GIIA 5J5TA 4PPBA 4TZRA 2OZAB 5DMZA 1XO2B 2I40A 1WCCA 3V5QA 5IUGA 2BZHB 5AUUA 4O1PA 5HZNA 4DFYA 3TJCA 3NW7A 3TKUA 3F3WA 2P0CA 4QNAA 1UU9A 4QT1A 2E9UA 5LWNA 5J87A 3HAMA 4MX9A 2E9OA 5FTQA 4GVJA 4F7JA 3GCQA 4BGHA 1YWVA 4GK2A 4DCAA 2HXLA 4MXAA 3E3PA 4D9UA 4I24A 5B2KA 3FWQA 1REKA 2ZV7A 3R8MA 2FB8A 3NUPA 3R63A 4R1YA 2UVYA 1XWSA 3SW7A 4QMQA 3JPVA 4J1RA 1PKGA 3UO4A 2VWYA 3UYSA 3LMIA 4A06A 2GSFA 2CKOA 4C4EA 3QBNA 4GFOA 3ZXTA 2B9HA 5H2UA 3HZTA 3AC8A 4J71A 4WG4A 3W10A 1P4FA 4YPSA 4RIWA 3LFNA 4JBVA 4ASZA 3NAYA 5TT7A 4V0GA 5H3QA 2UZDA 4U45A 3AMBA 2XRUA 4R7BA 4W4WA 3W8LA 1U54A 4RVTA 4ASXA 4IDVA 2F2UA 2Y9QA 4H1MA 4BTJA 3MY0A 3GBZA 2BFXA 2O8YA 3OUKA 4ANOA 2OLCA 4OBQA 1DAWA 3EN4A 2V22A 2Y0AA 3Q2MA 5LVMA 2R3LA 4BFMA 4RC3A 2XBJA 2HW7A 2CLXA 2A27A 3FLQA 4HNFA 3QQFA 3R04A 4XV2A 1J1BA 5DG5A 3ANRA 4PNIA 4C62A 5DI1A 4ZTRA 2Z8CA 2ERKA 2YIXA 1OL1A 2UW5A 3MYGA 5CNOA 4U3ZA 4FTMA 2XEYA 3RJCA 5AR2A 5EHLA 4AXAA 3NUYA 3ULIA 2C3JA 3ACJA 2Q83A 3OWJA 4IB5A 5AUWA 4OTDA 3Q60A 4Y72A 3HA6A 3FKLA 5J9YA 3DAEA 4DF3A 4IW0A 4BKYA 3HV4A 5IMEA 1OVEA 2XCKA 1M2PA 4TWPA 5HEZA 5EKOA 1OB3A 2R3KA 5FXSA 2R64A 2XIXA 5DRDA 4YMJA 3KRLA 4LV8A 4NJ3A 1YXSA 2OJ9A 4WIHA 2VTPA 3QRJA 2BROA 3KULB 5BX0A 5HU9A 4S31A 5CSWA 1JOWB 1RJBA 5AV4A 5A6NA 5M56A 1FQ1B 2VTIA 4I92A 5EW8A 4KIOA 4USFA 1CTPE 3FC1X 4K33A 2CMWA 2DQ7X 4MXOA 4EOPA 4YNEA 3F5PA 3VS5A 3GFEA 4CFWA 3ZM9A 2RG5A 4J98A 4IDTA 5FLFA 3FZRA 3FBVA 3NPCA 5HD4A 4QMUA 1NVRA 3TTIA 1JWHA 5L8LA 2JBOA 3EQIA 1OECA 3GCVA 2VTQA 3QA8A 3R9DA 3EFKA 3C4CA 1HCKA 3ZRLA 5I5ZA 3A61A 2F57A 3I79A 5AP5A 4C4GA 2R3HA 1OKWA 2OIQA 2YM7A 3HMMA 2VWZA 4S33A 5GIOE 2X7OA 3SRVB 3NUNA 2EVAA 5CT7A 3NYNA 3CCNA 4CZYB 1SNUA 3DK6A 3PRIA 5AUZA 3QD3A 1OIUA 4FG9A 3R22A 5HTIA 5JKGA 3OUNB 2JDRA 3M42A 5FP5A 3FZ1A 4FSWA 3PJ3A 1J1CA 4CZTA 5AR7A 4IM0A 1ZWSA 3W18A 3MB7A 4ZP5A 3CGFA 2YFXA 3LXKA 3F3TA 4ZSEA 5AR5A 5EOLA 3ZSGA 4BYJA 4FKIA 4OBOA 4YR8A 4NFMA 3QAME 3F7ZA 4KS7A 3BU6A 3FQHA 1H25A 2QLUA 2BRBA 3RZBA 3I7CA 4E93A 2B0QA 2YHVA 4AWIA 3A4PA 3KXNA 4XNEA 4J52A 1PXPA 3PA5A 2JAVA 2G1TA 4ZZOA 4FTKA 5K0KA 3D7ZA 1WBTA 1YHVA 4E8AA 3ZM4A 4JX3A 4DEIA 2QOIA 1OPJA 3ORKA 1ZYCA 4C37A 2JDOA 4QYHA 5D11A 1ZYJA 2YDJA 3D0EA 3ZFYA 4PNKA 3UQFA 5IQHA 3ATSA 5E8WA 4ZS0A 4AGDA 4D1SA 5HG9A 2C5VA 3R7UA 2B52A 1O6YA 1WFCA 2UW0A 4C35A 2XVDA 4FVPA 3Q3BA 1ZOHA 4BBFA 4EEVA 2XBAA 4HJOA 3FLNC 2YCSA 4KBAA 4XBRA 4ACGA 3CD8A 3T3VA 3SLSA 3IK3A 2XIKA 3IW4A 5ANJA 5IH6A 5CSXA 1L3RE 3IGOA 2BRHA 4FV0A 4FGRA 2UZBA 3PJ2A 2Z7QA 2FUMA 3L9LA 5EM6A 4JX7A 1JNKA 1PMEA 4HCTA 3FXZA 2JLDA 3QTQA 2F9GA 3RBWA 3COHA 4QNYA 2WD1A 5DEYA 5FEQA 4I5PA 5JGAA 4GT4A 3MIAA 1ZRZA 4IM3A 4L01A 4XOZA 4IX3A 3DDQA 3QGYA 5H8EA 4ACCA 5M44A 2WNTA 5IDPA 1K2PA 4M8TA 5LMBA 4DT8A 3LXLA 4DGOA 2XK6A 3PWDA 5AJQA 4FZFB 2J2IB 2BALA 4MCVA 1IASA 4GU9A 5HORA 3F66A 1H07A 4PDPA 3IS5A 3C9WA 5DIAA 5DT0A 4FIHA 2IG7A 2REIA 3FQSA 3M1SA 4FVQA 4JDIA 4GCJA 2BZKB 4KA3A 1H27A 1ZXEA 3GEQA 3PVGA 4CQGA 3CJGA 3UIMA 4F1MA 4CG8A 1OKYA 2JAMA 3DLZA 5T68A 3TTJA 4Z3VA 1YOMA 4YC3A 2O0UA 1PMVA 3UPXA 3AMAA 4BDEA 4LOOA 2C68A 