1OECA

Fgfr2 kinase domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
298
structure length
280
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARREQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBROBLAST GROWTH FACTOR RECEPTOR 2
publication title The Crystal Structure of the Fgfr2 Tyrosine Kinase Domain in Complex with 4-Aryl-2-Phenylamino Pyrimidine Angiogenesis Inhibitors
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 280
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oecA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oecA01
1GOLA 3QXOA 2QNJA 3FE3A 1IR3A 4UX9A 1WAKA 1PMVA 2R0IA 4HNIA 5IA4A 3QL8A 2BDWA 4MNEB 4XG8A 3DAKA 3Q53A 2OO8X 2Y0AA 3D5UA 4C38A 4IZAA 4JBQA 5J1VA 3MJ1A 3I6UA 4I22A 5JFVA 3BWFA 5M44A 2JIIA 3SXSA 4DEBA 3TV6A 4EQMA 3KU2A 3R9OA 4NKSA 5EOLA 1TQPA 4U41A 2QR7A 4YJNA 3UOJA 2BILB 4LOOA 4OTWA 5BUEA 2ZB0A 3FZPA 3HVCA 3QKMA 5KKRB 4BIEA 1YOLA 4RWKA 3KK9A 2BCJA 5HO8A 4DG0E 4P7EA 3QTXA 3I1AA 4YZBA 5H9BA 5E4HA 3Q32A 3GQIA 5FLFA 4B0GA 3C5UA 1OUYA 2BHHA 3VQHA 4DG2E 1FVVA 2REIA 2WMTA 2WXVA 4LGGA 4MQ1A 4NW6A 4D9TA 5LMKA 1Q3DA 1QMZA 2WGJA 2PU8A 3UOHA 2UZLA 1ZYJA 5B7VA 2OJFE 1PXIA 4FV4A 5EI8A 1J7IA 3A99A 2VTMA 4QMOA 4KINA 2HZ0A 4IJ9A 4GS6A 3FY0A 5F95A 4IE9A 2VTSA 4S2ZA 1PY5A 1RJBA 2HXQA 2A19B 4WT6A 2YISA 2YLEA 3OCGA 3UIXA 4FTKA 3ZBXA 3BYMA 4BWPA 2ZMDA 4YPDA 3BU5A 4GIIA 4EI4A 1OKZA 2WQNA 4D2RA 3EYHA 4O82A 4N70A 4O6EA 3RALA 3NNVA 3TUDA 1G3NA 4AW2A 3FMNA 3A7FA 4TWCA 3N4UA 4LRJA 2PMLX 3SOCA 4NYEA 4YMJA 4HJOA 2OH4A 3PXFA 4IX4A 3HAMA 2QOIA 3Q6WA 3MVHA 3CC6A 1H00A 3BEAA 3QD2B 2XIZA 1UNGA 3RWPA 3C50A 4BCHA 1U46A 2ITTA 3TKUA 1XO2B 4FT0A 3EZVA 3FLYA 1K9AA 1GNGA 3W16A 3OF0A 2C6LA 4PL4A 2YM8A 5DE2A 1KV1A 3HDNA 3F3ZA 4RC2A 5DHJA 2GNJA 4FSZA 4KIQA 3VUKA 2P2HA 4YTHA 4EH5A 3DBCA 4FL3A 5JZNA 2PYWA 3AOXA 3SG8A 4O7YA 2PVFA 3DOGA 5IUGA 1B38A 3PSDA 5DRBA 2IWIA 3IKAA 4FODA 2RFEA 3II5A 2ZJWA 3I0QA 4QPMA 4HCUA 4KRDA 4V04A 2R3NA 2RSVA 3DKFA 3R04A 5FQDC 1PHKA 4BZDA 3FEGA 2CNQA 2WTDA 3D15A 2W7XA 5M09A 4DEDA 2WMXA 3LQ3A 4G31A 2I0EA 3WZJA 2BIKB 3PSBA 1WBPA 4DC2A 3R1YA 3OG7A 4RX5A 2QVSE 3EFWA 3HV3A 3VAPA 2PUIA 4MNFA 4NWMA 2PE2A 3CQWA 4PL5A 2GU8A 2X4ZA 3I0OA 4GT5A 4V0GA 4FOBA 1JBPE 3FHRA 1KE8A 4IM3A 2OZAB 4DFYA 5A4TA 3ORPA 4FIJA 3VQUA 5M08A 3WZKA 4I94A 2J9MA 4FEWA 3L8SA 4BWXA 5CEKA 5DYJA 4ZSEA 3UQGA 4AFJA 2P0CA 2XM9A 4IVDA 5E8TA 4O7ZA 3W8LA 4IAYA 4R3RA 4V05A 3A2CA 2YM3A 3LLAA 1H1RA 3ORNA 5AM7A 3QRJA 4BKYA 3SLSA 1YWRA 1ZLTA 4UZDA 