1OECA

Fgfr2 kinase domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
298
structure length
280
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARREQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FIBROBLAST GROWTH FACTOR RECEPTOR 2
publication title The Crystal Structure of the Fgfr2 Tyrosine Kinase Domain in Complex with 4-Aryl-2-Phenylamino Pyrimidine Angiogenesis Inhibitors
rcsb
source organism Homo sapiens
total genus 78
structure length 280
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oecA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oecA01
5M4FA 3FY0A 3GI3A 4F7LA 4QMSA 4X3FB 5AX9A 2UZUE 3QTRA 4V0GB 1H28A 2O8YA 5LMAA 4ACMA 2ZDUA 3HDNA 4XBRA 4GFMA 4FTTA 4L68A 4LGGA 4FEQA 3DA6A 4Z16A 1R39A 2C69A 5HICA 4M67A 3ZFYA 3R04A 2W1EA 1G8AA 2QLQA 2C6MA 2R3NA 2GQRA 4GFGA 2O63A 3H4JA 3PP1A 2C6LA 3BELA 1OGUA 3R63A 4K1BA 5ANIA 5ANJA 4D28A 3EQBA 2OFUA 3AT3A 3DAJA 5G1XA 4BDGA 4I4FA 4ALVA 3E3PA 4R1VA 3RI1A 4C58A 4EC9A 5TO8A 5CAOA 1ZYCA 3MWUA 1YHSA 3ZM4A 1BL7A 4I1ZA 4EOMA 2FA2A 4F0IA 4RVMA 3HP5A 4XOZA 4O27B 5L2TA 3MN3A 5L6PA 5EDQA 3U6HA 5B2KA 4MBIA 4YZBA 4YMJA 2VX3A 4EK4A 2SRCA 4MAOA 1WZYA 4M68A 5CU0A 4FIGA 4TTHB 3LE6A 2YM4A 1OL5A 3COKA 2ITZA 4L8MA 3UOJA 4ZZOA 5IQFA 5I9WA 1ZOEA 4ANNA 4GUBA 2DYLA 3I0OA 4X3FC 3ORZA 3RK5A 1PRYA 4F9YA 1IA9A 4ACHA 4IZAA 3Q9ZA 4YJSA 5AA9A 3PP0A 4CCUA 1JOWB 1SVEA 1PJKA 2WMTA 3RCDA 3TDVA 4FKSA 2R3GA 2ITUA 3PLSA 4RX7A 4F9WA 3LCKA 2IWIA 3D2IA 5J9ZA 3S1HA 3PPKA 1MRYA 4PRJA 1ZARA 3G2FA 3FYKX 4JJRA 2WTCA 3LCDA 1OB3A 3G0FA 3F2NA 3GU5A 4HYUA 4NW6A 1JVPP 4Y46A 2GS7A 4QYHA 5A4TA 4HNIA 1DM2A 5CAUA 2PVKA 5J5SA 5IUHA 3WYXA 1GIJA 4XG6A 3MH2A 4V05A 2VTOA 4DH5A 1XH6A 3RZFA 4YNOA 4BDHA 5CF8A 4KSQA 5HO8A 2PMIA 2ESMA 2QKWB 2C5NA 2PWLA 3LJ1A 3OWLA 4G3FA 4O2ZA 4JQ7A 2XNEA 4NKSA 4PF4A 4QMMA 1YI4A 2VWWA 3BV2A 3HLLA 4ZMEA 3EIDA 1ZMWA 2VWYA 3DB8A 5JZNA 2UUEA 4UB7A 5EYMA 5FG8A 3AC8A 3CGFA 4EH2A 2JEDA 2W05A 5A6OA 3D15A 4AW5A 4FSUA 3LFFA 4UMPA 5IMEA 4BR3A 3UPZA 1H08A 2GNJA 3QUPA 4JNWA 5HTIA 1R0EA 1XR1A 4HZRA 3GGFA 4BGHA 3PIYA 3HZTA 4U44A 1H01A 3K3JA 5CF5A 1KE7A 2XJ0A 3ZONA 4CD0A 3ZO1A 5BQ0A 3TM0A 4I3ZA 4RJ7A 3K54A 4FGBA 2UV2A 3IDCA 2VNWA 4U8ZA 4CFXA 2PZPA 3R6XA 4O82A 2C0IA 3ODYX 3SHEA 2HCKA 4A7CA 2DS1A 2VTTA 3GVUA 4ZAUA 5M4UA 4ARKA 2J0JA 4O0WA 4TYGA 5D1JA 2C47A 2F49A 2V7OA 4L45A 2GS2A 4C59A 5JFVA 3QTIA 2WTKB 4QMZA 4DCAA 2QCSA 1YDRE 3KRXA 4Z9LA 5JH6A 3Q96A 4FYNA 5A4CA 3PA4A 4WKQA 4FG9A 4FSTA 3OWPA 4N4SA 3BU6A 4XS2A 3TKUA 3UG1A 3C5UA 4FVRA 4CKJA 4OBOA 2Q0BA 1Q3DA 4ONAA 4E73A 2CN8A 2W9FB 3QA0A 4JIKA 5HCXA 1OKYA 1WVWA 4F0GA 3QD0A 4D2PA 2V22A 4DN5A 4L52A 4YC3A 4D4RA 3D4QA 4ZTRA 5IUIA 2YISA 3VQHA 3Q52A 5HKMA 4AT3A 4D2VA 2C1BA 1E1VA 5H3QA 3VUTA 5FRIA 3JXWA 1YVJA 1BUHA 2OH0E 5AP5A 2C1AA 5L6OA 5K4IA 4G3DA 1QMZA 3F7ZA 3TNWA 2R3KA 5CT0A 2HELA 2JKOA 5AUUA 3LKMA 3C4XA 3P7CA 4S31A 1OKZA 5HE3A 3TV4A 5M53A 2ZDTA 3PA3A 3DZOA 4D2WA 1H0WA 5JSMA 3NNUA 1BI8A 3UIUA 4F0FA 2G2FA 5H8GA 4EH5A 3EQRA 5CTPA 2RFNA 1OBDA 2R0UA 2CCHA 3FMDA 4PDPA 4BTKA 4YJTA 4CFNA 4F4PA 3MFRA 5KO1A 5KUPA 5IDNA 3ZXZA 1XH7A 4JBVA 3EJ1A 3E7VA 5IQEA 2WTKC 4N70A 4C4EA 5IA5A 4KS8A 5T68A 1GZ8A 2YZAA 4P2KA 1IR3A 5LVNA 5CSVA 2QOQA 5B2MA 1CKPA 4IC8A 4BZDA 1U54B 2Z7SA 5LCJA 2X4ZA 3MIAA 2P2IA 3V5TA 1CMKE 4RA5A 3MGYA 4J8NA 3GC8A 4YJUA 3UE4A 1H1PA 4EH9A 3FL4A 1ATPE 2ZMCA 3AC1A 4R7HA 4XCUA 2WU7A 5ACKA 4FV3A 4FICA 1O6KA 1PW2A 3C0HA 2QLUA 4DGLC 5FM3A 1J3HA 3V51A 4A9RA 3QALE 4L7SA 2OXYA 2W96B 1NVQA 3GU4A 4QT1A 5CI7A 3FXZA 3HVCA 3QL8A 5F1ZA 2LGCA 3PPJA 5CALA 2W1ZA 2GNFA 5AV0A 4FEUA 3I60A 5I3OA 5ETAA 3LM0A 3Q9YA 4FT7A 2JKMA 4O0SA 3WBLA 3NVKI 3I6UA 4X3JA 5KMNA 5LXMA 1U5RA 3HP2A 3QQLA 3TTIA 3EQCA 3VUIA 4GUEA 4AA0A 1M7NA 3HX4A 2DUVA 3SXRA 4BY9E 5F20A 2UZBA 4HJOA 4L00A 4FTLA 4UWCA 4XLVA 3AOXA 3F7WA 5D41A 4QP6A 4DYMA 4FV9A 3KVWA 3OWKA 5FP5A 1DI8A 3NUYA 5FBNC 3MS9A 3R7IA 2GNLA 5AWMA 4YTHA 4HW7A 4OTDA 2QOBA 4Y72A 2IZTA 3LFAA 4M0YA 3U87A 2IJMA 1P14A 2F4JA 3A7HA 4JQ8A 3RPSA 3KF7A 5AR5A 4D2SA 2XK7A 5EOLA 2YJRA 5E1EA 3UP7A 3CQEA 4ITHA 2FSTX 5BUIA 5DA3A 3R9NA 4XUFA 1R78A 5EFQA 4UV0A 4FTKA 4L43A 1BX6A 2YLEA 3FE3A 5BVFA 3GEQA 3EKNA 5J5TA 3EFKA 4NEUA 4I0SA 4BDAA 2J0KA 3FZRA 4O0VA 4FKTA 2CLQA 2QNJA 5ETFA 3OCSA 4RX9A 5IEVA 5KNJA 4J7BA 2A2AA 2R4BA 3TZ8A 4RFMA 3P0MA 1PY5A 3MPAA 3FY2A 3UP2A 4QNAA 4YR8A 4UYNA 4QP2A 3FC2A 3ZDUA 3G5DA 2OW3A 1ZZLA 3MPMA 4WG4A 3ZFXA 5HU3A 3F82A 3U54A 1FPUA 2CNQA 2P0CA 4IVCA 4YTCA 3A62A 2NP8A 1H27A 1OIYA 2AUHA 4BWXA 4O0TA 4E1ZA 2BVAA 4FYOA 4TT7A 2F7XE 2GTNA 3ZFMA 4H39A 4ZLOA 5HLWA 3QGWA 1U59A 2PL0A 2Y4IB 3NSZA 4W4XA 3PE1A 3SQQA 3UC3A 4CCBA 1U46A 3WILA 4U42A 1LP4A 4I23A 4PPBA 4EQMA 4PP7A 5L8KA 3UZRA 3A8WA 2OJGA 3E64A 5HLPA 3NIEA 3AMAA 2FH9A 3GU8A 4RWIA 2G2HA 4AT5A 3BLHA 5HHWA 5BYLA 2GHLA 4AZFA 4G3EA 4DFBA 4U7ZA 1UNHA 3T8OA 4DBNA 2QO9A 3NUNA 4M84A 2PMNX 5JKGA 4R7IA 4MKCA 3QTQA 5HU9A 3N4TA 4C2WA 2YZLA 5T3QA 5AR7A 3WZKA 4DHFA 4YHTA 5TF9A 4U9AA 3IOKA 5LARA 3W2OA 3PLAE 3LLAA 5H8EA 3DFCB 3R00A 3JR1A 2VRXA 4LMUA 3VS1A 4BIBA 2WU6A 3G9NA 4IANA 2YCRA 3MH1A 5LMKC 1JAMA 3FAAA 1OL1A 3O96A 5AV2A 5I9ZA 