4CV8A

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
279
structure length
255
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 255
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cv8A01
3RMFA 5J7HA 3O96A 4ASXA 5HG5A 4O7VA 4CMUA 3WILA 1AQ1A 5FP6A 3DS6A 3ZEPA 3KVWA 3PPJA 3SLSA 3MN3A 3AC8A 2O65A 3WF8A 3GFEA 4JT3A 4WHZA 1ZXEA 5AUXA 5JQ8A 5LVNA 4WNMA 1T45A 2HXQA 2JDSA 3ATSA 4D2TA 3VS4A 4YZMA 1OI9A 2J50A 4BDDA 3ACJA 3ZEWA 2XNOA 2C0IA 5GJFA 4NIFB 5D7AA 5F9EA 2REIA 4J96A 2OJ9A 2ITTA 4ANMA 4AX8A 4KIPA 4GU6A 3RK5A 3ZMMA 3JS2A 1WMKA 1JPAA 2UUEA 1P5EA 4TXCA 3GT8A 4PTEA 5IA5A 4OAUC 2ZJWA 5BNJA 4TYEA 3OP5A 3QD4A 4FKQA 4HCUA 4RC2A 4CQGA 1GAGA 4E4LA 5CQUA 3T8OA 3ZUVA 4YO6A 1UU9A 2YCRA 4TY1A 5CQWA 3RWPA 4BRXA 2BKZA 2IW9A 4MX9A 4CCUA 3JPVA 2WTJA 4GT3A 4ZSEA 3R0TA 3ULZA 3G15A 4NW5A 4G3CA 3KK8A 4KIKB 3EZVA 1Q8WA 1SNUA 1YXSA 4ANQA 4YURA 4JX3A 2QVSE 1A06A 2J2IB 3PSBA 1OZ1A 4E26A 2UZEA 2DWBA 3ZHPC 3PJ3A 3QZIA 4Y95A 4ORKA 5ANDA 3OBGA 3RHXA 4O83A 3A7JA 2CKQA 2IVUA 2PK9A 3TNIA 2RG6A 5CU3A 3QKMA 4QPMA 4EHEA 3LXLA 3NEWA 2YDKA 4H3QA 1H26A 3MDYA 5JFSA 2FSMX 2HK5A 2CJMA 1LP4A 1SNXA 3HVCA 4CFUA 2PMOX 5JEBA 4O0WA 2FSLX 4R1YA 3DLZA 3WZKA 5CXZA 3CKXA 2HZNA 4G6OA 1XHAA 4ALWA 4D55A 3KXGA 3TM0A 1U4DA 2OBJA 4B8MA 3RVGA 4USDA 4GG5A 3V8TA 5HIEA 3SA0A 4EOKA 4RJ3A 4D1XA 4LGGA 5DEYA 4CTBA 2HZIA 2C3IB 4ACGA 3D7TA 3DDQA 4Y83A 5HBHA 4A7CA 1NVRA 4JAIA 4BIEA 3NVMB 2ZV8A 3KMMA 2YIRA 4MYGA 5G6VA 2G2FA 3AGMA 4EZ5A 3KCFA 3FYJX 3FLSA 1YXXA 3DJ5A 4YJTA 4R3PA 5J1VA 2PVKA 2YDIA 5D9HA 4E6CA 2CPKE 1JOWB 4O6LA 2F2UA 4D2RA 3DGKA 5I9WA 2W1GA 4UX9A 5E8SA 2OGVA 2Q0BA 3PTGA 4GG7A 5CSVA 5CS6A 5LARA 3W2OA 4RIYB 5FTGA 1P4FA 2VN9A 3ZO3A 2RFSA 3ALNA 3FC2A 3MTLA 4IQ6A 4UYNA 4HGTA 3RAWA 2WMVA 3VJNA 5HVKA 2XJ1A 4XX9A 2YACA 4NU1A 2ITPA 3KULA 3Q5IA 4CKIA 4WIHA 4RLLA 3G5DA 5FEQA 3ORZA 3FZRA 5HOAA 3R8ZA 4DH7A 3KK9A 4ZSLA 2J0JA 4FKVA 4M69B 3LHJA 2XK8A 4MCVA 4BBMA 2JKOA 3GFWA 3NUAA 4RFMA 3NZ0A 4WT6A 5L2WA 4NWMA 3O17A 3EQRA 3MA6A 4YPDA 4ASEA 4EQUA 4IX3A 3R9RA 3QRKA 3GVUA 3DK7A 3SHEA 4AT5A 2IWIA 2OIBA 3OXZA 4IBMA 5DYJA 2WB8A 3KCKA 4X0MA 3VQHA 4R7BA 4LI5A 5CWZA 5F1ZA 5F94A 4BCIA 5A4LA 4PQNA 4D4SA 1DS5A 1IR3A 1OL5A 2XH5A 5EQPA 4FEQA 3UG1A 5KX8A 4OBQA 5HCXA 4GRBA 1ZLTA 3R2YA 4PNKA 4FTUA 1GY3A 4CLIA 3MY1A 3QZGA 1UKHA 1URWA 3GC9A 4I41A 4FZ7A 4L52A 5KMNA 4I94A 4LL0A 1JKLA 4N4SA 5HGIA 2BHHA 4QP3A 3P86A 2QOOA 3I81A 1UNHA 3EFJA 3NYXA 3PJ8A 4JIKA 5AV0A 4NKSA 1NVSA 1B38A 5F20A 2KULA 5L3AA 1YOLA 5DBXA 4H1JA 5DR9A 2WU7A 3D9VA 5IZFA 1TQMA 4A9TA 4ERKA 2PTKA 3VF8A 3BHYA 4C02A 3LQ3A 2C47A 5IA0A 4MF0A 3HRFA 3U51A 2XEYA 4F63A 2QLUA 4KB8A 4TT7A 3ZSIA 4LMUA 5JMSA 3TTIA 1PMEA 5HICA 2PVMA 2BALA 3PJ2A 4RBLA 1JSUA 1Q97A 3GUBA 3FDNA 2BIYA 3LM5A 4V05A 1H0WA 3VBXA 4XP3A 4GS6A 4RJ8A 4FL2A 4DT8A 1CTPE 2OSCA 5LMKA 3OMVA 4GK2A 5CAVA 4XNEA 3D5VA 4I3ZA 4JG8A 3TIZA 5CVGA 3FQSA 4D0WA 3KRLA 2HW6A 4CEGA 4E6DA 4XLVA 3G0EA 5GIPE 1YHSA 1PF8A 4PV0A 4YJOA 3BLHA 5HVYA 4ZSJA 1WZYA 3OCBA 1ZMUA 3ULIA 1ATPE 1KOAA 4F08A 3MPTA 4BCKA 1M7QA 1OL6A 3EQBA 4WD5A 2XS0A 3II5A 4NKAA 2C6KA 5CU4A 4MD8E 4CRLA 2XK7A 2ZM1A 2YFXA 2YCQA 4E3CA 2BZJA 4WG5A 2JIVA 4EHGA 4I0RA 4IACA 5CF6A 2WTDA 5DR2A 4DHFA 3NUUA 3AC3A 4HVDA 5M08A 4ANNA 4YTFA 3MV5A 3IW7A 3UE4A 1BI8A 3LXKA 2GQGA 4PDOA 1BX6A 4IVAA 4Z3VA 1GJOA 3NW5A 4M84A 3CP9A 4JRVA 1M2PA 3PE2A 4EKKA 3SRVA 3R2BA 3WYXA 4E6QA 1REKA 2YITA 4N0SA 4JDJA 4DG2E 1J7UA 5AJQA 3R63A 2WTIA 3QRUA 3ZBFA 4EZ3A 4I23A 5E8YA 3V5JA 3HAMA 2LAVA 3U87A 4ZMFA 4FV0A 2VX0A 3BYSA 3ZC5A 4I6BA 1UU7A 4E4NA 5AUUA 1M2QA 4I20A 5E1EA 4RX8A 3POOA 2ITXA 4NUSA 3DXQA 4IH8A 4G9RA 2OZOA 2HZ4A 3MB6A 4RRVA 4U79A 5FDXA 5HTCA 3QUDA 2WIPA 4BKYA 5DLSA 3TEIA 2ZYBA 4FSRA 3OW4A 3TTJA 3SAYA 2ERZE 2ITUA 1G3NA 5KHXA 1UNLA 3DFCB 1SVHA 3U4UA 3ANRA 3QXOA 3RALA 4L43A 4EOSA 4LQMA 4EH8A 5IKWA 1H8FA 1UU8A 3VBWA 3Q3BA 3HMOA 3W2RA 3SOCA 4FVRA 3RTPA 5JFXA 2BRGA 5EM6A 1F3MC 2ZDUA 4JNWA 4I6FA 4YTIA 3OS3A 5ACKA 3R9OA 1Y8GA 4A4XA 3MY5A 2B9JA 4NM3A 2PZPA 2HWOA 5L6PA 5JZNA 2PVFA 1H4LA 4A4LA 4A9SA 4II5A 3PA4A 3G6HA 4D9TA 4G6NA 3QD0A 1OMWA 4PP9A 3A4OX 2C3KA 4ASZA 4YSJA 4MQ1A 4BCHA 4EHZA 4D4VA 4DBXA 4H3PA 3OXTA 1XO2B 4XG8A 5DNRA 4PDPA 5HLNA 3OOMA 3PXFA 3IDBA 4YJVA 2Z8CA 2WMXA 3KF4A 3C50A 3H4JA 4YUQA 4KUJA 4OTPA 4APPA 3DAKA 4L53A 4V01A 2UW3A 2H6DA 2VTJA 4L9IA 3RCJA 1XR1A 3IGOA 4I0TA 4FTIA 4AT4A 4DT9A 4PP7A 2GPHA 1ZZ2A 2Y9QA 3UVRA 3ELJA 3V6RA 4YMJA 3OXIA 5IMEA 4JR7A 4EZ7A 5M57A 3LXPA 4FEWA 4IW0A 2VWIA 2VTOA 4FT9A 3O0GA 3EJ1A 4F70A 1DM2A 1Q41A 3FLYA 3HL7A 4BCOA 5BYYA 3MFRA 5IG1A 4FNYA 2WOTA 3ZM9A 2QLQA 1WBPA 3ZXZA 3R8MA 4XG9A 4DEGA 3PVWA 3M42A 3R9HA 3C5UA 3VF9A 1PKDA 2YLFA 3K5UA 3ZRKA 4F0FA 3JXWA 3ZZEA 3FI8A 3B2TA 4HGSA 3D2KA 4B6LA 5E8UA 5HO8A 1EH4A 5DHJA 5HG7A 4FTCA 2E9VA 2ESMA 3S1HA 5IQHA 2GMXA 4KNBA 5LOHA 4MWIA 5EI8A 5L8KA 4AT3A 3HV5A 4TZRA 1LPUA 2X4FA 3COHA 4EQMA 5IH5A 3ALOA 2GS6A 5J79A 5ACBC 3OUNB 3O7LB 4FV5A 3N4VA 3H0YA 2V55A 4BCNA 4BDAA 2WMQA 4Z7HA 3EN9A 4TWOA 4EH7A 5EDPA 3RK7A 4B99A 3VBYA 4FE2A 4P2KA 5I9UA 3HRCA 1IASA 2OKRA 3OWJA 2ZM3A 3VIDA 3GC8A 