4CV8A

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
279
structure length
255
Chain Sequence
b'QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 255
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cv8A01
2PSQA 4IZYA 5DPVA 5ETAA 2H8HA 2OJIA 3NUSA 3PDTA 2KULA 3QA0A 5JRSA 3OUKA 3UOHA 4RWIA 3AT2A 4ANLA 3ATTA 2R3KA 3QD2B 4R1YA 4EEVA 3OG7A 2ERZE 3KXXA 4LQMA 5CEMA 2QLUA 2VTPA 1PXOA 1VYZA 2CGXA 3ZZWA 4GG7A 5AV1A 3ET7A 4MKCA 4I0TA 4LRJA 2BTRA 4M66A 4NH1A 5DLSA 1H4LA 2JBPA 5BUEA 3UVPA 4L53A 4U8ZA 5LJJA 4AS0A 3GCPA 4MYGA 4ALWA 2BKZA 3G90X 2QD9A 3GQLA 2CKEA 3SDJA 3T8OA 1XBBA 4CRLA 3TKUA 2C6TA 4UMTA 4JBPA 1E1VA 2OU7A 2UW6A 3UP2A 3EL7A 4QQJA 2A0CX 3OXZA 3CLYA 4KS7A 4MD7E 4WBOA 4J96A 1CM8A 5GZ8A 3I0OA 3EZVA 3EKNA 3QKKA 5EI8A 2O0UA 4RIYB 2R3QA 4YURA 4YO4A 3ZO1A 3NWWA 4D0WA 3ZSIA 3PPZA 2ITYA 1MRVA 1TQIA 3R04A 3NUAA 3A99A 1GJOA 2X4ZA 3H9OA 3N4TA 3JY9A 4I1ZA 4EHEA 4OAVB 4S33A 3VW8A 3F6XA 3EZRA 4BKZA 1LR4A 3IDPA 1PXMA 2Y6OA 3PVGA 4YNEA 4P5ZA 4XG9A 3FMMA 1XH9A 2BVAA 3BYVA 2UZBA 3IDCA 3SV0A 3CEKA 3OP5A 3TNIA 3PP1A 2FVDA 1Z5MA 2C5OA 5CVGA 4YUQA 5CASA 4CG9A 2PZ5A 5FXSA 4TWPA 4APCA 4IH8A 2VTQA 3NUYA 2YITA 4RX8A 2WMTA 5DG5A 3WI6A 3R01A 3MY5A 4KAOA 1MUOA 3JXWA 4FT7A 4YTHA 3NNUA 3BYUA 4DAWA 3NNXA 5CEOA 3QQKA 3FQHA 3O0GA 5AR8A 4IX4A 4BI0A 1K2PA 4CFUA 1H26A 1WAKA 4D9TA 4NWMA 4RFYA 3C5IA 4NTTA 5EKOA 3LJ2A 3LFDA 5LWNA 4F9AA 2IVSA 4EHGA 2FH9A 3QRIA 4YP8A 4ZEGA 2ZVAA 3UC4A 3AC1A 4TL0A 1Z9XA 2VTRA 3QQLA 3BLRA 4MXXA 2PWLA 5CI7A 1WVWA 4GCJA 2P4IA 2VAGA 4RA4A 5J5SA 1SVEA 4QTAA 4V01A 4AE6A 1PXLA 2XS0A 2NP8A 5BVOA 3UVQA 3B8QA 3TWJA 4F6SA 2Z8CA 4KD1A 3GCVA 4ONAA 1H00A 4YJRA 3I4BA 4AN2A 4F6UA 4CKJA 2VUWA 2WHBA 4FT5A 5LQFA 2VNYA 3LXNA 3PPKA 3UYSA 4CEGA 4E8AA 3RPRA 2WZJA 4MF1A 5EQYA 4DEGA 2BRHA 1GIIA 1XH8A 3R73A 2BRBA 3CCNA 1BYGA 2XNOA 4KIQA 4U97A 2DYLA 2R4BA 1R0PA 4USEA 4RLLA 1TQPA 5CF5A 5IEVA 3MIYA 2FSTX 3HV6A 4LUEA 4O2ZA 5I0BA 3VAPA 5HESA 1YKRA 2H34A 4NJDA 1Y6AA 4CFXA 5E8UA 4AE9A 5J5TA 2J7TA 1MQBA 2XKCA 2F7XE 2QKRA 4LGDA 4XBRA 4PPCA 5GJFA 4GKIA 5ICPA 2CN5A 4L3PA 3IGOA 4FKSA 3L9PA 1FVRA 5DN3A 2YCFA 4YPSA 5IA3A 1FVTA 5LMKA 4CFMA 4PWNA 3W2CA 2PZRA 4NIFB 3KY2A 5CX9A 3NLBA 4BTMA 2RKUA 3GP0A 3P7AA 1DS5A 3FMKA 5AP0A 4I6BA 4U44A 4MX9A 2O5KA 3G6HA 1O6YA 4WT6A 4I5MA 3GU8A 1FPUA 3K5UA 3BHHA 4J98A 2YM3A 3NYVA 4EJNA 2I7QA 4IM0A 3D2IA 1KE9A 1W7HA 2BDJA 4QMOA 5CS6A 3WZJA 4AG8A 1JBPE 2RSVA 4TY1A 2CNQA 2W1GA 3R7OA 4RQVA 4U42A 4DGGA 1E9HA 3HUCA 2J0KA 4KKEA 3VF9A 4E4LA 4EBWA 3QKLA 2GTMA 2C3IB 3GBZA 2ITNA 3BPRA 4D28A 3CE3A 4IJPA 3H9FA 2RFNA 4D2WA 5HGIA 4RVKA 3DBDA 4YJUA 3TN8A 4FI1A 1Y57A 5BNJA 3IDBA 3DKGA 2WQOA 5EI2A 2QLQA 3DFCB 1JKKA 2YEXA 3R02A 1APME 4L3JA 3R8PA 3VUTA 5TF9A 3COKA 5HE0A 4DTKA 2W05A 3K3IA 5CTPA 5JSMA 2J50A 3FWQA 3ZS5A 2CKQA 4XMOA 3SOCA 4C36A 3SC1A 1YOLA 3IECA 4GYGA 5EM7A 2UZEA 5TOZA 3N9XA 4BDDA 2Z02A 5EOBA 4F99A 2XIKA 4DEIA 3C51A 4BTJA 4IFGA 4TWCA 4YBJA 1PXKA 3HRFA 3P08A 4FUXA 3EQPA 1M17A 1SVGA 4V04A 3RPYA 3OCGA 4O0RA 3FLWA 4QD6A 1KV2A 4HVDA 3BBTB 1JPAA 4GIIA 5D7VA 5EOLA 5HO7A 4C57A 3D4QA 4FK3A 3W2QA 2IW8A 4C58A 1O6KA 3ROCA 3OFMA 1A9UA 5CSVA 2IWIA 3G33A 5IU2A 2C0OA 4L44A 2ZV7A 2CJMA 1YXUA 1WBTA 3FPMA 3NYOA 4QMLA 3KRRA 4Z55A 4DFNA 4QP9A 1Q8UA 4GT3A 3BV2A 4Q9SA 3RTPA 1B38A 4FTUA 1KE8A 4D2VA 3VS6A 2YIYA 5AP5A 4HZRA 3QYZA 1YDTE 5EG3A 1JAMA 2GU8A 4FTTA 3PZEA 2XK9A 4MXAA 2UW3A 1OVEA 3TZ8A 2UZTA 5GJDA 5GINE 4O2PA 3FYJX 4D4RA 1GY3A 2YERA 4M97A 5BYZA 3AC5A 2C6LA 5CSHA 5KX8A 3ORIA 5HICA 3VUIA 1YRPA 3PXRA 2QU5A 2XZSA 3I5NA 2PL0A 3PWYA 3FC2A 5M57A 3O8UA 4NKAA 5CWZA 4AT4A 1T45A 4AZFA 2E9PA 3BCEA 4DEBA 4EOPA 1V0OA 5KKRC 3CQEA 4U6RA 4D1XA 1W0XC 3ZSHA 3PSCA 4RWKA 3ZTXA 4RZWA 4WUAA 4DTBA 4QP6A 3CPBA 2QODA 5HVYA 4IJ9A 3L8VA 4PL4A 4QMUA 3ULZA 2J0LA 2XH5A 3NDMA 2YIRA 3KK8A 4UYNA 5IQBA 5F94A 5BYYA 4FKLA 1QPJA 2OJFE 3DDQA 5JN2A 2UZNA 3MB6A 4IB5A 4HVSA 2QR7A 4MD9E 4FV1A 4BI1A 4F70A 5A6OA 3MPTA 4IIRA 5JMSA 3QQUA 4ENXA 4EH7A 4QNAA 5B7VA 5L8KA 2PULA 2Q0BA 2PVLA 3OW3A 4R1VA 3HMOA 3F2RA 5CQUA 2VD5A 4DYMA 2I0YA 3Q4CA 3WZDA 1M7QA 1U46A 3IKAA 3ZXTA 3DKFA 2A27A 4QP8A 4PP7A 5KBRA 2OF2A 3TDWA 2GFCA 4S2ZA 4ASZA 3KEXA 1PYEA 2VWWA 4FTJA 1M2QA 4D2PA 4ANOA 4FKUA 4HCUA 2UZUE 3WF9A 5CXZA 1Y91A 2PMNX 2XBAA 2YM7A 3BWJA 3WOWA 5J9YA 4PUZA 4BGQA 5JRQA 3IW8A 4FEUA 3AXWA 4FZFB 3UDBA 3UG1A 1A06A 3DB8A 3V5JA 2NRUA 3V01A 4A7CA 4QTEA 2DQ7X 2XRWA 4RIXA 3NAYA 5AR4A 1PHKA 5EHLA 3LZBA 5IZFA 3R28A 4RJ6A 4F1MA 1UV5A 2BFYA 3QBNA 4FR4A 4KUJA 2Y9QA 1UU7A 3QFVA 4FT3A 3ANQA 4BCPA 4ZOGA 5HIBA 2C3JA 3DT1A 4BGGA 4EHVA 4KRDA 1JKSA 3PG1A 3CP9A 1PXJA 3GC8A 5EH0A 1OPJA 2W7XA 2V7OA 5LMKC 2ONLA 4W8DA 4ZXTA 3AOXA 5HZNA 5M4FA 4CV8A 4G9RA 2B4SB 3PY1A 3HAVA 2F4JA 4V0GA 1UU8A 1ZMWA 3TJDA 3L8XA 5G1XA 4B6LA 3DA6A 4UZDA 4U3YA 3UE4A 3EL8A 1Q8TA 3DPKA 4DH8A 4M68A 4ZTRA 2VWVA 4UEUA 1DM2A 3H4JA 4S30A 4BDFA 4D4YA 5L2IA 5LWMA 4QMXA 5C8KA 2VO6A 3NZ0A 3SOAA 3LKMA 1R0EA 2BROA 4OT6A 4M84A 4IVDA 4L00A 2PVHA 3TNHA 3E93A 4J7BA 4BR3A 5B2LA 3GC0A 3QCYA 4DT9A 3GCUA 3NW6A 4BDJA 4QT1A 3D5XA 1OPKA 2REIA 3T9IA 4F9WA 4USFA 