4A9YA 3ELJA 2OXDA 4ORKA 4XRLA 3AQVA 5EHOA 2R2PA 2RIOA 5IA3A 2PK9A 4L43A 4NTTA 2WMAA 3FE3A 3V01A 1FMOE 4C3PA 1QMZA 3WF7A 3KXGA 4QMZA 4EK8A 5A4EA 3A7GA 4FL3A 3UZRA 3FLYA 3BQRA 4Z7HA 2RSVA 3W2CA 5CLPA 4F6SA 3GU4A 5IZFA 5M07A 5M57A 1J3HA 3UC4A 4ZAUA 4K2RA 4KABA 4PTGA 2HK5A 4NM0A 1URWA 4B0GA 3LFFA 4F9WA 2YAAA 3KRJA 2YA9A 4ZLYA 1RQQA 1UU8A 2BKKA 4XG4A 3D7TB 1L8TA 2OJFE 2VZ6A 4B8MA 4C33A 5EM5A 5KBQA 3JVRA 3JYAA 3QCXA 4CVAA 4YO4A 4R3PA 3GOPA 4WBBB 5ETFA 4QP2A 2QKRA 2EUFB 1ZMVA 1LR4A 3E64A 1KOAA 2X6DA 3W16A 4DC2A 5HIEA 3W33A 5H8GA 3NX8A 3PZEA 4BDIA 3SC1A 5CXHA 4DTKA 1E1VA 4EHZA 2WTWA 3AC1A 3HL7A 5GZ9A 3LFBA 1IA9A 3I6WA 4MBLA 4Z16A 2FSMX 2ITPA 1MQBA 3BEGA 1JKSA 3LCOA 2QC6A 3QYZA 3QZGA 3O51A 1EH4A 4FTJA 2C5XA 3NW5A 1GZKA 4PY1A 5FXRA 5LVNA 5FG8A 2XEZA 5A6OA 3R1SA 3RVGA 4MBIA 4RZVA 3MWUA 4BI0A 4QQJA 1W98A 5EHYA 4JNWA 2PMOX 2ONLA 3N4VA 4M0YA 4NTSA 2PL0A 3QTUA 4W4VA 1XKKA 4L3JA 4U0IA 3ZONA 2VTMA 3BHYA 5KKRB 3NNVA 3PVUA 2HIWA 4O7ZA 2VTTA 4JDJA 2ZV8A 2UZTA 3H10A 4ZY4A 4FTRA 4WSYA 1YDRE 2IVTA 4HYIA 3G51A 1WVXA 4L3LA 3QC9A 3TACA 1OBGA 1P5EA 5BYYA 2XNPA 4O82A 4OT6A 2IZSA 1I44A 3FI4A 3OG7A 3OTUA 2QG7A 3R2YA 2JIVA 3SX9A 3W8QA 2R3GA 3OY3A 4O2PA 4FKLA 2BILB 4HZRA 5AV3A 4DITA 4RIYB 3RALA 3WE8A 3QUEA 4E5AX 2G2HA 2QOFA 4WSQA 2UZVA 3TNWA 3TV6A 2E9PA 3GQLA 2B9IA 1GIHA 1WBOA 2BAJA 2PMNX 3F5GA 2Q0NA 4YZDA 3L9PA 3G5DA 4A07A 3R9NA 3HRBA 5ETIA 2DWBA 1Q3WA 1M2QA 4C36A 3DKOA 3JXWA 4FIGA 2VUWA 4RMZA 3U6JA 3IO7A 1JSTA 5CSVA 3QQJA 4N70A 3MVHA 3QZFA 4I6QA 4C34A 4O7WA 5M06A 2O65A 5IMXA 5M08A 4XBUA 5GJFA 3AOXA 5DA3A 5C03A 3B8RA 2W4JA 2J90A 3EHAA 4WRGA 3NNUA 4O6EA 5BMMA 3RCDA 2ERZE 4ANBA 2C6IA 4ACHA 2Y4IB 4U81A 2WAJA 1Q97A 5E4HA 4O7VA 2YJSA 3FXWA 4ZTHA 4M97A 3ZC6A 3BQCA 3KULA 4HVIA 2GCDA 3KCFA 3I7BA 4YJSA 3AGMA 1ND4A 2UVZA 5A4QA 2EXMA 5GIPE 4FL1A 1R39A 4CT1A 2HENA 4TYHB 1K3AA 2WTJA 3Q96A 4X2KA 3V5JA 4R78A 4W4XA 3EYGA 2ZMDA 4LGHA 4K18A 3FXXA 5F4NA 2IVVA 5KCVA 5IKWA 2OF2A 2WEIA 3D15A 4U9AA 2IWIA 3FMDA 2IN6A 4RLLA 3UOKA 4CT2A 4O84A 1MUOA 3KMUA 1XHAA 4O0WA 3QCQA 4QP4A 1BLXA 3GVUA 3IOPA 5EM8A 4BCQA 2X7GA 3HV5A 4TYGA 1FBNA 4O7RA 4ANNA 5H9BA 5I9ZA 2YAKA 1GZOA 3QCSA 3HRFA 3ODZX 4BB4A 3SRVA 3KXZA 4D0WA 2P2IA 5A4TA 1QL6A 3OC1A 4UN0C 3FLZA 4BL1A 4UY9A 3OOMA 5FDPA 3QX2A 4PP9A 3BV3A 3QQGA 3BX5A 5EOBA 1OITA 2P4IA 2QOLA 5FEDA 3S95A 1YI6A 3OXTA 5A54A 5BUJA 3U8WA 4O96A 2VO3A 3OS3A 4GUEA 4JRNA 4EUTA 4YZMA 5ANKA 4BGGA 4NSTA 3NNWA 3LCKA 4L52A 4I21A 4KNBA 5D7AA 3R30A 3RK9A 2C6DA 3U9NA 4HGSA 5A46A 4I20A 2F7EE 3PSCA 4IC8A 2ACXA 5AAEA 5GHVA 1PXMA 3OBGA 4DEHA 4E4MA 4QOXA 2J0KA 2CNQA 5DYJA 4AX8A 3POOA 4RX8A 3FKOA 3A7FA 3L1SA 3EKKA 3C7QA 2GNHA 4FNZA 3GU8A 3BI6A 4QPMA 4EH2A 3FZOA 5EW3A 3O8UA 5GJDA 4PF4A 4RPVA 1J91A 4DLIA 2EB2A 3FMLA 4MF0A 4RIXA 2WTDA 3UP2A 5J9LA 4O6LA 3VW6A 3NWWA 3UNJA 3C5UA 2FSTX 3FJQE 3GC8A 3RKBA 2A2AA 4HOKA 4BHNA 2C0IA 4IWOA 4RFMA 2XK3A 3BCEA 4H3QA 4F0IA 2C3LA 4V0GB 2VTRA 3MDYA 5JFWA 3QFVA 4I22A 2BHEA 2WMTA 4QD6A 3Q4CA 1W7HA 4UMPA 1U54B 4O7SA 4Y8DA 4IEBA 1OGUA 3BHVA 4FTQA 4MXYA 3HYHA 4RX5A 1WVWA 5I0BA 