3QF9A 3VS6A 2NP8A 3OHTA 1YWVA 1O6YA 1DAWA 1PXIA 4IWOA 5LJJA 2CGXA 3SG8A 5HIBA 2G2HA 2RSVA 3A62A 5JGAA 5IMXA 3W1FA 1QPDA 2VTLA 1G5SA 3PFQA 3F3VA 4FTQA 4RA5A 5AADA 4DTBA 4IAIA 2YM8A 2YM3A 3FZPA 3LCTA 4LOOA 3L9NA 3LFEA 4N70A 3VO3A 4OGRA 2AC3A 5IEXA 3PP0A 4XG3A 3DCVA 4EUUA 4Z16A 1YXUA 3UVQA 2FO0A 4HVIA 1XBBA 2WMWA 4DGNA 2YHVA 4DH8A 3SG9A 4JQ7A 2P3GX 4AOJA 3EYHA 2HIWA 2GHGA 4XUFA 4CV8A 4IVCA 5GJGA 2IZTA 3A99A 3D5WA 4K8AA 2JFLA 4O96A 4OTGA 4DEBA 4ZEGA 4ZY6A 4G16A 4FNXA 3MPMA 4QPSA 3W18A 2H34A 5TR6A 3A7IA 2HZ0A 3FMEA 5K3YA 2FH9A 2RF9A 2QG5A 3EQIA 3ENMA 3HV6A 4G9CA 5I3OA 3ZOSA 2Z7RA 4DG0E 4EH2A 1DI8A 1S9JA 3I5NA 3NDMA 4CLJA 3OWPA 3N4TA 2UW5A 3LJ0A 3OVVA 4O0SA 4HYUA 2OF2A 2R3PA 3ORTA 3D83A 3D5UA 3DQXA 4CT1A 2VWWA 5CAPA 3NNUA 2OF4A 4JR3A 3VS2A 4FG9A 2ITWA 5EH0A 4MXAA 2ITVA 1GIIA 2WTKC 3Q6UA 3LZBA 5IQIA 4GIIA 2V7OA 3MYGA 2EXCX 3B2WA 3PG1A 4Z55A 2E9NA 3E3PA 4LRJA 4MXYA 3R8LA 2B55A 4HGLA 4EK3A 4IDTA 2F2CB 1JAMA 1Q62A 4G5PA 4PPBA 4RWKA 5HTIA 3CQEA 4YLJA 1PY5A 3OCSA 1ZOGA 4X2KA 3Q4ZA 4YHTA 3VAPA 4GV1A 4PY1A 3DJ7A 3UIUA 4USFA 3BX5A 2BTRA 2OH4A 4G6LA 4WNOA 4O82A 2GNJA 4AN9A 4UYAA 4PL4A 5EHYA 4PMPA 2QURA 5KBRA 3E7OA 4NFMA 4F65A 2C6MA 2E2BA 1CKPA 1H27A 3GCQA 3KY2A 1P4OA 4QMPA 3ZO2A 2J0MB 4IAKA 2UZTA 4KSPA 1YI3A 2XK6A 3GB2A 4IJ9A 4XV2A 3IOKA 5FM3A 3WIKA 5IISA 2XJ2A 3OFMA 4F7NA 2IZRA 3UC3A 3NYNA 4HW7A 1YOMA 4UWYA 3R73A 5AR5A 2R3GA 3TL8A 3ZRMA 3U6JA 3CPBA 2V7AA 3TV4A 2A4LA 3UODA 1RQQA 1RW8A 2QO2A 5AR7A 4UN0C 2GS2A 1XBCA 4BDIA 3M1SA 2BRHA 2PUNA 4U81A 2UVXA 3L8VA 2P2IA 3O50A 4D1ZA 2WTKB 3V51A 4X21A 5K0XA 2ETMA 3O71A 4W8EA 5GIOE 1JBPE 1PYEA 3BWJA 3TIYA 1OL2A 5IQDA 4RVTA 1ZWSA 5LCJA 4EH5A 2OI4X 2QOKA 4CQEA 4CXAA 3KXHA 4X6QC 4U40A 1OPKA 4IX5A 4XHKB 2ZDTA 3O2MA 1YDRE 3OTUA 3O8UA 3QHRA 1R1WA 4JBOA 2RL5A 3MH3A 4MHAA 3ZLXA 4F1OA 3OWKA 3QTQA 4FYNA 4X2NA 3R28A 1MUOA 2BHEA 2OWBA 3DBQA 3LCOA 1FMOE 5HIDA 2EB2A 3N4UA 3RPYA 3FXXA 1NY3A 3WF9A 1KV2A 3WZJA 4BZDA 4ZJVA 3I6UA 3CTHA 1FVRA 1XH4A 2W1EA 5DE2A 5L2TA 2ZM4A 3WARA 3IDPA 4AFJA 1XH8A 2UVZA 4AOIA 2DQ7X 4ID7A 5H3QA 4DFUA 2FA2A 2YERA 4U3YA 3Q6WA 2JLDA 1JKSA 3ENHA 3NYOA 3W8QA 2JGZA 3F69A 2VAGA 3R1QA 1CDKA 4BZNA 1DAYA 2YCSA 1H1WA 3HDMA 5FBOA 3WZUA 4BZOA 4UMRA 4DGMA 2PYWA 2JIUA 2JDVA 3IO7A 4BDHA 1MRVA 4DN5A 5JQ5A 1Q8ZA 2C0OA 4DA5A 3NAYA 5JKGA 2C6EA 4RG0A 2PMIA 5LVMA 1J7LA 4ENXA 4G3FA 4B0GA 4N57A 3TV6A 1XQZA 5FEDA 5FXSA 2PHKA 1PJKA 2BCJA 3BHVA 3Q4CA 4IB3A 4C35A 4EUTA 5A6OA 4CKJA 3RNIA 4GSBA 1V0PA 3DT1A 3FI4A 4FG8A 1VZOA 5C8KA 2BPMA 3P7BA 1FGIA 4KABA 1R39A 4GL9A 3GGFA 4NT4A 5A6NA 2YJSA 4DYMA 5AP7A 2DS1A 4L6QA 4R6VA 4FGBA 4BIDA 1UKIA 1K3AA 4BDJA 3FE3A 5JRSA 4OAVB 3GC7A 3BGZA 3UZPA 1PRYA 3TV7A 2OIDA 2XKEA 3F61A 5EK7A 5CEKA 1QPJA 4BBFA 4NYEA 4FTMA 4LM5A 5HNGA 3PUPA 3EOCA 4RC3A 4F6UA 4BFMA 4L3PA 3ZLWA 4FKPA 5HNIX 3ZC6A 1GZ8A 3QQFA 2PE0A 1PHKA 4KBAA 3UVPA 4UZDA 2XIYA 3UQCA 4XJ0A 1I09A 3R1SA 4DH1A 1IAHA 3KA0A 4AW1A 1YXVA 2YAAA 4IXPA 4BWPA 1KE8A 3DPKA 3CJGA 2CDZA 2ERKA 3LJ1A 4P90A 2YM4A 3Q60A 2JKKA 4EOOA 5IH4A 2OFVA 4QYYA 3GOKA 3ID6C 3TT0A 4X2GA 4F99A 4MXOA 4HJOA 4ZZNA 5HLWA 2E9UA 3U9CA 2Z7LA 5HQ0A 4BYIA 1O6LA 3ROCA 3RINA 4DFXE 4U45A 3R04A 4BKZA 1FVTA 4FR4A 2A0CX 2YA9A 5H8BA 4BVUA 4C36A 3HDNA 3NCGA 3ZSHA 4FNZA 1ZOHA 1YW2A 3V04A 3B8RA 1LR4A 4J53A 1Y6AA 4DH3A 4C4FA 5M06A 4C58A 1OIYA 1B6CB 4JG6A 4P5ZA 5AUWA 4HOKA 4PL3A 3P9JA 3UOHA 3OBJA 2VU3A 1Q8UA 2GU8A 2OW3A 3NR9A 4GH2A 4YSMA 1KE5A 3BV3A 3T9IA 2XIXA 4BWXA 4QMMA 3HV4A 3LFBA 3ATTA 5CALA 3ZONA 4DC2A 4GMYA 5E8ZA 3DV3A 3S00A 5BQ0A 5J9ZA 4D0XA 2EVAA 2V62A 3DKGA 5T68A 2GQSA 4C3PA 4I5PA 4PRJA 1WVWA 2VRXA 3E5AA 2AUHA 3E92A 3LFFA 3CS9A 2WHBA 3CY3A 3DK3A 3ODZX 3QTRA 4FV1A 4ZS0A 1H00A 5B2LA 2PE1A 5L4QA 1FVVA 2ZMCA 3IS5A 4U6RA 4A07A 2XNBA 4L46A 2X39A 2JDOA 5J8IA 3QLGA 4O7YA 2JEDA 1OIQA 4XYFA 5D11A 4BB4A 1URCA 4YGAA 4IAYA 1X8BA 2X2MA 3BBWA 4RGJA 3TZ9A 2XK9A 2VTTA 5HBJA 3LMHA 2F57A 2Y7JA 5IEVA 3A8XA 1R0PA 4XP0A 3MB7A 2QU5A 1JLUE 3R7YA 3PJ1A 4AGCA 1J1BA 5KMKA 3KQ7A 5AM7A 3EB0A 3FKNA 3UC4A 4K18A 2XVDA 4PMTA 2W4JA 2XRWA 2ZV2A 4I4EA 4JAJA 5IUIA 2VNYA 3TWJA 4B7TA 4NSTA 3RJCA 3F5XA 3CQWA 4ZTMA 5H2UA 1M7NA 4YJRA 4MH7A 3BYOA 4D1SA 3PXYA 3M2WA 2ZOQA 4ANOA 1CSNA 1G8SA 4JJRA 4QTCA 3KRXA 4L01A 1J3HA 2WMSA 3PE1A 5CNOA 2WQBA 4QD6A 3TZ8A 2I0VA 5DT0A 4EBVA 5TF9A 3G6GA 4GEOA 4GIHA 1TVOA 4JQ8A 5E9EA 3UIMA 2IZUA 4R5YA 4D2SA 5AEPA 4EH6A 4AWIA 1WFCA 3A60A 3G33A 4ZMEA 2W1IA 5A3XA 3R7EA 4TNDA 2C5OA 4EORA 3DBDA 4A9UA 4KRDA 4M66A 5DA3A 1SMHA 2QG7A 4IFGA 3ANQA 1Q3WA 4NTTA 5HO7A 5EDQA 5F4NA 4DGOA 2QOHA 4JG7A 4H1MA 4IDVA 3C13A 4CFNA 1GZNA 3OW3A 2R64A 3ZFYA 2UZDA 1PMUA 2C3JA 4Q2AA 4WBOA 1GOLA 2VWUA 5FLFA 5HX8A 3SGCA 2J5FA 2OG8A 4ZXTA 5HO6A 3UQGA 2W4KA 2GTNA 3V5TA 4CSVA 4UMPA 3P5KA 5CSXA 1PXKA 3BI6A 3C0HA 3PPKA 3MFTA 5IUGA 3I5ZA 3FI2A 3PSCA 4Z9LA 4D2VA 3FZTA 2IW8A 4OTIA 3DAJA 1KOBA 5CXHA 3UNJA 2P2HA 2XBAA 4LMNA 3BHUA 4PF4A 4K2RA 5FGKA 3TUDA 4RVMA 3IW6A 4J98A 2SRCA 3KMWA 3MIYA 5M44A 3PRFA 2UW8A 4J7BA 3D5XA 3FLNC 3BCEA 1H1SA 1BKXA 3C4FA 2P33A 4C61A 4EJNA 3TUBA 4KA3A 4OW8A 3FQHA 5EM7A 3EL8A 