2ZDTA 5C8MA 4P90A 4U41A 4Z9LA 4PF4A 2QNJA 4F1OA 2ZB1A 4FV7A 1YDSE 4XEYA 4RZVA 3LXKA 3KULA 3MGYA 3UOJA 2E9OA 4YZNA 4JBOA 4TPTA 5AR2A 3W1FA 4CD0A 5HTIA 4R5SA 4AP7A 1NVSA 2EXMA 3FZTA 2WMRA 3VS7A 5EW8A 3AD6A 5FEDA 3PY0A 4PNIA 5EQPA 4ZTSA 5HLNA 4U45A 3PWDA 4G3DA 2UW5A 3BEGA 4TYGA 2C1BA 3V5TA 4YZDA 2F2UA 4EK5A 2UZWE 1YI6A 3R2YA 4I4FA 3FMNA 4EH6A 3SA0A 3PFQA 3PA4A 3KN5A 3MN3A 4LFIA 5E7RA 3NPCA 3SQQA 5HBJA 2JGZA 3KXNA 4PDSA 4EH4A 2RFDA 5D41A 4HVIA 2VTIA 1DAWA 2WQNA 3O17A 2OGVA 3R1NA 4YZ9A 4RG0A 5LVNA 2X8DA 4YZBA 3Q3BA 5L6WL 3V8TA 4Y85A 4DH3A 5L2WA 2JAVA 4XV9A 1T46A 3EQHA 4FTMA 5FRIA 4DBNA 3VRYA 2VTOA 1G5SA 4R3CA 1YOMA 3QCQA 5FLFA 4EQCA 4ERKA 4AT3A 2FUMA 4MNEA 5EM6A 5KCVA 5KMJA 4G31A 2RFSA 4N6ZA 4WG4A 3HA8A 5ETFA 5J87A 3U9CA 5DR2A 4ZZNA 3HX4A 2XB7A 1YHSA 3CGFA 4AW5A 1K9AA 4K0YA 3TTJA 4JDKA 5I9YA 3C50A 4QP2A 5GNKA 3ZFYA 4FGRA 3DK7A 4H1MA 1ZMUA 3CD3A 3L1SA 4D2SA 1XQZA 4WNPA 3PVWA 5KMOA 3KXZA 3OROA 1ZYLA 2JIVA 2QR8A 4PV0A 4WD5A 5FWKK 3VBYA 2OK1A 2YLFA 3QZHA 1H1SA 4EOMA 2PVKA 3ZRLA 2ITPA 1OBGA 4ZMFA 1URCA 4A9YA 4ID7A 3EFJA 4JI9A 4RC4A 3TUBA 2XNGA 4HCTA 4ZTNA 3PE2A 4RQKA 5HD7A 3QD0A 4OGRA 3F61A 3R63A 3F82A 3UQGA 3FXZA 4IB1A 4UMRA 3I1AA 4Y72A 4FKQA 4BRXA 5IH5A 2B53A 4BFMA 4TTHB 5DOSA 2PZIA 5M53A 4ACDA 5GJGA 3DJ6A 5A46A 5DWRA 4FSWA 5GIOE 2XM8A 2BPMA 1YXXA 2XK4A 2F57A 3IW4A 4HOKA 4ZY6A 3AGMA 1Q97A 4E7WA 1OKWA 2IPXA 4CTCA 4BCIA 4C4JA 4ZSLA 4RPVA 2OLCA 4D5KA 4X3FB 3CQWA 4WRSA 5CU4A 3BU5A 4H36A 4XV3A 4L42A 4MQ2A 5HEZA 4C4IA 3UOLA 2EXCX 5I3RA 3HVCA 1H27A 3F2AA 3E87A 3KN6A 3LCKA 5HLWA 3QRTA 4GJ2A 1J3HA 4BIDA 5LVMA 2W1DA 4TXCA 4FTCA 5ANIA 3V3VA 4CYJA 4FT9A 4DEDA 4FTQA 3ODYX 3P86A 3HMIA 4WNMA 2VO0A 2QCSA 2X0GA 3EQCA 5E9EA 4O83A 3A7FA 4IFCA 4ZTMA 5KO1A 4I4EA 1REJA 2JBOA 5IH4A 5DBXA 4ZSGA 5IEXA 3P78A 1STCE 1ZARA 4HYUA 4BL1A 1CSNA 2C5XA 4FL3A 2CGUA 1J91A 2OBJA 3MV5A 1JSUA 4C0TA 2GNHA 5DYJA 1BUHA 5AP1A 4DINA 2G2HA 3FKOA 3FC1X 3R9DA 4EBVA 3SXSA 3W32A 3TUCA 3E5AA 3EFWA 4Y46A 1J7UA 3U54A 4FTIA 1J7LA 3VBWA 4YBKA 4W8EA 5DVRA 2JLDA 2R7IA 1LUFA 2X81A 4IWOA 4I41A 4FZ6A 2GS2A 4FTAA 2R3OA 5HVJA 3CSVA 4E1ZA 4RSSA 5AP2A 3NCGA 1RE8A 1ZYDA 2GHLA 1IG1A 2R0UA 4RWLA 3RK9A 4E6DA 1OECA 4E5BA 3DAKA 4BHNA 3EYHA 2ZOQA 4E6AA 4L67A 3BRBA 1WBPA 4GH2A 3GCSA 1FQ1B 1H1RA 4IAFA 4IB0A 5E8SA 3W2OA 3ZO2A 4UBAA 5I4NA 4CRSA 4YMJA 3D7TB 4BF2A 4HGSA 3F3WA 2DUVA 3F5UA 3TACA 2HY81 2WMVA 5CSXA 5H8BA 1YHWA 2JDOA 4OTPA 3CBLA 4LV8A 4ZY5A 5JFSA 4DGNA 4JR7A 5AP7A 3HEGA 3LCTA 2Y8OA 3QRKA 4Z3VA 2IO6A 3FKLA 3ODZX 2CMWA 2C6MA 4X2NA 2OO8X 4XJ0A 1YWVA 5DRDA 5HHWA 4RMZA 2UZLA 2BILB 3Q53A 3NGAA 3KVWA 2AUHA 3ZDUA 5CEKA 2ITQA 4QTDA 2BIYA 3KCFA 3S1HA 4MEDA 5EYKA 3O8PA 4JDIA 3R9NA 4EONA 4KB8A 5AUUA 4JG6A 1W84A 2XKEA 4EC9A 4UWYA 3O50A 5JFVA 5HX8A 5CNOA 1KUTA 3TNWA 3FAAA 4B8LA 3JPVA 3DZOA 4R7HA 4G6LA 5L2QA 2P3GX 3Q60A 3N4VA 4UY9A 5AP3A 3ROYA 2QHNA 3G15A 2A4LA 3REPA 5LVLA 1ZYCA 2OSCA 5FD2A 5D11A 5DE2A 3HNGA 3DXPA 3CJFA 4WG3A 4IXPA 4NK9A 4HGEA 3I7BA 3AG9A 1YI3A 4CSVA 4C4FA 1J1CA 3LOKA 4KKGA 4DT8A 2BFXA 2X7FA 5E8ZA 5I3OA 4QP7A 4IZ7A 4C37A 3DKCA 3FBVA 4CZYB 4LGHA 3F88A 2CKPA 4MWIA 2QONA 2BDWA 3EIDA 3Q2MA 4NCTC 5E8XA 2YWVA 5L6PA 3EQGA 4LL0A 3EMGA 3V5WA 1XR1A 3HRBA 2C69A 1OMWA 3RCDA 4L43A 5AA8A 4GFGA 4JIKA 1FGIA 3TI1A 5HG8A 5CSPA 4RIWB 4RX7A 3HLLA 5CZIA 5BVWA 5IA2A 2OIDA 4LMUA 4GW8A 2YAKA 2J5FA 3BV3A 5KBQA 1U54A 4EHZA 3RK5A 2CCIA 2VN9A 3GOKA 4FNWA 2C5YA 4HCVA 4DCEA 3LW0A 3TV7A 3ZO4A 3SD0A 5HBEA 5TO8A 2R0IA 3A2CA 3HP5A 4G3CA 3R0TA 1A48A 3P7BA 2R3MA 3MFTA 4NT4A 4JX7A 4FUYA 5C1QB 3OEFX 2BZHB 5LCKA 4GK2A 4EYJA 2WOUA 4A9SA 3O8TA 2HWPA 4I20A 4GU6A 3FPQA 1JVPP 4DH5A 4I3ZA 2QI8A 3MVLA 5AV0A 3VW6A 4YSJA 4JRVA 5AADA 4O1PA 4FIJA 3BGZA 5FEEA 4BIEA 4FSNA 3DXNA 3HV4A 3ZM4A 5ACKA 3CY2A 1M2PA 3TM0A 2X6DA 1IAJA 4FX3A 2JFMA 2QOKA 5FBNC 3KGAA 2XMYA 4FV0A 1UNLA 2WKMA 1SZMA 4J71A 4ZP5A 3TJCA 2X9FA 4K6ZA 4KKHA 3UO6A 3R1QA 3FZSA 1LEZA 5JGBA 2FB8A 4KSPA 1OL1A 2PZYA 2QOQA 3UZRA 4C61A 4H05A 3FI8A 4O7YA 3EQIA 4JAIA 4PMTA 2CNUA 3BHUA 2OIQA 3VF8A 4ARKA 4AZSA 5BX0A 3BGPA 5A4CA 3ZUVA 2NO3A 1REKA 2UVYA 4ASEA 5BVDA 2XM9A 4NKSA 2WQBA 2YIXA 5AEPA 3TT0A 3DTCA 3FLZA 4IAKA 5FP6A 4R7BA 4XP3A 4O7LA 2O64A 4BVUA 5EHYA 4B0GA 3R6XA 2EXEA 5FQDC 4F7JA 2OZAA 3LXLA 2VTSA 3UYTA 4HNIA 2Z60A 1GZKA 4AZVA 5T3QA 5EDPA 5HTCA 1IAHA 4R77A 4S32A 3QGYA 3ZFMA 2B9JA 1M2RA 2H9VA 4UV0A 1OKYA 1WBNA 5EW9A 1BMKA 4L3LA 3TCPA 2VWBA 4H1JA 2E9NA 3WF8A 3Q4TA 3MFRA 3QZIA 3V5LA 2BUJA 4FL2A 3UG2A 1R1WA 4XNEA 5AUXA 4ANBA 1JOWB 3S0OA 4MBIA 4O6EA 1NY3A 3D5WA 2O65A 3KRWA 1UNGA 2XK3A 4AGDA 4DG2E 4FV5A 3U6HA 2GPHA 3RCJA 1V0PA 4G9CA 1M52A 4M0YA 4I6HA 3HGKA 5D9HA 4OUCA 5FM3A 5E8TA 2W1ZA 4WA9A 3IOPA 5I9UA 4CMUA 4FYOA 3HV3A 5ANOA 1YXVA 3OWPA 2GCDA 2W5BA 4BTFA 4II5A 5H9BA 2AC5A 2XNNA 4FIFA 4NEUA 5B0XA 3UJGA 4EWHA 4KSQA 4IVBA 4YHFA 3BE2A 3T3UA 3CKXA 3O23A 4A4OA 3U6IA 1NW1A 3R1YA 3U4WA 3R1SA 4YJVA 1W98A 2FGIA 2VV9A 3BYOA 3W16A 2WTIA 1JWHA 5KKRB 5BMMA 2WD1A 3FDNA 1VYWA 3BX5A 1PW2A 2W5HA 3GU4A 4E3CA 3DNDA 5T68A 3NVMB 1W83A 3RKBA 1ZXEA 4AFJA 2W1FA 3P4KA 2G15A 3QC4A 4JVGA 3EFLA 