1NXKA 5AUYA 4KS8A 2VWUA 2YZLA 3HMIA 3R7YA 2R3NA 3OW4A 5HU3A 1H4LA 4JS8A 4K11A 3P79A 2XM9A 3MFUA 1OL2A 4IX5A 5B0XA 3DTWA 4G5JA 4IANA 1X8BA 4GL9A 2FVDA 4GG7A 2W1GA 3TZ7A 5HBEA 4FODA 4NW6A 4ANQA 2C5YA 2ONLC 3QKLA 4JDKA 3D2KA 2UZLA 4A7CA 3LM0A 4L00A 4BHZA 1PF8A 3COMA 3P78A 3VF9A 3CC6A 5CEMA 4L42A 2WTKC 3A2CA 4LMUA 3ITZA 3R7IA 4FL2A 2PVKA 4L7SA 1IAHA 3Q9ZA 4F1TA 1WBVA 1PYEA 2GHGA 2J6MA 2R5TA 3QQLA 5AP4A 5KE0A 4EK6A 4ZY5A 2ETMA 3KRRA 5JN2A 1CKPA 4UALA 4CFNA 4RGJA 5CF5A 2VWWA 4XG6A 3TJDA 2QOKA 4RWKA 4EKKA 4B9DA 3BYOA 2W5AA 5M4IA 5CU6A 3VW8A 3N4UA 2C30A 5IU2A 3H30A 4ZY6A 3PXZA 4QMMA 4M14A 2CNUA 3PXRA 3FSKA 5EDPA 4AZVA 5DE2A 3CGOA 2WU7A 4BCOA 2J7TA 3DNDA 2VWIA 3D5VA 3IW6A 3OY1A 4FV8A 4UYAA 1AD5A 2XM8A 4GW8A 2C47A 2ZDUA 4EORA 4TWOA 2BRMA 5M4UA 5CVGA 3B2WA 5HG7A 3MN3A 5TKDA 2JKKA 4RFZA 3OT3A 4IB1A 3TZ9A 3DBFA 1P2AA 5C4LA 5IQEA 3D7TA 4L3PA 4G3DA 5EH0A 5HNBA 1CKJA 3R83A 3CPBA 4EZ5A 5IQGA 4AS0A 1ZYSA 2FSOX 4RC2A 2YLFA 5DLSA 1YOJA 3QXOA 4FKJA 4N6YA 1SVGA 2WTCA 4D2PA 2XNOA 3EN7A 4FV4A 3HVCA 1CDKA 3UIBA 4MD7E 4BICA 5HCXA 5AADA 5AEPA 3AC4A 2QI8A 4CMTA 5LXMA 5T6KA 2H96A 2YIQA 4KB8A 2OZOA 2XB7A 3BE9A 3Q9YA 4JQEA 4OT5A 3TV7A 4NL0A 4S30A 5DN3A 2LGCA 3Q9WA 4HCUA 2GHMA 5DR6A 3CTHA 4EZ3A 4MQ2A 4FSMA 4KRCA 1XH9A 3U87A 1Y57A 4U44A 3F88A 4IZ5A 5AMNA 4EHGA 3EN6A 1TQPA 4CV8A 3U9CA 2QODA 4I93A 4ZTQA 3BYSA 4D2TA 3FZPA 4UXQA 4BBEA 3L9NA 3PIYA 2GNGA 4U8ZA 4FOCA 4UYNA 2PU8A 1YDTE 3OHTA 3R1QA 4J53A 4OTGA 4DH1A 1LP4A 3KGAA 3C4FA 5HG5A 4KSQA 2ITTA 4H1JA 4FV6A 4XRJA 5CAVA 4GUBA 4BKZA 5AIKA 3DB8A 4IVBA 4ARKA 3F2NA 3EZRA 4XV9A 4EH7A 3CD3A 3Q6WA 3ROYA 3RZFA 1R78A 2VX0A 2XKEA 4ITHA 5HBHA 3ENMA 5GJGA 4G6LA 5D12A 4UX9A 1MRYA 3ZS5A 2F49A 4PPCA 5J7BA 5LARA 3LCTA 3ZDIA 4EBVA 3VUIA 2QOCA 5M55A 4IH8A 4DFZE 5D9HA 2R3OA 2ZV2A 4OTRA 2VTNA 5K4JA 4XJ0A 4IZYA 2CN8A 3DCVA 4YSJA 3SG9A 5IQCA 3EFJA 4CFFA 5EI2A 3L8VA 3NIZA 2B9JA 5BVWA 4RJ5A 5AP6A 4FKSA 2R9SA 3PJ1A 4NKSA 4KAOA 3DBDA 2ZYBA 2EXEA 5FTOA 4CKIA 4UMUA 1B38A 2Y7JA 5L2WA 5LQFA 4P7EA 3L8XA 3QWKA 5FD2A 4LYNA 5GINE 5EQPA 2ETKA 3C1XA 1VYWA 2WMSA 4NIFA 4NKAA 4ENXA 4AAAA 5B2LA 5DR9A 4CSVA 5HESA 4FIFA 4TL0A 1UV5A 3ZLXA 4AQCA 2C6TA 4V05A 5KZ0A 3RK5A 4ZJVA 2A4LA 2IO6A 2X39A 5DWRA 4EK5A 2ZVAA 4ANMA 1GOLA 4TYHA 3SV0A 2EU9A 3MY1A 2VTJA 5LCKA 5CENA 4D4RA 1WBSA 3ZRKA 5ANIA 4BZOA 5KNJA 2X2MA 2E2BA 1Q41A 3GU5A 4R1VA 3WOWA 1Z5MA 2RFDA 3MIYA 4BY9E 3TI1A 3DAJA 3GC7A 4ZTLA 3FMEA 2NO3A 2BZJA 3V8SA 1MP8A 1XH6A 4YTHA 3WZUA 5LMAA 3BU3A 4OAUC 4AA0A 3NIEA 3D83A 2VO0A 3QZHA 2R0UA 4YZ9A 3BHUA 3VS4A 3PXFA 4M0ZA 4AFEA 4I0RA 4Q9ZA 4MHAA 2WQOA 4YP8A 2R0IA 4ASEA 3DT1A 5KMJA 2VWXA 3VQUA 5AR3A 1KV2A 5F95A 4A4OA 3DZOA 4AE6A 4FC0A 3OEFX 4G31A 1OUYA 4YJOA 4ASDA 4PDYA 3R1NA 3UJGA 2JKMA 3FI8A 4ZSJA 1S9IA 2HY0A 4I5CA 5HOAA 4WO5A 3TKIA 4U7ZA 4AZWA 4KIKB 3O2MA 5M4FA 4F64A 2OXXA 2QOBA 3FHRA 4O91A 1KV1A 3E7OA 4UZHA 2ZMCA 5DHJA 5HGIA 5KMNA 1ZYLA 4AOIA 5KMKA 4I6BA 1PJKA 3LQ3A 4QRCA 4TKSA 4TYIA 4I4FA 4BVUA 3FSFA 4LGDA 3MV5A 5E1SA 5C26A 4AZSA 3QXPA 4BC6A 2RKUA 5IG1A 5KUPA 2IW8A 4U97A 4EH8A 4AG8A 4C8BA 