3ZFXA 4N57A 4AZFA 3QQLA 4DH7A 4EL9A 3HRBA 5A46A 3ID6C 4B4LA 3ODZX 2X8EA 3G33A 3U4UA 3SKCA 4FZ7A 5M51A 4FTOA 4AAAA 5LMAA 4F7SA 3QTQA 4C35A 4EOJA 1WFCA 4AUAA 2W1EA 4TYGA 2HY0A 5JGAA 5K5XA 2LGCA 3OFMA 3TTIA 3FKNA 5HE3A 2VX0A 2QC6A 4JT3A 3K54A 4OLIA 4F4PA 3CY2A 4BVUA 5HG8A 4CT2A 4C4JA 2R3IA 2E9OA 4GK4A 5BVWA 2W9FB 5CEOA 3QZIA 3BGPA 3PYYA 3TNIA 3R1SA 4EH3A 4FT9A 4AN9A 1GZOA 4KS8A 5M4UA 3D5XA 3F3UA 3MA6A 3P78A 2ZYBA 3R8PA 5ETFA 2JKKA 3HMNA 3WZUA 4RJ6A 3T9IA 1V0PA 4EH6A 1DS5A 2CMWA 3C1XA 3NSZA 2PZIA 3O51A 3PXZA 5HX8A 3ORZA 5AUYA 4WSQA 4AX8A 3HAVA 4ZY6A 2GNHA 3CS9A 3CGFA 1MRUA 2X39A 4L67A 5AIRA 2Q0BA 2P4IA 4U5JA 3TNWA 2X2LA 3KEXA 3OCSA 4X6RA 3FI3A 4FSRA 2FB8A 3NCGA 1TQMA 3ZO3A 5AUTA 4GJ3A 4B7TA 4O6LA 4TYJA 3FI4A 5CLPA 3I5NA 5LWMA 3KMWA 1LP4A 3G9LX 3MIAA 4CT1A 2PSQA 5EG3A 4X3FC 1XKKA 5HHWA 3RNIA 3D94A 3KVXA 5J7HA 4NK9A 4AA4A 4R78A 4D4SA 4DEHA 1B6CB 3PG3A 2JC6A 3NUNA 5DA3A 3V5PA 3WF8A 4AQCA 5J5SA 2WMQA 3AGMA 1Y6BA 3D7TA 2VX3A 2VWVA 4YJOA 2AYPA 4EZ5A 2ZDUA 4C2WA 3O8PA 3RHKA 3SOAA 4GFMA 4FUYA 2WNTA 1ZYDA 4O81A 2VTJA 2WMVA 2XB7A 4OT5A 4APCA 4NW5A 5FBOA 1ERKA 3O71A 5DIAA 3QTWA 4WNMA 3BIZA 2IW8A 4RPVA 2C6OA 4XHKB 4CYJA 2C3JA 1G8AA 3H0YA 5FG8A 5IA1A 4GSBA 2G1TA 4IAIA 3VUGA 2O64A 2W9ZB 3VO3A 5EQPA 2JD5A 1P5EA 4D1SA 1UU3A 4DF3A 4UALA 4DGGA 4LRMA 4FKOA 3UC4A 4I21A 3TKHA 1OVEA 1Q5KA 2C30A 2GTNA 1PXOA 4JJRA 4D4YA 5TR6A 1O6YA 4ZJJA 4E5BA 4P4CA 5I9XA 5IA0A 5BUJA 2UV2A 5CAPA 5I5ZA 3F66A 3PWYA 4DBNA 4EOMA 1NT2A 3UTOA 1UVRA 2I40A 4BDIA 1U54A 4F9BA 3PTGA 3VNTA 4ALVA 3KQ7A 2BZJA 2WMAA 3NNUA 5IQFA 2FSTX 4YP8A 2YEXA 3D9VA 3KXMA 3FL5A 3MWUA 4O7LA 2ZM3A 3RPYA 1M2QA 2IVTA 2WMSA 4C4HA 2VGOA 2BIYA 1Q61A 4QRCA 5AUVA 3W2PA 2HW7A 2F2UA 3DY7A 3P7CA 4HVGA 2YLFA 5FXRA 1IG1A 2UW4A 3FSKA 4U7ZA 4L6QA 5AJQA 4X3JA 3DBDA 4EKLA 2OJJA 3BEGA 2UZOA 3ZEPA 2OF4A 3U4WA 4O7VA 3MTFA 4AG8A 4JAIA 2JDRA 3R6XA 2HWOA 1ZOHA 3P9JA 4L7SA 4XCUA 5A4QA 2JDSA 4BDAA 1H01A 4NIFA 1JKLA 3ALNA 3EIDA 4MXZA 4GG5A 5IUHA 2XNOA 4FEVA 1YWVA 3PRFA 2QOFA 5EKNA 1YXXA 2YIXA 4J7BA 4YJRA 2C0OA 4X3FA 4ASEA 2R3JA 4MBIA 2VTIA 1YXTA 4GVAA 4YC6A 1MQ4A 3BCEA 3F3WA 1OKWA 4EK4A 3PLSA 3ZDIA 5K4JA 3S0OA 2I0YA 5ANGA 4Q9ZA 2AC5A 1H1WA 5AUZA 2WTIA 4Z7GA 4CFUA 3MPTA 4R8QA 3D2KA 4FKVA 1Z5MA 1UWHA 3DCVA 1OIQA 5JZJA 2A1AB 2PZYA 5HBHA 2RFNA 1WBSA 3I81A 3QGWA 3EQCA 5JN2A 2ZV7A 4D2PA 3N9XA 3CCNA 3DKCA 5HU9A 3GU4A 3NUPA 3VJNA 5FTGA 2GSFA 1Q8ZA 3D5VA 4TRLA 4ANNA 4FTMA 4FG9A 4L00A 3T8OA 1GJOA 1OUKA 3DTWA 4FSMA 2FSLX 5HCXA 4FL1A 4EK5A 3QQHA 