5EW3A 4TTHB 3RK9A 3WF5A 3G2FA 2FYSA 3DZOA 2I0EA 5CSHA 3Q2MA 1L3RE 2HXLA 4FSWA 3IQ7A 1M14A 3UOJA 4GFMA 3QTUA 4ZZOA 4DFZE 4AE6A 3V8SA 5KMMA 5M07A 4DEDA 4AGWA 4QTAA 1ZYCA 4AN3A 3FLWA 5M4UA 4AAAA 4EK6A 1PXPA 3O7LD 2ZB1A 4HCVA 4FI1A 4XG2A 3LCDA 3C7QA 4NCTA 4C59A 1ZYSA 5LVOA 1QPCA 3UP7A 3SVVA 3FZOA 5KZIA 3QBNA 4ACCA 2R3MA 3PA3A 1WAKA 4F1TA 2ONLA 3V5LA 3C4WA 5AUYA 4BI2A 2PPQA 5CNNA 4IC8A 3TCPA 4BBEA 4FIJA 2BIKB 1MRUA 3OROA 3QGWA 4MTAA 4C3RA 5HTBA 4C34A 4R1VA 4U43A 4MBLA 3DJ6A 3FUPA 4FICA 5CF4A 3EQGA 4M13A 4W4YA 4FT3A 5CEQA 4TRLA 4FYOA 3KGAA 4IADA 4M67A 4M15A 4MD9E 1CKJA 4BDBA 4DTKA 2WZJA 3FZ1A 4BCMA 4IAAA 4NTSA 5FTOA 5IQEA 4WNPA 3MVLA 1ND4A 2RIOA 4X3JA 5K5NA 3A8WA 3PXKA 3W2PA 3R21A 3HP2A 4IE9A 5EKOA 3VULA 2J0IA 4M14A 5GZ8A 5HG8A 1UV5A 3FMLA 3E93A 3TN8A 3UIXA 3GU7A 4DEAA 4EK5A 3TG1A 3D2IA 4DE4A 4FTNA 4RX9A 3DBCA 4IC7A 3KRJA 2Z2WA 4LOPA 5HI2A 4TL0A 5FXRA 4G17A 4CFXA 2PVYA 4LOQA 4RWIA 5EOLA 4R3CA 5EW9A 4F9YA 3KFAA 5EHOA 4F1MA 5JFWA 4OBOA 4XMOA 2YLEA 3BHTA 1M17A 4BHNA 3U8WA 5L2SA 2WELA 3GU6A 4BCGA 2VTAA 2B9HA 2Y6MA 4GVJA 5L2IA 2OICA 5CTPA 5IQGA 3KC3A 1QPEA 3QYZA 4DFYA 4O0YA 4ZTNA 5DMZA 3VS5A 5JGBA 2CKOA 2X8IA 5C9CA 3EN4A 1PMVA 4DFBA 4XBRA 4FV6A 1W0XC 2IZSA 3BU6A 2QOBA 2UZLA 4Q5EA 4R7HA 3UIBA 4BTMA 5C4KA 2JDRA 5C01A 3BLRA 4QTDA 3UOKA 3L8SA 2YM6A 4QMXA 5I4NA 4FZAB 5K9IA 3NUNA 4XV9A 3C0GA 3W2CA 3KXZA 4EC9A 2PU8A 2VX3A 3BQRA 3KXMA 3PLSA 4QTEA 4JXFA 3Q5ZA 4H39A 3P0MA 2OFUA 3LFNA 4K77A 3PDTA 2IG7A 4RVKA 1W7HA 4KKHA 4FTRA 5L6OA 4C3FA 1FQ1B 1E1VA 3FBVA 5LCKA 3WZDA 3BE9A 3WF7A 3A7HA 2JC6A 4RWLA 3AOXA 4QQ5A 1Q61A 4ZS4A 5CZHA 3VN9A 4A9RA 1NW1A 2HAKA 5FTQA 4WG4A 2QOCA 3W2SA 4FEUA 2PE2A 3QCYA 4L3JA 5AR8A 4XG7A 3N9XA 3QUPA 5J95A 4DTAA 4FSTA 4J71A 2HWPA 4D2WA 3BU3A 2VO3A 2XUUA 1JKTA 3ZZWA 3Q4TA 5D1JA 2XRUA 3IOPA 3KKVA 4HVGA 5KHWA 3NSZA 4OTQA 5I5ZA 2JKMA 3IG7A 4CMTA 4ASDA 4BL1A 4UWBA 3FAAA 3QFVA 1JQHA 5L2QA 3I60A 4NCTC 4CZYB 4EH4A 4YLKA 5AM6A 3DNEA 3JY9A 3ZS5A 4ACHA 1OKYA 5BVOA 3VBTA 3FMHA 3MBLA 3QWJA 3B8QA 4UMTA 3DLSA 2W9ZB 4C4JA 2GFSA 2VUWA 5E92A 1U54B 3ORIA 4XG4A 1YI6A 2YABA 4QT1A 4E7WA 4O0TA 4JDKA 2QC6A 4QQJA 2Z02A 3NVKI 4PDSA 4FZFB 4QMUA 5LMAA 2C0TA 1J1CA 2WQMA 4D2PA 1J91A 4QO9A 4EKLA 2RFDA 1L8TA 5K4JA 3I4BA 4HCTA 4YHFA 3W33A 3BQCA 4M0ZA 1H28A 3U6HA 5DFPA 4ZP5A 1IG1A 3FI3A 2Y0AA 4OTFA 2Y4PA 4RA4A 2J5EA 4FX3A 1OECA 3UTOA 4OTHA 5DG5A 3NS9A 4GUEA 3TACA 3DAEA 3RP9A 2O2UA 3QLFA 5IQCA 5CYIA 3HA8A 3KMUA 3LCSA 4PUZA 3QQGA 1OITA 4TN6A 3RKBA 2YDJA 5B2KA 3KULB 5EKNA 4DGLC 3F3ZA 5HE1A 4QMWA 2B52A 5I9YA 4QYGA 1G8AA 1OBDA 4X3FA 3U55A 3UJGA 3R22A 4F0IA 3QQHA 3ORMA 4WO5A 4GYGA 2W5AA 4WUNA 3HLLA 4ZTRA 3SW4A 5E1SA 3EN5A 3AMYA 5HCYA 2G1TA 4ITJA 5AAFA 4C62A 4O21A 5BUEA 5IQBA 1HOWA 3SC1A 2AYPA 4S30A 4ZSAA 1W83A 5LMKC 2ZMDA 1VYWA 2PMNX 2VX1A 2V5QA 3E87A 4RJ6A 2RFNA 4FTKA 5C27A 5LWNA 1WVXA 3F9NA 3FY2A 5CT0A 2UZNA 4YBJA 5E90A 3FWQA 4C33A 2QO7A 3DDPA 3R71A 5TO8A 4R77A 2F9GA 2BUJA 3NUYA 4J99A 4LL5A 4QYEA 3VUTA 4RPVA 3NUPA 4MBIA 4V0GB 5CANA 4LRMA 3H9OA 5ETCA 3SW7A 3MVMA 5FP5A 3MFUA 3QD2B 2VNWA 3L1SA 5CX9A 1W98A 4FV7A 2YEXA 4I24A 3TNHA 5C4LA 3G9NA 3GNIB 3FSFA 3WOWA 3BV2A 2UW9A 5GZ9A 3LXNA 3D7ZA 5KKRC 3OT8A 1PYXA 4G1WA 4G34A 3VBVA 1UWJA 3R9DA 4FKTA 4KWPA 4AA4A 4CVAA 5HE3A 2OH0E 2PVJA 3CKWA 3W55A 1MRYA 3EQDA 5E8TA 4F9WA 3DB6A 2XCHA 2Y4IC 2WTWA 4I5CA 3VQUA 3BYMA 1FMKA 2YAKA 3GC0A 3PXQA 1QL6A 1V0OA 3NW6A 4JQEA 5FWKK 3ZTXA 1YDTE 4L00A 2Y8OA 4RIWA 4HYIA 3WE4A 4EQCA 4F6SA 3R8UA 3C5IA 2W96B 4H05A 3NLBA 3DBFA 5AUZA 5HE2A 3OUKA 1SVEA 2X2LA 2YIQA 3DA6A 5I9ZA 2R7BA 2X8DA 4A9YA 2C6LA 3S4QA 5G1XA 4GVAA 3Q9YA 4IVBA 4K11A 4FT7A 5B7VA 1SYKA 5JN2A 3LE6A 4H3BA 4IZYA 3BYVA 5L8JA 3C4EA 2WQOA 2H9VA 5DT4A 3AC5A 2W0JA 5B0XA 3VVHA 5HU9A 4F9AA 3Q32A 3H9FA 3N51A 3FMMA 3AMBA 4AN2A 4D5HA 4G31A 3R7VA 4X6RA 2WKMA 5AP5A 3DOGA 4BTFA 5CF8A 3OC1A 1WBWA 4JBQA 4UEUA 2QOIA 3VHEA 5KKRB 3R7IA 2IVVA 1UU3A 4ZJJA 2RKUA 5CVHA 4EWQA 4OTRA 4E1ZA 2C1BA 2VWZA 5BMSA 3PPZA 1XH9A 3SDJA 5AUVA 5TKDA 2R5TA 2A2AA 3HA6A 4O84A 2EUFB 4QP4A 3ZFXA 1OKWA 4I93A 4E5BA 2F49A 2B9FA 5DGZA 2C4GA 3SQQA 3AGLA 4UY9A 4Y8DA 3SRVB 2R3NA 2OK1A 4YPSA 3MWUA 4DEEA 2W1HA 3ORLA 4FV8A 5ANIA 5I3RA 3DU8A 4P4CA 4CFVA 1AD5A 4IHPA 3ZO4A 2YZAA 4KIOA 4Q9ZA 2I7QA 5ANOA 4FF8A 4DG3E 3LOKA 4CYJA 4X3FC 4NM0A 2R3FA 4FEVA 3F6XA 3AD5A 3POZA 4NFNA 3Q4UA 4GJ3A 4ALUA 1BL7A 2B1PA 1KWPA 3AC1A 5KMIA 5A54A 5BVEA 5FM2A 4RJ4A 1PKGA 4O0RA 1MQBA 3LMGA 3R1YA 1XH5A 3BHHA 3PVUA 3QCQA 3U9NA 2IO6A 1AGWA 5J1WA 2UZWE 2XM9A 2I0HA 2VGPA 3JY0A 4LRKA 4RWJA 5C26A 3EFWA 5M51A 3W8LA 3MI9A 4CFWA 2BRNA 2CN8A 4JDIA 5CAOA 2QOLA 2PUPA 3QYWA 3DNDA 4MNEA 5DEWA 3TZ7A 1TQIA 3GQIA 3P78A 4UZHA 4BYJA 1O6KA 3LJ2A 4USEA 2C30A 2V22A 4P5QA 2OXXA 3D4QA 3UDBA 5A4EA 3JVRA 4FKLA 3ORKA 2NNWB 3E8NA 2WEVA 4LG4A 3QQJA 4O6EA 5LVPA 2VTPA 4HZSA 4YBKA 2BTSA 5L6WL 4AE9A 5AIRA 4RZWA 4K9YA 2X7FA 4GJ2A 2R3QA 3MH2A 5TOZA 5KMLA 4Y46A 4O0UA 4BWKA 5J5TA 3MSSA 4M68A 3QGYA 4XP2A 3WYYA 4ACDA 3BWFA 4OT6A 2GHLA 3E3BX 3P79A 1IEPA 4MAOA 4W4VA 2F4JA 3K5VA 4U42A 2OIQA 4ENYA 3WIGA 2FB8A 3KL8A 2R3LA 4AZVA 4Q5HA 