5IZFA 3TN8A 1YOJA 3DQXA 1OKVA 4XG8A 5CI6A 3MA3A 3JVRA 3U9CA 3AC2A 1YRPA 3FL5A 3ULZA 2Y4IC 4EWQA 4NKAA 2OJIA 4QTAA 3UYTA 3BYOA 1OM1A 4RG0A 5FXQA 4AF3A 2IG7A 2ZJWA 4B7TA 4XLIA 5M44A 3EN4A 1MUOA 2JBOA 4GVJA 1QPCA 2AC5A 4WNKA 3IKAA 5FBOA 3WIKA 1JBPE 3EQGA 4QMLA 4L3PA 2HZIA 3LFCA 5FDXA 4CXAA 4DEGA 3RALA 4G31A 3E62A 4J96A 5CT7A 5BUEA 4RIYB 2RSVA 4A06A 3VBXA 3O23A 1R3CA 2GSFA 4IWDA 4S2ZA 5I9UA 1JSVA 3RPOA 5E90A 3FC1X 3QRKA 5AUXA 2VNYA 3RAKA 3T3VA 3SOAA 4XX9A 2VWIA 2Z2WA 3DKFA 4Q9ZA 3ZUUA 3GOPA 3R2BA 5CU3A 3LCOA 3HRBA 4B8MA 1ERKA 4M97A 4NL0A 5CYIA 3GENA 4O86A 3LM5A 1XH5A 3E7OA 3VUHA 4E4LA 3QCYA 4FEVA 4NIFA 3U4UA 4FL3A 4UX9A 1W7HA 2WNTA 2BILB 3F3UA 4AZSA 3PY1A 5F94A 4TYEA 5CSHA 1PXOA 4M69B 4C3PA 4N57A 3FXXA 4TY1A 5ICPA 2WAJA 3H0YA 3Q04A 3R2YA 5CAPA 4C4FA 2HAKA 4AG8A 2UVZA 4BHZA 2R3IA 4QTDA 4EORA 2RG6A 5JEBA 2PYWA 3DY7A 3AD4A 3ID6C 3QFVA 3SA0A 3THBA 1R1WA 2ZV2A 4RC4A 5DLSA 4JG7A 5HTBA 3Q3BA 2CDZA 4IFCA 4JR7A 2ONLC 4PPCA 1ZMVA 4DG0E 3VC4A 2Y7JA 3CEKA 3R1QA 2ETRA 3KULA 3TG1A 4YJQA 1WVXA 3GCQA 4B6LA 4APCA 4IVAA 1SVGA 4ANMA 3EOCA 2VTMA 3R8VA 5JFSA 1IG1A 3VRZA 5EG3A 3FQSA 1QL6A 5J95A 4U40A 4G5PA 4KS7A 4E3CA 2BHEA 5A14A 3QTUA 3ELJA 5CEOA 5JGAA 5EYKA 2RFEA 5BVDA 2WEVA 3WZDA 5KX8A 3G15A 2J0LA 4HVSA 3CR0A 4FC0A 4ITIA 4K8AA 3ZZWA 4D2TA 4EBWA 4E5BA 3O8TA 4DE4A 4ASZA 2GCDA 5IQAA 3OCGA 4I5HA 3LXLA 3SG9A 5AV3A 4DF3A 2ZYBA 3F5XA 3LXNA 4NZWB 5AP2A 2ETMA 4HVGA 4J98A 3EQFA 3DPKA 3OW4A 3PPZA 4O21A 3WF6A 5AUTA 5LMBA 2J7TA 1SVHA 2XIRA 3ZTXA 2XYUA 4BF2A 4G17A 4YO6A 1Q62A 5F4NA 5CS6A 3RVGA 1J1CA 3NW7A 5IG1A 4JBOA 4DA5A 3A60A 3L8PA 3MY5A 4YURA 5IDPA 3F9NA 3HMMA 4ZTSA 5DNRA 4O7WA 5D10A 4BRXA 2OZOA 5AIRA 2BDWA 4UZHA 3WF7A 2XK9A 1CDKA 1ZXEA 3QXPA 4X2GA 3Q60A 4GYGA 3A99A 1H1RA 3KREA 1SNXA 5EHOA 1PMVA 1FGIA 3V5WA 4RVLA 1YHWA 3NVMB 2OJFE 1OMWA 4E6DA 2ITPA 3E92A 3RP9A 4LOPA 4BCMA 4BCQA 1I09A 3TTJA 4USFA 4X21A 4CFUA 4DTBA 2JKKA 3C9WA 1OPLA 2WTDA 2WEIA 3ENHA 3IW8A 4LFIA 5HG7A 2HK5A 2W7XA 5ETIA 5IA0A 4X2KA 2IW6A 4ERWA 2UW0A 4WBBB 2PVFA 1XBCA 4HGLA 3DAKA 4UALA 5TT7A 1J7LA 4C4JA 4YZMA 1MQ4A 4DCEA 4WNMA 2IVVA 3IW4A 4OUCA 1M7QA 2W5AA 3DJ5A 2XRWA 4F1OA 5B7VA 5CANA 5IA2A 5EM5A 1UA2A 4G6LA 4YJNA 2NNWB 1IASA 4FKRA 3EZVA 3OTVA 3KVXA 4C37A 2XJ1A 3QUEA 4KBAA 2QI8A 4FNZA 5J8IA 4RC3A 2XZSA 4GT5A 4GYIA 3OFMA 2BRNA 1FMKA 5CU6A 5LQFA 4JL9A 4EJNA 3VW8A 3F3VA 4I41A 4IQ6A 4AP7A 3FI4A 4NK9A 3KRJA 3HAMA 2EUFB 4G2FA 2XP2A 3F69A 4FNXA 4WOVA 4RX5A 3RTPA 3QRTA 4LRJA 4IAAA 4X6QC 5CSPA 3ZO2A 3ACJA 2XEYA 3IECA 4F65A 3FDNA 3RJCA 4ZY5A 3PVBA 4R7BA 4P90A 4AZWA 2R7BA 4NW5A 4F9AA 2J5EA 2ITNA 4CV9A 5TR6A 2ZM3A 4X3FA 3ERKA 3UVPA 4XYFA 3A4PA 3CS9A 4OW8A 3R28A 3CJFA 2ITWA 4UXQA 4V0GA 1KE9A 2YITA 3ATTA 3ULIA 1ZOGA 2OIBA 3LLTA 1JKTA 4DGOA 4QMWA 3SOCA 4XP2A 4C35A 4KKGA 4K18A 5KMJA 5HG5A 1B6CB 4O0UA 3MI9A 4ZS4A 3O51A 3OCBA 5GJGA 3II5A 5E8XA 3PXRA 4O6EA 3SKCA 2PE0A 1TQPA 1GY3A 2V62A 4FVQA 5A46A 3QX4A 4JBPA 5C26A 4UN0C 2PULA 2YM3A 4BDCA 3QTZA 4MD8E 2Y0AA 3HRFA 2BKZA 1CKIA 3FSKA 4CV8A 3E5AA 4BC6A 3JUHA 2WMSA 3DZQA 5KBQA 3S95A 4H36A 2J0MB 2C6OA 4FL2A 2DQ7X 5HBEA 5GIPE 3Q6WA 3AC3A 3QRUA 3OVVA 3ORIA 4GCJA 4WHZA 3R8ZA 3V5LA 4ALWA 4A9UA 2UZOA 1BI7A 4EH4A 4FOBA 5DVRA 2FUMA 4PL4A 1XH9A 3VUDA 4LL0A 4CQGA 3COIA 2GPHA 5EQEA 1RJBA 3C4WA 3P5KA 3FLNC 2H96A 2VO7A 2XBJA 4LUEA 2EVAA 3MPTA 5HESA 3TDWA 2YWPA 2F7EE 3FHIA 1WBWA 1UU3A 2ZV8A 4FK3A 3VRYA 4W4WA 4B99A 2W1GA 4DH3A 4C36A 1A9UA 3LXPA 2XUUA 2GHGA 1G8SA 2JFMA 1KE5A 3R1SA 5IA4A 4I24A 1Y57A 2IZSA 1H0VA 4PL5A 4AS0A 4C4IA 3CIKA 3UVQA 4UMTA 4EK6A 3D5VA 3ALNA 4MQ2A 3I0QA 3V6SA 2OF4A 4M14A 3D5UA 3W55A 5CU4A 2F2UA 3JS2A 2YEXA 3TACA 3KCKA 4GU9A 4AW2A 1TQMA 3RCJA 2XMYA 4DEHA 4QTCA 4J1RA 4EI4A 3D9VA 2CGWA 2UW3A 1SMHA 2I0VA 4AN9A 3G9LX 4DAWA 2R7IA 2RG5A 4CFMA 4CLJA 1F5QA 4EK5A 1QCFA 4MXZA 4DH7A 3ZXTA 3FI2A 2VV9A 1E1XA 1YOMA 2CPKE 1VYWA 3P7AA 2ITXA 4WG5A 4FV1A 4AGCA 1XKKA 3NUXA 1W84A 4Z7HA 4BDKA 1ZAOA 4OTHA 5M4IA 4FZ6A 1SZMA 5TKDA 5B0XA 1RW8A 2VTSA 3S2PA 1XO2B 3LFEA 2VWVA 4BTMA 1WFCA 3PYYA 3VS5A 3MESA 3ROYA 4G5JA 4L44A 4RFZA 4ENYA 3F5UA 4YLKA 1S9JA 4MF0A 4NJDA 2R3FA 4FUYA 4O0XA 3WZJA 2Y6MA 4H1JA 4AX8A 3GCPA 3RM7A 1YDSE 4Y5QA 4H3PA 3OROA 3R7YA 3KCFA 4FF8A 3VJOA 4Y8DA 4B0GA 1S9IA 3BIZA 4MD9E 4DC2A 4RZVA 3DNEA 2XNGA 1UVRA 3V8WA 5LOHA 3VBYA 2WKMA 4IAIA 3KF4A 4WA9A 3UOHA 2UW9A 1J7IA 3R9OA 2IVTA 2XK8A 3C51A 3JYAA 4JDKA 4FTJA 4TYHB 1PYXA 3TCPA 1YWVA 4IB0A 2JIUA 4KNBA 2R64A 4EK3A 1KSWA 3OOGA 1KV2A 2WFYA 5LVLA 4L7FA 4AGWA 4ALUA 3A7JA 5A4EA 1GZKA 1IRKA 4GL9A 3R7OA 4E4XA 1H07A 3MY1A 5JQ5A 4RWKA 2UVXA 3S3IA 3PTGA 4R3RA 2HXQA 2EB3A 4AT4A 3PIZA 4EOQA 3DDQA 5CNNA 3WE4A 4D4VA 3LQ5A 4C2VA 4F09A 3BV3A 1NA7A 1XBBA 3Q2JA 1Q97A 4FKIA 2G9XA 5D7AA 3KY2A 3BWFA 4JBQA 4ANBA 4M66A 1F3MC 1W83A 5AR2A 4U80A 5C01A 1U4DA 5FP6A 4BBEA 1X8BA 4F1TA 1ZYJA 3DTCA 3AGLA 4MTAA 4KAOA 4W8EA 4YC8A 4EZ3A 4RFYA 1PXLA 3BE9A 4EH8A 4NM0A 3C7QA 4YZ9A 3V04A 4BBMA 3T9IA 5J1VA 3VVHA 4FIIA 3ZM9A 4OTPA 4OTQA 5GIOE 5GNKA 4IJ9A 3RNIA 1GIHA 4RBLA 1YXUA 3MBLA 3UO5A 2ITYA 3D7ZA 2X6DA 3UBDA 4O91A 4YPDA 4GIHA 3BU5A 1U54A 3ANQA 1BYGA 4DEBA 2XEZA 2WHBA 1OZ1A 3ZEPA 3R02A 