4YJPA 3CXWA 4QQJA 5HKMA 3VF9A 2YA9A 3F2NA 2UUEA 4DFNA 2J0LA 4YURA 4E6CA 4NM3A 3A7GA 4L9IA 3V3VA 1FGIA 2FH9A 3FYKX 3CD3A 4OBQA 4QPSA 4TKSA 5CWZA 4AZSA 4L43A 4CCBA 5TOZA 2JDTA 3HDMA 4M12A 3UNZA 4F9CA 5M06A 5EYCA 3TJCA 5E90A 2XH5A 2WIHA 3TJDA 1RDQE 2OIBA 1MRYA 2PVRA 5E9EA 1Q3WA 4L53A 4MHAA 3UG1A 3Q9YA 5GZ9A 2QKWB 4IWPA 1ZZLA 1SZMA 4C36A 3QKKA 4QD6A 4BCJA 2ITYA 4FVPA 5KE0A 3KXHA 1LEZA 2C5YA 5HG7A 4HGLA 3EQIA 3LM5A 1KE7A 5HESA 1H0WA 3NUUA 4CXAA 2PVMA 2W4OA 2VGPA 3KKVA 4UBAA 4UY9A 4CGAA 3BQRA 4HZRA 5ETIA 2Z7SA 2QHMA 4HYIA 4RX9A 3DT1A 4PUZA 1E9HA 3A62A 3MSSA 3K5UA 5D11A 3UVRA 3GNIB 5A14A 5T68A 3ZLXA 1O6LA 3OD6X 1UNLA 1W83A 2NRUA 3NYVA 3S95A 4DH3A 4E1ZA 4DCAA 3Q04A 2VX1A 1G8SA 4A4XA 4LYNA 3GC7A 3Q9WA 5EQEA 5KX8A 4EWHA 2UZVA 3COHA 2WMRA 3UO4A 3E87A 3A8WA 4C4IA 3G9NA 2UW6A 3FLNC 4BDBA 3F61A 3GXLA 5ANDA 3A4OX 4ERKA 3QX4A 3AC2A 2IZUA 4FKGA 1WVWA 5HU3A 3LVPA 3IW8A 5FXQA 2QOBA 3PE1A 5IQGA 4Y72A 5EFQA 4ZS4A 4HYHA 2R3HA 3R8ZA 2BR1A 4RSSA 5KHXA 5GIPE 2KTYA 1JKKA 2V7OA 3CIKA 4A9TA 4BWKA 1YKRA 2IZSA 2OXDA 1XH5A 4FKIA 1ZXEA 2I0HA 2UZEA 3IW7A 4ERWA 5F4NA 1Q4LA 5JGBA 3HRFA 5FP5A 4NM5A 2XK8A 3MJ2A 4FZAB 4RJ5A 5AR8A 4F64A 5CNNA 4F08A 3HRCA 3ORXA 3KB7A 3GCUA 4NUSA 3GENA 4EOIA 3JVSA 3OBGA 1REKA 3IECA 4YZ9A 3E8NA 4FTJA 3GCPA 3RINA 3SQQA 3FYJX 4EOOA 3R8VA 1H27A 3LOKA 4QTBA 2R3KA 5AR7A 2OU7A 4L7FA 5E1SA 2YDKA 1EH4A 2V7AA 4GV1A 5DH3A 4AE6A 2B9HA 3D14A 1NVRA 4QMUA 1KE9A 4BCFA 4O7SA 3NEWA 2PVYA 4Y85A 5GZ8A 4O84A 5D10A 4ONAA 2UW7A 2GFSA 5CI6A 4DH1A 3A8XA 4XP2A 1IAHA 4NZWB 1WVXA 4TYIA 4WRSA 4EKKA 4FG7A 4FNZA 4I0TA 3Q4UA 4YGAA 5IG1A 1BLXA 2O2UA 2Y9QA 1L3RE 4YJQA 1QL6A 4XG7A 5IQDA 2HY81 5DI1A 4NH1A 4FK6A 3A60A 3KRXA 4FSQA 4Y83A 3ORMA 3DK6A 4PMMA 4PTCA 4RBLA 5E1EA 4D5KA 5CSHA 3BYSA 1OKYA 2V55A 3R02A 4FT7A 4LUEA 4E4XA 4LMNA 4TT7A 2GS2A 3C0IA 4BFMA 3HA8A 5JH6A 2PUPA 3FWQA 4LG4A 4ZXTA 4AZTA 5HIEA 3G2FA 4RC3A 2ITVA 2QO2A 2C68A 4AGCA 4CFFA 4EK6A 4YBKA 3B2TA 4W8EA 3U6IA 1FVRA 2WO6A 3HEGA 3UODA 3ZCLA 4J8MA 3AQVA 3KC3A 2DQ7X 4JAJA 2ITUA 4HVIA 1PF8A 3KXXA 3CTQA 5H8GA 4G3CA 3MY5A 2C3LA 3FQEA 4EZ7A 4Y5HA 4ZZNA 3OHTA 2PY3A 2ONLC 4XX9A 3R7GA 3DGKA 5CSPA 4QYEA 5EW3A 3FLWA 1YOMA 3O7LD 4XG2A 5DRDA 3Q52A 3C0HA 3C4ZA 2F49A 3LJ1A 5AR3A 4IEBA 2F4JA 4U45A 4ASDA 2C6DA 3G90X 3VC4A 3UOKA 4EBVA 4I5PA 2GQSA 4AA5A 3EYGA 5CVFA 4R3PA 3RPVA 4D4RA 1DI8A 3RGFA 4DTBA 3ROCA 4F99A 4ANLA 3LLTA 3FL4A 5FP6A 3IG7A 2IPXA 4H3QA 4D0XA 1OPKA 3W10A 1OL7A 5E8UA 3NDMA 5ACBC 5L2SA 3T3VA 2PZPA 4JDKA 4PQNA 3ZSIA 5J9LA 