5HVJA 2WB8A 2YM4A 1U46A 1XBBA 4XP3A 3H9RA 5ETCA 3DJ7A 4IAZA 2DS1A 2RG6A 1YWRA 3TWJA 5A14A 3P7BA 3U54A 3RI1A 5AUTA 3RHXA 4DTBA 5CEIA 4JAIA 3VO3A 4DGLC 4BKJA 4KD1A 4AP7A 2WTKB 4NCTA 1Y91A 4E6CA 2ITWA 5I9WA 3I81A 3QTRA 4FKGA 4IAYA 3QKKA 3C51A 2UZNA 4IZAA 1JPAA 3I0QA 1SMHA 4NK9A 3BWFA 4F99A 4F9YA 5K9IA 2GTMA 3KN6A 4G6OA 3VRYA 3ZBXA 2BKZA 1BX6A 3DPKA 2BUJA 3IECA 3RTPA 2HWPA 4DH8A 2PTKA 3DY7A 4D0XA 3B8QA 4ZZNA 4HGEA 5AV1A 2XNNA 4EH5A 2B7AA 3MJ1A 1GZ8A 2CCHA 3O0GA 3RNYA 3CTQA 3D5UA 3QTZA 2ZM3A 4MXXA 5E92A 4DTAA 4M13A 2BAQA 3W2PA 4U40A 1NT2A 1OL6A 4JRVA 3NMUF 5CF8A 1HOWA 3IW7A 3VJOA 5KKRC 3UNKA 2UW4A 1PXJA 5L2QA 2BRGA 4HYSA 4E4XA 3MGYA 2OW3A 2GQGA 4FKVA 3ORZA 3R71A 4TY1A 3TG1A 4TTHB 3VBWA 4DG3E 4YTFA 2ZM4A 2OIBA 5EK7A 4A9RA 4EOSA 3ULZA 5M51A 2G01A 5AV2A 5HIDA 1A9UA 3VBXA 5E9EA 4EBWA 3WZKA 1ERKA 4A9SA 4CYIA 1Z9XA 3MVMA 4QMWA 4I6FA 2OWBA 4MF1A 4YZNA 2W1CA 2WMXA 3UQGA 3UNZA 5EYMA 4ALUA 2FO0A 4O27B 4O7TA 4O81A 4D4YA 1STCE 3Q5IA 3TNHA 4C61A 2C69A 3BYMA 3CS9A 2JKQA 5IUHA 1H24A 4TW9A 4B8LA 2X8IA 3OCSA 1PMNA 4BZNA 3C0GA 1QCFA 3RWPA 2ETRA 2OO8X 3FC2A 3MY5A 4OLIA 3V6RA 5CASA 3TUCA 3VVHA 5JRSA 3C50A 3FQEA 4JBOA 4FV7A 5C9CA 5EW9A 5KMLA 2QD9A 2IPXA 2W1DA 2GTNA 4P4CA 1PXNA 4PPAA 2X2LA 2V5QA 3QWJA 2OFVA 3PRFA 4D5KA 5DH3A 3ZC5A 1KWPA 2Y4IC 1OKZA 3LQ5A 3QRIA 1OZ1A 4GEOA 4MXCA 1OPKA 4W9WA 5FGKA 4E6DA 2ZV9A 3BHTA 5E90A 2R3MA 1ZARA 4QMOA 2Z7SA 2CKPA 3ZO1A 1PXIA 2J5EA 2ITUA 2YERA 2ITNA 1VJYA 4KSPA 4LRMA 4DFBA
chains in the Genus database with same CATH superfamily
2CGUA 3R7OA 2W9FB 5BVKA 1FMKA 3ALOA 4RQVA 2R3RA 3GI3A 1NA7A 3HKOA 5KZIA 4HW7A 3S1HA 3JY9A 3PSBA 3LXPA 3AC2A 4JQ7A 1E9HA 5AM7A 4MNFA 2EB3A 3EZVA 3ATTA 5ITAA 4U80A 4MBJA 3Q9XA 2O63A 4DYMA 5KMOA 4KKEA 1VLRA 4WUNA 2W1IA 4QMLA 2W96B 4LRJA 1PYXA 4QMYA 2RL5A 5C8KA 5FTGA 4M84A 2H8HA 1IA8A 4JG6A 3FMJA 4YLKA 3GC0A 4U6RA 3W1FA 4D1ZA 3LJ0A 3DB6A 1W8CA 4QTBA 5E91A 2GS7A 2B4SB 1Q8YA 1CSNA 3F7WA 3KVWA 3R21A 3DZQA 2AUHA 2XYUA 2QHNA 3G0EA 3Q52A 3FYKX 4RIXB 1LUFA 2R7IA 3MTFA 4JG8A 5FDXA 4PDSA 4KBCA 4U41A 4JIAA 2YM6A 4YU2A 1CMKE 3C4ZA 3D5XA 1Q8UA 3UDBA 4LFIA 5E1EA 3POZA 4CFVA 4WUAA 3SXFA 3ORXA 3DXNA 4EOIA 5IQDA 5I3RA 2AYPA 4ZSAA 2XKCA 4AZFA 5E8TA 1WBNA 1UA2A 3QHRA 4IACA 3BGQA 3EN5A 3ZHPC 4C58A 4W8EA 4WRSA 3QHWA 4EKLA 5AP1A 2WQEA 1OMWA 2PUIA 3MTLA 3FPMA 3SAYA 3BV2A 4FEUA 1GY3A 4CCUA 4I5MA 4RJ6A 2Z7LA 3A7HA 4YHTA 1Q61A 5FEEA 2QONA 4L67A 4BWKA 2HOGA 4MNEA 5AX3A 2WMVA 4DEGA 2PUPA 4FTIA 3LKMA 4ZTNA 3D5WA 5L8KA 4FNWA 4L53A 3KEXA 4EH6A 4WNOA 4YTCA 4DA5A 3E92A 3DBCA 4GIIA 4KBKA 4B4LA 3S3IA 5BQ0A 3MH3A 3R8UA 4HVDA 4FKUA 2CKEA 4FZDB 4IMYA 4FR4A 4OGRA 4Y95A 3QC4A 4NCTC 5BVFA 3EYHA 4EC9A 1BYGA 4DEEA 3EMGA 3O7LD 4EYMA 3TT0A 2VV9A 3E3BX 4J8NA 2XK4A 4ZJIA 4AACA 4J7BA 3P7AA 2OG8A 4EHEA 4GFGA 5FRIA 2O64A 4FTLA 3ZLYA 3IGGA 4ZK5A 3BGZA 4LGGA 3AD5A 3L9MA 4CKRA 3EQFA 1YXXA 4R7HA 2XK8A 5AP7A 5FM3A 4F0FA 5AAGA 2QO7A 3ZOSA 2PZRA 5HLNA 4OTPA 4CRLA 3ALNA 3CEKA 2PVMA 4HNIA 3VBQA 1YXTA 2YDIA 3KKVA 1B39A 4YO6A 1GJOA 2QCSA 2ZAZA 3OT8A 4GVAA 3TKHA 4TNDA 3KMWA 2DUVA 