4QP3A 3EMGA 2PVJA 4EZ5A 4XG9A 5EHLA 2QOLA 2YLFA 3WARA 4W8DA 3R7VA 1H24A 3NR9A 2FGIA 4KKEA 2W4JA 4ZMFA 3NLBA 4YU2A 2C5VA 5CNOA 4FKQA 3QLGA 4BBFA 2XCKA 3U6IA 3DOGA 4FNYA 3NX8A 3QCSA 4BCGA 2X1NA 3EWHA 2Z60A 1NT2A 4EKKA 4I6HA 3Q4CA 5D7VA 5L6WL 4BCJA 4D4YA 5L2SA 4YSMA 3QRJA 2XRUA 1Q4LA 4H05A 1FVRA 2GQGA 4ZSJA 5AR8A 2JKQA 1Y8GA 3AQVA 3NNXA 4HYHA 3WI6A 5KHWA 1IAJA 4CMTA 2A1AB 5IQDA 1XQZA 4OLIA 4FODA 3T3UA 4PP9A 1HCKA 3DJ6A 2OSCA 1M2RA 3EN6A 3HUBA 4I22A 5HNBA 3UO4A 1VZOA 4C61A 3Q6UA 4GRBA 3V3VA 3LQ3A 5E91A 2I6LA 1DS5A 2XNBA 3SAYA 3ZBFA 2OF2A 5HD4A 1LEZA 2QOKA 3G90X 4F9BA 2VWZA 4QPSA 4LGDA 4EHZA 4OTRA 1P4OA 5HX8A 5DN3A 2OKRA 3SVVA 4BKJA 3RNYA 1WBTA 3W10A 4GK4A 3VF8A 2QHNA 4G9RA 5DWRA 1OUKA 2VWXA 1PXJA 3PE2A 4LUDA 4IMYA 3FZ1A 2EWAA 3DK3A 3MY0A 4ASDA 3O8UA 4C0TA 4AZVA 4LOQA 2VWBA 3QZFA 3LW0A 4ZLZA 2PVMA 3KK9A 3LCTA 4V01A 2ZM1A 3BGPA 4BWKA 2BAKA 4QTEA 4S30A 5HEZA 4FSMA 4MNEB 4DT9A 4U6RA 4ANQA 5C03A 5JQ8A 3TV6A 2W4KA 5HIBA 3TT0A 3VJNA 3LMGA 2CNVA 2OJ9A 3U9NA 5FD2A 2QC6A 3MVLA 3QZIA 3G33A 5DHJA 2IN6A 3OTUA 3VNTA 3W32A 4EC8A 1YQJA 2CMWA 2RL5A 4GJ2A 5CU2A 4QMNA 4O7SA 4FX3A 3AD6A 3H9RA 5LMKA 4FKWA 2OG8A 4O81A 2C6DA 2ZB0A 4BIDA 2PMLX 3C4FA 4BZOA 3OEZA 1J7UA 3E88A 2BRHA 3UPXA 2BRMA 2Y8OA 4FKOA 3AG9A 3DBEA 5AR4A 4FNWA 3AXWA 3MJ1A 3PG1A 4DINA 4C7TA 5FXSA 2XNOA 5E9EA 4I6QA 5DEWA 5FEDA 4EL9A 5BYZA 4AXAA 3FBVA 4FSZA 3I5ZA 4ID7A 3TZ7A 4CZYB 4Q5EA 3KMUA 2W5HA 4ACCA 1STCE 3DK6A 2HW7A 5J79A 3HMOA 4KIKB 3FMKA 4MBJA 4NTSA 3UTOA 3PXFA 4YJVA 2XIXA 3CY3A 3DFAA 3CD8A 3R7GA 3HNGA 4JOAA 3ZDIA 3FMLA 4QMOA 4FTNA 4M0ZA 4C8BA 1OITA 2B9IA 4FEXA 5TE0A 4NCTC 3OXIA 2PUIA 3LCSA 1OVEA 4PDYA 3QQGA 5CEKA 3FEGA 1V0PA 4D5KA 3C0GA 2XNNA 3DNDA 1GAGA 4PNKA 3ORTA 2YM8A 4F7NA 3TUCA 3ANRA 3OBGA 1TQIA 2ZM4A 5ITAA 3EQPA 3P79A 5DE2A 3W8QA 4DTAA 3R7EA 3ACKA 4AOTA 3PJ8A 3PVUA 4O7NA 3DQWA 4BI2A 2CJMA 2WQNA 5HG8A 5AAGA 4QP4A 2QG5A 5AM7A 4O7LA 4CQEA 3FHRA 1XWSA 3LJ0A 2OICA 2WMUA 4TWPA 4X2JA 5F95A 4F7SA 4RC2A 4GJ3A 4P5QA 4W4YA 4KRDA 1M14A 1VR2A 3SXFA 5M07A 5AA8A 4FT0A 1KOBA 3R21A 4UWYA 5HTCA 2QKRA 4GH2A 5HD7A 2REIA 3OXZA 2ONLA 1RQQA 3I79A 4KBCA 2JD5A 3P78A 3UMXA 3ZRKA 4UMRA 3I7CA 4RIYA 4NH1A 2OU7A 4F99A 4UY9A 2IO6A 2PY3A 3TZMA 3AMYA 3IPHA 4I0TA 3MVMA 5EYDA 2QD9A 2B1PA 3QCQA 5KMIA 3F6XA 3PY3A 5IA1A 4MD7E 1JKLA 2R3LA 4IM0A 3FI8A 4MK0A 3O17A 4O0RA 4GK3A 3NUUA 3BU3A 2BAJA 2JIIA 2VO3A 4GW8A 2ITQA 2OO8X 3Q5ZA 2IVUA 3DLSA 4YLLA 4BCOA 2PU8A 3LAUA 4FTOA 4UYAA 1F0QA 3QUDA 4JXFA 4DGGA 3ALOA 1B38A 4CZTA 4FA2A 2X8DA 3EFJA 4MXXA 5HIDA 1YXTA 4J71A 5J9YA 5E7RA 2FO0A 3Q4ZA 4FV4A 4M69A 3SXSA 5ANDA 5FM2A 3G6HA 3PRIA 5M4CA 1J1BA 4HYIA 4L3JA 4K77A 2ZVAA 3IW6A 5DGZA 3GFWA 4BI0A 4LGHA 4O38A 2VN9A 4I93A 3PXKA 4PMSA 4CKIA 3RAHA 4AFJA 3KXNA 3MTLA 4OBQA 3B8RA 3KXHA 4PV0A 3NCZA 4WRSA 4XG2A 3VF9A 4J52A 4K11A 3DXNA 4XBUA 4O6LA 3IK3A 2VX1A 2Y6OA 2J0IA 2QU6A 4IIRA 4BDDA 5L2IA 3AD5A 3FSFA 4IX6A 4OTGA 2X0GA 5LJJA 4RLLA 4U81A 4FTUA 1TKIA 5FGKA 5HE0A 4IB3A 4AZEA 2C4GA 2BAQA 3QD2B 4GKHA 4DLJA 4EEVA 2GU8A 3W2PA 3NUAA 5HVKA 4AGDA 4DLIA 4DFZE 4AW1A 1MQBA 3QTSA 4PTEA 2CCIA 2E9UA 4S32A 4Z3VA 2CGXA 1O6YA 4IB5A 4QD6A 5CVFA 2X9FA 3ORLA 3A61A 3DLZA 3QYWA 1B39A 3QZHA 5JFXA 4OT5A 3V5PA 3FQHA 4EWHA 5AJQA 1ZY4A 1KOAA 2FYSA 4YZDA 4JDJA 3IQ7A 4APPA 3IW7A 4IACA 4TZRA 4MXYA 3G6GA 4MXOA 2EXCX 3FKLA 5ANGA 4O7RA 2VWUA 1H1WA 4GG5A 5M06A 5CWZA 2BMCA 4WSYA 2OH4A 4FZDB 3W33A 2X39A 3MW1A 4PDOA 4EH6A 4I20A 4PMMA 4CFVA 4A9TA 2YIXA 4ZLYA 4WUAA 4OAVB 1BMKA 4RMZA 5C9CA 2VTHA 1FINA 4LG4A 4BGGA 3O2MA 3QWJA 4LRMA 3RGFA 4EBVA 4GFOA 5J1WA 4PNIA 1REJA 1JLUE 5CQWA 2CLXA 3NAYA 3TIYA 3R01A 1URWA 3RAWA 3ZO3A 5IH4A 5IMXA 4BFMA 4A9SA 2VTNA 2WO6A 3NW5A 5EDRA 4DTKA 2F2CB 3V01A 3WZEA 3ZBXA 4YBJA 3HRCA 1M2PA 1ZYDA 2PZ5A 4H1MA 3VS7A 3CBLA 3IO7A 4QMXA 1IAHA 3V5QA 4MCVA 2VTAA 2OGVA 3QRIA 5A54A 3QCXA 3E87A 4D4SA 3DGKA 5LVOA 1YWRA 1UU7A 4PDSA 2BDJA 5IH5A 3WE8A 4MF1A 2QOFA 3IG7A 1GJOA 1WMKA 2VO0A 3Q9XA 1UKIA 1OUYA 2BZJA 3I6WA 3ORMA 5CXHA 3KXZA 2X2KA 4IDTA 4IM3A 3L8SA 4JS8A 2BALA 1P5EA 3OY3A 3ZOSA 5EQPA 4RJ8A 5E92A 3QQKA 3LMHA 4I4EA 2YAAA 1MRUA 4KIQA 2VTLA 4K6ZA 3U6JA 4EJ7A 4EHVA 4TWNA 3Q5IA 3RPVA 2RFSA 3BE2A 3PRFA 2B4SB 3D83A 3QX2A 3SW4A 4EHGA 5BYYA 5LWMA 4I21A 5AP0A 2BKKA 3L8VA 5FLFA 4XEYA 4BDFA 2HWOA 1JNKA 5EK7A 5HE1A 3BEAA 2QODA 4QTBA 4XP3A 3KU2A 4W9XA 5AM6A 1WVYA 1YHVA 3V8TA 2GFCA 4LL5A 4C38A 4U41A 2GQSA 3GC0A 3QD3A 3CY2A 2CN5A 1OBGA 3E8NA 3T9TA 5EDPA 2XIKA 3SX9A 2I40A 2W1DA 3GC7A 4CSVA 2YERA 5E8ZA 5HGIA 4C4HA 5AFVA 1DAWA 3VBVA 2X8EA 3AC5A 3LZBA 3PA5A 3SD0A 3UIBA 4BN1A 2H34A 3TL8A 4LQMA 4TPTA 5I4NA 3DS6A 5AIKA 2PE1A 4FZ7A 4F63A 3VS6A 4E7WA 5EQYA 3ZEWA 1WBSA 4ENXA 3K5UA 4ZSEA 3O0GA 3ZU7A 3HV4A 4CRSA 3IGOA 4AFEA 4ACDA 3QWKA 3CKXA 4YP8A 4M8TA 3F88A 5IKWA 3GT8A 2HY81 2BHHA 4GMYA 3BHHA 4I5MA 2P3GX 3FQEA 1UV5A 3F3ZA 3NYNA 3ZYAA 3R8MA 2X2MA 4J97A 4NM7A 2PZYA 3CPBA 4USDA 2NO3A 4D9TA 4RGJA 2BDFA 2Z7RA 3UJGA 2UZNA 3PXZA 3L9MA 4FMQA 3UDBA 4FUXA 2P2HA 4XH6A 2UW4A 4L3LA 4AE9A 1QPEA 1ZYLA 4CYIA 3FLYA 3QQFA 3POZA 3U51A 4BCNA 4FKJA 5L8LA 3RKBA 3VHEA 3G0EA 4X0MA 3P23A 2E9VA 3U4WA 3FLSA 3MYGA 4JDIA 2VTQA 