3EMGA 4GUBA 4F7JA 4PPCA 3HNGA 1H1PA 3OCTA 3QZHA 4U97A 5EYDA 2J51A 3C1XA 1GIHA 2ITOA 3F3TA 4OR5A 4AQCA 3THBA 2ZV7A 3CGOA 1Y6BA 4QP7A 4WG3A 3F3UA 4JBVA 3PJCA 2BMCA 3EZRA 1ZRZA 2UZVA 4JDHA 4ONAA 4QPAA 2W1FA 3OWLA 4IVDA 4U9AA 3V3VA 3COKA 1OBGA 2GNHA 2CNUA 1JSVA 3QTIA 3I79A 4FIGA 3R7GA 3TZMA 2OU7A 4C2VA 4QQTA 5KCVA 1VYZA 4NW6A 4RZVA 5A9UA 3CTJA 4AGUA 2PVHA 4MK0A 2R3HA 3EWHA 2JBOA 3P7CA 4RX5A 5J9YA 4E20A 3TI1A 5AAGA 3S95A 4ZAUA 3OTVA 3AD4A 4RJ7A 4YC3A 1W84A 4XH6A 3CQUA 3GU4A 2YISA 2X1NA 3AG9A 3GOPA 4O22A 3GU8A 4W4XA 3DXPA 3COMA 3OZ6A 3Q9ZA 4FKRA 4FTLA 3BEGA 3ZO1A 3GCVA 1WBOA 3BLQA 4NZWB 4U80A 4X7QA 3CC6A 1ZMVA 4MXZA 4NIFA 4I5HA 4FVQA 4KS7A 4O7LA 3HUCA 4C7TA 4EOLA 4F6WA 2LGCA 3CEKA 3MJ1A 5LVLA 4AS0A 3FMJA 3BE2A 3G0FA 3CY2A 4CRSA 3RAHA 3CD8A 3QA8A 3VUMA 5J5SA 4QP9A 4AW2A 5GNKA 3VHKA 5DT3A 4RFZA 5M4IA 3E63A 2ZB0A 5CF5A 4K0YA 4KIQA 3LLAA 5BVNA 3GCUA 2W1DA 3QTWA 5IQAA 3O23A 2NRUA 1XH6A 3LFQA 1MP8A 4M3QA 3FMDA 5AV4A 1YHWA 2UZBA 4V04A 3WZEA 4RFYA 5M56A 4KIKA 3QX4A 5BYZA 3UO5A 2PULA 4I0SA 4UXLA 2B54A 3DBEA 4WUAA 3CR0A 3VS0A 4BY9E 3MIAA 4O2ZA 4YP8A 2J0KA 5KZ0A 2XIZA 1Q24A 1WVYA 3F82A 1YXTA 5EQEA 2B7AA 3H3CA 3FXWA 1W82A 2QNJA 2ITYA 5DWRA 2BVAA 2F7XE 4FGRA 4FT5A 1H24A 3R8VA 4DCAA 1XH7A 1H0VA 3CGFA 5HD4A 1U5QA 3RAKA 4I22A 4IAZA 1H1RA 4IB1A 1U5RA 5AR2A 4UMUA 4NJ3A 4Q9SA 4XRJA 3W2QA 1UVRA 1UA2A 2PVLA 3R7UA 3UQFA 5IDPA 2PMLX 2RG5A 3DTWA 3EH9A 5IA1A 1JVPP 5HD7A 4RSSA 2VWYA 4BDEA 4AXAA 4HZRA 3RZBA 3FPQA 4FTOA 2BDFA 2WGJA 3R8PA 4DGGA 2CN5A 2WMAA 3FKLA 4M8TA 4DEIA 2YM7A 2C1AA 3GBZA 3KN5A 3QX2A 4M0YA 3FXZA 4X2JA 4PTCA 3RPOA 2XKDA 2HOGA 4DITA 3QAME 2W05A 3PY3A 2Z7QA 4BDGA 4D4RA 3PVGA 3K54A 3PG3A 5GZAA 3Q04A 3UGCA 3ZH8A 4MF1A 3SXFA 3VW6A 3KXXA 3UPXA 4F9CA 4EOIA 4DBNA 4FVPA 4U8ZA 4M97A 4LUDA 1KV1A 3O8TA 4RIYA 2CCIA 1JKKA 2C6OA 2ZAZA 1OVEA 5AV1A 2F7ZE 2PZIA 3QALE 4C4GA 2VO7A 2PWLA 3PYYA 1Q99A 5H8EA 4AW0A 5IF1A 2I40A 2BRMA 4QP2A 4QNYA 5AP4A 3NMUF 5BUIA 2CHLA 4CFFA 1ZMWA 4EI4A 2WPAA 1H01A 3RPVA 5E7RA 2X2KA 5IH6A 5AMNA 3MA3A 3QTXA 4KSQA 3E8CA 4M69A 4IAFA 4MEDA 5KMOA 1XBAA 2W17A 1OIUA 5E8WA 5KNJA 3QTSA 2W1ZA 2FSOX 5FG8A 3ZM4A 2GFCA 1OKZA 4KS8A 3A4PA 4L42A 4MNFA 4WKQA 2GQRA 1A48A 3I7CA 3HKOA 1P14A 3OF0A 2C68A 5D12A 4WOVA 5JFVA 3RM7A 4FNWA 5BYLA 2EWAA 3CCNA 3VUKA 2QHMA 3H30A 2YIWA 2EXEA 5B2MA 2VWXA 2WMBA 3PRIA 4E93A 4FK3A 3MH1A 4KRCA 4F7SA 2CKPA 4EJ7A 2J9MA 3FY0A 2G9XA 3PP1A 2B9IA 3RPSA 3ZLSA 3FJQE 4XS2A 2XBJA 3I0QA 5CASA 3UO6A 2XEZA 1WCCA 3BELA 4I5MA 5HZNA 4AG8A 3U54A 2PZ5A 4QTBA 4S33A 4YTHA 5A46A 3E62A 4QMSA 2QO9A 4I6QA 3ZUUA 5K5XA 4DH5A 4G3GA 4BICA 3VUHA 3LKMA 2UW4A 2FSTX 2J90A 3FLZA 3NNWA 2J4ZA 4AW5A 5BUJA 3EQPA 2RFEA 3MESA 4IEBA 4C2WA 5JGDA 4C4HA 4MKCA 4PX6A 2OJGA 4O1OA 5AR4A 2XNNA 3UNKA 2B53A 2CGWA 1OIRA 3BKBA 3GEQA 3R01A 4L68A 4IJPA 2BFYA 2O8YA 1IA8A 3BBTB 3QQLA 2GNLA 3VUIA 4XOYA 1FGKA 4XCUA 4WBBB 4RIXB 4AU8A 1YVJA 2GNIA 1A9UA 3KREA 4C57A 4YU2A 4M12A 4BC6A 4ZSGA 2I0YA 1GZOA 3TKUA 5IA4A 5HKMA 3RBWA 4BGQA 4O7ZA 5ICPA 5CSPA 1ZYLA 4C8BA 4IIRA 3UNZA 3PY1A 4FTJA 5CU6A 1YI4A 5DH3A 2X7GA 4FKIA 5ANEA 3LQ8A 4FIEA 4ZY4A 1OL1A 4FKWA 1PXLA 4QMNA 3QRIA 1P2AA 4ZY5A 4K33A 4X2FA 3IW8A 3WE8A 1YHVA 4P7EA 2YN8A 1OM1A 5IEYA 4KINA 5CVFA 4WSQA 3UMWA 1MQ4A 1PXJA 2EU9A 3KRWA 1F0QA 4JLCA 3F7ZA 3ORNA 3QC9A 2BR1A 1PW2A 4IZAA 5FD2A 5A4CA 5KUPA 4BCFA 2UV2A 4BDFA 4Y72A 2W1CA 1TKIA 5GHVA 4WRGA 4N6YA 3UYSA 3V8WA 4EYMA 4O1PA 2C6TA 5JT2A 2WMRA 4S34A 4O7WA 2IVSA 2UW0A 4U3ZA 3F88A 5E8XA 4EBWA 5CAQA 4E5WA 4CG8A 2GS7A 2VTSA 3L8PA 4AZEA 1ZAOA 2BZHB 5BVWA 3FKOA 5CEMA 2IPXA 2CLXA 4FC0A 2XF0A 1YWNA 4PNIA 4PMSA 2BDWA 5D10A 5IA2A 3DQWA 4MD7E 5CU2A 3TJDA 3V6SA 1OPJA 4OUCA 3LVPA 4HYHA 5EG3A 4LGDA 3RWQA 4L44A 2C6IA 2CGUA 2JBPA 2PZYA 4M7IA 4OBPA 1FPUA 2VTRA 2XYUA 3E8DA 4OTDA 4FSUA 3VWAA 4DLJA 5EI2A 4XG6A 4TYHB 4CG9A 2QD9A 2H8HA 3F3WA 1TQPA 1VEBA 3FLQA 3HAVA 1SM2A 2QQ7A 3QRTA 4FIIA 4BTKA 3DKOA 4NJDA 3C0IA 4EONA 1U54A 4FIHA 3D0EA 4FUYA 2W5BA 1FOTA 3EN7A 5HBEA 3HGKA 4QOXA 3HMPA 3HP5A 2OXDA 2C5YA 4W8DA 3UZRA 2B4SB 3K3IA 4YJQA 4EYJA 1GNGA 3CPCA 2IVTA 4GFOA 5HEZA 2VGOA 3MPAA 3IW5A 4UMQA 3OCGA 2PUUA 4MVFA 3FHRA 2O3PA 4ZTLA 2UZOA 4D58A 3BIZA 3TJCA 3QRJA 4R8QA 5AP2A 4EWHA 4BDCA 3UZTA 5FRIA 4ARKA 4DFNA 3FMKA 4O7SA 5HU3A 1PXOA 3JR1A 3PIXA 2OLCA 2OO8X 1R3CA 4IWDA 4FL1A 2DUVA 2J6MA 4WNKA 3T9TA 2QI8A 4ACMA 3AC2A 4F4PA 3E88A 3Q96A 3G90X 4TYIA 4QP8A 3KF7A 5BX0A 4I1ZA 4YTCA 2VD5A 2VTQA 5CI7A 3TDWA 5K0KA 3P1AA 4CFMA 2WTCA 5M09A 3AMAA 4ZK5A 3A61A 2X6DA 4EC8A 3HV7A 5BMMA 2CNQA 4O86A 2X81A 4EOPA 5AR3A 1UWHA 4GKIA 5AFVA 5BVDA 4JL9A 3L8XA 3ZXTA 4G2FA 3WBLA 4TWCA 4RQKA 4HNFA 4CMOA 2OZAB 2OJJA 2CCHA 1OUYA 4C4IA 3EKNA 3REPA 3ZYAA 4FKSA 2WAJA 3FYKX 3T3VA 2PVRA 4IMYA 1ZZLA 1ZY5A 3PWYA 5H8GA 2CNVA 2PUIA 4EH3A 1QMZA 3QL8A 3KXNA 4QYHA 4V0GA 2ZV9A 2X4ZA 1PMNA 4U0IA 1YDSE 4AACA 4AFEA 4ZTSA 4F0GA 3P23A 3VRZA 5IDNA 4JIAA 4YZ9A 4IZ7A 3FMNA 5HG9A 5HNBA 5DN3A 3OD6X 4HNIA 3P08A 4R5SA 5JH6A 3ZDUA 4I6HA 1ZYJA 4LGHA 5DR6A 5C03A 5DVRA 4YZBA 3JUHA 4GK4A 3H10A 3OY1A 2BROA 5BVKA 2XIKA 5J87A 2R2PA 2WNTA 1BL6A 4QNAA 