3QYWA 5L6PA 2QG5A 3U4WA 3UOLA 2PWLA 3FL5A 5J1VA 3UGCA 5CYIA 3V04A 3TUDA 3ZFXA 2BR1A 3SD0A 4JL9A 3G9LX 4G3FA 4XYFA 4F1OA 3CJFA 4QDVA 2VNYA 3R7GA 4I41A 1Q5KA 1U59A 1W83A 2FSLX 3EFWA 5FM2A 2J0LA 3ZO2A 2W1EA 4LQMA 1JKLA 2RGPA 4J95A 4U42A 4X2JA 3E88A 3ZBFA 3ZSIA 2Y4PA 2XIZA 4K1BA 5CSPA 4IVCA 1QPEA 3PPKA 2VX1A 4KIKA 4U43A 5CF4A 3F9NA 4QPAA 4CV9A 3KF7A 4MWIA 2I0VA 2P3GX 2RF9A 3P9JA 1G3NA 3D94A 4WG5A 2CJMA 3MH0A 4IWPA 3RNIA 2NPQA 3W55A 3AGLA 1M14A 4DLJA 3UZPA 3BYUA 3Q4ZA 4EOMA 2YZAA 4DHFA 3HX4A 1PMUA 1PXOA 2WTIA 3BRBA 3D9VA 1RDQE 3L8SA 3I0OA 3PJ8A 4PX6A 4XP0A 4FE2A 2XRWA 2JDVA 3MJ2A 5CEPA 4Q5EA 4O7YA 5CWZA 4CFUA 4F78A 5HE2A 3A7IA 5AUXA 5EG3A 2YN8A 5BYZA 3RK7A 1PKDA 3R9OA 4AW5A 3KXHA 4D1XA 4FT3A 4AUAA 4EK3A 2JIUA 3UE4A 2QO2A 1YI3A 4FYNA 4JBQA 3VRZA 1M7NA 3OWPA 1BL7A 4E4NA 5F20A 2HXQA 2XP2A 4DGMA 4UB7A 3PSDA 4NT4A 1UWJA 1SNXA 4CKJA 5CXZA 4FZ6A 1YXVA 3P0MA 4Y83A 2PHKA 5C4KA 2W5BA 2OJGA 2B1PA 3EQDA 3NYVA 4D28A 4R6VA 2VTSA 2YACA 4RA4A 3FEGA 3HLLA 2DYLA 3UVQA 3V51A 1QPJA 2UW3A 3NVKI 1H1RA 5BUIA 5EQYA 4JJRA 3R0TA 5IF1A 3O96A 1CKIA 2WXVA 4QMTA 4MAOA 5CAPA 2XANA 3PPZA 5EDRA 4CTBA 2BDFA 4I5HA 2XA4A 2UW7A 2HZ0A 2RFEA 4NW5A 1BKXA 3PVBA 5HCYA 1T45A 4G34A 4GT5A 4XV3A 5CVHA 1G5SA 3HDMA 4NIFB 5I9XA 4RZWA 3W2SA 1DS5A 1NW1A 3WI6A 5FBNC 5HD7A 4W4YA 3GENA 5D7VA 4CNHA 3AD6A 2CDZA 3QL8A 3EL7A 1U5RA 3NUXA 3QRTA 4LUDA 1Q24A 3ZUVA 5HE3A 2GNFA 5LVOA 2CLQA 2PPQA 3EQHA 4TN6A 3PY3A 4GT3A 2YWVA 4XS2A 3DGKA 4QP6A 5GZ8A 4OBPA 4RX9A 3PIZA 4IJPA 3RM7A 4GYGA 1H8FA 3E5AA 2UV2A 2I1MA 2Q0BA 1FOTA 3EQBA 3E8NA 3PWYA 3VBYA 4BWPA 3OCTA 4NFNA 4QPSA 3GB2A 4I3ZA 4EOJA 2C6LA 3E93A 4G9CA 4EQUA 4BCMA 4AOTA 1BMKA 2QNJA 2UW8A 1KE5A 1UVRA 4R8QA 2G2IA 1MQ4A 2NP8A 4I0SA 5IA2A 5IH5A 3OXZA 3JVSA 4GG5A 4A4LA 5EQEA 4UXLA 3UODA 4NH1A 5J1WA 2OKRA 4AQKA 4IVAA 4RX7A 3IOKA 2XJ0A 5AM6A 3JS2A 3VUDA 3UPZA 1Y6AA 1G8SA 4USDA 5L3AA 4ANLA 4M69A 3ZFMA 5D41A 3AD4A 1YHSA 3R1YA 4XV1A 4RA5A 3WE4A 4O0UA 3F61A 2CPKE 3QD2B 4CLJA 3R9HA 3AXWA 1UKIA 4YJTA 3NZ0A 4X2NA 3DKCA 2BCJA 2GHLA 3A8XA 3Q04A 3K3IA 3VBTA 3FHIA 4AN2A 3PUFC 4AFJA 3SG8A 5J95A 4RC4A 3UBDA 5J8IA 4DEBA 2WFYA 3GUBA 4EC8A 4QP1A 2B9FA 3G33A 4TT7A 3VNTA 3I6UA 4XP2A 3E7VA 3R6XA 5CSHA 4CMOA 4DT9A 3TIYA 4FEXA 3AMYA 4FEVA 1SVEA 2HW6A 3LXNA 4LUEA 3NLBA 5GZAA 1IG1A 3VF8A 4LL5A 1OUKA 2PMIA 3FV8A 2WELA 2C4GA 5L4QA 5AP2A 2VAGA 4G1WA 5AUVA 3BYVA 2GNLA 4WD5A 3NEWA 4NM5A 3S0OA 4L6QA 3WARA 4DFXE 5FQDC 3QLGA 2WMQA 3NUUA 4DN5A 5AIRA 4EJNA 4FKWA 3W2RA 2PYWA 4TYJA 3HA8A 4YLLA 4GMYA 5K5NA 3NR9A 4XLIA 4IWDA 3RAWA 4TWCA 3A99A 3UC3A 3P5KA 4IZ7A 3KVXA 4L68A 4MTAA 3VJNA 4KRDA 1ZY5A 4PMSA 2WOUA 4CLIA 3TXOA 3UTOA 4G16A 2OK1A 4YBJA 3ZO4A 4C3FA 4RWIA 4JOAA 3FUPA 2WOTA 4GRBA 1ZOGA 4PL5A 4I23A 5CEQA 4JIKA 5DRBA 3LHJA 1WMKA 5JZNA 3FMHA 5DFPA 5HX6A 5E7RA 4EK4A 2V7OA 4F63A 1Q8ZA 4ERWA 5JFXA 5KHWA 2FH9A 4TYEA 2V7AA 3G15A 4PDOA 2ESMA 1TQIA 3S00A 3L8PA 2A0CX 1P4OA 2W17A 4DDGA 5T3QA 4M3QA 3JY0A 1ATPE 3OXIA 1Q8TA 2WQMA 4QMSA 4C4FA 4JAJA 1U5QA 4UV0A 3ZCLA 4BDKA 1KE7A 2VO7A 3BBTB 1YWNA 3PLAE 3RP9A 4QP9A 4XG7A 5EYKA 