3VBQA 3VBWA 4FIEA 2B53A 5KMKA 2VO6A 4NFMA 2Y4PA 2AYPA 4U3ZA 3HGKA 1BL6A 1OIRA 2XNPA 4J99A 1Q8YA 1PHKA 4E5AX 1DAYA 3RINA 1VYZA 2WXVA 2BZKB 4NM5A 3SDJA 3COMA 5BX0A 5I3RA 5LVMA 3LQ8A 3EKKA 4BDBA 4O7YA 2BIKB 1WCCA 3EQHA 4L6QA 4BI1A 4G6NA 2YAKA 4NJ3A 3KL8A 4ZK5A 5FTGA 3R9HA 3GQLA 5DRBA 2X2LA 3RPYA 3GCSA 5CX9A 1P4FA 2ACXA 3W2QA 3HYHA 2A27A 1MP8A 1W98A 3VWAA 4FVPA 4L9IA 5ETCA 5IUGA 4O84A 5ANOA 4MBLA 2C5OA 3DKOA 5EH0A 2OXDA 2X7GA 3BHUA 3GNIB 4HCVA 3V5JA 4FV8A 4F6UA 5KBRA 3NWWA 4BL1A 2CKEA 1PYEA 4TW9A 2YJSA 4JG8A 4D9UA 4JR3A 2VZ6A 2HWPA 4DEAA 1NXKA 5M08A 4GV1A 2G2IA 2BZHB 3NMUF 2ZMDA 3ETAA 4AUAA 3SLSA 3W16A 3EL7A 4C34A 4C02A 3FLZA 4OTWA 4RZWA 2A19B 3NUPA 5KZIA 2J6MA 1YKRA 3DV3A 4K2RA 1H25A 3MSSA 1R0PA 2GNIA 2WQEA 3VO3A 3IDBA 3ZSIA 4EHEA 5IA3A 5I0BA 4Q2AA 5KMOA 2I7QA 1ZYSA 4KRCA 4FKPA 5EKOA 4X6RA 1T46A 2R0IA 5E8VA 3KGAA 2PVLA 4R5SA 2JBPA 4IVDA 3OCTA 4PL3A 2XBAA 5DR6A 4E93A 5HORA 2JC6A 3BYMA 2R5TA 5EHYA 2BIYA 1P2AA 2BUJA 5HCYA 5I9XA 3EQIA 1VJYA 4KINA 1GIIA 3MB6A 3OY1A 5ACBC 5BPYA 4QYEA 5BUJA 3SRVA 4PUZA 1H1QA 2RIOA 5AP7A 3KXGA 3VULA 4EH7A 4JVGA 5AR3A 4IEBA 4KABA 4BTFA 2X6EA 4UZDA 4YO4A 5A4QA 3HKOA 5B2LA 3WIGA 3CSVA 1WAKA 4BDEA 2W06A 4EOPA 5JRSA 4U79A 1OPJA 2IVSA 1L8TA 3OT3A 4ZTMA 2PSQA 2XA4A 4TYHA 4G34A 2FSOX 3QTXA 3F2RA 5AADA 3V6RA 3NZ0A 3PSBA 2OZAB 4G16A 4CT1A 4F6WA 3L1SA 3ITZA 5CQUA 1OIUA 4FI1A 5DI1A 4LI5A 4QNYA 2J90A 5IQHA 2FSMX 5IF1A 4P7EA 2A0CX 3WOWA 2WOTA 3K2LA 1CKJA 4IAZA 1K2PA 3HAVA 2I0EA 3CC6A 3I4BA 5FEQA 2R9SA 3C4ZA 4IADA 3R8PA 3ZRMA 5DT4A 4IX3A 2XKFA 4AN3A 3PVGA 3NGAA 3O71A 1Q24A 3D7TB 4GS6A 3IONA 4O1PA 5EW3A 3TKIA 5CAVA 1JSUA 3ROCA 3TIZA 2C68A 2J50A 2E9NA 4G3CA 5JT2A 3MH0A 5EW8A 5A3XA 2JAMA 5DPVA 4YUQA 3OD6X 3NRMA 4M15A 3DXPA 5J7BA 2EXEA 3GCVA 1KE8A 4J8MA 3EN9A 3NYVA 2R3HA 3DBQA 2B55A 4JIAA 4JDHA 3H30A 4QP7A 2OI4X 3Q9WA 4E4MA 4IWPA 5CZHA 4ANLA 2IPXA 1GOLA 1OIQA 4FIFA 4R3PA 2ZB1A 4GU6A 4XNEA 4YGAA 3V8SA 2WTWA 4IAKA 4YJRA 3FI3A 2JDSA 4RIXB 5HI2A 4DEIA 4WT6A 3CCNA 3E8CA 4Z55A 3ZO4A 1UKHA 2HYYA 2Z7LA 3A2CA 4MHAA 1OL2A 4HPUE 4N0SA 1Z57A 4TKSA 2WOUA 4B4LA 1QPJA 3ZC5A 3MTFA 4RVKA 4BZNA 3BRBA 5JRQA 3S00A 2X7OA 2YCSA 4TNBA 3UIXA 3VS4A 2V55A 3QD4A 5I9VA 4O1OA 2XKDA 4IX4A 2J51A 3PSDA 3D94A 2IW9A 1IA8A 3FZTA 4MEDA 1Q61A 4E4NA 3OC1A 2WTJA 4OGRA 4D0XA 4FTIA 3W2CA 5LVPA 1BLXA 2RF9A 4LMNA 2WIHA 4BCFA 2JDRA 1GZOA 5E1SA 5E8YA 2BRGA 3VUKA 1XH8A 2YCFA 4N6ZA 5CF4A 4R77A 3R73A 3LOKA 2C6TA 3UNJA 2CKOA 2GMXA 4D1ZA 4DEEA 5K0KA 3ZS5A 2OK1A 1RE8A 3D5XA 3OEFX 5C27A 3VS2A 3NEWA 1UWHA 5J9LA 3OP5A 5JZJA 3C4CA 2UZTA 3I7BA 3OMVA 4EONA 5GZ8A 5IPJA 4W9WA 4J95A 3DAEA 4D1XA 2YA9A 4ZXTA 4XV3A 2VTJA 3H10A 2QQ7A 3C4EA 5HG9A 4DT8A 2EXMA 2NRYA 2QOHA 3CP9A 3ZLSA 4D1SA 2WELA 2QR8A 3MA6A 3VN9A 4ZY4A 4FKVA 2Z7QA 4FSQA 4ZS0A 2V0DA 3UC4A 4IE9A 4ZJJA 4AN2A 4XOYA 5AV1A 2C0OA 3VS0A 3A7IA 4N6YA 3NS9A 2VUWA 4NCTA 3HA6A 4IX5A 2PTKA 4MNEA 3N4VA 2PUNA 2QOCA 4I92A 4Y85A 4YNEA 4PY1A 5A9UA 2W1FA 2X9EA 4OR5A 3OWJA 3DJ7A 4NSTA 3JVSA 4F7JA 3QKKA 3TJCA 4M13A 3ZH8A 2J2IB 4RIOA 2YM6A 4DFUA 2QU5A 2C0TA 4KD1A 3BBWA 4PQNA 4FTCA 5L2WA 1ZMUA 3OHTA 3F5PA 2B9FA 4IZ5A 3QF9A 2QVSE 3KK8A 3PZEA 3ZLWA 1ZRZA 4M7IA 4EYJA 3K3IA 3BQRA 2RKUA 3NUSA 3OUNB 3R71A 3NDMA 3PIXA 4FZAB 4IW0A 2OWBA 5HLNA 2W99B 4E26A 4HVDA 1Q8WA 1Z9XA 2VD5A 3HECA 3I1AA 3F61A 4OBPA 4ZIMA 4RJ5A 1TVOA 2CGVA 3TI1A 2Z02A 1V0BA 2WMBA 4F08A 4HYSA 4FTQA 4KIKA 3F3TA 2PZRA 4FSNA 2EU9A 4LV5A 3BKBA 4C4GA 4PMPA 2YDJA 4BB4A 5EI6A 4AAAA 5CEIA 2OFVA 4F1MA 2O5KA 1PMUA 2OJJA 5AAFA 4X2NA 2QOOA 4QQTA 3TZ9A 4KUJA 3UZTA 5JFWA 3TNHA 3R1YA 3PJ3A 3JY9A 3C0IA 1H4LA 3QXOA 4RPVA 4L67A 5FTQA 5CSWA 4G3GA 5IQBA 2X8IA 1MRVA 4TRLA 5HQ0A 2VU3A 3QGYA 3W1FA 4BYIA 3FXWA 4MVFA 4WO5A 5HOAA 2W0JA 3BGZA 3EN5A 2JDVA 4FG7A 2WMWA 4FSWA 4OTIA 2WB8A 3UNZA 4YBKA 1REKA 3OW3A 4F6SA 5EKNA 3R1NA 4ZOGA 4BKZA 3WF9A 3BGQA 2R3RA 3DXQA 3F2AA 3KMMA 4AE6A 4IM2A 2H6DA 3UODA 1W82A 4IZ7A 5LWNA 4KBKA 4XJ0A 1PXPA 3JY0A 4FV7A 2YDKA 4XV1A 4ZZMA 3N9XA 3ORXA 3RK7A 3TKHA 4RX8A 4EZ7A 3F3WA 4A4LA 2GNGA 5FTOA 1FVVA 5CEQA 4RJ3A 5EI8A 3OG7A 2QO2A 2BCJA 4HNFA 3U55A 1Q8UA 3R8UA 3KMWA 1Q99A 5HNIX 2BROA 3IW5A 5AUVA 3DTWA 2J5FA 2XKCA 4J53A 2HZ4A 4NFNA 5AUWA 3LVPA 2YM5A 3KN5A 3CQUA 4QMTA 3S0OA 2R3QA 4DG2E 4EKLA 5FUTA 4FKLA 1NVSA 4PX6A 4BGQA 4GKIA 3LFQA 5M55A 2GNHA 4K33A 2LAVA 2CKPA 5IQCA 2C3LA 2XCHA 5D9HA 1E9HA 3TV7A 4YTIA 3ZLYA 1WBPA 1YXSA 4AA4A 3VHKA 3KQ7A 3IOPA 2B0QA 5BVNA 2YWVA 4IWQA 5EI2A 4BVUA 4D58A 2PHKA 1JSTA 3BQCA 4S34A 4EK8A 4ORKA 4LOOA 4EOJA 4RIWB 5BVWA 2Q83A 4BWPA 1W8CA 3GP0A 3QAME 2PVYA 3MVHA 4QQ5A 4I5PA 3ZC6A 3GU6A 4RA4A 3SGCA 3UVRA 4QQJA 3M42A 3BZ3A 4IHPA 4C3RA 4EOLA 2PVHA 2BPMA 3UZPA 4CGAA 2CHLA 2PK9A 2QONA 3GXLA 4CTCA 1AQ1A 1YI6A 5C1QB 5K5XA 2HZ0A 3DCVA 5CASA 1T45A 4ZJIA 3A4OX 3VUGA 2PPQA 5DYJA 4G6OA 4X7QA 5AP4A 3QC9A 3AGMA 4XRLA 1ZY5A 4YZCA 1YDTE 4S33A 1M2QA 4C33A 1CM8A 3N51A 4A07A 5AEPA 3G51A 4FV6A 3DBFA 3WF8A 1FGKA 4DH8A 2PUPA 4IVBA 3DU8A 3UQFA 5DEYA 1PKGA 3P86A 2UW6A 4Q5HA 3RAIA 4TN6A 2IZUA 1PKDA 1YOLA 4RVTA 5IU2A 2YN8A 4Y83A 4FT3A 4YPSA 3IGGA 3NYOA 2XS0A 3MDYA 3EH9A 5FEEA 3FLQA 3LXKA 4HGEA 2BRBA 2F7ZE 