3RI1A 5BYLA 2JAMA 3MPAA 4ZJIA 3RALA 4YU2A 1WCCA 4BBMA 4EZ3A 5FUTA 4ZSEA 4Q2AA 3LFFA 3D14A 3MY0A 3NSZA 1XH4A 5KHXA 3W33A 5LMAA 2FO0A 2QVSE 2ZV8A 4QNYA 3RMFA 4C4EA 3UQCA 4G34A 4A4XA 2I40A 3WF7A 3BQRA 2YIQA 3KMUA 2XUUA 2W17A 2XCHA 4JDJA 2ETKA 4Y5HA 4RVTA 5C9CA 3K2LA 4I21A 5GHVA 4FSZA 4MQ1A 5BVEA 4H58A 5FBOA 3VS4A 3SG8A 2IZSA 3ENMA 2W4JA 4O0VA 4ZSJA 4RIYA 4EZ7A 4ZJJA 3DOGA 5M56A 3E8DA 4EH2A 4JR3A 4CQGA 2YLEA 3AD4A 5KMKA 4FTLA 4NSTA 5IQHA 2VZ6A 4ZSAA 4X2GA 4YZCA 3PJ3A 4I93A 4RJ7A 2C6OA 2B1PA 5D10A 3KF7A 3WIGA 2ZM1A 3IW5A 3P5KA 1ZOHA 2VU3A 3DK3A 4F7LA 4NM0A 4MK0A 4B4LA 3ZLYA 4HJOA 3R71A 1X8BA 3OF0A 3GEQA 2PZPA 3ZC5A 4C02A 3P1AA 1OUKA 4N70A 1U59A 2B9HA 3ZLSA 4QYGA 3WZEA 1SNXA 4EWQA 2PU8A 2QG7A 4IBMA 3QTZA 1YW2A 4WIHA 4LRKA 1HCLA 3R7UA 3VS0A 3C1XA 2E9UA 3ZH8A 2QQ7A 1B39A 3TV4A 3JS2A 4AT5A 4FIHA 1WMKA 3H3CA 5GIPE 2I0EA 1V0BA 1Y6BA 3MDYA 1TQMA 3HP2A 4GVJA 4JNWA 2J0MB 3DS6A 3OY3A 4I23A 2W06A 3VQHA 1ZAOA 2R3RA 2VGPA 4QMWA 4D4VA 3IO7A 3B2TA 3EQBA 3A8XA 3G6GA 1P4FA 3C5UA 3OT3A 2WGJA 2QOBA 4ACHA 3EOCA 4CMTA 1PJKA 1ZWSA 3FMJA 1TKIA 3OWLA 4GV1A 4YHJA 2GS7A 1WVYA 3QQGA 3HMMA 3JYAA 4A07A 4O27B 4JX3A 4QMTA 4IAAA 2XCKA 3I6UA 3MWUA 3QHWA 4CG8A 3PLAE 2PMIA 5L2TA 1TVOA 2BRMA 3D15A 5E92A 3KA0A 4O82A 4BCHA 3BHVA 5IPJA 2YZLA 5IMEA 2V55A 1ZY4A 2ZMDA 3CY3A 3A4PA 4C62A 3EN5A 4MNFA 2YM4A 2ERKA 1XJDA 4G17A 4IACA 4C38A 3QYWA 4RJ5A 4YZMA 5AUYA 2FYSA 4Y5QA 4DGOA 3ERKA 5JFXA 3LFSA 2WOTA 3ORTA 3EH9A 4AGUA 2C6EA 2BAJA 5TT7A 3DLSA 3BHYA 5K5XA 3R8VA 4I0RA 1L8TA 3GCQA 4CVAA 5AIKA 4FVPA 4GT5A 2OZOA 2G01A 4AA4A 4X7QA 3QC9A 3QXOA 5DGZA 3F69A 3M2WA 3TNQB 2J2IB 4YC3A 4O7RA 1YQJA 3QTXA 3F5GA 4IAIA 4JJRA 4DITA 5CXHA 1XHAA 4ANSA 2VWYA 2CDZA 1GNGA 4O7VA 2DS1A 2GQSA 3VBVA 4S34A 5CVHA 4NJ3A 4YSMA 4FEWA 4F6WA 3JVRA 2J6MA 4AZEA 1YVJA 3GI3A 2GNFA 4AN3A 4CTBA 2OWBA 3ZZEA 3FQEA 3FZOA 3FLQA 3UIXA 3FZ1A 2XEYA 5DH3A 5DHJA 5ANJA 4E26A 2YA9A 3SLSA 3C4FA 5HIEA 4IMYA 2GMXA 3QWJA 2P2IA 4FSQA 3S00A 2BRNA 3UO5A 3WE8A 4FNYA 3SXFA 4QTCA 3RWQA 3QLGA 5CAQA 4N0SA 1VEBA 4FTNA 2XK6A 4MHAA 2C47A 2HZNA 5A6NA 1CMKE 2I0HA 2QO2A 3QXPA 1Q4LA 2OH0E 3MB7A 3FE3A 4RA5A 4TWNA 4ERWA 2CKOA 5HOAA 2YM8A 1KWPA 3DJ5A 3MJ2A 3ORZA 4CLJA 4EH3A 5HE1A 1FINA 5AAEA 4OW8A 3RJCA 4A9UA 4LOPA 3ORXA 3Q4UA 5EM5A 5AR5A 4ACMA 5IQFA 4BBFA 2R9SA 4CXAA 3V5PA 5A4TA 3WILA 4RC2A 2CN8A 5IQCA 4M67A 4BCFA 2FSLX 1XH7A 2ZV2A 2XRUA 3EYGA 2OXXA 4ZZOA 5JZNA 3C4XA 4RJ3A 2XIZA 3DQWA 4QMZA 3V8SA 4FE2A 1ZMVA 1RW8A 3KKVA 3AC2A 3FSKA 2JFLA 5DI1A 4X2KA 3G51A 4AW2A 2B9FA 4IWPA 3VUDA 4D1ZA 4A4LA 5T6KA 2YABA 2GHMA 2HELA 3DGKA 4FG7A 3UNKA 3QCSA 5L8LA 3SG9A 4ZTQA 5FDXA 5CLPA 4OBQA 2YHVA 2GDOA 4BCNA 3OCBA 1IEPA 3FKNA 3RAIA 3R7IA 5BUJA 5JQ8A 2PVRA 2VO3A 4QP1A 4R8QA 3NX8A 3GFEA 4BIBA 3JVSA 3QA8A 3LIJA 4KABA 3SRVB 2J0IA 5LCJA 4YLJA 4FA2A 2Q83A 2VGOA 2P33A 2YCQA 3UTOA 5GZ9A 3NUXA 4FKJA 3PG3A 3ZBXA 4QMNA 3PYYA 3I81A 2UZVA 3E92A 4BKYA 2GQGA 2X1NA 4YLKA 4CKRA 5AV4A 4BCQA 4Q5HA 3AC4A 4QPSA 5M55A 3SKCA 5L6OA 3KC3A 3C4CA 5JEBA 2XJ2A 2C6DA 5CF4A 4O86A 4IX5A 4PY1A 2UW9A 2X6EA 3VC4A 3RAWA 4JLCA 3N51A 5L8JA 3HV7A 4FV3A 5TR6A 3UZPA 1ND4A 3Q96A 4FOBA 2Y0AA 4FKPA 4FKVA 5HE2A 3D5VA 4FT0A 5I9WA 3PXKA 3O7LB 4ALVA 5IG1A 3QZGA 4EQMA 3LFAA 2ZAZA 4O21A 3FQSA 3QAME 1OL7A 2OICA 3KULB 4RC3A 4F9BA 3R8LA 5H3QA 4BZOA 3M11A 2HK5A 4ANNA 4D0XA 3DBQA 1BI7A 1ZZ2A 2FSMX 4BCGA 4BY9E 1S9IA 4QYHA 1Y8GA 3VS2A 3QTIA 4DHFA 4XHKB 3LFBA 1H1PA 4F9YA 1DI8A 3UODA 4JQ7A 3ULIA 4PPAA 1IRKA 3ZUUA 2QOLA 5IDPA 4F0GA 3LM0A 3MY1A 1H01A 4C4HA 5I9XA 3FHRA 4XX9A 1KE7A 3F3VA 3MI9A 5DRBA 5HE3A 5CF8A 3M1SA 4H3QA 3VIDA 4CNHA 3GQIA 1WBOA 2OF4A 2ZV9A 3GU5A 5BQ0A 4X2JA 5AFVA 1RDQE 3DAJA 1IA8A 4N4SA 3QGWA 2XNPA 2VTHA 3MS9A 1ATPE 3OC1A 2X8IA 2RIOA 5HORA 4I24A 5KMLA 4IE9A 2HZIA 2XKFA 2WMWA 4FEQA 2B0QA 3WARA 2C4GA 4HYSA 2IN6A 2XA4A 4F1TA 4KIKB 2IW6A 3MBLA 5M4IA 4USDA 2F7ZE 3F5XA 3EKKA 3RPVA 5M4CA 4IDTA 4E4XA 2YZAA 3I60A 1VZOA 5AIRA 2WB8A 4J97A 5CY3A 2RFEA 1WZYA 4FIEA 3IONA 4IVAA 3ENHA 4I5HA 3OTUA 3BYMA 1ZYJA 2R3GA 3LE6A 1P4OA 3KXMA 5F20A 3NNWA 4AGWA 4XS2A 4RFMA 4D58A 5I5ZA 4PX6A 4FKWA 4WBBB 3POZA 5J8IA 4HVHA 2W9ZB 2X4FA 1Q3WA 5HU3A 1G8SA 3UOKA 5DT3A 2F9GA 4TYHA 3UNJA 3BELA 4YNOA 3ZM9A 3QTWA 2VNWA 3ZLXA 4N57A 1FOTA 3G5DA 1UA2A 4M3QA 2RG6A 5IA0A 3ANRA 4IWQA 4J53A 3OCTA 3QQJA 2PYWA 4RRVA 2WTWA 3A8WA 3C13A 3D94A 5BVNA 4XP2A 5BUIA 3MYGA 5C4LA 3I5ZA 2ITUA 2F49A 2F2CB 3DLZA 4FOCA 1LEWA 3UPZA 4RIOA 3GNIB 4WUNA 5KZ0A 2OI4X 1MRYA 3OT8A 1PKDA 1ZRZA 1KE5A 3ALNA 3HA6A 5LXMA 3IPHA 2HW7A 2PE0A 3QRUA 5F95A 4FZAB 4I5PA 3PRFA 3HL7A 1Q61A 3FXXA 2CGWA 4X0MA 3R21A 3RP9A 4E6QA 1UWJA 4GFOA 3MFUA 3FI4A 2C5VA 3G9NA 5E8YA 2R2PA 2UUEA 2VTTA 3NIZA 4TN6A 5HG5A 3VBXA 2WTVA 4UWCA 1AD5A 5DIAA 1IA9A 1UKHA 3C7QA 4FKOA 1YI4A 4LGGA 1Q99A 4RT7A 1H0VA 4H39A 3U55A 4A9RA 5J9ZA 5EYMA 1XBCA 5L3AA 5G6VA 5KZIA 3SW7A 4OTGA 5HX6A 5IQAA 4KIPA 5CEIA 4K77A 3I6WA 4PTCA 5CU3A 4DE4A 2HWOA 3NUPA 2PVFA 2ZJWA 3AD5A 1Q8WA 4R3RA 1WBVA 4MXZA 4EUUA 3OHTA 3O71A 3TG1A 4EK6A 3RGFA 3Q2JA 4DH1A 3BHTA 1U4DA 3MTLA 3MVMA 2EU9A 2QKWB 3ETAA 5CU6A 3UQFA 3NNVA 3OTVA 