1Y8YA 4TWNA 5HE1A 3KU2A 4DEAA 5JK3A 3VHEA 2PULA 1R0EA 2G2FA 3UDZA 2XZSA 3HUCA 2OBJA 3DKGA 4BDAA 3EJ1A 3W2OA 3Q53A 3GP0A 2W06A 5I9VA 5HBJA 2VN9A 1UNHA 4BTMA 5LMKA 3RAKA 3HGKA 3BELA 2FYSA 4GJ2A 3CIKA 3LLAA 2GPHA 2V62A 4F0GA 3AC3A 3KK8A 2OF4A 4A4XA 2PVRA 4FKPA 3A60A 4E1ZA 3KXXA 3C0HA 4JR3A 4FIEA 3VC4A 4JVGA 2VX3A 3MFRA 2GS2A 5JFVA 5HQ0A 3LVPA 4H3BA 5J7HA 5L2IA 4G3GA 1WVYA 3Q6UA 4BDBA 4FSUA 4YBKA 5KMIA 4FNYA 2YM3A 4DH5A 2B54A 4OR5A 3CBLA 5CNNA 4UWYA 5IEVA 3NGAA 2X0OA 3R02A 2BZIB 5M53A 2WGJA 3V3VA 5E8VA 5ACBC 3F2AA 3CP9A 3KN5A 3HMOA 3PY1A 4Q9SA 5J79A 4CTCA 4RLKA 4ZXTA 3ORPA 3O8TA 5LJJA 3EOCA 2ZB0A 4IX6A 4DG2E 2AC5A 3RPYA 3TM0A 1TFFA 3NVMB 5K4IA 4IVDA 2JITA 3F3UA 4FT5A 4WNMA 5EYCA 3CY2A 2PUUA 4APPA 4AN9A 1OBDA 3RINA 3Q2JA 2O2UA 5CVFA 5HO7A 4JG7A 3WIGA 5L2SA 4RWJA 1YKRA 3HEGA 1LEWA 2ZM1A 2GFSA 2I0EA 4FVRA 1XJDA 3I4BA 2R3QA 4ACDA 2E9NA 2QO9A 1NVQA 1Y8GA 3FL4A 2XK9A 4FSNA 1YRPA 2PVNA 4FV2A 4Y5HA 1W0XC 3A4OX 3QTSA 5CI6A 2P55A 3BE2A 2XNMA 3Q4UA 4ID7A 1DI9A 2R3FA 4JT3A 4USEA 5IQBA 3MPMA 4YC8A 2ITVA 5IDNA 4Y85A 3MFTA 3QZIA 3MVJA 3PDTA 1JAMA 5CU4A 3BU5A 3PE2A 4FZ7A 5DPVA 5HICA 2ITOA 3LFQA 4QYYA 2XCHA 4EWQA 4QQCA 3MS9A 1PXLA 3PIXA 4G5PA 3GCPA 3RPOA 4FT0A 4F4PA 1UU7A 4FIJA 2QURA 4LOQA 3QALE 4YLJA 2WZJA 2FGIA 1UKHA 5HKMA 2BMCA 3CPCA 2R4BA 5CAUA 3DAKA 2BVAA 4N6ZA 2E9VA 2ITZA 2X81A 4FKQA 2LAVA 4ALVA 2YJRA 4E5BA 1XH5A 5IQIA 1U4DA 2WMUA 4DGGA 3UP7A 4RQKA 4F7NA 2GMXA 3F2RA 3RAHA 2XH5A 4Y5QA 4UMQA 3EQGA 4H58A 2UZWE 4BGQA 2RFSA 3UIUA 4YJNA 3AKKA 2X9EA 2PVFA 2I6LA 4J97A 1MRUA 2J51A 2QOQA 4BF2A 5AWMA 1KE6A 4BCFA 4MNEB 4E7WA 4GIHA 5CANA 4YUQA 1V0PA 2X8EA 3TN8A 4AZEA 4P90A 3SQQA 3O50A 1OPLA 3Q5ZA 2QKWB 3M11A 1W2CA 3QD0A 4RT7A 4CRSA 4DCEA 2IZUA 1ZY4A 2R3PA 1ST0A 3BZ3A 4AT5A 3HDNA 5BVOA 1FGIA 3IONA 4FK6A 4FOBA 3E62A 2JBPA 2HWOA 4FUXA 3LE6A 3UG2A 2XKFA 4IM2A 4NYEA 1ZAOA 4NZWB 4GS6A 5EFQA 5ANEA 5G6VA 3UVPA 3WF9A 5EKNA 4DFLA 3KFAA 3D14A 1JVPP 3DK3A 4NWMA 4GJ3A 4X7QA 3R7EA 1J7IA 4A9UA 3VS3A 3MH2A 1DI8A 5DOSA 2I7QA 4O21A 4AF3A 4F6WA 2J0JA 2PMLX 3TV4A 5D1JA 4LV5A 4XH6A 3HMNA 3EB0A 5HNIX 3HRCA 4IAKA 5HO8A 4BDJA 4ZSGA 4K77A 5IA0A 3NUSA 1YDSE 3PE1A 1XBCA 2OICA 3NAXA 3WYXA 4BTFA 5BUEA 3H9FA 3D2IA 3IKAA 3CTJA 3NYOA 2OH4A 4L44A 4C2WA 3TNQB 4DH3A 5BMSA 3F69A 4M67A 4GKIA 4FI1A 2C6KA 1E1XA 5CAOA 3DXPA 3W32A 1P14A 5HI2A 4WA9A 4C7TA 1KOBA 3BHHA 2PY3A 1XH4A 1BL6A 3TDVA 5FBOA 2OJJA 4GH2A 4YNOA 3UZTA 4AW0A 4IAFA 3MI9A 4MWHA 3UOHA 3K3JA 5JH6A 1SVHA 5G1XA 3GOKA 1YW2A 4L8MA 4II5A 2IJMA 2QOHA 4YHJA 3OWKA 5I9UA 3TEIA 3FZTA 5HLPA 4GK4A 1A48A 2F7XE 2HAKA 3KL8A 4NEUA 3NRMA 3ZH8A 4MQ1A 4C4HA 3BKBA 4EH3A 4QYEA 1M2RA 3MSSA 2OU7A 5E8YA 5L8JA 3U51A 4BTKA 4E4LA 1Y6BA 4BYIA 4O1OA 4FTTA 5ICPA 2VGOA 5HLWA 3VS1A 2XF0A 3NCZA 5K5XA 4CCBA 2G15A 4FSQA 2R3IA 2G9XA 4I94A 4FG8A 3EKNA 4IAIA 4X3FA 4RJ7A 2F2CB 3ZRMA 4ZEGA 3GXLA 1KE8A 2PVLA 3EWHA 2ZFYA 2C5NA 3BLQA 4D2SA 3BPRA 2X7FA 3ANQA 3HAVA 4FEWA 4QMVA 3LAUA 3GCSA 5E8XA 2HZIA 3VULA 3BWJA 3H0ZA 4AE9A 3FMNA 4FTAA 1M7QA 4LOPA 4D4VA 2PZPA 1BI7A 1XQZA 2XNBA 4BZDA 3QRKA 5AP3A 4CGAA 