4IJPA 2B9HA 2PVNA 2W4OA 3P08A 4V04A 5EM7A 4D5HA 4CEGA 2C3JA 4UMUA 4M12A 2P4IA 4CMUA 1H26A 2VGPA 3FMEA 3QC4A 2ITOA 4KKHA 3QKLA 3GOKA 3QLFA 4WIHA 4AU8A 4CG8A 3O7LD 4YJOA 4G9CA 4RT7A 1JPAA 4NT4A 3UO6A 5AUZA 3HA8A 3LHJA 3CQWA 4GIIA 3PXQA 3H0ZA 5G6VA 5JGDA 2E2BA 2KULA 5KMLA 2ZV9A 2XB7A 4O22A 2QURA 5I5ZA 5C8NA 2X81A 2YIYA 4RJ4A 4EUTA 4H3BA 4FKUA 4WNOA 4CG9A 4ZTHA 2PZIA 1GNGA 2HENA 1J91A 4XV9A 4O7VA 4EOSA 5ANKA 3TWJA 1HCLA 3LJ2A 4KA3A 1Q8ZA 3COHA 3PJCA 2P55A 1GZNA 2XH5A 3GU7A 4AOJA 5DR2A 4UWBA 4FV5A 4BTJA 3ORKA 2QO7A 2GS6A 4ZY6A 2UVYA 4QMUA 4U5JA 5KKRB 3FV8A 4RQKA 2B52A 2VGOA 1PXMA 1XBAA 3CTHA 4YHFA 5CAQA 1ZOHA 4CZUA 4EUUA 2XK4A 2JDOA 3VW6A 3QQUA 5M56A 1DI9A 3ATSA 3GFEA 1A06A 4AGUA 3KB7A 3W2RA 3R0TA 3OXTA 4AQCA 3ZLXA 2R3MA 4JAIA 2XM8A 4YLJA 2PUUA 3FZPA 3FMMA 2ZOQA 2BR1A 2JGZA 2YIRA 2YHVA 3A8XA 3BHYA 4L46A 5HNGA 4QPMA 4DFYA 2ETKA 4FTMA 4FT5A 2ZAZA 4K0YA 5HE2A 5KHXA 3D2KA 3N4UA 1ZZ2A 2WGJA 4I6FA 5H8BA 4BCKA 3OZ6A 4R1YA 4XP0A 1OECA 4O0YA 1KE6A 5L2QA 2HY0A 4MWIA 4ZTQA 2R3JA 3R8LA 4CKRA 3TUDA 1YI3A 2Y9QA 1Q5KA 4H58A 2JITA 4CVAA 1M52A 2ITVA 1FVTA 1V0OA 4JQEA 3KC3A 1OPKA 2W1CA 3AT2A 4FT9A 5M51A 5KKRC 1BKXA 5EOBA 3RHKA 2B9JA 2R2PA 4IB1A 1OI9A 1Q8TA 2XKEA 4DFLA 1PMNA 4KIOA 5EM6A 3B8QA 3HMPA 1Q41A 3BCEA 1LPUA 5CEPA 4TYIA 5FWKK 4EOIA 4ERKA 3Q32A 2CNUA 3HV6A 4AWIA 3PVWA 3H9FA 2KTYA 5AP3A 2UW5A 4BDJA 1YWNA 3MB7A 5L8JA 2YIWA 5EYCA 3QYZA 4FR4A 2ERKA 5LCKA 4ANSA 1YXVA 4OT6A 2NPQA 5KE0A 4R8QA 3R7UA 1RDQE 4HVIA 4TYJA 3O8PA 3PZHA 5DOSA 1YXXA 4MXAA 3KRWA 3BX5A 3MH3A 3NW6A 3LPBA 4IWOA 3LFBA 4QMPA 2XIZA 5IEXA 4UBAA 3KRRA 3PDTA 5HO7A 3HDMA 3W8LA 4WSQA 2WMXA 4FSRA 1PF8A 4WD5A 4XMOA 4XV2A 5CZIA 5IISA 4QP1A 2NRUA 4FOCA 4I5CA 4FKGA 1CSNA 5AP1A 1Y91A 2O3PA 1NW1A 2CKQA 2UZWE 3UOKA 4FE2A 5CVGA 3E3BX 4RWJA 4GT4A 2QOIA 4NU1A 4FSYA 2JIVA 3ZUVA 3O50A 4DGMA 5KMMA 3EL8A 4ANOA 3ZZEA 1JKKA 3DK7A 2WD1A 5C4KA 3RWPA 4M3QA 1PXNA 3TJDA 5IH6A 3O7LB 4LV8A 5AMNA 1Y6BA 5ANEA 4WG3A 4YZNA 2F57A 5D12A 1K3AA 2OIQA 3NPCA 3ZCLA 4AOIA 5K5NA 2P33A 3FYJX 1A48A 4EOOA 3TXOA 3QHWA 2WZJA 3BYUA 2WQBA 1W0XC 3BHTA 1FOTA 5H2UA 4D0WA 2B7AA 4TNDA 4XG3A 4XG7A 1UU9A 4GT3A 2XVDA 4JLCA 4PPAA 2EB2A 2X4FA 3D0EA 3E8DA 5BNJA 3DBDA 5L3AA 4QMYA 5CVHA 4L42A 2HIWA 2HXLA 4LRKA 1U5QA 2WQMA 1URCA 5IQIA 1Y8YA 1M17A 2UZVA 3Q2MA 3QKMA 2UZEA 3LFDA 5K0XA 4ZSLA 3S4QA 3VBTA 4JRNA 3I81A 3A7GA 3HV3A 3RBWA 3BLRA 2YACA 5K4JA 1FBNA 4ACGA 4EQUA 3OUKA 3CGOA 3CLYA 5DT3A 4F70A 4RLKA 2W1HA 5E8UA 1PXKA 4EYMA 3MJ2A 3C1XA 3BI6A 3PWYA 3QQJA 4G1WA 3UIMA 5GZ9A 3L9NA 2R3OA 3PFQA 4FV2A 1ND4A 2C6IA 2WTIA 2C30A 2XM9A 5DFPA 3RWQA 3UYSA 2WIPA 4A4OA 4DGNA 2PE2A 3C5IA 3CE3A 4MXCA 2FB8A 2UZDA 2BFXA 3QHRA 4QYYA 3MV5A 3ODZX 4IZYA 3FKNA 4HGSA 2WTVA 4BKYA 4E5WA 3VQUA 5M57A 2GTMA 3GB2A 4IDVA 2CSNA 1K9AA 4PTCA 3KXXA 4JRVA 3TNIA 4U3YA 3FMJA 4RJ6A 4AZTA 3DT1A 1QPDA 1KWPA 4IFGA 4Y73A 4C57A 1APME 2A4LA 3GUBA 3WZUA 4IXPA 4HZSA 4WRGA 1UNGA 5HBHA 3TNQB 5HZNA 2OLCA 3OBJA 3CJGA 4HCTA 1EH4A 3R22A 4R6VA 3HMIA 4CRLA 5JN2A 2OZAA 3MVJA 3BPRA 3HV5A 3PJ1A 4BCHA 4NM3A 5M09A 5F9EA 1WBNA 2X7FA 2YABA 4RSSA 4E20A 3ORPA 4EQCA 2J9MA 3HUCA 5AP6A 1IEPA 3AT4A 3REPA 4L53A 2F9GA 3C13A 3B2TA 4ZSAA 5C8MA 3KN6A 3SV0A 3ZMMA 5BVEA 3FMHA 3JPVA 3EHAA 3EN7A 5L4QA 4ZZNA 3SG8A 2O2UA 3D7TA 3FWQA 4JI9A 3RPRA 3R9RA 3RMFA 3NAXA 4C3FA 4OTFA 3A7FA 3NCGA 4FTRA 2ERZE 1NVRA 4BHNA 2AC3A 3OOMA 4F9CA 1ZLTA 2R3PA 5BVOA 2WMVA 3PY0A 1FQ1B 4MX9A 4QOXA 2VTRA 3H9OA 3HMNA 3HV7A 5DIAA 4CYJA 2JDTA 3GC9A 4I6BA 4K9YA 1UU8A 2RGPA 4IAFA 3WF5A 2XJ2A 4BIEA 3DKCA 3W18A 2V7AA 4XG4A 3OT8A 4GK2A 3D14A 4KB8A 3PWDA 4RIXA 4RQVA 5BMMA 3LIJA 1ZWSA 1UWJA 2C6EA 2IZRA 3GQIA 5DT0A 2O64A 2C6KA 4CTBA 4DFNA 4JG6A 2DWBA 2G01A 5D11A 1PMEA 2W1IA 4RRVA 4ASXA 2E9PA 3L8XA 4JX3A 4OAUC 3ZSHA 1VEBA 2G15A 2RFDA 3CTQA 2XF0A 4I94A 3LFSA 5EW9A 5TOZA 1XJDA 5BMSA 2H9VA 1H8FA 4FEWA 2B54A 3NNVA 2C3IB 4YTFA 2E9OA 4B9DA 4QPAA 3CXWA 1LUFA 3NIZA 3QA8A 5HCZA 4DBXA 1SYKA 5CSXA 5CXZA 4TL0A 3E8EA 4FTAA 4CLIA 4DFXE 3F66A 5HBJA 2C3KA 4CFWA 4QO9A 1L3RE 2JAVA 3OS3A 4WUNA 4ITJA 3POOA 4QYGA 2O65A 2C5YA 3EFLA 4D55A 3NNWA 4QQCA 4UEUA 2V5QA 4EH3A 2PMOX 5HO6A 2CGUA 3CKWA 4BYJA 4O83A 3U8WA 5GHVA 4MQ1A 2BZIB 4YC6A 1WBOA 2WQOA 2ITTA 2YFXA 5CEMA 4E8AA 2W5BA 4GSBA 1SM2A 3KRLA 2J4ZA 3FKOA 5A4LA 4DG3E 5E8SA 1YW2A 1H1SA 5J7HA 2WMQA 4QMQA 3UNKA 4C62A 3VIDA 4KSPA 3ORNA 4USEA 4P4CA 2YCQA 3BWJA 2WMAA 3QU0A 4GVAA 4YHJA 1V1KA 3M11A 3TUBA 3BLQA 3NYXA 4WBOA 5DH3A 1PXIA 3Q53A 4AA5A 2XK3A 3H3CA 3MFUA 1Z5MA 4O2PA 4WNPA 4ZTNA 2IW8A 1G5SA 1SNUA 5C8KA 3C50A 4B8LA 5FXRA 3RZBA 4LYNA 2GFSA 2OBJA 4QP9A 3L9LA 4PWNA 3ZRLA 4NTTA 4NWMA 4IC7A 3IS5A 4U97A 4FZFB 2YDIA 2QR7A 3FZOA 3KKVA 1G3NA 3PJ2A 4FK6A 4O96A 3VAPA 5K3YA 4ZSGA 3DBCA 4GEOA 5AX3A 3R83A 2OIDA 3MIYA 1CTPE 4R3CA 3F5GA 4HVHA 1XHAA 3PUPA 4ZEGA 4D2RA 3W2SA 3UQCA 4NUSA 2I0HA 5AUYA 4BCPA 4NIFB 2YIQA 3PXYA 3SW7A 2W17A 3PSCA 3CD3A 3HL7A 5DMZA 4MNFA 5KZ0A 2JFLA 3DKGA 1I44A 1JQHA 4AW0A 5HVJA 4BICA 3QQHA 2O0UA 3LFNA 2QHMA 3MFTA 1Y6AA 4KIPA 4FL1A 5FDPA 4ZJVA 2UZLA 5HIEA 4A9YA 1JKSA 4FBXA 4O7TA 4P5ZA 2WPAA 3FUPA 4W4VA 4AACA 3RM6A 5J87A 1OL6A 4L01A 4E6CA 4II5A 5AAEA 