1W8CA 2Y8OA 3LJ0A 3DS6A 3M42A 4GU9A 3FZ1A 4OUCA 3ZSHA 4DEAA 1OGUA 3F5GA 4TY1A 3PP0A 5HEZA 2G2FA 4KS7A 3C0GA 4YTCA 4I92A 3IDBA 2YIQA 3NS9A 4RFYA 2ITOA 4FTIA 3RAKA 3RK7A 3PY1A 3VBQA 3I6WA 4W9XA 5AX9A 3ZLWA 2WQBA 1YHSA 3ENMA 1IRKA 1VEBA 3QWKA 4EC8A 2PWLA 2BPMA 3GCQA 1M14A 5K0KA 3THBA 5IEXA 2YZLA 1ZARA 1ZYCA 5CYIA 4C2VA 2BKKA 2W1DA 4QPAA 4HGEA 4EK3A 3PFQA 3U6JA 4BIBA 4RQKA 3LXPA 4QP9A 2EVAA 1YWNA 4FR4A 3GU8A 3LQ5A 4K18A 4RFZA 3UIMA 5C8NA 4H05A 4WNKA 4NL0A 2GHGA 3AMYA 3NVKI 3D7TB 3EQGA 3HV7A 5CSWA 1Q62A 3OC1A 3MDYA 2BAJA 4RQVA 3RAIA 4ACHA 3TCPA 1K2PA 4DHFA 3KK8A 4D55A 2YCRA 5HTBA 4KBKA 2GPHA 2YM4A 5EM7A 4EONA 4I6HA 3DU8A 3ATTA 5JFXA 1VR2A 2ONLA 5CF6A 1OL5A 4O0VA 4CVAA 2BVAA 2FUMA 3TUCA 2CN8A 3WF9A 4JBPA 4BDKA 3P4KA 3VS6A 2PVJA 4QQTA 3IDPA 5H8BA 3VUHA 4IAFA 3HP2A 5HE2A 5KMJA 4E20A 3QRTA 3QA8A 2HW6A 2R64A 4EOKA 3JUHA 4FMQA 3CD8A 5B2KA 5DFPA 2WU6A 4IDVA 4BKZA 4HPTE 4USEA 4EQCA 2CHLA 1Q8WA 2J0KA 3V5TA 3HUCA 3R9DA 3RI1A 2YIRA 3C7QA 4H58A 4QMQA 4QNYA 2UVZA 4MD7E 4D2WA 4ZTQA 3RCJA 4A9SA 1FPUA 1OECA 1JSVA 2P3GX 4JG6A 5HVYA 5JQ5A 4YLJA 3GU5A 3WF6A 4DFUA 4KABA 3MI9A 4MAOA 4OW8A 5AR4A 2PUNA 5E8XA 3PRIA 4G3FA 4RIYB 2ITNA 4OTPA 4Q9SA 5HG5A 2CKEA 3R8LA 4EYJA 1BL6A 5FEQA 4C33A 3MW1A 2B7AA 2BDJA 3PVUA 2YFXA 4LMUA 3W33A 2WMWA 3U54A 2QURA 2OH0E 3RAWA 3TZMA 4TL0A 1H25A 4NIFB 1JNKA 4XBRA 1R3CA 3NAYA 4QMWA 3EZRA 4IM0A 1DAYA 4IWDA 3PDTA 5C27A 4PP7A 2GQGA 4G6OA 4WKQA 3R9HA 3V01A 5GNKA 2PVLA 5AP7A 4HGTA 3VS2A 4CFNA 5CAUA 4EH9A 5KNJA 5I9VA 5LJJA 4RWJA 3Q2JA 4II5A 4JDJA 3OUKA 3Q2MA 3RPSA 1DAWA 4Y46A 2ETRA 2PULA 1J1BA 4JS8A 1V1KA 2Y4PA 4QTCA 5HNGA 4RGJA 5I9WA 4R7BA 5J87A 3Q4ZA 3C51A 4RFMA 2DS1A 2PVHA 4MBLA 2GMXA 2XNEA 3IDCA 4LL0A 3PY3A 4BCNA 2WIPA 4M15A 5CU2A 1SNXA 3DKGA 4C61A 1FBNA 4F9WA 1OL2A 4W4VA 5L6OA 5FM2A 4ZTHA 2ITWA 5IDNA 3RM6A 2OW3A 3M11A 2YCFA 4MXOA 2IZRA 2J6MA 3ROYA 1PXPA 4AWIA 4S30A 5LOHA 4GCJA 5C9CA 2ESMA 5EDPA 2BROA 3MVLA 4C4GA 1XR1A 3BYVA 3DLZA 3VS7A 2H96A 1JQHA 2NO3A 3EN4A 4XV3A 3V8WA 4DEIA 4DITA 2X0GA 1PXKA 1WMKA 4IWOA 4PPCA 1U59A 4HPUE 4AW0A 5DVRA 2V5QA 4ACCA 5JK3A 5CF4A 4M97A 3D83A 4O2ZA 3ZO4A 5A3XA 2W17A 4FSNA 4O0YA 3N4VA 4HW7A 1P4OA 4AGDA 2C3KA 4C8BA 2ITXA 3RK5A 1PJKA 3ULZA 2W1HA 4FVRA 2PE0A 4YZCA 3ENHA 2WHBA 2Z7QA 3WZEA 4FTNA 5EKOA 2PZ5A 4DYMA 5A9UA 3CQEA 4UMPA 3AT3A 1AD5A 2J5EA 5CEQA 4AXAA 4BI2A 3QWJA 2C0TA 3P5KA 5CU6A 4FKTA 4E4MA 3Q4TA 2W96B 3A7JA 2JEDA 2QR8A 3PG1A 3QALE 2BDFA 4FI1A 3CQUA 2C69A 4UMTA 3LJ2A 4WBOA 4HNFA 3R7OA 3AMBA 2O0UA 2CLQA 