4M66A 4O2ZA 4BDDA 4BCHA 2UZEA 4BDCA 3O17A 4F65A 4APCA 4AU8A 3QA0A 5DGZA 3TDWA 2F4JA 3A62A 3FLWA 3K5UA 1FVRA 4QP8A 1R0PA 3KA0A 3DKFA 4E6QA 2Y8OA 3DNEA 4D9TA 4HVSA 4WHZA 3VUTA 1Q3DA 3CQEA 4ZLZA 3MA6A 2H6DA 4CQEA 3SKCA 2IVSA 3EQPA 4G3CA 5BYLA 4FSRA 3NCGA 4QQTA 5KX8A 4I6HA 4YHFA 4FEQA 4P5QA 4RJ4A 2Y6OA 4C57A 4O7LA 3DJ5A 4WT6A 5KO1A 5BVDA 4ZMEA 4U79A 3OOGA 3DOGA 3UQCA 3ZLWA 4EI4A 4XCUA 2IZRA 4FV5A 4WNKA 4YZBA 3I5NA 3ROCA 4AA4A 2H9VA 2PVHA 4O22A 5AFVA 4O0VA 4AN3A 3P7CA 5JRQA 4Z9LA 4FV3A 3F3ZA 5AA9A 2BIYA 3HNGA 3T8OA 3DA6A 5LVPA 4L45A 2IW6A 2IVUA 4JR7A 5TE0A 3VHKA 3R2BA 2XNGA 1H1WA 1YOLA 2RFNA 3QTXA 2W1ZA 2J50A 4IAAA 5H8BA 1VZOA 4ZZMA 2PE0A 5JZJA 3LJ1A 3C0IA 4UEUA 5HVYA 4AW1A 3P4KA 2W1FA 2W05A 3AT3A 1ZLTA 2ZDTA 2XALA 4CMUA 1QPDA 2JEDA 3JR1A 4QTDA 4BCNA 3QRUA 1YQJA 3HECA 4CXAA 1GNGA 1I09A 5J9ZA 5JQ8A 5LCJA 3H4JA 3NW6A 4P5ZA 3I1AA 2GU8A 3WZDA 2CGWA 4O4CA 1AQ1A 3ORMA 4X3JA 3CQUA 3EFLA 4RJ3A 3SHEA 4EYJA 4AOJA 4C4JA 4P2KA 1H26A 1XH7A 4D2WA 3IPHA 5B2MA 3QQHA 2XUUA 4O0TA 2V0DA 4IFGA 5I3OA 4OW8A 4AT3A 3P23A 1TVOA 2YABA 4D2RA 2CCIA 3DBEA 4QTAA 5ANOA 1Q62A 3VUGA 2GQRA 3IG7A 3FPQA 4QO9A 1F5QA 4DGNA 5BPYA 3HP5A 5TO8A 4MEDA 3BEAA 4IIRA 3V5WA 3K5VA 4JXFA 1YI4A 4DBXA 4NU1A 4Z55A 4ZS4A 2CKQA 3ZEWA 4HVHA 3EN9A 4FZAB 4W8DA 4LG4A 3II5A 4GKHA 4UMTA 4J99A 2XMYA 2WQNA 1ZZLA 4M69B 3M2WA 3QGWA 1Z57A 4RSSA 2VNWA 4YJQA 3T9TA 3LQ8A 4D4SA 3MVLA 3WBLA 4FBXA 4AZTA 4FV1A 2QHMA 2J0IA 3HV7A 4F6UA 2WKMA 4NM3A 1Q99A 3FMKA 4I4EA 3PYYA 5L2TA 1O9UA 5A4LA 4E6AA 2W5HA 1NY3A 4IQ6A 3I5ZA 3WF6A 4BCPA 1BI8A 3BGPA 3HP2A 3PP0A 2P2HA 4FTUA 3R00A 3KY2A 5E8UA 5GNKA 4ALWA 4BCGA 3NYXA 3LMHA 2FA2A 3PJCA 4CFXA 3AT4A 5IUIA 2W0JA 2X6EA 2GNIA 2QOOA 4FKOA 4MK0A 3VWAA 5TR6A 3LFCA 1ZMUA 2CGXA 5ANDA 3RPRA 4L9IA 5KHXA 5HHWA 5DR2A 3PVWA 4AXDA 5IPJA 1FVTA 3NUAA 2XYNA 5JGBA 4QP3A 3VS2A 1JSUA 4FNXA 3R8ZA 4HZSA 4V04A 3RMFA 3GFWA 4M7IA 2QR7A 3OCBA 3GNIB 3S2PA 3BL7A 2OH0E 5B7VA 4ITJA 4DBNA 4F70A 3VBVA 3I60A 5A4CA 4HPUE 4MKCA 2C5OA 4EOOA 3LMGA 3OCGA 5JSMA 5K0XA 5HTCA 4MYGA 3QTWA 3KXMA 4RBLA 3CKXA 2J5FA 1KUTA 1H1PA 2I0HA 4B7TA 4D2VA 4ZLOA 2A1AB 4ERKA 1H0WA 1BUHA 4BDGA 3PG1A 2OFUA 1GZNA 5ANGA 4PMMA 5BNJA 2PE1A 2PZYA 3MFSA 3VS6A 3AG9A 4X3FC 4KUJA 4BDHA 3FDNA 5I4NA 5ACKA 4ZTSA 2VD5A 1JKTA 3BLHA 1OL7A 3CE3A 3OFMA 5C27A 3TNPC 1Q8WA 2PZIA 3OF0A 5J5SA 2VWVA 2YM8A 4RJ8A 4D58A 1XH8A 3HUBA 1W82A 2VTAA 2OSCA 3K54A 4CZUA 5JT2A 1NVSA 2YCFA 4O38A 4QTEA 5LOHA 4UWBA 1A06A 3IDBA 3MH1A 1URCA 4S34A 4BI1A 1LEZA 2BDWA 2IZTA 3DDPA 4WKQA 3CQWA 2UZOA 4Q5HA 2R7BA 4PMTA 4RG0A 2NNWB 4MXZA 2WHBA 1TKIA 4FT9A 2BHHA 4DFNA 4G9RA 3QLFA 4IADA 2Y6MA 1G8AA 5DT3A 3ZDUA 3SW4A 3CR0A 4YJVA 2C1AA 5HG8A 3ERKA 2YITA 3G9NA 4LL0A 5TF9A 4AGUA 4C0TA 5HE0A 2JDTA 3IDCA 3RHKA 2YDKA 3ZYAA 3E63A 2C6MA 3E87A 4Q2AA 4C02A 5CU0A 4FSZA 3D4QA 2ITQA 2H34A 3LFEA 4EQMA 4DFUA 3SVVA 4PRJA 4IE9A 3G90X 4DINA 4A9TA 1FINA 2AC3A 2CN5A 3OEZA 3PA4A 4I0TA 4IX4A 4TPTA 4FT7A 4IFCA 4YJUA 4L46A 3UMWA 2I0YA 1M17A 2YEXA 3P08A 4OTWA 3R7VA 3VONA 4YJRA 4YSMA 1O6KA 4BBMA 4AW2A 2C0OA 4EOKA 3UVRA 5HO6A 4XG9A 