5DRDA 3KFAA 2Q0NA 3P4KA 4QMVA 4A4XA 1UNLA 3WYYA 3KULB 4F64A 4UXLA 2VX0A 4MWHA 5BVKA 3QZGA 3BEGA 3BYSA 4ZTLA 4Y95A 4RWLA 4JAJA 1HOWA 3TEIA 4CFFA 2UW8A 5AV4A 3ZHPC 3EFWA 1FMOE 4CMOA 3UGCA 2HOGA 1AGWA 3EZRA 5K9IA 4PTGA 3AMBA 3MFSA 5DBXA 4CT2A 1LEWA 4EOKA 3BBTB 4FV0A 4XRJA 4CNHA 4IH8A 3DB6A 1KUTA 2I0YA 3RHXA 4ZP5A 3FMNA 3P9JA 4U45A 2WMRA 5GJFA 3FJQE 5IQGA 4IAYA 3PG3A 3P7BA 4H3QA 3FPMA 4TWOA 2XYNA 4Y5HA 4XHKB 3R9DA 5CLPA 3ZSGA 2G1TA 4QP8A 3UQGA 5JMSA 3EYGA 4FG8A 5CENA 2UW7A 4HOKA 4Q9SA 3UOLA 4DH1A 2H8HA 4DITA 5KCVA 3ENMA 4X2FA 3GCUA 1Q3WA 4HPTE 5E8WA 3EYHA 2VTIA 3ET7A 3IDPA 4FIJA 5DG5A 3RK9A 5CF6A 5HX6A 3L9PA 3M1SA 4U0IA 1OKWA 4QRCA 4R78A 5CY3A 1JWHA 5C4LA 3SC1A 1AD5A 4I0RA 1OL7A 3E63A 5GJDA 2HZNA 1LR4A 1H00A 2GHMA 3TNPC 4U43A 3D5WA 5H9BA 3UG2A 3QBNA 5GINE 4JT3A 5E4HA 2XNMA 4QYFA 3QTWA 5FQDC 1O9UA 3DDPA 4YSJA 4E6AA 2VAGA 4FIHA 3AC4A 1NY3A 2C5XA 4TWCA 3BHVA 3K5VA 4R5YA 3EQDA 3I5NA 3P1AA 4JX7A 3EB0A 4RIWA 2XK6A 2QG7A 2OXXA 2BTSA 5IEYA 3OF0A 4FGRA 3VS3A 4E6QA 2XIYA 3HEGA 4O7ZA 4UMQA 5EM8A 2FSLX 4IBMA 4KWPA 5HVYA 5A6NA 3KXMA 3ZUTA 3UMWA 1XH4A 3BYVA 3Q4TA 5DR9A 3Q4UA 4BCIA 2I1MA 2W9ZB 4YJPA 5GZAA 4HCUA 3GBZA 4HGTA 4MH7A 5JGBA 3CTJA 4Z7GA 2PVRA 5I9YA 1KV1A 3B2WA 3KA0A 2VTPA 2BFYA 3KEXA 1WBVA 2GDOA 3FPQA 4DEDA 4NYEA 5E8TA 3CPCA 4PMTA 2Z8CA 3FLWA 4BDIA 3M2WA 3E93A 4LM5A 2BTRA 2HW6A 4MYGA 4TXCA 3SRVB 5T6KA 2JLDA 1O6LA 4GG7A 3VUMA 5JK3A 2FVDA 3R30A 4ASEA 3FZSA 3LMIA 2YM7A 2ZV7A
chains in the Genus database with same CATH superfamily
5M4FA 3FY0A 3GI3A 4F7LA 4QMSA 4X3FB 5AX9A 2UZUE 3QTRA 4V0GB 1H28A 2O8YA 5LMAA 4ACMA 2ZDUA 3HDNA 4XBRA 4GFMA 4FTTA 4L68A 4LGGA 4FEQA 3DA6A 4Z16A 1R39A 2C69A 5HICA 4M67A 3ZFYA 3R04A 2W1EA 1G8AA 2QLQA 2C6MA 2R3NA 2GQRA 4GFGA 2O63A 3H4JA 3PP1A 2C6LA 3BELA 1OGUA 3R63A 4K1BA 5ANIA 5ANJA 4D28A 2NYAA 3EQBA 2OFUA 3AT3A 3DAJA 5G1XA 4BDGA 4I4FA 4ALVA 3E3PA 4R1VA 3RI1A 4C58A 4EC9A 5TO8A 5CAOA 1ZYCA 3MWUA 1YHSA 3ZM4A 1BL7A 4I1ZA 4EOMA 2FA2A 4F0IA 4RVMA 3HP5A 4XOZA 4O27B 5L2TA 3MN3A 5L6PA 5EDQA 3U6HA 5B2KA 4MBIA 4YZBA 4YMJA 4DDIA 2VX3A 4EK4A 2SRCA 4MAOA 1WZYA 4M68A 5CU0A 4FIGA 4TTHB 3LE6A 2YM4A 1OL5A 3COKA 2ITZA 4L8MA 3UOJA 4ZZOA 5IQFA 5I9WA 1ZOEA 4ANNA 4GUBA 2DYLA 3I0OA 4X3FC 3ORZA 3RK5A 1PRYA 4F9YA 1IA9A 4ACHA 4IZAA 3Q9ZA 4YJSA 5AA9A 3PP0A 4CCUA 1JOWB 1SVEA 1PJKA 2WMTA 3RCDA 3TDVA 4FKSA 2R3GA 2ITUA 3PLSA 4RX7A 4F9WA 3LCKA 2IWIA 3D2IA 5J9ZA 3S1HA 3PPKA 1MRYA 4PRJA 4LV7A 1ZARA 3G2FA 3FYKX 4JJRA 2WTCA 3ML1A 3LCDA 1OB3A 3G0FA 3F2NA 3GU5A 4HYUA 4NW6A 1JVPP 4Y46A 2GS7A 4QYHA 5A4TA 4HNIA 1DM2A 5CAUA 2PVKA 5J5SA 3BL7A 5IUHA 3WYXA 1GIJA 4XG6A 3MH2A 4V05A 2VTOA 4DH5A 1XH6A 3RZFA 4YNOA 4BDHA 5CF8A 4KSQA 5HO8A 4AXFA 5BV3A 2PMIA 2ESMA 2QKWB 2C5NA 2PWLA 3LJ1A 3OWLA 4G3FA 4O2ZA 4JQ7A 2XNEA 4NKSA 4PF4A 4QMMA 1YI4A 2VWWA 3BV2A 3HLLA 4ZMEA 3EIDA 1ZMWA 2VWYA 3DB8A 5JZNA 2UUEA 4UB7A 5EYMA 2AEGA 5FG8A 3AC8A 3CGFA 4EH2A 2JEDA 2W05A 5A6OA 3D15A 4AW5A 4FSUA 3LFFA 4UMPA 5IMEA 4BR3A 3UPZA 1H08A 2GNJA 4DHIB 3QUPA 4JNWA 5HTIA 1R0EA 1XR1A 4HZRA 3GGFA 4BGHA 3PIYA 3HZTA 4U44A 1H01A 3K3JA 5CF5A 1KE7A 2XJ0A 3ZONA 4CD0A 3ZO1A 5BQ0A 3TM0A 4I3ZA 4RJ7A 3AKLA 3K54A 4FGBA 2UV2A 3IDCA 2VNWA 4U8ZA 4CFXA 2PZPA 3R6XA 4O82A 2C0IA 3ODYX 3SHEA 2HCKA 4A7CA 2DS1A 2VTTA 3GVUA 4ZAUA 5M4UA 4ARKA 2J0JA 4O0WA 4TYGA 5D1JA 2C47A 2F49A 2V7OA 4L45A 2GS2A 4C59A 5JFVA 3QTIA 2XANA 2WTKB 4QMZA 4DCAA 2QCSA 1YDRE 3KRXA 4Z9LA 5JH6A 3Q96A 4FYNA 5A4CA 3PA4A 4WKQA 4FG9A 4FSTA 3OWPA 4N4SA 3BU6A 4XS2A 3TKUA 3UG1A 3C5UA 4FVRA 4CKJA 4OBOA 2Q0BA 1Q3DA 4ONAA 4E73A 2CN8A 2W9FB 3QA0A 4JIKA 5HCXA 1OKYA 1WVWA 4F0GA 3QD0A 4D2PA 2V22A 4DN5A 4L52A 4YC3A 4D4RA 3D4QA 4ZTRA 5IUIA 2YISA 3VQHA 3Q52A 5HKMA 4FRFA 4AT3A 4D2VA 2C1BA 1E1VA 5H3QA 3VUTA 5FRIA 3JXWA 1YVJA 1BUHA 2OH0E 5AP5A 2C1AA 5L6OA 5K4IA 4G3DA 1QMZA 3F7ZA 3TNWA 2R3KA 5CT0A 2HELA 2JKOA 5AUUA 3LKMA 3C4XA 3P7CA 4S31A 1OKZA 5HE3A 3TV4A 5M53A 2ZDTA 3PA3A 3DZOA 4D2WA 1H0WA 5JSMA 3NNUA 1BI8A 3UIUA 4F0FA 2G2FA 5H8GA 4EH5A 3EQRA 5CTPA 2RFNA 1OBDA 2R0UA 2CCHA 3FMDA 4PDPA 4BTKA 4YJTA 4CFNA 4F4PA 3MFRA 5KO1A 5KUPA 5IDNA 3ZXZA 1XH7A 4JBVA 3EJ1A 3E7VA 5IQEA 2WTKC 4N70A 4C4EA 5IA5A 4KS8A 4BJJB 5T68A 1GZ8A 2YZAA 4P2KA 1IR3A 5LVNA 5CSVA 2QOQA 5B2MA 1CKPA 4IC8A 4BZDA 1U54B 2Z7SA 5LCJA 2X4ZA 3MIAA 2P2IA 3V5TA 1CMKE 4RA5A 3MGYA 4J8NA 3GC8A 4YJUA 3UE4A 1H1PA 4EH9A 3FL4A 1ATPE 2ZMCA 3AC1A 4R7HA 4XCUA 2WU7A 5ACKA 4FV3A 4FICA 1O6KA 1PW2A 3C0HA 2QLUA 4DGLC 5FM3A 1J3HA 3V51A 4A9RA 3QALE 4L7SA 2OXYA 2W96B 1NVQA 3GU4A 4QT1A 5CI7A 3FXZA 3HVCA 3QL8A 5F1ZA 2LGCA 3PPJA 5CALA 2W1ZA 2GNFA 5AV0A 4FEUA 3I60A 5I3OA 5ETAA 3LM0A 3Q9YA 4FT7A 2JKMA 4O0SA 3WBLA 3NVKI 3I6UA 4X3JA 5KMNA 5LXMA 1U5RA 4QDVA 3HP2A 3QQLA 3TTIA 3EQCA 3VUIA 4GUEA 4AA0A 1M7NA 3HX4A 2DUVA 3SXRA 4BY9E 5F20A 2UZBA 4HJOA 4L00A 4FTLA 4UWCA 4XLVA 3AOXA 3F7WA 5D41A 4QP6A 4DYMA 4FV9A 3KVWA 3TMOA 3OWKA 5FP5A 1DI8A 3NUYA 5FBNC 3MS9A 3R7IA 2GNLA 5AWMA 4YTHA 4HW7A 1ST0A 1W2FA 2QOBA 4OTDA 2IZTA 4Y72A 3LFAA 4M0YA 3U87A 2IJMA 1P14A 2F4JA 3A7HA 4JQ8A 3RPSA 3KF7A 5AR5A 4D2SA 2XK7A 5EOLA 2YJRA 5E1EA 3UP7A 3CQEA 4ITHA 2FSTX 5BUIA 5DA3A 3R9NA 4XUFA 