2UZUE 4H1MA 2RL5A 4PDPA 4C0TA 2G15A 2VNWA 3HKOA 1BI8A 4FUXA 4CCUA 1PW2A 4ZEGA 4YUQA 4WUNA 1BI7A 4EH8A 3G51A 1Y6AA 1BMKA 4C4EA 3V5JA 2CKQA 1PMUA 3HMOA 3K5VA 1T45A 2GS6A 5ETCA 4BDDA 4RT7A 2XNGA 4K9YA 1Q99A 4CD0A 4XH6A 2XRUA 4R7HA 3LCOA 5ICPA 3ULIA 2Y7JA 1UV5A 4C4FA 4GUBA 2HENA 4GU6A 3HL7A 1XJDA 5ANJA 3CP9A 1ZMUA 3TIYA 4O86A 5I9UA 2B9IA 4P90A 2X6DA 3PIXA 2R4BA 4KBAA 2RG5A 4CRSA 3NUYA 2BALA 4XUFA 3JY9A 1KOBA 3PXQA 2YM6A 4LOQA 4GFOA 3JY0A 2JBOA 2OBJA 4JIKA 4YC3A 3LPBA 4RLKA 4NFMA 2WQMA 3F5UA 4GKHA 4HVDA 2Z60A 2CPKE 5DT0A 3MN3A 3KVWA 3WYXA 3OTUA 3E5AA 2ETKA 3UC3A 5EM8A 5HNIX 3PY0A 3R1NA 1YI3A 4B6LA 1OL6A 2H8HA 2WD1A 5BPYA 5AEPA 3R7EA 4BKJA 4ZZMA 3R9RA 4R6VA 5CS6A 4E7WA 5E8VA 2JKQA 2OFVA 4JVGA 4QT1A 4TYEA 3PPJA 3QTSA 4U81A 1PMEA 4LQMA 4XV2A 5FEDA 2PUUA 3HECA 5C8KA 4L3PA 3SXRA 2AUHA 5IA5A 3MY0A 3IPHA 3LE6A 3UIUA 1WVYA 4UWYA 2WB8A 4CZTA 4ANSA 4JBVA 2B52A 2UZWE 4OTGA 5FXSA 4X2KA 4C3PA 1Q24A 4KKHA 2J90A 3R28A 4FOCA 4J99A 3CBLA 4QO9A 3CGOA 3IOKA 4FTQA 4O7TA 4FV3A 4ZZOA 5AAGA 5JRQA 4DBXA 3C4WA 5DNRA 4FV9A 4CMOA 1A06A 5IQIA 2QU6A 2IZTA 3Q4CA 2OXYA 3SD0A 3LMHA 4FICA 4WA9A 3LFQA 3R7VA 3HYHA 5FRIA 2XMYA 2GHLA 4ZTSA 5EI2A 2UZTA 2JBPA 5EHOA 4IANA 2VTQA 5LCJA 1SYKA 5CZHA 5AV2A 1CSNA 2JIUA 2YCQA 4MKCA 3WI6A 2Y6MA 4ZLYA 4CKRA 5G1XA 5GIOE 5EYKA 5TF9A 1IA9A 1UU7A 4ARKA 5IMEA 4ZTRA 4U3ZA 5D12A 4X7QA 2Q0NA 4RWLA 3GCVA 2VWBA 1QPDA 3ZHPC 5K9IA 4X0MA 1KSWA 3K3JA 3F2AA 4DGOA 2UVXA 3KRJA 5CSXA 5J7BA 3ZC5A 3DJ6A 2WU7A 2XKEA 2SRCA 3H0ZA 2YM7A 4KIOA 3HZTA 4DFZE 5FBNC 1REJA 3R0TA 4BTJA 3O17A 3ORTA 3QRIA 1YHVA 4FV8A 2GNGA 4AT4A 4EWQA 4TNDA 5EHLA 4TYHB 3ALOA 5CENA 3W2CA 3E8EA 4M67A 4O38A 4UEUA 2XKFA 3BU3A 4BR3A 3NIZA 4YC8A 3ZZWA 2WAJA 3O8TA 4BC6A 3E7VA 4PMPA 3DTCA 3GGFA 3BBTB 3DLSA 1JOWB 2A0CX 2VWXA 5LVOA 2EU9A 3VW6A 2VO3A 2G2IA 2GHMA 5BVEA 4PNKA 4UV0A 1O9UA 3KGAA 5L6WL 5GJDA 2Z02A 3MESA 2FSMX 3MY1A 4FNWA 4PP9A 5EYDA 1FGKA 4JOAA 4PPAA 5HNBA 5BMSA 5HLWA 2YDJA 2CGUA 3VBXA 1GY3A 4JX7A 5DR6A 3W1FA 4Z9LA 3KMUA 3DNDA 3NRMA 3QYWA 4GL9A 3TL8A 4PL3A 4E3CA 4RLLA 4EH4A 1DM2A 1MQBA 3V5LA 5HIBA 5L4QA 2VWYA 2WTWA 5M53A 2XK7A 4CZYB 2BRHA 4EK8A 4I1ZA 3C4EA 3NPCA 1Y57A 3P23A 4NTTA 4OTRA 3BV3A 2XYNA 2OGVA 4U8ZA 3MB6A 4A9UA 3MVMA 5A4LA 2J0IA 1PYEA 2C0IA 2QKRA 3GB2A 4JLCA 3BHTA 3QKLA 3AXWA 3L9MA 2FVDA 2VO0A 4YSMA 1VZOA 3UMXA 4ZLOA 3TN8A 2PVNA 3FMKA 4Y8DA 4D2SA 2BRBA 4G9RA 4YHFA 1W7HA 4G2FA 3EN9A 4J97A 1YXUA 3SAYA 5TT7A 4F6UA 3NR9A 3H9RA 5A4CA 5HOAA 1NY3A 5LVMA 3DFAA 2XKDA 2WTJA 3OXZA 3OZ6A 