2VTLA 3FMHA 3P79A 4GL9A 1QPEA 2UW8A 3EN7A 4O6LA 4LG4A 4AX8A 4G5PA 5J1WA 3KQ7A 4M8TA 4XBUA 4F4PA 3CXWA 2XEZA 1KOBA 3FSFA 3TZ7A 5CVFA 5IQDA 4EKKA 1QPCA 3TIZA 3K3JA 3TNPC 3CPCA 2J5EA 1YHVA 2RL5A 3Q4ZA 1JQHA 2C0IA 2R3JA 2P55A 2BRGA 3R7EA 3NAXA 4HPTE 3CJGA 4FG9A 5C8NA 2YM5A 4I5CA 2ONLC 2J4ZA 3BGQA 3LXPA 3Q32A 1UVRA 4GFMA 1P2AA 5K3YA 3T9TA 3VBQA 4QPMA 3FMLA 4Z7GA 3DBFA 4K9YA 3NEWA 3P9JA 1MQ4A 3I79A 5FGKA 4JS8A 2JKQA 4KA3A 3R9HA 5KMMA 1OIRA 2O63A 3PRIA 3DKOA 1CKIA 2WMXA 4G6OA 2Y4IC 3FL4A 1J1BA 2ETMA 5CAUA 5EYCA 4EOJA 4DA5A 5HNBA 2FA2A 2UVZA 4D2TA 5E4HA 3BZ3A 2VTAA 1Q41A 3DDPA 4L45A 1QPDA 2PVYA 3KVXA 1H0WA 4OLIA 4PL5A 3RPOA 2I6LA 4P2KA 5H8GA 4ALUA 3Q6WA 3NRMA 4ITJA 2HENA 4L6QA 4F63A 4IAYA 3R8MA 4DN5A 5GZAA 1H25A 1UU3A 2BHHA 3GFWA 1DAYA 2J9MA 2W1HA 4E5WA 4NL0A 3S2PA 4NU1A 2OIBA 1NVQA 2CLQA 2WMQA 3QUPA 3C4ZA 1MP8A 3ATSA 4FV2A 4PP9A 3KK9A 3DB6A 4FTOA 2JD5A 4Q5EA 5AP4A 5I9ZA 3EN9A 3Q52A 4BDIA 2ZYBA 4F64A 3BLQA 1SVHA 3MSSA 5DT0A 5DR6A 3RPSA 3O96A 3PIXA 5E1EA 1OITA 4FVQA 2J90A 2VX0A 5AX3A 4N6YA 3Q5IA 4OTIA 4O7SA 3MESA 4M12A 3UBDA 4KINA 4DFUA 2BDFA 2BKKA 4FIIA 3QZFA 3VNTA 5C4KA 4HGTA 4WG5A 5ITAA 3V6RA 4BKJA 3A7GA 4M69B 5IQGA 4CKIA 4OTHA 1VR2A 3OXIA 4O7ZA 3D7TA 3EJ1A 2JITA 3NW7A 5AM6A 2YIWA 1O6LA 2B9IA 3KRJA 2VX3A 3ORPA 3MA6A 3E8NA 5ANGA 1PRYA 3ZRMA 4AGCA 4ASXA 2EWAA 3BBWA 5HNIX 3Q9YA 3E64A 2XNMA 3GU7A 4EOKA 1GIHA 2W9FB 4OR5A 1O9UA 2YCRA 3AQVA 4DGMA 2Y4PA 3EFKA 4ZAUA 3EHAA 3E8CA 4YJPA 5JQ5A 5KMNA 2XNEA 4JIAA 3AC3A 4YTIA 2GSFA 3W2PA 1Q3DA 2CLXA 4EH9A 3ID6C 4Z16A 3CGOA 3L8PA 3OCSA 1CKPA 5F1ZA 4PMMA 4QYYA 4DG3E 4Y95A 3D2KA 2ESMA 3NS9A 4U81A 5M07A 4UZHA 4O0XA 2JDVA 2V5QA 4UYAA 4BZNA 3U6JA 3KMWA 1QL6A 4EK3A 3EWHA 4C59A 1GIJA 1JSTA 4EUTA 3PP0A 3QTRA 3ACKA 3PXZA 3C0GA 2WTKC 3OZ6A 1F3MC 2WO6A 4FSUA 5E91A 4BDEA 2W96B 4EZ5A 2EUFB 4IQ6A 4UN0C 3GENA 4BHZA 1PYXA 4JBVA 2JEDA 3GU6A 3TV6A 4DG0E 3QWKA 4CFFA 2W4OA 4KBCA 4EOIA 4EL9A 3NR9A 3A7HA 3OS3A 3S4QA 4HGLA 4UMQA 5K0XA 1OL5A 3OUNB 3HYHA 4MXCA 1PMNA 2QO7A 2UZOA 1E1XA 2RG5A 4F08A 3DU8A 2Z7QA 5AA9A 4DBXA 5LARA 3RAKA 4JBQA 4TYJA 3A4OX 3HDMA 4BTKA 3KCKA 4OTFA 4LMNA 4CFVA 1SYKA 4CT1A 3DY7A 3LVPA 3NMUF 5ANKA 2HZ4A 1JKLA 2XF0A 2JIIA 4YJQA 4O38A 4O0TA 4O1OA 4UXQA 3KB7A 4IZAA 2YDJA 3GVUA 1XWSA 1PXPA 4B9DA 2YCSA 3SW4A 4QMYA 1GZ8A 4KWPA 4ACGA 4CZUA 1W82A 2B7AA 4EOSA 2X2MA 5DA3A 5AWMA 4D4SA 1GZNA 4X6QC 4MWHA 1XH6A 5EQEA 4LOQA 5JGDA 3AMYA 5CI6A 4BWXA 4KBAA 4EH8A 3LHJA 1PXIA 4GSBA 3QD3A 5HVKA 4GG5A 3ZLWA 5EI6A 3W8LA 2WFYA 3BQCA 4L9IA 4FIGA 5CALA 3FY2A 3VO3A 1YXSA 3ALOA 2C0TA 1YWRA 3DAEA 5CZHA 1U5QA 5EM8A 2ZMCA 3G9LX 3ITZA 5K0KA 1YDRE 3I7CA 2HXLA 1H08A 4ZY4A 3TZ9A 1GZOA 4M15A 4IX6A 4K2RA 2OG8A 4MVFA 3RINA 3ZONA 3LQ3A 2XK8A 4FKGA 3DNEA 2H6DA 4QMSA 3U8WA 3K54A 3POOA 4GYIA 5EW3A 5IUHA 5KHWA 3HMPA 3C0HA 5EKNA 3BIZA 3A7IA 4HYIA 2WPAA 2XNBA 1OKVA 3PIYA 4E4MA 4EQUA 1OPLA 3CIKA 4BYJA 2BMCA 3DCVA 4IDVA 1V1KA 2CSNA 2WMUA 3TIYA 3O2MA 5CF6A 5H8EA 3R7YA 3FLNC 2YAAA 2OH4A 3BU3A 4M0ZA 5AMNA 5M44A 3VS5A 4DFXE 5J9LA 3TL8A 2YJSA 1Q8ZA 4FSYA 3BKBA 4W4YA 2YN8A 3BYSA 3ZXZA 2XP2A 3DBCA 2BZJA 5M51A 5M4UA 3A61A 4I6FA 3LAUA 3S3IA 2VO7A 2WXVA 3P0MA 3VHEA 4ZZMA 3OWKA 3ZFXA 3AMBA 3VHKA 4IWDA 4C3PA 3PJCA 5IUGA 1FGKA 2XYUA 2G2FA 4RGJA 4AZTA 5E8WA 4YJSA 2Y7JA 2B52A 2PVMA 2WAJA 2C5NA 5HNGA 4G3GA 1UNHA 4YJTA 4ORKA 1S9JA 2CCHA 2QOHA 4I0SA 2QOOA 3QALE 3QKMA 1P14A 4IVCA 4L7SA 3F3TA 1Y8YA 3R7VA 2YACA 3MTFA 5A9UA 2OFVA 2EVAA 3F3UA 5D1JA 3U4UA 4DF3A 4QOXA 2ZM3A 2PUPA 2XKDA 5CENA 4OAUC 5FXQA 3VVHA 3Q9XA 3Q5ZA 4WNOA 3KXHA 3PA5A 5HCXA 3PSBA 3D9VA 5CU2A 4ZLZA 2XIXA 4XH6A 4EK8A 2AYPA 4F0FA 3ZC6A 2WU6A 1G3NA 4AW0A 4DEHA 4X6RA 3EQFA 4AQCA 2QC6A 1OB3A 3FHIA 4NM7A 4FSRA 4NZWB 3EN4A 4XV1A 4C3RA 1K3AA 1Q24A 4DH7A 4FZ7A 3FUPA 4LL5A 1IR3A 1Q62A 4BB4A 3HDNA 3GT8A 4R3PA 4AF3A 2SRCA 3WE4A 2VWZA 2IVVA 3SAYA 4FTKA 1BI8A 4X3JA 3H9RA 4H3PA 4LUDA 4FYNA 4G6NA 4YGAA 2WEVA 1BKXA 3JR1A 2HCKA 3UMXA 3TZMA 4BYIA 5IISA 3NIEA 4HYHA 3KRLA 1JKTA 2QHMA 3MFSA 4ZS0A 2PUNA 2G2IA 1OKZA 4M13A 3RZBA 4BICA 3ZMMA 4BDBA 5IEYA 3EQDA 2BZKB 3GUBA 3QUEA 1U5RA 3MA3A 3R22A 5M08A 4HPUE 5M09A 2O8YA 3RBWA 4GU9A 4KS8A 4YC6A 1OIYA 4OBOA 4E73A 5DEWA 3BI6A 4E6CA 4F0IA 4RX5A 1FMKA 4FF8A 3P23A 4FNZA 2O2UA 4ZTLA 5AAGA 3HAMA 2ZM4A 1IASA 4YJNA 5JZJA 4BCJA 3IK3A 4FNXA 3ZHPC 1SMHA 4X2FA 4FC0A 4IAZA 2BALA 5EHOA 5IUIA 1DI9A 5FM2A 4GEOA 2BCJA 1ERKA 4ANMA 3QF9A 3R9RA 3VN9A 2GFSA 3QQFA 4ITHA 2VWXA 4ITIA 4GT4A 4IEBA 4RJ8A 3ZRKA 4B8MA 3FI3A 4WKQA 3HKOA 4IZ5A 2GNIA 2QG5A 3V04A 3ZSGA 3G0FA 2YWPA 3VBTA 4DC2A 2NPQA 1RJBA 4HZSA 3LFEA 4O7NA 4W4XA 3OW4A 4HVGA 3IS5A 4J8MA 1UWHA 2ITOA 1OBDA 2RF9A 4JOAA 4L46A 4E4NA 1CKJA 3N4UA 1W8CA 4NFNA 5FTQA 3GC7A 5J7HA 4F09A 3DZQA 3W18A 2IG7A 5TE0A 3PIZA 3LMHA 5A4QA 1NA7A 3A7JA 5EFQA 2QU6A 3GOPA 3WF5A 4C35A 4C2WA 2PUIA 2WMAA 5BPYA 1MRUA 2WQEA 4MTAA 3V6SA 4L8MA 4UMUA 5A3XA 2R3PA 3RAHA 2PE2A 4JRNA 3VUKA 5AV2A 5J1VA 4QYEA 2BTSA 5CAVA 2XVDA 3OD6X 3QL8A 2X7OA 3BWFA 1YXTA 3Q9WA 5JKGA 3PTGA 4IX3A 1ZOEA 2JKMA 4J1RA 4NIFA 5HU9A 3GXLA 2ACXA 3ELJA 2NNWB 4GIHA 3D7ZA 3QHRA 4FV8A 