3VRYA 3VUGA 3R00A 4F09A 2OXYA 2QCSA 3EQFA 2ACXA 2GSFA 5CZIA 5GJDA 3R9NA 3P4KA 3KU2A 4QMLA 2WTVA 3PSDA 5AP6A 4CT2A 5KBQA 4AGDA 2R3JA 2YWVA 2ZVAA 3CLYA 3HECA 2FUMA 3OEFX 4GU9A 4BCJA 2OJFE 1QCFA 3SX9A 1V1KA 3ZCLA 4FK6A 1OUKA 4RIOA 4FBXA 4AP7A 5F95A 3IK3A 2OJIA 2O5KA 2ITZA 3S3IA 2PY3A 3MY0A 2CSNA 3UOLA 4ZLYA 3C4ZA 3I6WA 4KD1A 3IDCA 2R0UA 3QTZA 4RQVA 1Y57A 5CAUA 4BI0A 4O38A 4ZTHA 3R30A 5M4FA 2R7IA 4ERWA 2F7EE 5AX3A 3K3JA 1KE7A 1K2PA 5H9BA 2W99B 1M2RA 4ZZMA 4JOAA 5K4IA 2BFXA 3F7WA 4IWQA 3IONA 3DK6A 3EKKA 3I7BA 1S9IA 2XK4A 3CSVA 5CENA 3EFKA 3Q9XA 2JITA 2BILB 4U41A 2W06A 4FSNA 4E5AX 4KBCA 1BYGA 1Y8YA 1M52A 3NRMA 3PY0A 3SXSA 4BN1A 4CYIA 4FKOA 5D41A 4QRCA 4K6ZA 1H25A 2R3RA 4EL9A 5I9VA 2HYYA 3CJFA 2VTMA 4BR3A 3HZTA 2BAKA 5ETIA 3VS7A 4BCPA 2Q0NA 4BDKA 5KE0A 1IA9A 1Q8TA 2ONLC 4BCQA 2WOUA 5J9LA 3LM0A 3F5UA 1YKRA 4IZ5A 4EK4A 3D7TB 4PTGA 1HCLA 2BAJA 2VO6A 4F64A 4FA2A 3KRRA 3V01A 1Z57A 2WQEA 3NNXA 4OT5A 2C5NA 4MWHA 5KMJA 3QKLA 5C1QB 3A2CA 2QKWB 2C5XA 3LFAA 2VTHA 3U6IA 1YWRA 2UW6A 4NM5A 3VW8A 4FUXA 4S31A 4NH1A 5EW8A 4GYIA 2QKRA 4W4WA 3WF6A 4B9DA 3Q2JA 4KAOA 3E7VA 2UW7A 5AA9A 3E64A 3EN6A 4S32A 2C6DA 4C0TA 4E4XA 4O7NA 2G01A 3U4WA 2NPQA 3IPHA 3BRBA 3VC4A 5CI6A 2C5VA 3QCXA 4D9UA 4NL0A 4YNOA 4FSZA 3R7OA 3A7FA 4L7SA 2XNPA 4AA0A 2WFYA 2YZLA 3F2RA 5J7BA 5HHWA 2ETRA 4UBAA 3DKFA 3VNTA 5JK3A 4IX4A 1XJDA 2QODA 4XV1A 3HUBA 5HX6A 5I0BA 2XJ0A 1KSWA 1V0BA 4EHVA 5EI6A 3UP2A 2IW6A 4PDYA 2X6EA 3HEGA 5CU0A 4DF3A 5A4QA 1PXNA 2QR8A 3WI6A 1ERKA 3ODYX 3UG2A 3G9LX 2R4BA 2FGIA 2PL0A 3LLTA 4ZLOA 2H96A 1KE6A 4BGHA 1Z5MA 3F2NA 3R83A 4JS8A 4GFGA 3ZLYA 2P55A 4H58A 2GNGA 1H08A 3MJ2A 4HYSA 4IWPA 4YC6A 3QU0A 2CMWA 3MVHA 3F2AA 1NVQA 4ZLZA 4RMZA 2XKFA 5M55A 5E4HA 3UYTA 2WO6A 2R0IA 3R02A 3R1NA 5EOBA 2CKEA 2YWPA 4DAWA 4L7FA 3PIZA 4QP1A 3RHKA 5IQFA 3DB8A 3DY7A 2VWVA 3FL4A 2HW7A 5JZJA 1H1QA 4RX7A 2HENA 2KTYA 3NW7A 3MS9A 3SV0A 4J8MA 4NM7A 5ANKA 3PA5A 3C4CA 4ZTQA 1KE9A 4GK3A 2YCFA 3UBDA 3QC4A 1Q4LA 3EHAA 3NIEA 3LQ5A 3TNPC 4FTTA 2XNGA 5DRDA 4O91A 3PLAE 3QQKA 2XZSA 3QWKA 5FEEA 4PL5A 3AT2A 4RLKA 1OKVA 2XNEA 4FOBA 3MVJA 4HPUE 4LFIA 2UVYA 1Z9XA 4FKUA 3RI1A 2QU6A 4B8LA 5ITAA 4L3LA 3OG7A 1BLXA 2A19B 4CV9A 4W9WA 4LV5A 2VWBA 5EYMA 1I44A 5FDPA 2W5HA 3VUDA 1NT2A 1R0EA 1JSTA 4ANSA 3M11A 3GCSA 4U7ZA 4JX7A 3SOAA 2YM5A 3JYAA 5TE0A 3OY3A 4O0XA 4TYGA 3BPRA 4IFCA 2WD1A 3V5WA 3FZSA 3R6XA 1RE8A 2XM8A 2XB7A 2WEIA 4U44A 3QKKA 4HGEA 2QOQA 4OTWA 1IAJA 4O7TA 1YOJA 5AV3A 4E4MA 4ITIA 2O63A 3BEAA 3FQEA 4DLIA 3BGPA 4FSYA 4H36A 2VTIA 3FHIA 3QA0A 5AA8A 3GU5A 4Z7GA 3TUCA 1KUTA 2XMYA 1VR2A 5CY3A 2XCKA 2Q83A 4DEHA 2WMUA 3HRBA 4QQCA 3EQCA 4XV3A 4ZIMA 2A1AB 2Y4IB 4JRNA 2QONA 1NA7A 4IM3A 3KEXA 4O2PA 1WBVA 3HX4A 2BKKA 3AT4A 2UZUE 4PWNA 2R3KA 4F7LA 5EM8A 5E8VA 3AC4A 4UALA 1CKIA 3JVSA 5JSMA 3TXOA 2XYNA 4IX6A 1F5QA 4JI9A 2PZRA 3NPCA 4L8MA 4ANLA 4BI1A 2NO3A 5AP0A 5HVJA 3TKHA 4AUAA 4W9XA 3HMNA 3NAXA 4DFLA 5T3QA 4K1BA 4A4OA 4AF3A 2I1MA 3W32A 1FINA 3NWWA 4JVGA 4NK9A 5FQDC 1IRKA 1UNGA 5DOSA 5BPYA 3LW0A 4GKHA 4CD0A 4LV8A 4UV0A 4QMQA 2YIYA 3D94A 4FV3A 4YZNA 4RT7A 4YC8A 5LXMA 1REJA 3FV8A 4J8NA 4LUEA 4Y5HA 2YIXA 4AZTA 5IUHA 4BKJA 3SKCA 3VS3A 3GP0A 2X7OA 4IM0A 3SD0A 3CTQA 2IN6A 2ITNA 3ZDIA 2V0DA 3VJOA 5EFQA 4WRSA 3H9RA 1RJBA 3KVXA 1CM8A 4TWNA 5CLPA 1SZMA 5E91A 5TT7A 3DFAA 3DXNA 4BIBA 4APCA 4TKSA 3C51A 2QOFA 4RJ5A 4XRLA 2HCKA 2GNFA 3UMXA 4BHZA 4YZDA 4CTCA 3IGGA 4XBUA 4FT0A 4FEXA 3P7AA 1DI9A 3VBQA 5BVFA 4J1RA 4GT4A 4CZTA 1BUHA 3HV3A 4YO4A 4CCBA 2X8EA 3QHWA 3DKCA 3QXPA 5CEIA 5KO1A 4HVHA 3ZRLA 3ORXA 2B0QA 3RCDA 1RDQE 4R7IA 4AZSA 5AX9A 4QYFA 5C8MA 3PZHA 3QCSA 3RNYA 3T3UA 4C4EA 3EL7A 5HLPA 3ERKA 3GQLA 2JFMA 4G3EA 3CIKA 4IB0A 4X3FB 3LAUA 3E8EA 3RZFA 4L67A 3IECA 3MTFA 3TNWA 3L9PA 4EH9A 3OEZA 2JDTA 2PVNA 1U46A 3ZBXA 2ETKA 3EQHA 5ANJA 2WU6A 1Q8YA 2JIIA 2A27A 5EYKA 3D15A 2P0CA 3ET7A 1K9AA 4TNBA 5CSWA 3I1AA 2J7TA 4FKGA 3MH0A 4PPAA 1OGUA 4BF2A 2BDJA 3Q52A 4O27B 1Q3DA 1STCE 4I92A 2O0UA 2JD5A 1BMKA 3OT3A 4S2ZA 5A4TA 5I9XA 5HCZA 2J0LA 3VS1A 2E9PA 1JWHA 1Q5KA 2VV9A 1E9HA 5AUTA 4RVLA 4FV9A 1CMKE 2BRBA 4Y5QA 4QMOA 5AV2A 5AWMA 2WQNA 1YQJA 1W8CA 4YNEA 3V5QA 1SVGA 4HPTE 4TPTA 2EB3A 3G51A 3O51A 4UWCA 5FXQA 4E73A 3UPZA 5DIAA 3HMMA 3LFDA 4ITHA 4AZWA 3IW4A 1WBTA 2EXMA 4C37A 1FBNA 1H07A 3EIDA 4D5KA 4E8AA 3BU5A 4FSQA 4GT5A 4JBPA 4QMTA 4XLIA 1OPLA 2FVDA 2I6LA 4FOCA 2XP2A 2CLQA 1XWSA 1HCKA 3LMIA 3W16A 3QQUA 3S0OA 3C4XA 4N6ZA 5ETAA 4RIXA 4AOTA 4DINA 4CGAA 2P4IA 3W10A 4YZCA 4FV2A 3COIA 4IB5A 4O81A 2WMTA 3L9LA 5CT7A 3HMIA 4XOZA 3UO4A 4MQ2A 5M53A 4PMMA 3FSKA 4RIWB 5EYCA 2JAVA 5C8NA 2JKQA 4EOQA 4O0VA 4YJNA 4TWPA 2GHMA 4FZDB 2C69A 3PIYA 2Z7SA 4WSYA 2E9OA 4YR8A 2VTNA 4Y85A 3ZSGA 4YHJA 1R78A 5ETFA 3NIZA 3ITZA 4J52A 3ZUTA 4UB7A 2PSQA 4CNHA 5LWMA 1JNKA 3FL5A 2WIHA 2HY0A 4TYJA 4D28A 2Z60A 2VO0A 2AC5A 5L8LA 4QP6A 2CGVA 3ZFMA 2QHNA 5FUTA 3RPRA 2W7XA 5EM5A 1GIJA 3DZQA 3PWDA 4CZUA 4MXXA 3PZEA 2XKCA 2X9FA 3FEGA 3K2LA 4FL3A 3LIJA 2YJRA 1XKKA 3CXWA 3DTCA 4J95A 3GI3A 1E1XA 4WA9A 4GCJA 2BZKB 3I0OA 2BAQA 3LFCA 3AD6A 1ZOEA 4FIFA 1OL7A 3PXZA 2BZIB 2XIRA 4CKRA 