4YJTA 3KN6A 2ZMCA 4O0SA 2YAAA 5TO8A 1ZAOA 4UXQA 4NCTA 2UW5A 3QF9A 3KULA 4FZ6A 3QA0A 3MH2A 4JRVA 3F3VA 1E1XA 3FI2A 3R30A 4G5PA 4BB4A 4LL5A 2C6TA 1SVGA 2E9NA 2OIQA 2JDVA 2I0VA 1TKIA 2WKMA 4IDTA 4K8AA 4I5MA 3PIZA 2DUVA 3ANQA 1F5QA 4QMMA 5HI2A 5AAEA 1OM1A 2IVUA 5M57A 3HUBA 4RJ4A 2Q83A 2YM5A 3K3IA 4G3EA 5BVOA 2B55A 1SNUA 3QQKA 4PF4A 4RIYA 5EOBA 1OI9A 2QLQA 3R8UA 1R0EA 3NLBA 5HO7A 1XH6A 3G15A 3D4QA 4L3LA 4BRXA 4D0WA 4R77A 1AGWA 2V22A 1RQQA 3E7OA 1FINA 1H4LA 1ZOEA 4ZIMA 3UZTA 2IW6A 5LVPA 4IX3A 4EC9A 5C8MA 4PRJA 3A7IA 3FZRA 3QXPA 2F57A 4ZSAA 4FTLA 4E93A 3C13A 3JS2A 3PVGA 4FX3A 2GNIA 3DXPA 2QOOA 4F1TA 3ZH8A 5BX0A 4GEOA 5CZIA 5IA3A 5HBJA 2YIWA 5AP3A 2OJIA 4AS0A 4CSVA 3R7IA 1F0QA 2B53A 3QCQA 3QHWA 3TV7A 2UW3A 5AP2A 3QYZA 4KWPA 5EYMA 3CTHA 1W84A 3EOCA 5HTIA 4YU2A 5LWNA 4YO4A 2XIXA 3L8XA 4ZY4A 2XK6A 3R7UA 1J7LA 3NMUF 4YJUA 4QP8A 3HMIA 1KE5A 4AT3A 2P2IA 2PMOX 2RGPA 3S3IA 4RRVA 3RAHA 4CLJA 3DB6A 4N6ZA 2GCDA 2WZJA 3AC1A 3L8VA 3LZBA 4TW9A 2R7IA 4C7TA 4Y95A 4QP3A 5BVDA 2BTSA 4DAWA 4WHZA 3MIYA 1F3MC 3AT2A 3QX2A 4O1PA 5ANOA 1JSTA 4FV5A 5DG5A 1LR4A 2R5TA 3DNEA 3UBDA 3VUDA 4FSUA 1OPJA 3EJ1A 4PWNA 4XG6A 3PPKA 4IB0A 5IQAA 4UZHA 4ZSJA 2UW9A 5AV0A 2Y4IB 4TNBA 4O0XA 4PV0A 1WZYA 1UU8A 2VV9A 2QOCA 4KNBA 5G6VA 2XA4A 1XBCA 2YAKA 1KOAA 2C47A 4XBUA 5JGDA 4HOKA 5DOSA 3NYXA 3MV5A 5CVGA 4OTDA 4ANOA 3DB8A 3I79A 4CLIA 4ASXA 4CQEA 4FEXA 3W18A 1NXKA 1R1WA 4QP2A 4BZOA 2YJSA 4WSYA 2XNMA 4FZDB 4D2VA 5GHVA 1HCKA 5BYLA 3N51A 4GK3A 2FA2A 1M52A 3E3BX 3EQDA 4AZWA 2FGIA 2BZIB 4XV9A 4BICA 3EL7A 3DV3A 3SHEA 4JNWA 4YZNA 4X2FA 5I9YA 3V5QA 3ZONA 4DCEA 1YDTE 3EFKA 4QP7A 4UB7A 4ZJVA 5KMMA 3PXKA 3ERKA 3WF5A 1ZWSA 3ZMMA 2GFCA 1Q8YA 3VS0A 3F82A 3NUSA 3PA3A 2YIYA 3NNWA 4MD9E 3ZEWA 2OLCA 4IBMA 2VNYA 3UIBA 5EI6A 4S31A 3MYGA 4CYIA 3UVQA 1L8TA 4RIXA 1ZRZA 3MFSA 2QO7A 3F5XA 3UJGA 3VN9A 4MXAA 3NVMB 4G9CA 2A4LA 4OR5A 2PL0A 4U44A 4WG3A 5CF8A 1HCLA 2X7OA 4NM0A 4CMUA 3FPMA 4B99A 4I24A 3FMDA 3QQJA 4AGUA 5BUIA 2C4GA 3F9NA 5L8KA 2CGXA 2X2MA 4EHEA 3SGCA 4DE4A 2ZDTA 2X9EA 4GMYA 3RPOA 3EHAA 4TWNA 3GP0A 1OPLA 1Z9XA 4Y5QA 4QMXA 5E7RA 3RKBA 4E8AA 1BYGA 3VF8A 5K5NA 1HOWA 2IO6A 3LFCA 5AADA 1E1VA 5CAQA 3PVBA 2C3IB 3LHJA 4M13A 3QTIA 4OTHA 4D4VA 3TNQB 2EUFB 2VUWA 4FV2A 3ZS5A 4CFMA 5JRSA 1OZ1A 2CGWA 3LAUA 3TZ9A 5BVNA 3R2YA 4XG9A 3IK3A 5CT0A 5DR9A 3EL8A 4I41A 5CXZA 3UYSA 1Q8UA 4RIWA 3PE2A 2Z7RA 4FC0A 3DZQA 4K0YA 3FC2A 4BBMA 4A9RA 3KY2A 1PXLA 5J79A 2EXEA 5EK7A 1S9IA 2XIKA 3OUNB 2X8DA 3H9OA 3FLSA 3HMMA 3LQ8A 3B8RA 3NNXA 