4DE4A 4WG3A 4XG8A 1S9JA 3C5IA 2YIWA 3FKNA 3AT2A 5DVRA 4AGWA 4U3YA 5JMSA 4GYIA 3Q32A 4N4SA 3VN9A 2YLEA 2B55A 4LM5A 3QUPA 3ET7A 4X21A 4JI9A 3T9IA 4EUUA 4F9CA 3CY3A 4FG7A 5FUTA 4B6LA 2SRCA 2XIYA 3TZMA 5FWKK 5CTPA 2HY81 2QVSE 4R3RA 4FJVA 3PTGA 3EL8A 5CQUA 3ZZEA 1XBAA 2OZAA 4X6RA 3VS7A 1GIJA 4FTCA 3U6HA 2WMBA 1PY5A 4CEGA 2UUEA 3F5UA 4O0XA 3PG3A 2Z02A 1MRVA 2W1HA 5ETAA 2VTHA 3OMVA 2WIPA 4PV0A 2NRYA 2BIKB 4AXCA 1OGYA 5IH4A 3PP1A 2PE2A 4QP7A 4JLCA 5CT0A 5DNRA 3RPVA 1W2DA 1VYZA 1WBWA 3QU0A 4RVLA 4LI5A 4XX9A 3VUHA 2ITXA 3C4XA 4BIDA 2UW9A 3DQWA 1DAYA 4GK3A 4IXPA 5HNGA 1R1WA 2XJ1A 3ODYX 4BRXA 4BR3A 3CLYA 4EJ7A 1VR2A 5CY3A 3OP5A 3R8PA 1PW2A 3TCPA 3TUBA 1F3MC 3DS6A 3FAAA 3V6SA 1O6LA 3ZZWA 1IRKA 4X2FA 4C59A 3NS9A 3O7LB 3QX4A 3H9OA 4Y46A 5M09A 5JFSA 4G6NA 1JLUE 4K8AA 3COKA 5IEXA 4O0SA 1JKKA 3G2FA 2A98A 2VU3A 4PWNA 4V01A 3RAIA 1WAKA 1LPUA 2KTYA 4K9YA 3G6HA 1F0QA 2XJ2A 4K0YA 3UDSA 2JGZA 2QU5A 4MD8E 2HCKA 3A8WA 4HVGA 3MESA 4EHVA 2WEVA 3GC9A 4TRLA 5DBXA 2WIHA 2YCQA 2VRXA 3QKMA 3W2QA 2ZOQA 3FY0A 3PZHA 4YJPA 2YCRA 4KIQA 4C4IA 2Z2WA 4O83A 2W9ZB 3B2TA 4GFMA 4Z7GA 1WZYA 3DLSA 3NNXA 5CZIA 3EQRA 3GGFA 5AR4A 2QQ7A 3P1AA 5CS6A 3S4QA 3TNIA 2IW9A 5AAFA 3UO5A 2J4ZA 3DU8A 1OIYA 4TXCA 4PP7A 1V0OA 3MBLA 4D5HA 3NFFB 4QYGA 2GFCA 1H0VA 5CEKA 4YPDA 3OZ6A 3TIZA 4E73A 2EWAA 2JC6A 3R8LA 2YWPA 3C4WA 5LWMA 3KREA 1CM8A 3EH9A 2WO6A 3NFGB 3O71A 4FRFA 4PUZA 3EQCA 3PLSA 4G17A 4BWXA 2XAMA 5BV3A 5CU3A 2YISA 3N9XA 4JDHA 4ONAA 3WILA 1H08A 5CF6A 3QQUA 4UBAA 3UG1A 1JBPE 5EI8A 4EH4A 4OTFA 3RM6A 2CSNA 4QTCA 4AGCA 1WBPA 2BPMA 5CALA 3SA0A 4CYJA 4YURA 2X4ZA 3V5LA 5EI6A 4KIPA 4H39A 3ZXZA 4H36A 4O7NA 4FYOA 4DHZA 4U5JA 3KQ7A 1TZDA 4XEYA 5D10A 3ZU7A 3BIZA 5TOZA 5IA4A 1K9AA 3P86A 2V55A 3KRXA 3ZUUA 3OBJA 3COIA 5CI7A 4EWHA 3RPSA 3LPBA 3PXYA 4BCKA 2A19B 5AX9A 4M12A 5JEBA 3LCSA 3OTVA 2GDOA 1PXKA 1GAGA 4ZTMA 2IF8A 1ZOEA 4YGAA 4ZSLA 3REPA 3KMMA 4M68A 2CHLA 3VAPA 4JQ8A 3JUHA 3DJ6A 3KCKA 5C8NA 5CX9A 1XR1A 3KB7A 1M52A 3QCYA 4YTIA 4IBMA 3WF5A 3ID6C 2EXCX 3FI2A 5E8SA 3LOKA 4H3PA 2UZUE 3IQ7A 2F7ZE 4X3FB 4F08A 5CQWA 4OAVB 3R73A 5AV0A 2ZB1A 1OIQA 2YM5A 3E8CA 4XG2A 1OM1A 2C3KA 4R77A 3LLTA 3FYJX 1T46A 4EL9A 3GT8A 2YIRA 3OW3A 3F82A 2X1NA 3H3CA 3KRWA 4QMPA 1SYKA 3R01A 2WMWA 3LCDA 3LZBA 4PL3A 3WYYA 3SXRA 1YXUA 4RVKA 4B99A 3CKWA 2VTLA 4IWQA 2JKOA 4R7IA 4DH7A 2XK7A 4EQCA 3MPTA 3VUKA 1OI9A 3V8TA 2PVJA 4BCIA 4EONA 4FA2A 4RFYA 1UWHA 4WNPA 3DQXA 3C13A 4MVFA 4O0YA 3AC5A 3SDJA 3U4UA 4JBPA 2VO6A 4I1ZA 3ZO3A 5HCZA 5KMMA 4DG0E 1H01A 5L6OA 4IC7A 3O8PA 2X9FA 5M4CA 2R3JA 3V5PA 4RIWB 4BDFA 1RW8A 3H0YA 4BIEA 5FXQA 5CU2A 3QQKA 1V1KA 3DV3A 2PSQA 5IQFA 3ML1A 3ZUTA 2KULA 3THBA 3ZSHA 3NSZA 2GNJA 3IW5A 5CEOA 2WQBA 3ZLSA 3KK9A 4PQNA 1H1QA 3N51A 4DAWA 1TQMA 2PZ5A 4IJ9A 4QMXA 5A9UA 3ENHA 5CAQA 3A7JA 4AA5A 3U6IA 4R3CA 2O3PA 4UMRA 5HX8A 4F9BA 4S2ZA 3RWQA 2JDSA 3WZJA 4OTHA 2YIYA 3DFCB 3WF8A 2BRNA 1KSWA 3F5XA 4FKTA 2BTRA 2PVYA 4RIOA 4X2GA 3KF4A 3ORTA 5E8ZA 2VGPA 4FICA 3PPJA 1APME 3GQIA 2BDJA 3QTIA 4ACMA 2C1BA 3UMXA 3PA3A 1FGKA 1ZMWA 2HZNA 4FUYA 3MA3A 4WBOA 4R