3FC1X 3CD3A 3NNVA 5AAEA 4B4LA 3LFSA 5IPJA 3QZFA 4IM2A 4LYNA 3AXWA 4MXCA 3EYGA 1GZKA 2X9EA 1APME 4UXQA 5ANGA 3BYUA 1O9UA 4F9BA 2HELA 4ZJIA 1LUFA 4YJSA 3LPBA 3Q53A 3EFLA 3H0ZA 4G3DA 3NCZA 3A7GA 3AT3A 1B39A 1U59A 5AIKA 5JRQA 5IA3A 3AQVA 2XK3A 3F5GA 5DI1A 5IU2A 4FSMA 3GXLA 2JAMA 4U5JA 5DRBA 5A14A 4KBKA 3MW1A 3ETAA 4TYHA 2RGPA 3HYHA 2HY81 3PXRA 4FG7A 4J97A 4QMZA 1ZY4A 5D7VA 5LMBA 2W4OA 3GCPA 5CEOA 4G5JA 5AP3A 3OOGA 3V5PA 4TW9A 3IKAA 4IANA 4R3RA 4FKJA 5EDRA 4EOJA 3ORPA 2G15A 4FV4A 2X0GA 2QR7A 5FBNC 4FTAA 3NGAA 1YRPA 4O7RA 3ZU7A 4BGGA 1WBNA 3MGYA 3CBLA 4MNEB 1Y91A 4ANBA 2GCDA 1NXKA 4EOMA 3F66A 4AA5A 4L45A 4R78A 3ACKA 3CE3A 3TNQB 5GINE 4EEVA 2XA4A 3ROYA 1PXMA 3TKIA 2Y6OA 3BGQA 4QMYA 4ALVA 2ITQA 4HVSA 3SXRA 3PVBA 3RM6A 4E6AA 5CEPA 5EQYA 2O64A 4D4YA 2VZ6A 3KN6A 4YJPA 2IJMA 3NUSA 5HESA 4FZ6A 1OB3A 2NRYA 4NEUA 4Y73A 4ZOGA 4BTJA 5DPVA 4DCEA 3GENA 4EK8A 4AZFA 4I21A 3QD3A 4A06A 1ZYDA 2GTMA 1T46A 4C38A 3F5PA 1J7IA 1BI7A 3L9MA 4OLIA 3NYVA 3RGFA 2R3IA 3QUEA 4XEYA 4YJUA 3RAIA 3FPMA 3O8PA 3C9WA 3NX8A 4MBJA 5HE0A 2G2IA 3KB7A 1ZARA 4FODA 4KKEA 5AP1A 2OZAA 4YLLA 4I4FA 3NUXA 5T6KA 5LQFA 4GW8A 3TDVA 1LEWA 2GDOA 2R3OA 3D14A 4QMVA 5HORA 2C3LA 3MFSA 3Q9WA 4RC4A 1WBSA 1LEZA 2R9SA 3BZ3A 4FMQA 1VJYA 4KKGA 2DYLA 2WXVA 3S2PA 3LCKA 5EHLA 2XNMA 2W9FB 5M4CA
chains in the Genus database with same CATH superfamily
3RMFA 5J7HA 3O96A 4ASXA 5HG5A 4O7VA 4CMUA 3WILA 1AQ1A 5FP6A 3DS6A 3ZEPA 3KVWA 3PPJA 3SLSA 3MN3A 3AC8A 2O65A 3WF8A 3GFEA 4JT3A 4WHZA 1ZXEA 5AUXA 5JQ8A 5LVNA 4WNMA 1T45A 2HXQA 2JDSA 3ATSA 4D2TA 3VS4A 4YZMA 1OI9A 2J50A 4BDDA 3ACJA 3ZEWA 2XNOA 2C0IA 5GJFA 4NIFB 5D7AA 5F9EA 2REIA 4J96A 2OJ9A 2ITTA 4ANMA 4AX8A 4KIPA 4GU6A 3RK5A 3ZMMA 3JS2A 1WMKA 1JPAA 2UUEA 1P5EA 4TXCA 3GT8A 4PTEA 5IA5A 4OAUC 2ZJWA 5BNJA 4TYEA 3OP5A 3QD4A 4FKQA 4HCUA 4RC2A 4CQGA 1GAGA 4E4LA 5CQUA 3T8OA 3ZUVA 4YO6A 1UU9A 2YCRA 4TY1A 5CQWA 3RWPA 4BRXA 2BKZA 2IW9A 4MX9A 4CCUA 3JPVA 2WTJA 4GT3A 4ZSEA 3R0TA 3ULZA 3G15A 4NW5A 4G3CA 3KK8A 4KIKB 3EZVA 1Q8WA 1SNUA 1YXSA 4ANQA 4YURA 4JX3A 2QVSE 1A06A 2J2IB 3PSBA 1OZ1A 4E26A 2UZEA 2DWBA 3ZHPC 3PJ3A 3QZIA 4Y95A 4LV7A 4ORKA 5ANDA 3OBGA 3RHXA 4O83A 3A7JA 2CKQA 2IVUA 2PK9A 3TNIA 2RG6A 4QEBA 5CU3A 3QKMA 4QPMA 4EHEA 3LXLA 3NEWA 2YDKA 4H3QA 1H26A 3MDYA 5JFSA 2FSMX 2HK5A 2CJMA 1LP4A 1SNXA 3HVCA 4CFUA 2PMOX 5JEBA 4O0WA 2FSLX 4R1YA 3DLZA 3WZKA 5CXZA 3CKXA 2HZNA 4G6OA 1XHAA 4ALWA 4D55A 3KXGA 3TM0A 1U4DA 2OBJA 4B8MA 3RVGA 4USDA 4GG5A 3V8TA 5HIEA 3SA0A 4EOKA 4RJ3A 4D1XA 4LGGA 5DEYA 4CTBA 2HZIA 2C3IB 4ACGA 3D7TA 3DDQA 4Y83A 5HBHA 4A7CA 1NVRA 4JAIA 4BIEA 3NVMB 2ZV8A 3KMMA 2YIRA 4MYGA 5G6VA 2G2FA 3AGMA 4EZ5A 3KCFA 3FYJX 3FLSA 1YXXA 3DJ5A 4YJTA 4R3PA 5J1VA 2PVKA 2YDIA 5D9HA 4E6CA 3UDTA 2CPKE 1JOWB 4O6LA 2F2UA 4D2RA 3DGKA 5I9WA 2W1GA 4UX9A 5E8SA 2OGVA 2Q0BA 3PTGA 4GG7A 5CSVA 5CS6A 5LARA 3W2OA 4RIYB 5FTGA 1P4FA 2VN9A 3ZO3A 2RFSA 3ALNA 3FC2A 3MTLA 4IQ6A 4UYNA 4HGTA 3RAWA 2WMVA 3VJNA 5HVKA 2XJ1A 4XX9A 2YACA 4NU1A 2ITPA 3KULA 3Q5IA 4CKIA 4WIHA 4RLLA 3G5DA 5FEQA 3ORZA 3FZRA 5HOAA 3R8ZA 2A98A 3KK9A 4ZSLA 2J0JA 4DH7A 4FKVA 4M69B 3LHJA 2XK8A 4MCVA 4BBMA 2JKOA 3GFWA 3NUAA 4RFMA 3NZ0A 4WT6A 5L2WA 4NWMA 3O17A 3EQRA 3MA6A 4YPDA 4ASEA 4EQUA 4IX3A 3R9RA 3QRKA 3GVUA 3DK7A 3SHEA 4AT5A 2IWIA 2OIBA 3OXZA 4IBMA 5DYJA 2WB8A 3KCKA 4X0MA 3VQHA 4R7BA 4LI5A 5CWZA 5F1ZA 5F94A 4BCIA 5A4LA 4PQNA 4D4SA 4MUQA 1DS5A 1IR3A 1OL5A 2XH5A 5EQPA 4FEQA 3UG1A 5KX8A 4OBQA 5HCXA 4GRBA 1ZLTA 3R2YA 4PNKA 4FTUA 1GY3A 4CLIA 3MY1A 3QZGA 1UKHA 1URWA 3GC9A 4I41A 4FZ7A 4L52A 5KMNA 4I94A 4LL0A 1JKLA 4N4SA 5HGIA 2BHHA 4QP3A 3P86A 2QOOA 3I81A 1UNHA 3EFJA 3NYXA 3PJ8A 4JIKA 5AV0A 4NKSA 1NVSA 1B38A 5F20A 2KULA 5L3AA 1YOLA 5DBXA 4H1JA 5DR9A 2WU7A 3D9VA 5IZFA 1TQMA 4A9TA 4ERKA 2PTKA 3VF8A 3BHYA 4C02A 3LQ3A 2C47A 5IA0A 4MF0A 3HRFA 3U51A 2XEYA 4F63A 2QLUA 4KB8A 4TT7A 3ZSIA 4LMUA 5JMSA 3TTIA 1PMEA 5HICA 2PVMA 2BALA 3PJ2A 4RBLA 1JSUA 1Q97A 3GUBA 3FDNA 2BIYA 3LM5A 4V05A 1H0WA 3VBXA 4XP3A 4GS6A 4RJ8A 4FL2A 4DT8A 1CTPE 2OSCA 5LMKA 3OMVA 4GK2A 5CAVA 4XNEA 3D5VA 4I3ZA 4JG8A 3TIZA 5CVGA 3FQSA 4D0WA 3KRLA 2HW6A 4CEGA 4E6DA 4XLVA 3G0EA 5GIPE 1YHSA 1PF8A 4PV0A 4YJOA 3BLHA 5HVYA 4ZSJA 1WZYA 3OCBA 1ZMUA 3ULIA 1ATPE 1KOAA 4F08A 3MPTA 4BCKA 1M7QA 1OL6A 3EQBA 4WD5A 2XS0A 3II5A 4NKAA 2C6KA 5CU4A 4MD8E 4CRLA 2XK7A 2ZM1A 2YFXA 2YCQA 4E3CA 2BZJA 4WG5A 4FJVA 2JIVA 4EHGA 4I0RA 4IACA 5CF6A 2WTDA 5DR2A 4DHFA 3NUUA 3AC3A 4HVDA 5M08A 4ANNA 4YTFA 3MV5A 3IW7A 3UE4A 1BI8A 3LXKA 2GQGA 4PDOA 1BX6A 4IVAA 4Z3VA 1GJOA 3NW5A 4M84A 3CP9A 4JRVA 1XMMA 1M2PA 3PE2A 4EKKA 3SRVA 3R2BA 3WYXA 4E6QA 1REKA 2YITA 4N0SA 4JDJA 4DG2E 1J7UA 5AJQA 3R63A 2WTIA 3QRUA 3ZBFA 4EZ3A 4I23A 5E8YA 3V5JA 3HAMA 2LAVA 3U87A 4ZMFA 4FV0A 2VX0A 3BYSA 3ZC5A 4I6BA 1UU7A 4E4NA 5AUUA 1M2QA 4I20A 5E1EA 4RX8A 3POOA 2ITXA 4NUSA 3DXQA 4IH8A 4G9RA 2OZOA 2HZ4A 3MB6A 4RRVA 4U79A 5FDXA 5HTCA 3QUDA 2WIPA 4BKYA 5DLSA 3TEIA 2ZYBA 4FSRA 3OW4A 3TTJA 3SAYA 2ERZE 2ITUA 1G3NA 5KHXA 1UNLA 3DFCB 1SVHA 3U4UA 3ANRA 3QXOA 3RALA 4L43A 4EOSA 4LQMA 4EH8A 5IKWA 1H8FA 1UU8A 3VBWA 3Q3BA 3HMOA 