4JBOA 4OTQA 5CEPA 5J9ZA 4WD5A 3TUBA 2YWVA 3ZFYA 2R3LA 4J53A 4DH5A 4I5CA 5LMBA 3L9NA 5AM6A 4CV8A 4UWBA 1IEPA 2NP8A 4AZEA 1H07A 3OROA 5HCZA 3EQPA 1W82A 1ZY5A 4BI1A 5JSMA 4FSYA 5LARA 4F09A 5KMKA 5EH0A 3ELJA 4IAAA 5AP6A 4BHNA 5HLPA 3UPZA 4J71A 4CEGA 1Y91A 1XH8A 2FO0A 2W1GA 5CAVA 3COMA 5IEVA 4WUAA 4L45A 2W1CA 2QOKA 1BUHA 4U40A 4G5JA 3VWAA 3RWQA 2WMBA 4UYAA 3OT8A 3FZTA 1MP8A 2OIDA 3OT3A 4XP0A 4ENYA 3UO5A 4PDSA 3KXZA 2F7ZE 2W1FA 5J9YA 4BYIA 3L9LA 3GQLA 5IQEA 2Z8CA 2O5KA 4FVQA 4YPSA 4PPBA 4ALWA 4KKEA 4WOVA 4XG4A 3OMVA 5AX3A 3WZDA 4ANBA 3LFAA 3POOA 5IF1A 1H0VA 2C5VA 2DYLA 3ZM4A 1GAGA 2QI8A 2VWWA 5AA9A 3G0FA 2RKUA 3AD6A 3C4CA 3CJFA 5BYZA 2C6IA 2WMUA 2XNNA 5FD2A 4CTCA 2BRNA 3FJQE 3KF4A 1XH9A 4HZSA 4O0WA 5EQYA 4D9UA 4F65A 3PJ3A 4YSJA 4AA0A 2BRMA 3ETAA 4I23A 4IADA 3LMGA 1QPJA 3FMJA 4FSWA 2UZBA 4MTAA 4RVMA 3RP9A 4EOPA 3QQFA 1YDRE 4PTEA 5AR2A 3F3TA 4FBXA 1IAJA 5IQCA 4I20A 3GOPA 3DAEA 3LFBA 3MA3A 2I7QA 1OIRA 4FT5A 2OKRA 2B54A 5EDQA 4S32A 2CLXA 3FI8A 1JLUE 3BLQA 1XHAA 4GT4A 4J96A 5T3QA 4A06A 2GNFA 3DBFA 2PE1A 4O0TA 4TYHA 2UW0A 4EQUA 1FMKA 4C02A 3VUIA 3EFLA 3D2IA 4L3JA 2LAVA 5CTPA 4ZSGA 4ANMA 2X9FA 3BGZA 4NTSA 5A6NA 1PRYA 3QRUA 2HZNA 4MXXA 4BGGA 1YW2A 4IACA 4NSTA 2A27A 4FKWA 4RVTA 3FMMA 4W4YA 2CDZA 2QLUA 3TWJA 4OGRA 5EDRA 3UPXA 5KMLA 3RZFA 4IVBA 1P4FA 3BE2A 2BHEA 3IW6A 4BHZA 3CY3A 3QCSA 5EW8A 1T46A 4HYSA 2C5XA 2KULA 3ZRLA 2ERKA 3G6HA 4B8LA 4F6WA 2R2PA 4Q5HA 3ORKA 4JI9A 4MEDA 4GK2A 5ETAA 4JX3A 3SVVA 1IA8A 2XP2A 3SC1A 3ZUTA 3ZTXA 4IC8A 4X6QC 2WOTA 2EWAA 1ZY4A 2X6EA 3R1QA 2OG8A 5KMNA 3KFAA 5FDPA 4QP1A 3SW4A 4D2TA 2PTKA 3TDVA 4AACA 2J0JA 4KRCA 3V8SA 3QRKA 2Z2WA 4AZVA 5CAOA 1XWSA 3BHHA 4FV6A 3VRYA 1V0OA 4C37A 2VRXA 3WILA 1A9UA 2JAVA 3BKBA 3ZDUA 3ZBFA 4QP4A 5A6OA 4ENXA 1UNHA 2PK9A 4H39A 4YTFA 2IW9A 2ZV2A 2V62A 5HQ0A 2EXMA 2JLDA 4BCGA 4C3RA 3QCYA 1YXVA 3P7AA 1PMNA 4WNPA 2Y4IC 4J1RA 5AV3A 3AGLA 4FKPA 3LCTA 5D1JA 1PKDA 3A61A 4KIPA 4F7NA 5I3OA 4ACGA 4FE2A 2G2HA 4MX9A 2P33A 2R3MA 3AC8A 4BTMA 4YHTA 4FKSA 3Q3BA 1YRPA 2GDOA 4QMZA 3VRZA 4RZWA 4JG8A 3TV4A 2XBJA 3IW5A 5M55A 3JYAA 5BYYA 2XIYA 3PWDA 3SV0A 3NWWA 3W2SA 4CKJA 3KULB 4KBCA 3SA0A 5F1ZA 1GZNA 4I6BA 3VS4A 4MF1A 4MXCA 4PMSA 5JMSA 3VBVA 4R3CA 5D41A 1VYZA 3ZRMA 5JFSA 5J95A 3QCXA 5I9ZA 4N6YA 1QCFA 4XLVA 5HLNA 5L2IA 5IISA 2CNVA 2X81A 2F2CB 2HXLA 3FZSA 3F2RA 2A2AA 2IJMA 3Q60A 2F7EE 4QYFA 3KCFA 1ZOGA 3LXLA 5AP4A 3TNPC 4DG3E 4F6SA 3EB0A 4QTDA 4IB5A 4J95A 4X21A 4ACMA 5AMNA 3Q5ZA 3SRVA 3DFCB 2G9XA 2P55A 3O96A 2XIRA 4FKLA 