3DTWA 4D5HA 4PL3A 4AWIA 3ZO3A 4IW0A 3PXFA 5E8VA 1BLXA 5K9IA 3VUGA 2G1TA 5ETIA 2HZ0A 4K18A 2NRYA 4ANQA 3FMDA 3UC3A 4AOJA 3T3VA 5ACBC 2JKOA 4IADA 5A14A 5J95A 3QU0A 3TDVA 5AJQA 2VWUA 5J7BA 4FKRA 1ZLTA 3LQ5A 4LYNA 4C33A 2QOCA 3ZCLA 2ZB0A 4FV6A 3FLSA 4DCAA 4IHPA 4YPDA 4XUFA 2WELA 4FSTA 3EQRA 1I09A 5C27A 4UMPA 2JKKA 4ASDA 4QO9A 2C3LA 2QOIA 3H0ZA 4DFLA 5M06A 4EOLA 4RJ4A 4RX9A 5AV3A 4WOVA 1Q5KA 4ZTHA 3FZPA 3IQ7A 4U43A 2ITZA 4JG8A 3VUMA 1YOJA 3LM5A 2E2BA 5HIDA 2JC6A 5FP5A 1H8FA 1M14A 1OI9A 2UW7A 4JQ8A 5CYIA 3ZBFA 4EH5A 4ZJVA 3LCSA 3R2BA 3W8QA 1URWA 4I92A 2Q0NA 1OUYA 2QOFA 2IJMA 3E62A 3NUNA 4TWOA 2PPQA 1UU9A 4CV9A 5HO6A 5CAOA 5EK7A 4QTBA 4R6VA 3KREA 4NW6A 2PE1A 1SM2A 3PSDA 4AOTA 2BIKB 4FVRA 4GUEA 3DQXA 4GUBA 5CANA 3DK6A 4Y8DA 4AA0A 4RBLA 4F7NA 5DT4A 4QP4A 3CTJA 3ZOSA 5E90A 1QCFA 4F9CA 4DEAA 4Y73A 4KIOA 5CEPA 2X2KA 1BL7A 4BCKA 1SNUA 3VULA 4G16A 3ZDIA 3KMMA 5F9EA 1HCKA 3B2WA 1P5EA 3COIA 3E3BX 4RIXB 4PRJA 4CFNA 4CCBA 4L01A 3UZTA 4ZK5A 4XV2A 4EC8A 2GHGA 3PE1A 1R3CA 2BAQA 3CTHA 4JT3A 4FL1A 4YO6A 1PMVA 2XBJA 4FKTA 4TNBA 3R8UA 5BMSA 5AUWA 5KNJA 4K33A 4XCUA 3F2NA 4TYIA 3IOKA 3R00A 2J0JA 3LQ8A 3CKWA 4EKLA 3MJ1A 3HV5A 4G3FA 3GGFA 1CTPE 1F0QA 2WTDA 4O91A 3VJOA 2WIHA 2BAKA 5AR7A 4LOOA 4V0GB 3U9NA 2Z7LA 4OTDA 3RHKA 2V22A 3Q9ZA 4F7SA 3QCXA 1H28A 3SHEA 5FTGA 4E93A 3PPJA 4Y83A 2GNLA 2A2AA 3MH2A 3VQUA 4RVMA 3RWPA 3IW7A 1KV1A 3A60A 4QQTA 5DFPA 4EOOA 3PJ1A 4OTRA 4RVLA 4ZLYA 4BDHA 2R7BA 3H0YA 5LVPA 2Y4IB 2VRXA 3SX9A 3ORMA 2PHKA 3UIUA 4AOIA 5TKDA 4XLIA 2OJ9A 4D55A 4EI4A 3LFNA 2V7AA 1AGWA 3COMA 3DJ7A 4YHTA 5IA5A 2PVJA 2Z2WA 1ZY5A 4XG2A 1AQ1A 2WIPA 2Y6MA 3KF4A 4NM3A 4FG8A 4KRCA 4WSYA 3C4EA 3NW5A 5K4JA 4JG7A 1OIQA 5EYDA 3FEGA 3SGCA 2V62A 3D83A 3WZKA 5A4LA 5DMZA 2ITVA 1ZZLA 2HW6A 4CQEA 4ZLOA 5C03A 4L52A 4CGAA 2OKRA 1YWNA 3VS3A 3OOMA 3L9MA 3QX2A 4XOZA 3MH1A 1OL6A 3MH0A 3OMVA 5IDNA 4G3EA 4M14A 4O81A 4U0IA 3BE9A 3SRVA 3NUUA 4NFMA 2HXQA 3BLHA 5EDRA 1LPUA 4V05A 2W1EA 3MVHA 2XIRA 2H96A 3BEAA 4GK4A 5K4IA 5HKMA 1WBSA 3JUHA 3OWJA 2GS6A 4DLJA 3F3ZA 5ANDA 3G2FA 4LV5A 3AMAA 1XBAA 1WBWA 1PMEA 4TYEA 3RNYA 3ZUTA 1BX6A 2YDKA 4TRLA 5IF1A 2WTJA 4DFBA 3F9NA 4YC8A 4BI2A 2VTJA 5IQIA 2RGPA 4AW1A 2W5AA 4W9XA 4FTRA 1FMOE 5CT7A 5L2SA 3C4WA 4JXFA 3C9WA 4C3FA 3EB0A 4MNEB 5AAFA 2EB3A 1PMUA 3UMWA 4EORA 1OM1A 2HYYA 2JDRA 2WEIA 2CHLA 3K5VA 2OXYA 4O7TA 4FEVA 2IZRA 2LGCA 3OBJA 4QQ5A 1QMZA 3CC6A 5AR3A 2E9VA 4WHZA 3P7CA 4TYHB 5C01A 1J7IA 2IZUA 3CTQA 2ITWA 4DEEA 2JIUA 3H30A 3V8WA 1NVRA 1G8AA 2W99B 3E63A 1VJYA 2R3FA 3NYXA 4OBPA 5B2MA 5A4EA 2CNVA 2P0CA 5AUTA 4U80A 4APPA 2W4KA 3QUDA 1H1QA 3UIMA 4O0YA 4K8AA 4OT5A 3Q04A 3F66A 5HBHA 4DFYA 3Q6UA 4ACCA 4D1SA 3UGCA 4G1WA 5CEQA 3O51A 3HECA 4GKHA 4WO5A 1I44A 3E8EA 3H10A 4XRJA 3S95A 4QMMA 4BWPA 3TKIA 3LLTA 5C26A 3PZHA 3E7VA 1EH4A 2IVUA 4DGLC 3V51A 5E1SA 4TW9A 4FV9A 5ETCA 1H24A 2IZTA 2PK9A 1H1WA 2FSOX 5FEQA 5HLPA 3VRZA 3QX4A 3RM6A 4CLIA 5LOHA 1ZOGA 2WTKB 4QYFA 4W9WA 2BZIB 2GNJA 3V5QA 4UX9A 2HY0A 4TZRA 4L7FA 2BR1A 2HAKA 3OEZA 2BHEA 4HW7A 4CFWA 3C0IA 2VX1A 3GC9A 2ETRA 3THBA 3O7LD 2JDTA 4YR8A 1WFCA 4KIKA 4MXOA 4O0UA 3SXRA 3CR0A 4MBJA 4BCMA 4MCVA 4AU8A 5L4QA 5LMBA 4IB3A 4GVAA 1KSWA 3QQHA 2GTNA 2YJRA 3FL5A 5FXRA 4GMYA 2C3KA 2X39A 4NCTA 1XO2B 3QTSA 3NVKI 3UO4A 1FVVA 4C34A 2A19B 3RK7A 4AXAA 5JGAA 3A62A 5JT2A 3KU2A 5ANEA 4AN9A 4PDOA 4P7EA 4FMQA 3E7OA 5D12A 3QD4A 2R3LA 1R39A 3QTQA 3E3PA 3FV8A 3PXYA 2ZDUA 4O0SA 3ZEWA 4DTAA 3FXWA 4PTEA 5FDPA 3ORNA 5CAPA 4AACA 2PUUA 2R3NA 2VTMA 3FYKX 2KTYA 2OFUA 3OXTA 4I6QA 4IC7A 2HIWA 3VUHA 3UP7A 4R7IA 3ZEPA 4AZWA 4B7TA 4C8BA 4C7TA 4MBLA 2YFXA 3QTUA 1NXKA 4PDPA 4NTSA 5KUPA 4UALA 1FBNA 3PJ8A 3OY1A 1PXNA 4JAJA 4E20A 2C68A 4QMVA 4BGHA 3KFAA 3CS9A 4LI5A 2IVTA 3PUPA 2QO9A 3KRXA 4A9TA 3FMEA 3II5A 3M42A 3OOGA 5AP6A 4F65A 3FZRA 3JY0A 5AM7A 3RVGA 4RLKA 4S31A 2A1AB 3U87A 4EK4A 4IANA 3WZUA 2UW0A 4MAOA 2LAVA 4B99A 3PVUA 4UXLA 2GNGA 4WRGA 1HOWA 2OXDA 3G0EA 2I0VA 4BN1A 3B8RA 4DFZE 4YJOA 4X3FA 2C6IA 2PVNA 3U51A 2W0JA 3R30A 3MPMA 1PKGA 5HG7A 3LCDA 4J99A 5D7AA 2B55A 4U40A 3PY3A 3VS1A 4U79A 2YM6A 5FG8A 4FK6A 4XP0A 5BVKA 4TNDA 5JH6A 5DNRA 2PMOX 1H07A 3R83A 1RQQA 5I9VA 3HRCA 2XJ1A 3IG7A 4U5JA 3RZFA 4QMQA 1Q8YA 5HCYA 4QRCA 4D9UA 3MVJA 2IW9A 4P4CA 4CCUA 1GOLA 1M7NA 4LM5A 4UB7A 2GQRA 3RNIA 3PLSA 3RM7A 4GRBA 4O7WA 3DFAA 4U3ZA 2XJ0A 4R78A 3MIAA 4D2RA 4W4VA 4DLIA 2WNTA 4RFZA 3WYYA 3DXQA 4O84A 2O3PA 4PTGA 5JFWA 3OVVA 3NYNA 1KOAA 4EJ7A 3UPXA 2XYNA 2W1IA 2Z7SA 3DBEA 3LPBA 5B2KA 3RHXA 2VWIA 4C4GA 1JSVA 4KNBA 4TT7A 4FZDB 4XG8A 2R3HA 3R9OA 4BWKA 3AGLA 1ZYSA 4FICA 4CZTA 5CU0A 3LMGA 1B6CB 4A06A 2F7EE 5IA4A 2C1AA 5BVFA 1OIUA 3PXQA 3MH3A 3F7WA 5AUZA 5IA1A 2C30A 4XG3A 2OJJA 2WQMA 3DV3A 3CQUA 2R5TA 4IM2A 5EDQA 4X21A 4BCOA 5CNNA 4PNKA 1Z57A 4BDAA 4J95A 2OJGA 4MXYA 4WSQA 3FI2A 2VTNA 3PJ2A 4BDKA 4NW5A 4QMPA 4CT2A 3AT4A 4NYEA 3TEIA 1KE6A 3VJNA 3LFCA 3SVVA 4FBXA 3IGGA 4WNKA 5IH6A 1PY5A 1BL6A 1L3RE 3WF6A 4ZS4A 4EOQA 2X9EA 3QRJA 4J52A 4QQCA 1LP4A 3OBGA 2P2HA 4AUAA 5A54A 3R7GA 4EYMA 3KL8A 4L68A 2X8EA 5HCZA 4QP3A 4K11A 1U54B 2G9XA 4CYIA 3WYXA 2WTCA 5AUVA 