1R78A 5EFQA 4UV0A 4FTKA 4L43A 1BX6A 2YLEA 3FE3A 5BVFA 3GEQA 3EKNA 5J5TA 3EFKA 4NEUA 4I0SA 4BDAA 2J0KA 3FZRA 4O0VA 4FKTA 2CLQA 2QNJA 5ETFA 3OCSA 4RX9A 5IEVA 5KNJA 4J7BA 2A2AA 2R4BA 3TZ8A 4RFMA 3P0MA 1PY5A 3MPAA 3FY2A 3UP2A 4QNAA 4YR8A 4UYNA 4QP2A 3FC2A 3ZDUA 3G5DA 2OW3A 1ZZLA 3MPMA 4WG4A 3ZFXA 5HU3A 3F82A 3U54A 1FPUA 2CNQA 2P0CA 4IVCA 4YTCA 3A62A 2NP8A 1H27A 1OIYA 2AUHA 4BWXA 4O0TA 4E1ZA 2BVAA 4FYOA 4TT7A 2F7XE 2GTNA 3ZFMA 4H39A 4ZLOA 5HLWA 3QGWA 1U59A 2PL0A 2Y4IB 3NSZA 4W4XA 3PE1A 3SQQA 3UC3A 4CCBA 1U46A 3WILA 4U42A 1LP4A 4I23A 4PPBA 4EQMA 4PP7A 5L8KA 3UZRA 3A8WA 2OJGA 3E64A 5HLPA 3NIEA 3AMAA 2FH9A 3GU8A 4RWIA 2G2HA 4AT5A 3BLHA 5HHWA 5BYLA 2GHLA 4AZFA 4G3EA 4DFBA 4U7ZA 1UNHA 3T8OA 4DBNA 2QO9A 3NUNA 4M84A 2PMNX 5JKGA 4R7IA 3UDZA 4MKCA 3QTQA 5HU9A 3N4TA 4C2WA 2YZLA 5T3QA 5AR7A 3WZKA 4QEBA 4DHFA 4YHTA 5TF9A 4U9AA 3IOKA 5LARA 3W2OA 3PLAE 3LLAA 5H8EA 3DFCB 3R00A 3W0OA 3JR1A 2VRXA 4LMUA 3VS1A 4BIBA 2WU6A 3G9NA 4IANA 2YCRA 3MH1A 5LMKC 1JAMA 3FAAA 1OL1A 3O96A 5AV2A 5I9ZA 5IZFA 3TN8A 1YOJA 3DQXA 1OKVA 4I6LA 4XG8A 5CI6A 3MA3A 3JVRA 3U9CA 3AC2A 1YRPA 3FL5A 3ULZA 2Y4IC 4EWQA 4NKAA 2OJIA 4QTAA 3UYTA 3BYOA 1OM1A 4RG0A 5FXQA 4AF3A 2IG7A 2ZJWA 4B7TA 4XLIA 5M44A 3EN4A 1MUOA 2JBOA 4GVJA 1QPCA 2AC5A 4WNKA 3IKAA 5FBOA 3WIKA 1JBPE 3EQGA 4QMLA 4L3PA 2HZIA 3LFCA 5FDXA 4CXAA 4DEGA 3RALA 4G31A 3E62A 4J96A 5CT7A 5BUEA 4RIYB 2RSVA 4A06A 3VBXA 3O23A 1R3CA 2GSFA 4IWDA 4S2ZA 5I9UA 1JSVA 3RPOA 5E90A 3FC1X 3QRKA 5AUXA 2VNYA 3RAKA 3T3VA 3SOAA 4XX9A 2VWIA 2Z2WA 3DKFA 4Q9ZA 3ZUUA 3GOPA 3R2BA 5CU3A 3LCOA 3HRBA 4B8MA 1ERKA 4M97A 4NL0A 5CYIA 3GENA 4O86A 3LM5A 1XH5A 3E7OA 3VUHA 4E4LA 3QCYA 4FEVA 4NIFA 3U4UA 4FL3A 4UX9A 1W7HA 2WNTA 2BILB 4LDTA 3F3UA 4AZSA 3PY1A 5F94A 4TYEA 5CSHA 1PXOA 4M69B 4C3PA 4N57A 3FXXA 4TY1A 5ICPA 2WAJA 3H0YA 3Q04A 3R2YA 5CAPA 4C4FA 2HAKA 4AG8A 2UVZA 4BHZA 2R3IA 4QTDA 4EORA 2RG6A 5JEBA 2PYWA 3DY7A 3AD4A 3ID6C 3QFVA 3SA0A 3THBA 1R1WA 2ZV2A 4RC4A 5DLSA 4JG7A 5HTBA 3Q3BA 2CDZA 4IFCA 4JR7A 2ONLC 4PPCA 1ZMVA 4DG0E 3VC4A 2Y7JA 3CEKA 3R1QA 2ETRA 3KULA 3TG1A 4YJQA 3W0RA 1WVXA 3GCQA 4B6LA 4APCA 4IVAA 1SVGA 4ANMA 3EOCA 2VTMA 3R8VA 5JFSA 1IG1A 3VRZA 5EG3A 3FQSA 1QL6A 5J95A 4U40A 4G5PA 4KS7A 4E3CA 2BHEA 5A14A 3QTUA 3ELJA 5CEOA 5JGAA 4AQKA 5EYKA 2RFEA 5BVDA 2WEVA 3WZDA 5KX8A 3G15A 2J0LA 4HVSA 3CR0A 4FC0A 4ITIA 4K8AA 3ZZWA 4D2TA 4EBWA 4E5BA 3O8TA 4DE4A 4ASZA 2GCDA 5IQAA 3OCGA 4I5HA 3LXLA 3SG9A 5AV3A 4DF3A 2ZYBA 3F5XA 3LXNA 4NZWB 5AP2A 2ETMA 4HVGA 4J98A 3EQFA 3DPKA 3OW4A 3PPZA 4O21A 3WF6A 5AUTA 5LMBA 2J7TA 3PUFC 1SVHA 2XIRA 3ZTXA 2XYUA 4BF2A 4G17A 4YO6A 1Q62A 5F4NA 5CS6A 3RVGA 1J1CA 3NW7A 5IG1A 4JBOA 4DA5A 3A60A 3L8PA 3MY5A 4YURA 5IDPA 3F9NA 3HMMA 4ZTSA 5DNRA 4O7WA 5D10A 4BRXA 2OZOA 5AIRA 2BDWA 4UZHA 3WF7A 2XK9A 1CDKA 1ZXEA 3QXPA 4X2GA 3Q60A 4GYGA 3A99A 1H1RA 3KREA 1SNXA 5EHOA 1PMVA 1FGIA 3V5WA 4RVLA 1YHWA 3NVMB 2OJFE 1OMWA 4E6DA 2ITPA 3E92A 3RP9A 4LOPA 4BCMA 4BCQA 1I09A 3TTJA 4USFA 4X21A 4CFUA 4DTBA 2JKKA 3C9WA 1OPLA 2WTDA 2WEIA 3ENHA 3IW8A 4LFIA 5HG7A 2HK5A 2W7XA 5ETIA 5IA0A 4X2KA 2IW6A 4ERWA 2UW0A 4WBBB 2PVFA 1XBCA 4O7YA 4HGLA 3DAKA 4UALA 5TT7A 1J7LA 4C4JA 4YZMA 1MQ4A 4DCEA 4WNMA 2IVVA 3IW4A 4OUCA 1M7QA 2W5AA 3DJ5A 2XRWA 4F1OA 5B7VA 5CANA 5IA2A 5EM5A 1UA2A 4G6LA 4YJNA 2NNWB 1IASA 4FKRA 3EZVA 3OTVA 3KVXA 4C37A 2XJ1A 3QUEA 4KBAA 2QI8A 4FNZA 5J8IA 4RC3A 2XZSA 4GT5A 4GYIA 3OFMA 2BRNA 1FMKA 5CU6A 5LQFA 4JL9A 4EJNA 3VW8A 3F3VA 4I41A 4IQ6A 4AP7A 3FI4A 4NK9A 3KRJA 3HAMA 2EUFB 4G2FA 2XP2A 3F69A 4FNXA 4WOVA 4RX5A 3RTPA 3QRTA 4LRJA 4IAAA 4X6QC 5CSPA 3ZO2A 4AXCA 3ACJA 2XEYA 3IECA 4F65A 3FDNA 3RJCA 4ZY5A 3PVBA 4R7BA 4P90A 4AZWA 2R7BA 4NW5A 4F9AA 2J5EA 2ITNA 4CV9A 5TR6A 2ZM3A 4X3FA 3ERKA 3UVPA 4XYFA 3A4PA 3CS9A 4OW8A 3R28A 3CJFA 2ITWA 4UXQA 4V0GA 1KE9A 2YITA 3ATTA 3ULIA 1ZOGA 2OIBA 3LLTA 1JKTA 4DGOA 4QMWA 3SOCA 4XP2A 4C35A 4KKGA 4K18A 5KMJA 5HG5A 1B6CB 4O0UA 3MI9A 4ZS4A 3O51A 3OCBA 5GJGA 3II5A 5E8XA 3PXRA 4O6EA 3SKCA 2PE0A 1TQPA 1GY3A 2V62A 4FVQA 5A46A 3QX4A 4JBPA 5C26A 4UN0C 2PULA 2YM3A 4BDCA 3QTZA 4MD8E 2Y0AA 3HRFA 2BKZA 1CKIA 3FSKA 4CV8A 3E5AA 4BC6A 3JUHA 2WMSA 3DZQA 5KBQA 3S95A 4H36A 2J0MB 2C6OA 4FL2A 2DQ7X 5HBEA 5GIPE 3Q6WA 3AC3A 3QRUA 3OVVA 3ORIA 4GCJA 4WHZA 3R8ZA 3V5LA 4ALWA 4A9UA 2UZOA 1BI7A 4EH4A 4FOBA 5DVRA 2FUMA 4PL4A 1XH9A 3VUDA 4LL0A 4CQGA 3COIA 2GPHA 5EQEA 1RJBA 3C4WA 3P5KA 3FLNC 2H96A 2VO7A 2XBJA 4LUEA 2EVAA 3MPTA 5HESA 3TDWA 2YWPA 2F7EE 3FHIA 1WBWA 1UU3A 2ZV8A 4FK3A 3VRYA 4W4WA 4B99A 2W1GA 4DH3A 4C36A 1A9UA 2ZFYA 3LXPA 2XUUA 2GHGA 1G8SA 2JFMA 1KE5A 3R1SA 5IA4A 4I24A 1Y57A 2IZSA 1H0VA 4PL5A 4AS0A 4C4IA 3CIKA 3UVQA 4UMTA 4EK6A 3D5VA 3ALNA 4MQ2A 3I0QA 3V6SA 2OF4A 4M14A 3D5UA 3W55A 5CU4A 2F2UA 3JS2A 2YEXA 3TACA 3KCKA 4GU9A 4AW2A 1TQMA 3RCJA 2XMYA 4DEHA 4QTCA 3W0MA 4J1RA 4EI4A 3D9VA 2XAOA 2CGWA 2UW3A 1SMHA 2I0VA 4AN9A 3G9LX 4DAWA 2R7IA 2RG5A 4CFMA 4CLJA 1G8KA 1F5QA 4EK5A 1QCFA 4MXZA 4DH7A 3ZXTA 3FI2A 2VV9A 1E1XA 1YOMA 2CPKE 1VYWA 3P7AA 2ITXA 4WG5A 4FV1A 4AGCA 1XKKA 3NUXA 1W84A 4Z7HA 4BDKA 1ZAOA 4OTHA 5M4IA 4FZ6A 1SZMA 5TKDA 5B0XA 1RW8A 2VTSA 3S2PA 1XO2B 3LFEA 2VWVA 4BTMA 