3W2RA 3SOCA 4FVRA 3RTPA 5JFXA 2BRGA 5EM6A 1F3MC 2ZDUA 3AKJA 4JNWA 4I6FA 4YTIA 3OS3A 5ACKA 3R9OA 1Y8GA 4A4XA 3MY5A 2B9JA 4NM3A 2PZPA 2HWOA 5L6PA 5JZNA 2PVFA 1H4LA 4A4LA 4A9SA 4II5A 3PA4A 3G6HA 4D9TA 4G6NA 3QD0A 1OMWA 4PP9A 3A4OX 2C3KA 4ASZA 4YSJA 4MQ1A 4BCHA 4EHZA 4D4VA 4DBXA 4H3PA 3OXTA 1XO2B 4XG8A 5DNRA 4PDPA 5HLNA 3OOMA 3PXFA 3IDBA 4YJVA 2Z8CA 4BJJB 2WMXA 3KF4A 3C50A 3H4JA 4YUQA 4KUJA 4OTPA 4APPA 3DAKA 4L53A 4V01A 2UW3A 2H6DA 2VTJA 4L9IA 3RCJA 1XR1A 3IGOA 4I0TA 4FTIA 4AT4A 4DT9A 4PP7A 2GPHA 1ZZ2A 2Y9QA 3UVRA 3ELJA 3V6RA 4YMJA 3OXIA 5IMEA 4JR7A 4EZ7A 5M57A 3LXPA 4FEWA 4IW0A 2VWIA 2VTOA 4FT9A 3O0GA 3EJ1A 4F70A 1DM2A 1Q41A 3FLYA 3HL7A 4BCOA 5BYYA 3MFRA 5IG1A 4FNYA 2WOTA 3ZM9A 2QLQA 1WBPA 3ZXZA 3R8MA 4XG9A 4DEGA 2XANA 2X0PA 3PVWA 3M42A 3R9HA 3C5UA 3VF9A 1ST4A 4DHZA 1PKDA 2YLFA 3K5UA 3ZRKA 4F0FA 3JXWA 3ZZEA 1OGYA 3B2TA 4HGSA 3D2KA 4B6LA 5E8UA 5HO8A 1EH4A 5DHJA 5HG7A 4FTCA 2E9VA 2ESMA 3S1HA 4AXCA 5IQHA 2GMXA 4KNBA 5LOHA 4MWIA 5EI8A 5L8KA 1W2CA 4AT3A 3HV5A 4TZRA 1LPUA 2X4FA 3COHA 4EQMA 5IH5A 3ALOA 2GS6A 5J79A 5ACBC 4O4FA 3OUNB 3O7LB 4FV5A 3N4VA 3H0YA 2V55A 4BCNA 4BDAA 2WMQA 4Z7HA 3EN9A 4TWOA 4EH7A 5EDPA 3RK7A 4B99A 3VBYA 4FE2A 4P2KA 5I9UA 3HRCA 1IASA 2OKRA 3OWJA 2ZM3A 3VIDA 3GC8A 3QF9A 3VS6A 2NP8A 3OHTA 1YWVA 1O6YA 1DAWA 1PXIA 4IWOA 5LJJA 2CGXA 3SG8A 5HIBA 2G2HA 2RSVA 3A62A 5JGAA 1ST0A 5IMXA 3W1FA 1QPDA 2VTLA 1G5SA 3PFQA 3F3VA 4FTQA 4RA5A 5AADA 4DTBA 4IAIA 2YM8A 2YM3A 3FZPA 3LCTA 4LOOA 3NFFB 3L9NA 3LFEA 4N70A 3AKKA 3VO3A 4OGRA 2AC3A 5IEXA 3PP0A 4XG3A 3DCVA 4EUUA 4Z16A 1YXUA 3UVQA 2FO0A 4HVIA 1XBBA 2WMWA 4DGNA 2YHVA 4DH8A 1G8KA 3SG9A 4JQ7A 2P3GX 4AOJA 3EYHA 2HIWA 2GHGA 4XUFA 4CV8A 4IVCA 5GJGA 2IZTA 3A99A 3D5WA 4K8AA 2JFLA 4O96A 4OTGA 4DEBA 4ZEGA 4ZY6A 4G16A 4FNXA 3MPMA 4QPSA 3W18A 2H34A 5TR6A 3A7IA 2HZ0A 3FMEA 5K3YA 2FH9A 2RF9A 2QG5A 3EQIA 3ENMA 3HV6A 4G9CA 5I3OA 3ZOSA 2Z7RA 4DG0E 4EH2A 1DI8A 1S9JA 3I5NA 3NDMA 4CLJA 3OWPA 3PUFC 3N4TA 2UW5A 3LJ0A 3OVVA 4O0SA 4HYUA 2OF2A 2R3PA 3ORTA 3D83A 3D5UA 3DQXA 3BL9A 4CT1A 2VWWA 5CAPA 3NNUA 2OF4A 4JR3A 3VS2A 4FG9A 2ITWA 5EH0A 4MXAA 2ITVA 1GIIA 2WTKC 3Q6UA 3LZBA 5IQIA 4GIIA 3BL7A 2V7OA 3MYGA 3W0RA 2EXCX 3B2WA 3PG1A 4Z55A 2E9NA 3E3PA 4LRJA 4MXYA 3R8LA 2B55A 4HGLA 4EK3A 4IDTA 2F2CB 1JAMA 1Q62A 4G5PA 4PPBA 4RWKA 5HTIA 3CQEA 4YLJA 1PY5A 3OCSA 1ZOGA 4X2KA 3Q4ZA 4YHTA 3VAPA 4GV1A 4PY1A 3DJ7A 3UIUA 4USFA 3BX5A 2BTRA 2OH4A 4G6LA 4WNOA 4O82A 2GNJA 4AN9A 4UYAA 4PL4A 5EHYA 4PMPA 2QURA 5KBRA 3E7OA 4NFMA 4F65A 2C6MA 2E2BA 1CKPA 1H27A 3GCQA 3KY2A 1P4OA 4QMPA 3ZO2A 2J0MB 4IAKA 2UZTA 4KSPA 1YI3A 2XK6A 3GB2A 4IJ9A 4XV2A 3IOKA 5FM3A 3WIKA 5IISA 2XJ2A 3OFMA 4F7NA 2IZRA 3UC3A 3NYNA 4HW7A 1YOMA 4UWYA 3R73A 5AR5A 2R3GA 3TL8A 3ZRMA 3U6JA 3CPBA 2V7AA 3TV4A 2A4LA 3UODA 1RQQA 1RW8A 2QO2A 5AR7A 4UN0C 2GS2A 1XBCA 4BDIA 3M1SA 2BRHA 2PUNA 4U81A 2UVXA 3L8VA 2P2IA 3O50A 4D1ZA 2WTKB 3V51A 4X21A 5K0XA 3AKLA 4I6LA 2ETMA 3O71A 4W8EA 5GIOE 1JBPE 1PYEA 3BWJA 3TIYA 1OL2A 5IQDA 4RVTA 1ZWSA 5LCJA 4EH5A 2OI4X 2QOKA 4CQEA 4CXAA 3KXHA 4X6QC 4U40A 1OPKA 4IX5A 4XHKB 2ZDTA 3O2MA 1YDRE 3OTUA 3O8UA 3QHRA 1R1WA 4JBOA 2RL5A 3MH3A 4MHAA 3ZLXA 4F1OA 3OWKA 3QTQA 4FYNA 4X2NA 3R28A 1MUOA 1TZDA 2BHEA 2OWBA 3DBQA 3LCOA 1FMOE 5HIDA 2EB2A 3N4UA 3RPYA 3FXXA 1NY3A 3WF9A 1KV2A 3WZJA 4BZDA 4ZJVA 3I6UA 3CTHA 1FVRA 1XH4A 2W1EA 5DE2A 5L2TA 2ZM4A 3WARA 3IDPA 4AFJA 1XH8A 2UVZA 4AOIA 2DQ7X 4ID7A 5H3QA 4DFUA 2FA2A 2YERA 4U3YA 3Q6WA 2JLDA 1JKSA 3ENHA 3NYOA 3W8QA 2JGZA 3F69A 2VAGA 3R1QA 1CDKA 4BZNA 1DAYA 2AQXA 2YCSA 1H1WA 3HDMA 5FBOA 3WZUA 2AEGA 4BZOA 4UMRA 4DGMA 2PYWA 2JIUA 2JDVA 3IO7A 4BDHA 1MRVA 4DN5A 5JQ5A 1Q8ZA 2C0OA 4DA5A 3NAYA 5JKGA 2C6EA 4RG0A 2PMIA 5LVMA 1J7LA 4ENXA 4G3FA 4B0GA 4N57A 3TV6A 1XQZA 5FEDA 5FXSA 2PHKA 1PJKA 2BCJA 3BHVA 3Q4CA 4IB3A 4C35A 4EUTA 5A6OA 4CKJA 3RNIA 1W2FA 4GSBA 1V0PA 3DT1A 3FI4A 4FG8A 1VZOA 5C8KA 2BPMA 3P7BA 1FGIA 4KABA 1R39A 4GL9A 3GGFA 4NT4A 5A6NA 4DHIB 2YJSA 4DYMA 5AP7A 2DS1A 4L6QA 4R6VA 4FGBA 4BIDA 1UKIA 1K3AA 4BDJA 3FE3A 5JRSA 4OAVB 3GC7A 3BGZA 3UZPA 1PRYA 3TV7A 2OIDA 2XKEA 3F61A 5EK7A 5CEKA 1QPJA 4BBFA 4NYEA 3UDZA 4FTMA 4LM5A 5HNGA 3PUPA 3EOCA 4RC3A 4F6UA 4BFMA 4L3PA 3ZLWA 4FKPA 5HNIX 3ZC6A 1GZ8A 3QQFA 2PE0A 1PHKA 4KBAA 3UVPA 4UZDA 2XIYA 3UQCA 4XJ0A 1I09A 3R1SA 4DH1A 1IAHA 3KA0A 4AW1A 1YXVA 2YAAA 4IXPA 4BWPA 1KE8A 3DPKA 3CJGA 2CDZA 2ERKA 3LJ1A 4AXDA 4P90A 2YM4A 3Q60A 2JKKA 4EOOA 5IH4A 2OFVA 4QYYA 3GOKA 3ID6C 3TT0A 4X2GA 2NYAA 4F99A 4MXOA 4HJOA 4ZZNA 5HLWA 2E9UA 3U9CA 2Z7LA 5HQ0A 4BYIA 1O6LA 3ROCA 3RINA 4DFXE 4U45A 3TYKA 3R04A 4BKZA 1FVTA 4FR4A 2A0CX 2YA9A 5H8BA 4BVUA 4C36A 3HDNA 3NCGA 3ZSHA 4FNZA 1ZOHA 1YW2A 3V04A 3B8RA 1LR4A 4J53A 1Y6AA 4DH3A 4C4FA 5M06A 4C58A 1OIYA 1B6CB 4JG6A 4P5ZA 5AUWA 4HOKA 4PL3A 3P9JA 3UOHA 3OBJA 2VU3A 1Q8UA 2GU8A 2OW3A 3NR9A 4GH2A 4YSMA 1KE5A 3BV3A 3T9IA 2XIXA 4BWXA 4QMMA 3HV4A 3LFBA 3ATTA 5CALA 3ZONA 4DC2A 4GMYA 5E8ZA 3DV3A 3S00A 5BQ0A 5J9ZA 4D0XA 2EVAA 2V62A 3DKGA 5T68A 2GQSA 4C3PA 4I5PA 4PRJA 1WVWA 2VRXA 3E5AA 2AUHA 3E92A 3LFFA 3CS9A 2WHBA 3CY3A 3DK3A 3ODZX 3QTRA 4FV1A 