2DWBA 3ORLA 3I0QA 4FODA 1XH5A 4CMOA 2OW3A 4MH7A 5DR9A 3LJ0A 2UW4A 4P5QA 5JK3A 2UV2A 4YLLA 4BC6A 2CGVA 3E88A 5HG9A 4AFEA 1CDKA 1OL2A 1WVXA 3FJQE 3QLFA 4M7IA 4W4WA 5DEYA 5FTOA 2V0DA 2W1CA 4GK3A 5HD4A 4AA5A 3FY0A 5J79A 5HQ0A 3ZU7A 1JLUE 2WMSA 3W55A 4ZIMA 4OTQA 3ZYAA 2UZDA 4QPAA 3W2RA 1OGUA 4KBKA 4U7ZA 5AX9A 3PVBA 3UVRA 4YTFA 4UWBA 2PTKA 4C2VA 4FV4A 5KE0A 4M69A 1UKIA 1R78A 4JDHA 3F5PA 4J8NA 2Z7RA 5CT0A 4BZDA 3L9LA 2AC3A 3LLAA 4XG4A 5CSWA 4O0WA 5IKWA 5KMIA 1F5QA 3D5UA 4PPBA 4Z7HA 4OTWA 1PF8A 2UVXA 4MD8E 4XG7A 4TKSA 4Q9ZA 3NCZA 1JNKA 1NT2A 4GJ3A 3VWAA 5LVOA 3AC8A 2QURA 4XOYA 3WBLA 4GS6A 1XKKA 4R5YA 4FKIA 4I22A 3LFQA 2CPKE 1OZ1A 2ITTA 3ACJA 4FGBA 3UIBA 4XLVA 5HTBA 4I94A 5CQWA 3CD8A 4PDYA 4PMSA 3TUDA 3W10A 2XK7A 2JDSA 2WU7A 3D0EA 4IM3A 4MF0A 3UNZA 3TXOA 3R8ZA 3LMIA 5HI2A 3W2SA 4G2FA 4XRLA 4RIWA 4NUSA 2J51A 4FSMA 2OZAB 4K1BA 2X2LA 3MW1A 4BDGA 4E5AX 3COHA 3FLYA 3L9NA 3TTIA 4BBEA 3KXGA 3EN6A 1GAGA 4IC8A 2ITXA 4PQNA 3GB2A 2PMLX 3HUBA 4HNFA 4XG6A 5H2UA 4BDCA 5IMXA 4ZMEA 2B54A 3TKHA 3IW6A 4H3BA 4X3FC 3HZTA 5HO8A 2HOGA 3ORKA 4FEXA 4U9AA 3WIKA 3AT3A 4RWJA 2I1MA 2X7GA 3LCOA 3PA3A 3BU6A 2C6KA 2EB2A 2YDIA 4AAAA 2R64A 2YISA 4G5JA 4ENYA 4YTCA 2R3IA 3L8SA 3HMNA 2WMBA 4JL9A 2PY3A 4LRMA 4XYFA 5K5NA 4PMPA 5IQEA 3LJ1A 4JQEA 5F4NA 4NM5A 3F7ZA 4O22A 2XIYA 4O96A
chains in the Genus database with same CATH superfamily
2PSQA 4IZYA 5DPVA 5ETAA 2H8HA 2OJIA 3NUSA 3PDTA 2KULA 3QA0A 5JRSA 3OUKA 3UOHA 4RWIA 3AT2A 4ANLA 3ATTA 2R3KA 3QD2B 4R1YA 4EEVA 3OG7A 2ERZE 3KXXA 4LQMA 5CEMA 2QLUA 2VTPA 4BJJA 1PXOA 1VYZA 2CGXA 3ZZWA 4GG7A 5AV1A 3ET7A 4MKCA 4I0TA 4LRJA 2BTRA 4M66A 4NH1A 5DLSA 1H4LA 2JBPA 5BUEA 3UVPA 4L53A 4U8ZA 5LJJA 2XANA 4AS0A 3GCPA 4MYGA 4ALWA 2BKZA 3G90X 2QD9A 3GQLA 2CKEA 3SDJA 3T8OA 1XBBA 4CRLA 3TKUA 2C6TA 4UMTA 4JBPA 1E1VA 2OU7A 2UW6A 3UP2A 3EL7A 4QQJA 2A0CX 3OXZA 3CLYA 4KS7A 4MD7E 4WBOA 4J96A 1CM8A 5GZ8A 3I0OA 3EZVA 3EKNA 3QKKA 5EI8A 2O0UA 4RIYB 2R3QA 4YURA 4YO4A 3ZO1A 3NWWA 4D0WA 3ZSIA 3PPZA 2ITYA 1MRVA 1TQIA 4AXDA 3R04A 3NUAA 3A99A 1GJOA 2X4ZA 3H9OA 3N4TA 3JY9A 4I1ZA 4EHEA 4OAVB 4S33A 3VW8A 3F6XA 3EZRA 4BKZA 1LR4A 3IDPA 1PXMA 2Y6OA 3PVGA 4YNEA 4P5ZA 4XG9A 3FMMA 1XH9A 2BVAA 3BYVA 2UZBA 3IDCA 3SV0A 3CEKA 3OP5A 3TNIA 3PP1A 2FVDA 1Z5MA 2C5OA 4O4BB 5CVGA 4YUQA 5CASA 4CG9A 2PZ5A 5FXSA 4TWPA 4APCA 4IH8A 2VTQA 3NUYA 2YITA 4RX8A 2WMTA 5DG5A 3WI6A 3R01A 3MY5A 4KAOA 1MUOA 3JXWA 4FT7A 4YTHA 3NNUA 3BYUA 4DAWA 3NNXA 5CEOA 3QQKA 3FQHA 3O0GA 5AR8A 4IX4A 4BI0A 1K2PA 4CFUA 1H26A 1WAKA 4D9TA 4NWMA 4RFYA 3C5IA 4NTTA 5EKOA 3LJ2A 3LFDA 5LWNA 4F9AA 2IVSA 4EHGA 2FH9A 3QRIA 4YP8A 4ZEGA 2ZVAA 3UC4A 3BL7A 3AC1A 4TL0A 1Z9XA 2VTRA 3QQLA 3BLRA 4MXXA 2PWLA 2X0OA 5CI7A 1WVWA 4GCJA 2P4IA 2VAGA 4RA4A 5J5SA 1SVEA 4QTAA 2A98A 2NYAA 4V01A 3NFGB 4AE6A 1PXLA 2XS0A 2NP8A 5BVOA 3UVQA 3B8QA 3TWJA 4F6SA 2Z8CA 4KD1A 3GCVA 4ONAA 1H00A 4YJRA 3I4BA 4AN2A 4F6UA 4CKJA 2VUWA 2WHBA 4FT5A 5LQFA 2VNYA 3LXNA 3PPKA 3UYSA 4CEGA 4E8AA 3RPRA 2WZJA 4MF1A 5EQYA 4DEGA 2BRHA 1GIIA 1XH8A 3R73A 2BRBA 3CCNA 1BYGA 2XNOA 4KIQA 2X0QA 3W0RA 3P5JC 4U97A 2DYLA 2R4BA 1R0PA 4USEA 4RLLA 1TQPA 5CF5A 5IEVA 3MIYA 2FSTX 3HV6A 4LUEA 4O2ZA 5I0BA 3VAPA 5HESA 1YKRA 2H34A 4NJDA 1Y6AA 4CFXA 5E8UA 4AE9A 5J5TA 3PFYA 2J7TA 1MQBA 2XKCA 2F7XE 2QKRA 4LGDA 4XBRA 4PPCA 5GJFA 4GKIA 5ICPA 2CN5A 4L3PA 3IGOA 4FKSA 3L9PA 1OGYA 1FVRA 5DN3A 2YCFA 4YPSA 5IA3A 1FVTA 5LMKA 4CFMA 4PWNA 3W2CA 2PZRA 4NIFB 3KY2A 5CX9A 3NLBA 4BTMA 2RKUA 3GP0A 3P7AA 1DS5A 3FMKA 5AP0A 4I6BA 4U44A 4MX9A 2O5KA 3G6HA 1O6YA 4WT6A 4I5MA 3GU8A 4JMQA 1FPUA 3K5UA 3BHHA 4J98A 2YM3A 3NYVA 4EJNA 2I7QA 4IM0A 3D2IA 1KE9A 1W7HA 2BDJA 4QMOA 5CS6A 3WZJA 4AG8A 1JBPE 2RSVA 4TY1A 2CNQA 2W1GA 3R7OA 4RQVA 4U42A 4DGGA 1E9HA 3HUCA 2J0KA 4KKEA 3VF9A 4E4LA 4EBWA 3QKLA 2GTMA 2C3IB 3GBZA 2ITNA 3BPRA 4D28A 3CE3A 4IJPA 3H9FA 2RFNA 4D2WA 5HGIA 4RVKA 3DBDA 4YJUA 3TN8A 4FI1A 1Y57A 5BNJA 3IDBA 3DKGA 2WQOA 5EI2A 2QLQA 3DFCB 1JKKA 2YEXA 3R02A 1APME 4L3JA 3R8PA 3VUTA 5TF9A 3COKA 5HE0A 4DTKA 2W05A 3K3IA 5CTPA 5JSMA 2J50A 3FWQA 3ZS5A 2CKQA 4XMOA 3SOCA 4C36A 3SC1A 1YOLA 3IECA 4GYGA 5EM7A 2UZEA 5TOZA 3N9XA 4BDDA 2Z02A 5EOBA 4F99A 2XIKA 4DEIA 3C51A 4DHJA 4BTJA 3AKLA 4IFGA 4TWCA 4YBJA 1PXKA 3HRFA 3P08A 4FUXA 3EQPA 1M17A 1SVGA 4V04A 3RPYA 3OCGA 4O0RA 3FLWA 4QD6A 1KV2A 4HVDA 3BBTB 1JPAA 4GIIA 5D7VA 5EOLA 5HO7A 4C57A 3D4QA 4FK3A 3W2QA 2IW8A 4C58A 1O6KA 3ROCA 3OFMA 1A9UA 5CSVA 2IWIA 3G33A 5IU2A 2C0OA 4L44A 2ZV7A 2CJMA 1YXUA 1WBTA 3FPMA 3NYOA 4QMLA 3KRRA 4Z55A 4DFNA 4QP9A 1Q8UA 4GT3A 3BV2A 4Q9SA 3RTPA 1B38A 4FTUA 1KE8A 4D2VA 3VS6A 2YIYA 5AP5A 4HZRA 3QYZA 1YDTE 5EG3A 1JAMA 2GU8A 4FTTA 3PZEA 2XK9A 4MXAA 2UW3A 1OVEA 3TZ8A 2UZTA 5GJDA 3PUFC 5GINE 4O2PA 3FYJX 4D4RA 2AEGA 1GY3A 2YERA 4M97A 5BYZA 3AC5A 2C6LA 5CSHA 5KX8A 3ORIA 5HICA 3VUIA 1YRPA 3PXRA 2QU5A 2XZSA 3I5NA 2PL0A 3PWYA 3FC2A 5M57A 3O8UA 4NKAA 5CWZA 4AT4A 1T45A 4AZFA 2E9PA 3BCEA 4DEBA 4EOPA 1V0OA 5KKRC 3CQEA 4U6RA 4D1XA 1W0XC 3ZSHA 3PSCA 4RWKA 3ZTXA 4RZWA 4WUAA 4DTBA 4QP6A 3CPBA 2QODA 5HVYA 3BLAA 4IJ9A 3L8VA 4PL4A 4QMUA 3ULZA 2J0LA 3W0OA 2XH5A 