1WFCA 3PYYA 3VS5A 3MESA 3ROYA 4G5JA 4L44A 4RFZA 4ENYA 3F5UA 4YLKA 1S9JA 4MF0A 4NJDA 2R3FA 4FUYA 4O0XA 3WZJA 2Y6MA 4H1JA 4AX8A 3GCPA 3RM7A 1YDSE 4Y5QA 4H3PA 3OROA 3R7YA 3KCFA 4FF8A 3VJOA 4Y8DA 4B0GA 1S9IA 3BIZA 4MD9E 4DC2A 4RZVA 3DNEA 2XNGA 1UVRA 3V8WA 5LOHA 3VBYA 2WKMA 4IAIA 3KF4A 4WA9A 3UOHA 2UW9A 1J7IA 3R9OA 2IVTA 2XK8A 3C51A 3JYAA 4JDKA 4FTJA 4TYHB 1PYXA 3TCPA 1YWVA 4IB0A 2JIUA 4KNBA 2R64A 4EK3A 1KSWA 3OOGA 1KV2A 2WFYA 5LVLA 4L7FA 4AGWA 4ALUA 3A7JA 5A4EA 1GZKA 1IRKA 4GL9A 3R7OA 4E4XA 1H07A 3MY1A 5JQ5A 4RWKA 2UVXA 3S3IA 3PTGA 4R3RA 2HXQA 2EB3A 4AT4A 3PIZA 4EOQA 3DDQA 5CNNA 3WE4A 4D4VA 3LQ5A 4C2VA 4F09A 3BV3A 4AAYA 1NA7A 1XBBA 3Q2JA 1Q97A 4FKIA 2G9XA 5D7AA 3KY2A 3BWFA 1XMLA 4JBQA 4ANBA 4M66A 1F3MC 1W83A 5AR2A 4U80A 5C01A 1U4DA 5FP6A 4BBEA 1X8BA 4F1TA 1ZYJA 3DTCA 3AGLA 4MTAA 4KAOA 4W8EA 4YC8A 4EZ3A 4RFYA 1PXLA 3BE9A 4EH8A 4NM0A 3C7QA 4YZ9A 3V04A 4BBMA 3T9IA 5J1VA 3VVHA 4AXEA 4FIIA 3ZM9A 4OTPA 4OTQA 4BJJA 5GNKA 4IJ9A 3RNIA 5GIOE 1GIHA 4RBLA 2X0QA 1YXUA 3MBLA 3UO5A 2ITYA 3D7ZA 2X6DA 3UBDA 4O91A 4YPDA 4GIHA 3BU5A 1U54A 3ANQA 1BYGA 4DEBA 2XEZA 2WHBA 1OZ1A 3ZEPA 3R02A 4QP3A 3EMGA 2PVJA 4EZ5A 4XG9A 5EHLA 2QOLA 2YLFA 3WARA 4W8DA 3R7VA 1H24A 3NR9A 2FGIA 4KKEA 2W4JA 4ZMFA 3NLBA 4YU2A 2C5VA 5CNOA 3BL9A 4FKQA 3QLGA 4BBFA 2XCKA 3U6IA 3DOGA 4FNYA 3NX8A 3QCSA 4BCGA 2X1NA 3EWHA 2Z60A 1NT2A 4EKKA 4I6HA 3Q4CA 5D7VA 5L6WL 4BCJA 4D4YA 5L2SA 4YSMA 3QRJA 2XRUA 1Q4LA 4H05A 1FVRA 2GQGA 4ZSJA 5AR8A 2JKQA 1Y8GA 3AQVA 3NNXA 4HYHA 3WI6A 5KHWA 1IAJA 4CMTA 2A1AB 5IQDA 1XQZA 4OLIA 4FODA 3T3UA 4PP9A 1HCKA 3DJ6A 2OSCA 1M2RA 3EN6A 3HUBA 4I22A 5HNBA 3UO4A 1VZOA 4C61A 3Q6UA 4GRBA 3V3VA 3LQ3A 5E91A 2I6LA 1DS5A 2XNBA 3SAYA 3ZBFA 2OF2A 5HD4A 1LEZA 2QOKA 3G90X 4F9BA 2VWZA 4QPSA 4LGDA 4EHZA 4OTRA 1P4OA 5HX8A 5DN3A 2OKRA 3SVVA 4BKJA 3RNYA 1WBTA 3W10A 4GK4A 3VF8A 2QHNA 4G9RA 5DWRA 1OUKA 2VWXA 1PXJA 3PE2A 4LUDA 4IMYA 3FZ1A 2EWAA 3DK3A 3MY0A 4ASDA 3O8UA 4C0TA 4AZVA 4LOQA 2VWBA 3QZFA 3LW0A 4ZLZA 2PVMA 3KK9A 3LCTA 4V01A 2ZM1A 3BGPA 4BWKA 2BAKA 4QTEA 4S30A 5HEZA 4FSMA 4MNEB 4DT9A 4U6RA 4ANQA 5C03A 5JQ8A 3TV6A 2W4KA 5HIBA 3TT0A 3VJNA 3LMGA 2CNVA 2OJ9A 3U9NA 5FD2A 2QC6A 3MVLA 3QZIA 3G33A 5DHJA 2IN6A 3OTUA 3VNTA 3W32A 4EC8A 1YQJA 2CMWA 2RL5A 4GJ2A 5CU2A 4QMNA 4O7SA 4FX3A 3AD6A 3H9RA 5LMKA 4FKWA 2OG8A 4O81A 2C6DA 2ZB0A 4BIDA 2PMLX 3C4FA 4BZOA 3OEZA 1J7UA 3E88A 2BRHA 3UPXA 2BRMA 2Y8OA 4FKOA 3AG9A 3DBEA 5AR4A 4FNWA 3AXWA 3MJ1A 3PG1A 4DINA 4C7TA 5FXSA 2XNOA 5E9EA 4I6QA 5DEWA 5FEDA 4EL9A 5BYZA 4AXAA 3FBVA 4FSZA 3I5ZA 4ID7A 3TZ7A 4CZYB 4Q5EA 3KMUA 2W5HA 4ACCA 1STCE 3DK6A 2HW7A 5J79A 3HMOA 4KIKB 3FMKA 4MBJA 4NTSA 3UTOA 3PXFA 4YJVA 2XIXA 3CY3A 3DFAA 3CD8A 3R7GA 3HNGA 1OGYA 4JOAA 3ZDIA 3FMLA 4QMOA 4FTNA 4M0ZA 4C8BA 1OITA 2B9IA 4FEXA 5TE0A 4NCTC 3OXIA 2PUIA 3LCSA 1OVEA 4PDYA 3QQGA 5CEKA 3FEGA 1V0PA 4D5KA 3C0GA 2XNNA 2IF8A 3DNDA 1GAGA 4PNKA 3ORTA 2YM8A 4F7NA 3TUCA 3ANRA 3OBGA 1TQIA 2ZM4A 5ITAA 3EQPA 3P79A 5DE2A 3W8QA 4DTAA 3R7EA 3ACKA 4AOTA 3PJ8A 3PVUA 4O7NA 3DQWA 4BI2A 2CJMA 2WQNA 5HG8A 5AAGA 4QP4A 2QG5A 5AM7A 4O7LA 4CQEA 3FHRA 1XWSA 3LJ0A 2OICA 2WMUA 4TWPA 4X2JA 5F95A 4F7SA 4RC2A 4GJ3A 4P5QA 4W4YA 4KRDA 1M14A 1VR2A 3SXFA 5M07A 5AA8A 4FT0A 1KOBA 3R21A 4UWYA 5HTCA 2QKRA 4GH2A 5HD7A 2REIA 3OXZA 2ONLA 1RQQA 3I79A 4KBCA 2JD5A 3P78A 3UMXA 3ZRKA 4UMRA 3I7CA 4RIYA 4NH1A 2OU7A 4F99A 4UY9A 2IO6A 2PY3A 3TZMA 3AMYA 3IPHA 4I0TA 3MVMA 5EYDA 2QD9A 2B1PA 3QCQA 5KMIA 3F6XA 3PY3A 5IA1A 4MD7E 1JKLA 2R3LA 4IM0A 3FI8A 4MK0A 3O17A 4O0RA 4GK3A 3NUUA 3BU3A 2BAJA 2JIIA 2VO3A 4GW8A 2ITQA 2OO8X 3Q5ZA 2IVUA 3DLSA 4YLLA 4BCOA 2PU8A 3LAUA 4FTOA 4UYAA 1F0QA 3QUDA 4JXFA 4DGGA 3ALOA 1B38A 4CZTA 4FA2A 2X8DA 3EFJA 4MXXA 5HIDA 1YXTA 4J71A 5J9YA 5E7RA 2FO0A 3Q4ZA 4FV4A 4M69A 3SXSA 5ANDA 5FM2A 3G6HA 3PRIA 5M4CA 1J1BA 4HYIA 4L3JA 4K77A 2ZVAA 3IW6A 5DGZA 3GFWA 4BI0A 4LGHA 4O38A 2VN9A 4I93A 3PXKA 4PMSA 4CKIA 3RAHA 4AFJA 3KXNA 3MTLA 4OBQA 3B8RA 3KXHA 4PV0A 3NCZA 4WRSA 4XG2A 3VF9A 4J52A 4F78A 4K11A 3DXNA 4XBUA 4O6LA 3IK3A 2VX1A 2Y6OA 2J0IA 2QU6A 4IIRA 4BDDA 5L2IA 3AD5A 3FSFA 4IX6A 4OTGA 2X0GA 5LJJA 4RLLA 4U81A 4FTUA 1TKIA 5FGKA 5HE0A 4IB3A 4AZEA 2C4GA 2BAQA 3QD2B 4GKHA 4DLJA 4EEVA 2GU8A 3W2PA 3NUAA 5HVKA 4AGDA 1G8JA 3BLAA 4DLIA 4DFZE 4AW1A 1MQBA 3QTSA 4PTEA 2CCIA 2E9UA 4S32A 4Z3VA 2CGXA 1O6YA 4IB5A 4QD6A 5CVFA 2X9FA 3ORLA 3A61A 3DLZA 3QYWA 1B39A 3QZHA 5JFXA 4OT5A 3V5PA 3FQHA 4EWHA 5AJQA 1ZY4A 1KOAA 2FYSA 4YZDA 4JDJA 3IQ7A 4APPA 3IW7A 4IACA 4TZRA 4MXYA 3G6GA 4MXOA 2EXCX 3FKLA 5ANGA 4O7RA 2VWUA 1H1WA 4GG5A 5M06A 5CWZA 4FJVA 2BMCA 4WSYA 2OH4A 4FZDB 3W33A 2X39A 3MW1A 4PDOA 4EH6A 4I20A 4PMMA 4CFVA 4A9TA 2YIXA 4ZLYA 4WUAA 4OAVB 1BMKA 4RMZA 5C9CA 2VTHA 1FINA 4LG4A 4BGGA 3O2MA 3QWJA 4LRMA 3W0QA 3RGFA 4EBVA 4GFOA 5J1WA 4PNIA 1REJA 1JLUE 5CQWA 2CLXA 3NAYA 3TIYA 3R01A 1URWA 3RAWA 3ZO3A 5IH4A 5IMXA 4BFMA 4A9SA 2VTNA 2WO6A 3NW5A 5EDRA 4DTKA 2F2CB 3V01A 3WZEA 3ZBXA 4YBJA 3HRCA 1M2PA 1ZYDA 2PZ5A 4H1MA 3VS7A 3CBLA 3IO7A 4QMXA 1IAHA 3V5QA 4MCVA 2VTAA 2OGVA 3QRIA 5A54A 3QCXA 3E87A 4D4SA 3DGKA 5LVOA 1YWRA 1UU7A 4PDSA 2BDJA 5IH5A 3WE8A 4MF1A 2QOFA 3IG7A 1GJOA 1WMKA