4ZS0A 1H00A 5B2LA 2PE1A 5L4QA 1FVVA 2ZMCA 3IS5A 4U6RA 4A07A 2XNBA 4L46A 2X39A 2JDOA 5J8IA 3QLGA 4O7YA 2JEDA 1OIQA 4XYFA 5D11A 4BB4A 1URCA 4YGAA 4IAYA 1X8BA 2X2MA 3BBWA 4RGJA 3TZ9A 2XK9A 2VTTA 5HBJA 3LMHA 2F57A 2Y7JA 5IEVA 3A8XA 1R0PA 4XP0A 3MB7A 2QU5A 1JLUE 3R7YA 3PJ1A 4AGCA 1J1BA 5KMKA 3KQ7A 5AM7A 3EB0A 3FKNA 3UC4A 4K18A 2XVDA 4PMTA 2W4JA 2XRWA 2ZV2A 4I4EA 4JAJA 5IUIA 2VNYA 3TWJA 4B7TA 4NSTA 3RJCA 3F5XA 3CQWA 4ZTMA 5H2UA 1M7NA 4YJRA 4MH7A 3BYOA 4D1SA 3PXYA 3M2WA 2ZOQA 4ANOA 1CSNA 1G8SA 4JJRA 4QTCA 3KRXA 4L01A 1J3HA 2WMSA 3PE1A 5CNOA 2WQBA 4QD6A 3TZ8A 2I0VA 5DT0A 4EBVA 5TF9A 3G6GA 4GEOA 4GIHA 1TVOA 4JQ8A 5E9EA 3UIMA 2IZUA 4R5YA 4D2SA 5AEPA 4EH6A 4AWIA 4AQKA 1WFCA 3A60A 3G33A 4ZMEA 2W1IA 5A3XA 3R7EA 4TNDA 2C5OA 4EORA 3W0MA 3DBDA 4A9UA 4KRDA 4M66A 5DA3A 1SMHA 2QG7A 4IFGA 3ANQA 3TMOA 1Q3WA 4NTTA 5HO7A 5EDQA 5F4NA 4DGOA 2QOHA 4JG7A 4H1MA 4IDVA 4JMQA 3C13A 4CFNA 1GZNA 3OW3A 2R64A 3ZFYA 2UZDA 1PMUA 2C3JA 4Q2AA 4WBOA 1GOLA 2VWUA 5FLFA 5HX8A 3SGCA 2J5FA 2OG8A 4ZXTA 5HO6A 3UQGA 2W4KA 2GTNA 3V5TA 4CSVA 4UMPA 3P5KA 5CSXA 1PXKA 3BI6A 3C0HA 3PPKA 3MFTA 5IUGA 1W2DA 3FI2A 3I5ZA 3PSCA 4Z9LA 3FZTA 2IW8A 4OTIA 3DAJA 4D2VA 1KOBA 5CXHA 3UNJA 2P2HA 2XBAA 4LMNA 3BHUA 4PF4A 4K2RA 5FGKA 3TUDA 4RVMA 1VLRA 3IW6A 4J98A 2SRCA 3KMWA 3MIYA 5M44A 3PRFA 2UW8A 4J7BA 3D5XA 3FLNC 3BCEA 1H1SA 1BKXA 3C4FA 2P33A 4C61A 4EJNA 3TUBA 4KA3A 4OW8A 3FQHA 5EM7A 3EL8A 5EW3A 4TTHB 3RK9A 3WF5A 3G2FA 2FYSA 3DZOA 2I0EA 5CSHA 3Q2MA 1L3RE 2HXLA 4FSWA 3IQ7A 1M14A 3UOJA 4GFMA 3QTUA 4ZZOA 4DFZE 4AE6A 3V8SA 5KMMA 5M07A 4DEDA 4AGWA 4QTAA 1ZYCA 4AN3A 3FLWA 5M4UA 4AAAA 4EK6A 1PXPA 3O7LD 2ZB1A 4HCVA 4FI1A 4XG2A 3LCDA 3C7QA 4NCTA 4C59A 1ZYSA 5LVOA 1QPCA 3UP7A 3SVVA 3FZOA 5KZIA 3QBNA 4ACCA 2R3MA 3PA3A 1WAKA 4F1TA 2ONLA 3V5LA 3C4WA 5AUYA 4BI2A 2PPQA 5CNNA 4IC8A 3TCPA 4BBEA 4FIJA 2BIKB 1MRUA 3OROA 3QGWA 4MTAA 4C3RA 5HTBA 4C34A 4R1VA 4U43A 4MBLA 4BJJA 3DJ6A 3FUPA 4FICA 5CF4A 3EQGA 4M13A 4W4YA 4FT3A 5CEQA 4TRLA 4FRFA 3KGAA 4FYOA 4IADA 4M15A 4M67A 1CKJA 4MD9E 4DTKA 2WZJA 3FZ1A 4BCMA 4IAAA 4NTSA 5FTOA 5IQEA 4WNPA 3MVLA 1ND4A 2RIOA 4X3JA 5K5NA 3A8WA 3PXKA 3W2PA 3R21A 3HP2A 4IE9A 5EKOA 3VULA 2J0IA 4M14A 5GZ8A 5HG8A 1UV5A 3FMLA 3E93A 3TN8A 3UIXA 3GU7A 4DEAA 4EK5A 3TG1A 3D2IA 4DE4A 4FTNA 4RX9A 3DBCA 4IC7A 3KRJA 2Z2WA 4LOPA 5HI2A 4TL0A 5FXRA 4G17A 4CFXA 2PVYA 4LOQA 4RWIA 5EOLA 4R3CA 5EW9A 4F9YA 5IQCA 3KFAA 5EHOA 4F1MA 5JFWA 4OBOA 4XMOA 3W0OA 2YLEA 3BHTA 1M17A 4BHNA 3U8WA 5L2SA 2WELA 3GU6A 4BCGA 2VTAA 2B9HA 2Y6MA 4GVJA 5L2IA 2OICA 5CTPA 5IQGA 3KC3A 1QPEA 3QYZA 4DFYA 4O0YA 4ZTNA 5DMZA 3VS5A 5JGBA 2CKOA 2X8IA 5C9CA 3EN4A 1PMVA 4DFBA 4XBRA 4FV6A 1W0XC 2IZSA 3BU6A 2QOBA 2UZLA 4Q5EA 4R7HA 3UIBA 4BTMA 5C4KA 2JDRA 5C01A 3BLRA 4QTDA 3UOKA 3L8SA 2YM6A 2XARA 4QMXA 5I4NA 4FZAB 5K9IA 3NUNA 4XV9A 3C0GA 3W2CA 3KXZA 4EC9A 2PU8A 2VX3A 3BQRA 3KXMA 3PLSA 4QTEA 4JXFA 3Q5ZA 4H39A 3P0MA 2OFUA 3LFNA 4K77A 3PDTA 2IG7A 4RVKA 1W7HA 4KKHA 4FTRA 5L6OA 4C3FA 1FQ1B 1E1VA 3FBVA 5LCKA 3WZDA 3BE9A 3WF7A 3A7HA 2JC6A 4RWLA 3AOXA 4QQ5A 1Q61A 4ZS4A 5CZHA 3BLAA 3VN9A 4A9RA 1NW1A 2HAKA 5FTQA 4WG4A 2QOCA 3W2SA 4FEUA 2PE2A 3QCYA 4L3JA 5AR8A 4XG7A 3N9XA 3QUPA 5J95A 4DTAA 4FSTA 4J71A 2HWPA 4D2WA 3BU3A 2VO3A 2XUUA 1JKTA 3ZZWA 3Q4TA 5D1JA 2XRUA 3IOPA 3KKVA 4AXEA 4HVGA 5KHWA 3NSZA 4OTQA 5I5ZA 2JKMA 3IG7A 4CMTA 4ASDA 4BL1A 4UWBA 3FAAA 3QFVA 1JQHA 5L2QA 3I60A 4NCTC 4CZYB 4EH4A 4YLKA 5AM6A 3DNEA 3JY9A 3ZS5A 4ACHA 1OKYA 5BVOA 3VBTA 3FMHA 3MBLA 4F78A 3QWJA 3B8QA 4UMTA 3DLSA 2W9ZB 4C4JA 2GFSA 2VUWA 5E92A 1U54B 3ORIA 4XG4A 1YI6A 2YABA 4QT1A 4E7WA 4O0TA 4JDKA 2QC6A 4QQJA 2Z02A 3NVKI 4PDSA 1XMLA 4FZFB 4QMUA 5LMAA 2C0TA 1J1CA 2WQMA 4D2PA 1J91A 4QO9A 4EKLA 2RFDA 1L8TA 5K4JA 3I4BA 4HCTA 4YHFA 3W33A 3BQCA 4M0ZA 1H28A 3U6HA 5DFPA 4ZP5A 1IG1A 3FI3A 2Y0AA 4OTFA 2Y4PA 4RA4A 2J5EA 4FX3A 1OECA 3UTOA 3W0QA 4DDGA 4OTHA 5DG5A 3NS9A 4GUEA 3TACA 3DAEA 3RP9A 2O2UA 3QLFA 4DHJA 5CYIA 3HA8A 3KMUA 3LCSA 4PUZA 3QQGA 1OITA 4TN6A 3RKBA 2YDJA 5B2KA 3KULB 5EKNA 4DGLC 3F3ZA 5HE1A 4QMWA 2B52A 5I9YA 4QYGA 1G8AA 1OBDA 4X3FA 3U55A 3UJGA 3R22A 4F0IA 3QQHA 3ORMA 4WO5A 4GYGA 2W5AA 4WUNA 3HLLA 4ZTRA 3SW4A 5E1SA 3EN5A 3AMYA 5HCYA 2G1TA 4ITJA 5AAFA 4C62A 4O21A 5BUEA 5IQBA 1HOWA 3SC1A 2AYPA 4S30A 4ZSAA 1W83A 5LMKC 2ZMDA 1VYWA 2PMNX 2VX1A 2V5QA 3E87A 4RJ6A 2RFNA 4FTKA 5C27A 5LWNA 1WVXA 3F9NA 3FY2A 5CT0A 2UZNA 4YBJA 5E90A 3FWQA 4C33A 2QO7A 3DDPA 3R71A 5TO8A 4R77A 2F9GA 2BUJA 3NUYA 4J99A 4LL5A 4QYEA 3VUTA 4RPVA 3NUPA 1G8JA 4MBIA 4V0GB 5CANA 4LRMA 3H9OA 5ETCA 3SW7A 3MVMA 5FP5A 3MFUA 3QD2B 2VNWA 3L1SA 5CX9A 1W98A 4FV7A 2YEXA 4I24A 3TNHA 5C4LA 3G9NA 3GNIB 3FSFA 3WOWA 3BV2A 2UW9A 5GZ9A 3LXNA 3D7ZA 5KKRC 3OT8A 1PYXA 4G1WA 4G34A 3VBVA 1UWJA 3R9DA 4FKTA 4KWPA 4AA4A 4CVAA 5HE3A 2OH0E 2PVJA 3CKWA 3W55A 1MRYA 3EQDA 5E8TA 4F9WA 3DB6A 2XCHA 2Y4IC 2WTWA 4I5CA 3VQUA 3BYMA 1FMKA 2YAKA 3GC0A 3PXQA 1QL6A 1V0OA 3NW6A 4JQEA 5FWKK 3ZTXA 1YDTE 4L00A 2Y8OA 4RIWA 4HYIA 3WE4A 4EQCA 4F6SA 3R8UA 3C5IA 2W96B 4H05A 3NLBA 3DBFA 5AUZA 5HE2A 3OUKA 1SVEA 2X2LA 2YIQA 3DA6A 5I9ZA 2R7BA 2X8DA 4A9YA