3NDMA 2YIRA 3KK8A 4UYNA 5IQBA 5F94A 5BYYA 4FKLA 1QPJA 2OJFE 3DDQA 5JN2A 2UZNA 3MB6A 4IB5A 4HVSA 2QR7A 4MD9E 4FV1A 4BI1A 4F70A 5A6OA 3MPTA 4IIRA 5JMSA 3QQUA 4ENXA 4EH7A 4QNAA 5B7VA 5L8KA 2PULA 3AKKA 2Q0BA 2PVLA 3OW3A 4R1VA 3HMOA 3F2RA 5CQUA 2VD5A 4DYMA 2I0YA 3Q4CA 3WZDA 1M7QA 1U46A 3IKAA 3ZXTA 3DKFA 4QDEA 2A27A 4QP8A 4PP7A 5KBRA 2OF2A 3TDWA 2GFCA 4S2ZA 4ASZA 3KEXA 1PYEA 2VWWA 4FTJA 1M2QA 4D2PA 4ANOA 4FKUA 4HCUA 2UZUE 3WF9A 4QEBA 5CXZA 1Y91A 2PMNX 2XBAA 2YM7A 3BWJA 3WOWA 5J9YA 4PUZA 4BGQA 5JRQA 3IW8A 4FEUA 3AXWA 4FZFB 3UDBA 3UG1A 1A06A 3DB8A 3V5JA 2NRUA 3V01A 4A7CA 4QTEA 2DQ7X 2XRWA 4RIXA 3NAYA 5AR4A 1PHKA 5EHLA 3LZBA 5IZFA 3R28A 4RJ6A 4F1MA 1UV5A 2BFYA 3QBNA 4FR4A 4KUJA 2Y9QA 1UU7A 3QFVA 4FT3A 3ANQA 4BCPA 4AXCA 4ZOGA 5HIBA 2C3JA 3DT1A 4BGGA 4EHVA 4KRDA 1JKSA 3PG1A 3CP9A 1PXJA 3GC8A 5EH0A 1OPJA 2W7XA 2V7OA 5LMKC 2ONLA 4W8DA 4ZXTA 3AOXA 5HZNA 5M4FA 4CV8A 4G9RA 2B4SB 3PY1A 3HAVA 2F4JA 4V0GA 1UU8A 1ZMWA 3TJDA 3L8XA 5G1XA 4B6LA 3DA6A 4UZDA 4U3YA 3UE4A 3EL8A 1Q8TA 3DPKA 4DH8A 4M68A 4ZTRA 2VWVA 4UEUA 1DM2A 3H4JA 4S30A 4BDFA 4D4YA 5L2IA 5LWMA 4QMXA 5C8KA 2VO6A 3NZ0A 3SOAA 3LKMA 1R0EA 2BROA 4OT6A 4M84A 4IVDA 4L00A 2PVHA 3TNHA 3E93A 4J7BA 4BR3A 5B2LA 3GC0A 3QCYA 4DT9A 3GCUA 3NW6A 4BDJA 4QT1A 3D5XA 1OPKA 2REIA 3T9IA 4F9WA 4USFA 2ZDTA 5C8MA 4P90A 4U41A 4Z9LA 4PF4A 2QNJA 4F1OA 2ZB1A 4FV7A 1YDSE 4XEYA 4RZVA 3LXKA 3KULA 3MGYA 3UOJA 2E9OA 4YZNA 4JBOA 4TPTA 5AR2A 3W1FA 4CD0A 5HTIA 4R5SA 4AP7A 1NVSA 2X0PA 2EXMA 3FZTA 2WMRA 3VS7A 5EW8A 3AD6A 5FEDA 3PY0A 4PNIA 5EQPA 4ZTSA 5HLNA 4U45A 3W0NA 3PWDA 4G3DA 2UW5A 3BEGA 4TYGA 2C1BA 3V5TA 4YZDA 2F2UA 4EK5A 2UZWE 1YI6A 3R2YA 4I4FA 3FMNA 4EH6A 3SA0A 3PFQA 3PA4A 3KN5A 3MN3A 4LFIA 5E7RA 3TYKA 3NPCA 3SQQA 5HBJA 2JGZA 3KXNA 4PDSA 4EH4A 2RFDA 5D41A 4HVIA 2VTIA 1DAWA 2WQNA 3O17A 2OGVA 3R1NA 4YZ9A 4RG0A 5LVNA 2X8DA 4YZBA 3Q3BA 5L6WL 3V8TA 4Y85A 4DH3A 5L2WA 2JAVA 4XV9A 1T46A 3EQHA 4FTMA 5FRIA 4DBNA 3VRYA 2VTOA 1G5SA 4R3CA 1YOMA 3QCQA 5FLFA 4EQCA 4ERKA 4AT3A 2FUMA 4MNEA 5EM6A 5KCVA 5KMJA 4G31A 2RFSA 4N6ZA 4WG4A 3HA8A 5ETFA 5J87A 3U9CA 5DR2A 4ZZNA 3HX4A 2XB7A 1YHSA 3CGFA 4AW5A 1K9AA 4K0YA 3TTJA 4JDKA 5I9YA 3C50A 4QP2A 5GNKA 3ZFYA 4FGRA 3DK7A 4H1MA 1ZMUA 3CD3A 3L1SA 4D2SA 1XQZA 4WNPA 3PVWA 5KMOA 3KXZA 3OROA 1ZYLA 2JIVA 2QR8A 4PV0A 4WD5A 5FWKK 3VBYA 2OK1A 2YLFA 3QZHA 1H1SA 4EOMA 2PVKA 3ZRLA 2ITPA 1OBGA 4ZMFA 1URCA 4A9YA 4ID7A 3EFJA 4JI9A 4RC4A 3TUBA 2XNGA 4HCTA 4ZTNA 3PE2A 4RQKA 5HD7A 3QD0A 4OGRA 3F61A 3R63A 3F82A 3UQGA 3FXZA 4IB1A 4UMRA 3I1AA 4Y72A 4FKQA 4BRXA 5IH5A 2B53A 4BFMA 4TTHB 5DOSA 2PZIA 5M53A 4ACDA 5GJGA 3DJ6A 5A46A 5DWRA 4FSWA 5GIOE 2XM8A 2BPMA 1YXXA 2XK4A 2F57A 3UDZA 3IW4A 4HOKA 4ZY6A 3AGMA 1Q97A 4E7WA 1OKWA 2IPXA 4CTCA 4BCIA 4C4JA 4ZSLA 4RPVA 2OLCA 4D5KA 4X3FB 3CQWA 4WRSA 5CU4A 3BU5A 4H36A 4XV3A 4L42A 4MQ2A 5HEZA 4C4IA 3UOLA 2EXCX 5I3RA 3HVCA 1H27A 3F2AA 3E87A 3KN6A 3LCKA 5HLWA 3QRTA 4GJ2A 1J3HA 4O4DA 4BIDA 5LVMA 2W1DA 4TXCA 4FTCA 5ANIA 3V3VA 4CYJA 4FT9A 4DEDA 4FTQA 3ODYX 3P86A 3HMIA 4WNMA 2VO0A 2QCSA 2X0GA 3EQCA 5E9EA 4O83A 3A7FA 4IFCA 4ZTMA 5KO1A 4I4EA 1REJA 2JBOA 5IH4A 5DBXA 4ZSGA 5IEXA 3P78A 1STCE 1ZARA 4HYUA 4BL1A 1CSNA 2C5XA 4FL3A 2CGUA 1J91A 2OBJA 3MV5A 1JSUA 4C0TA 2GNHA 5DYJA 1BUHA 5AP1A 3W0PA 4DINA 2G2HA 3FKOA 3FC1X 3R9DA 4EBVA 3SXSA 3W32A 3TUCA 3E5AA 3EFWA 4Y46A 1J7UA 3U54A 4FTIA 1J7LA 3VBWA 4YBKA 4W8EA 5DVRA 2JLDA 2R7IA 1LUFA 2X81A 4IWOA 4I41A 4FZ6A 2GS2A 4FTAA 2R3OA 5HVJA 3CSVA 4E1ZA 4RSSA 5AP2A 3NCGA 1RE8A 1ZYDA 2GHLA 1IG1A 2R0UA 4RWLA 3RK9A 4E6DA 1OECA 4E5BA 3DAKA 4BHNA 3EYHA 2ZOQA 4E6AA 4L67A 3BRBA 1WBPA 4GH2A 3GCSA 1FQ1B 1H1RA 4IAFA 4IB0A 5E8SA 3W2OA 3ZO2A 4UBAA 5I4NA 4CRSA 1W2DA 4YMJA 3D7TB 4BF2A 4HGSA 3KIOC 3F3WA 2DUVA 3F5UA 3TACA 2HY81 2WMVA 5CSXA 5H8BA 1YHWA 2JDOA 4OTPA 3CBLA 4LV8A 4ZY5A 5JFSA 4DGNA 4JR7A 5AP7A 3HEGA 3LCTA 2Y8OA 3QRKA 4Z3VA 2IO6A 3FKLA 3ODZX 2CMWA 2C6MA 4X2NA 2OO8X 4XJ0A 1YWVA 5DRDA 5HHWA 4RMZA 2UZLA 2BILB 3Q53A 3NGAA 3KVWA 2AUHA 3ZDUA 5CEKA 2ITQA 2XAOA 4QTDA 2BIYA 3KCFA 1XMMA 3S1HA 4MEDA 5EYKA 3O8PA 4JDIA 3R9NA 4EONA 4KB8A 5AUUA 4JG6A 1W84A 2XKEA 4EC9A 4UWYA 3O50A 5JFVA 5HX8A 5CNOA 1KUTA 3TNWA 3FAAA 4B8LA 3JPVA 3DZOA 4R7HA 4G6LA 5L2QA 2P3GX 3Q60A 3N4VA 4UY9A 5AP3A 3ROYA 3W0MA 2QHNA 3G15A 2A4LA 3REPA 5LVLA 1ZYCA 2OSCA 5FD2A 5D11A 3O5AA 5DE2A 3HNGA 3DXPA 3CJFA 4WG3A 4IXPA 4NK9A 4HGEA 3I7BA 3AG9A 1YI3A 4CSVA 4C4FA 1J1CA 3LOKA 4KKGA 4DT8A 2BFXA 2X7FA 5E8ZA 5I3OA 1TFFA 4QP7A 4IZ7A 4C37A 3DKCA 3FBVA 4CZYB 4LGHA 3F88A 2CKPA 4MWIA 2QONA 2BDWA 3EIDA 3Q2MA 4NCTC 5E8XA 2YWVA 5L6PA 3EQGA 4LL0A 3EMGA 3V5WA 1XR1A 3HRBA 2C69A 1OMWA 3RCDA 4L43A 5AA8A 4GFGA 4JIKA 1FGIA 3TI1A 5HG8A 5CSPA 4RIWB 4RX7A 3HLLA 5CZIA 5BVWA 5IA2A 2OIDA 3ML1A 4LMUA 4GW8A 2YAKA 2J5FA 3BV3A 5KBQA 1U54A 4EHZA 3RK5A 2CCIA 2VN9A 3GOKA 4FNWA 2C5YA 4HCVA 4DCEA 3LW0A 3TV7A 3ZO4A 3SD0A 4AXFA 5HBEA 5TO8A 2R0IA 3A2CA 3HP5A 4G3CA 3R0TA 1A48A 3P7BA 2R3MA 3MFTA 4NT4A 4JX7A 4FUYA 5C1QB 3OEFX 2BZHB 5LCKA 4GK2A 4EYJA 2WOUA 4A9SA 3O8TA 2HWPA 4I20A 4GU6A 3FPQA 1JVPP 4DH5A 4I3ZA 2QI8A 3MVLA 5AV0A 3VW6A 4YSJA 4JRVA 5AADA 4O1PA 4FIJA 3BGZA 5FEEA 4BIEA 4FSNA 3DXNA 3HV4A 3ZM4A 5ACKA 3CY2A 1M2PA 3TM0A 2X6DA 1IAJA 4FX3A 2JFMA 2QOKA 5FBNC 3KGAA 2XMYA 4FV0A 1UNLA 2WKMA 1SZMA 4J71A 4ZP5A 3TJCA 2X9FA 4K6ZA 4KKHA 3UO6A 3R1QA 3FZSA 1LEZA 5JGBA 2FB8A 4KSPA 4BJJB 1OL1A 2PZYA 2QOQA 3UZRA 4C61A 4H05A 3TMOA 3FI8A 4O7YA 3EQIA 4JAIA 4PMTA 2CNUA 3BHUA 2OIQA 3VF8A 4ARKA 4AZSA 5BX0A 3BGPA 5A4CA 3ZUVA 2NO3A 1REKA 2UVYA 4ASEA 5BVDA 2XM9A 4NKSA 2WQBA 2YIXA 5AEPA 3TT0A 3DTCA 3FLZA 4IAKA 5FP6A 4R7BA 4XP3A 4O7LA 2O64A 4BVUA 5EHYA 4B0GA 3R6XA 2EXEA 5FQDC 4F7JA 2OZAA 3LXLA 2VTSA 3UYTA 4HNIA 2Z60A 1GZKA 4AZVA 5T3QA 5EDPA 5HTCA 1IAHA 4R77A 4S32A 3QGYA 3ZFMA 2B9JA 1M2RA 2H9VA 4UV0A 1OKYA 1WBNA 5EW9A 1BMKA 4L3LA 3TCPA 2VWBA 4H1JA 2E9NA 3WF8A 3Q4TA 3MFRA 3QZIA 3V5LA 2BUJA 4FL2A 3UG2A 1R1WA 4XNEA 5AUXA 4ANBA 1JOWB 3S0OA 4MBIA 4O6EA 1NY3A 3D5WA 2O65A 3KRWA 1UNGA 2XK3A 4AGDA 4DG2E 4FV5A 3U6HA 2GPHA 3RCJA 1V0PA 4G9CA 1M52A 4M0YA 4I6HA 3HGKA 5D9HA 4OUCA 5FM3A 5E8TA 2W1ZA 4WA9A 3IOPA 4O4CA 5I9UA 4CMUA 4FYOA 3HV3A 5ANOA 1YXVA 3OWPA 2GCDA 2W5BA 4BTFA 4II5A 5H9BA 2AC5A 2XNNA 4FIFA 4NEUA 5B0XA 3UJGA 4EWHA 4KSQA 4IVBA 4YHFA 3BE2A 3T3UA 3CKXA 3O23A 4A4OA 3U6IA 1NW1A 3R1YA 3U4WA 3R1SA 4YJVA 1W98A 2FGIA 2VV9A 3BYOA 3W16A 2WTIA 1JWHA 5KKRB 5BMMA 2WD1A 3FDNA 1VYWA 3BX5A 1PW2A 2W5HA 3GU4A 4E3CA 3DNDA 5T68A 3NVMB 1W83A 3RKBA 1ZXEA 4AFJA 2W1FA 3P4KA 2G15A 3QC4A 4JVGA 3EFLA 3RI1A 5BYLA 2JAMA 3MPAA 4ZJIA 3RALA 4YU2A 1WCCA 4BBMA 4EZ3A 5FUTA 4ZSEA 4Q2AA 3LFFA 3D14A 3MY0A 3NSZA 1XH4A 5KHXA 3W33A 5LMAA 2FO0A 2QVSE 2ZV8A 4QNYA 3RMFA 4C4EA 3UQCA 4G34A 4A4XA 2I40A 3WF7A 3BQRA 2YIQA 3KMUA 2XUUA 2W17A 2XCHA 4JDJA 2ETKA 4Y5HA 4RVTA 5C9CA 3K2LA 4I21A 5GHVA 4FSZA 4MQ1A 5BVEA 4H58A 5FBOA 3VS4A 3SG8A 2IZSA 3ENMA 2W4JA 4O0VA 4ZSJA 4RIYA 4EZ7A 4ZJJA 3DOGA 5M56A 3E8DA 4EH2A 1XMLA 4JR3A 4CQGA 2YLEA 3AD4A 5KMKA 4FTLA 4NSTA 5IQHA 2VZ6A 4ZSAA 4X2GA 4YZCA 3PJ3A 4I93A 4RJ7A 2C6OA 2B1PA 5D10A 3KF7A 3WIGA 2ZM1A 3IW5A 3P5KA 1ZOHA 2VU3A 3DK3A 4F7LA 4NM0A 4MK0A 4B4LA 3ZLYA 4HJOA 3R71A 1X8BA 3OF0A 3GEQA 2PZPA 3ZC5A 4C02A 3P1AA 1OUKA 4N70A 1U59A 2B9HA 3ZLSA 4QYGA 3WZEA 1SNXA 4EWQA 2PU8A 2QG7A 4IBMA 2XALA 3QTZA 1YW2A 4WIHA 4LRKA 1HCLA 3R7UA 3VS0A 3C1XA 2E9UA 3ZH8A 2QQ7A 1B39A 3TV4A 3JS2A 4AT5A 4FIHA 1WMKA 3H3CA 5GIPE 2I0EA 1V0BA 1Y6BA 3MDYA 1TQMA 3HP2A 4GVJA 3W0QA 4JNWA 2J0MB 3DS6A 3OY3A 4I23A 2W06A 3VQHA 1ZAOA 2R3RA 2VGPA 4QMWA 4D4VA 3IO7A 3B2TA 3EQBA 3BL9A 3A8XA 3G6GA 1P4FA 3C5UA 3OT3A 2WGJA 2QOBA 4ACHA 3EOCA 4CMTA 1PJKA 1ZWSA 3FMJA 1TKIA 3OWLA 4GV1A 4YHJA 2GS7A 1WVYA 3QQGA 3HMMA 3JYAA 4A07A 4O27B 4JX3A 4QMTA 4IAAA 1TZDA 2XCKA 3I6UA 3MWUA 3QHWA 4CG8A 3PLAE 2PMIA 5L2TA 1TVOA 2BRMA 3D15A 5E92A 3KA0A 4O82A 4BCHA 3BHVA 5IPJA 2YZLA 5IMEA 2V55A 1ZY4A 2ZMDA 3CY3A 3A4PA 4C62A 3EN5A 4MNFA 2YM4A 2ERKA 1XJDA 4G17A 4IACA 4C38A 3QYWA 4RJ5A 4YZMA 5AUYA 2FYSA 4Y5QA 4DGOA 3ERKA 5JFXA 3LFSA 2WOTA 3ORTA 3EH9A 4AGUA 2C6EA 2BAJA 5TT7A 3DLSA 3BHYA 5K5XA 1ST0A 3R8VA 4I0RA 1L8TA 3GCQA 4CVAA 5AIKA 4FVPA 4GT5A 2OZOA 2G01A 4AA4A 4X7QA 3QC9A 3QXOA 5DGZA 3F69A 3M2WA 3TNQB 2J2IB 4YC3A 4O7RA 1YQJA 3QTXA 3F5GA 4IAIA 4JJRA 4DITA 5CXHA 1XHAA 4ANSA 2VWYA 2CDZA 1GNGA 4O7VA 2DS1A 2GQSA 3VBVA 4S34A 4LDTA 5CVHA 4NJ3A 4YSMA 4FEWA 4F6WA 3JVRA 2J6MA 4AZEA 1YVJA 3GI3A 2GNFA 4AN3A 4CTBA 2OWBA 3ZZEA 3FQEA 3FZOA 3FLQA 3UIXA 3FZ1A 2XEYA 5DH3A 5DHJA 5ANJA 4E26A 2YA9A 3SLSA 3C4FA 5HIEA 4IMYA 2GMXA 3QWJA 2P2IA 4FSQA 3S00A 2BRNA 3UO5A 3WE8A 4FNYA 3SXFA 4QTCA 3RWQA 3QLGA 5CAQA 4N0SA 1VEBA 4FTNA 2XK6A 4MHAA 2C47A 2HZNA 5A6NA 1CMKE 2I0HA 2QO2A 3QXPA 1Q4LA 2OH0E 3MB7A 3FE3A 4RA5A 4TWNA 4ERWA 2CKOA 5HOAA 2YM8A 1KWPA 4FRFA 3DJ5A 3MJ2A 3ORZA 4CLJA 4EH3A 5HE1A 1FINA 4O4EA 5AAEA 4OW8A 3RJCA 4A9UA 4LOPA 3ORXA 3Q4UA 5EM5A 5AR5A 4ACMA 4DDIA 5IQFA 4BBFA 2R9SA 4CXAA 3V5PA 5A4TA 3WILA 4RC2A 2CN8A 5IQCA 4M67A 4BCFA 2FSLX 1XH7A 2ZV2A 2XRUA 3EYGA 2OXXA 4ZZOA 5JZNA 3C4XA 4RJ3A 2XIZA 3DQWA 4QMZA 3V8SA 4FE2A 1ZMVA 1RW8A 3KKVA 4AAYA 3AC2A 3FSKA 2JFLA 5DI1A 4X2KA 3G51A 4AW2A 2B9FA 4IWPA 3VUDA 4D1ZA 4A4LA 5T6KA 2YABA 2GHMA 2HELA 3DGKA 4FG7A 3UNKA 3QCSA 5L8LA 3SG9A 4ZTQA 5FDXA 5CLPA 4OBQA 2YHVA 2GDOA 4BCNA 3OCBA 1IEPA 3FKNA 3RAIA 3R7IA 5BUJA 5JQ8A 2PVRA 2VO3A 4QP1A 4R8QA 3NX8A 3GFEA 4BIBA 3JVSA 3QA8A 3LIJA 4KABA 3SRVB 2J0IA 5LCJA 4YLJA 4FA2A 2Q83A 2VGOA 2P33A 2YCQA 3UTOA 5GZ9A 3NUXA 4FKJA 3PG3A 3ZBXA 4QMNA 3PYYA 3I81A 2UZVA 3E92A 4BKYA 2GQGA 2X1NA 4YLKA 4CKRA 5AV4A 4BCQA 4Q5HA 3AC4A 4QPSA 5M55A 3SKCA 5L6OA 3KC3A 3C4CA 5JEBA 2XJ2A 2C6DA 5CF4A 4O86A 4IX5A 4PY1A 2UW9A 2X6EA 3VC4A 3RAWA 4JLCA 3N51A 5L8JA 3HV7A 4FV3A 5TR6A 3UZPA 1ND4A 3Q96A 4FOBA 2Y0AA 4FKPA 4FKVA 5HE2A 3D5VA 4FT0A 5I9WA 3PXKA 3O7LB 4ALVA 5IG1A 3QZGA 4EQMA 3LFAA 2ZAZA 4O21A 3FQSA 3QAME 1OL7A 2OICA 3KULB 4RC3A 4F9BA 3R8LA 5H3QA 4BZOA 4FJVA 3M11A 2HK5A 4ANNA 4D0XA 3DBQA 1BI7A 1ZZ2A 2FSMX 4BCGA 4BY9E 1S9IA 4QYHA 1Y8GA 3VS2A 3QTIA 4DHFA 4XHKB 3LFBA 1H1PA 4F9YA 1DI8A 3UODA 4JQ7A 3ULIA 4PPAA 1IRKA 3ZUUA 2QOLA 5IDPA 4F0GA 3LM0A 3MY1A 1H01A 4C4HA 5I9XA 3FHRA 4XX9A 1KE7A 3F3VA 3MI9A 5DRBA 5HE3A 5CF8