3FXZA 4B9DA 2BZKB 3BWJA 5D9HA 3PSCA 3PLAE 4R5SA 5T6KA 1Y8YA 3HMPA 5FGKA 2B0QA 4KAOA 3LM0A 2QOLA 4GW8A 4LV5A 4QMYA 5IQHA 4L42A 3ZOSA 4FKJA 4JQEA 2X7FA 1W0XC 5HICA 3WOWA 5C4KA 1M7NA 4YTIA 4ZJIA 5CALA 1NA7A 2QU5A 1GIHA 4IH8A 1XH7A 3CTJA 4KSPA 5JT2A 4K11A 2J0MB 5K0XA 1WCCA 2HOGA 3QUDA 1G5SA 4ZOGA 3FXWA 2W06A 4FTTA 4RG0A 5E8YA 4E4NA 4NT4A 2C6KA 2ZM4A 2XYUA 1YXSA 3PPZA 4FNYA 2CSNA 3FLZA 2O65A 2CN5A 2GQRA 3PVWA 4IB3A 4F1MA 2XCHA 4ID7A 2H34A 3V04A 3ZZEA 2GS7A 4BI0A 4EOQA 4F7LA 5HX6A 1J7UA 1URWA 3V8TA 3MH0A 2PPQA 2UW8A 3OCBA 3OEZA 4F9AA 4MXYA 3R9NA 5GINE 3EH9A 4NEUA 3DQXA 1YOJA 3BHYA 2QOQA 3HA6A 4PMTA 3DBQA 3VS1A 5KUPA 3AMAA 5AAFA 5HVJA 4PNIA 4IVAA 3EFJA 4M0YA 5L8JA 4MD8E 2XK4A 3VHKA 1APME 5AV1A 4DN5A 4IHPA 3ANRA 2W1ZA 4RC4A 4RJ3A 4BYJA 1JWHA 3GC8A 5DMZA 3LCDA 3E8DA 4BCOA 3QQGA 3R01A 1JPAA 3M2WA 1XQZA 4C57A 3AC3A 3GCSA 1CM8A 4BCPA 2OWBA 3FMLA 3JXWA 3DZOA 2XBAA 4TWPA 4D1ZA 5EM6A 3QHRA 4BCQA 3KXGA 2IG7A 3VVHA 4ZTLA 4AN2A 2QCSA 4EHZA 3BHUA 4O0UA 4BCMA 3QTZA 2O63A 4FKUA 4DLIA 4AW1A 3NYNA 2QO9A 4RJ7A 5ANIA 1RE8A 3VS5A 3ZUUA 3U9NA 3WARA 3WIGA 2BFXA 4K6ZA 3W2QA 4HVSA 3A4PA 4WIHA 4TZRA 4H3BA 3TEIA 3MH1A 1YDSE 4UN0C 1SM2A 2CGVA 3F5PA 4FTCA 5IEYA 2X4FA 4RX7A 4E4LA 4FYOA 1H26A 2R0UA 1M17A 4RA5A 3IGOA 4BN1A 3FKOA 1UKIA 2RFSA 3R73A 4M69B 4C62A 3UYTA 4AP7A 4O91A 2ACXA 3O8UA 2RFDA 3RZBA 4GIHA 3P86A 3PP1A 2Y6OA 2AC3A 4RWIA 4K77A 1ATPE 4IZ7A 2VZ6A 5L2WA 4BZNA 4JQ8A 3TKIA 3F69A 4GUEA 2YCSA 5DGZA 4NM7A 4Z3VA 4M0ZA 4RIXB 1OIYA 2G01A 2QONA 3UNJA 4EYMA 4KUJA 4CFXA 4J98A 2H9VA 2OSCA 3HV4A 3OS3A 1Z57A 2YDIA 3H9FA 5DT3A 3LFSA 4GRBA 1R78A 3PXRA 4I0SA 3FUPA 3RK9A 4K1BA 5BNJA 4QNAA 3ZSGA 2C6MA 5GJGA 2B9JA 5CEIA 5M4CA 3E8CA 4NU1A 5DBXA 3LW0A 4RX8A 4IB1A 3NX8A 2UZDA 2WPAA 3C4XA 4U0IA 3GI3A 5DWRA 4DEEA 3BYOA 3IOPA 3KMMA 4ITJA 1UWJA 2WOUA 2XRWA 3QC4A 5DR2A 4O21A 4ZTNA 4J8NA 3QFVA 3E3PA 3BZ3A 4EH7A 1M7QA 2WEIA 4JQ7A 5CQWA 4EORA 2WQOA 3BYUA 4P2KA 5JQ8A 5J8IA 3RMFA 5IMXA 2ZM1A 4JDHA 4RIWB 3AD5A 3BGQA 5IH4A 3UO6A 2VAGA 4L44A 4A7CA 5FWKK 1PXJA 3SDJA 4XOYA 4DGMA 3UMWA 3O23A 3MFTA 1W98A 3PIYA 2ZV9A 4CFWA 1H1QA 2W1IA 3VBYA 4U43A 1OITA 2HZ4A 2IVSA 3V51A 2VN9A 4BDCA 1MUOA 3QAME 2OJ9A 4O96A 5IZFA 4USDA 5JFWA 4BY9E 1LPUA 5CU0A 1H28A 1GIJA 2HAKA 3BLRA 4K2RA 4QMLA 5HD7A 3KRLA 2JDOA 3HP5A 4MWHA 4JIAA 3WYYA 5LCKA 3ATSA 1PXMA 1H08A 4EUUA 2JGZA 3DPKA 3VUMA 3SG9A 4ZLZA 5HZNA 3LMIA 5CQUA 2VWIA 4EBWA 5IUIA 2F9GA 4CV9A 5ACKA 2OICA 4E26A 3OXIA 3AD4A 3KN5A 4FGBA 2JIVA 2WELA 5IPJA 3UNKA 4DT8A 1NW1A 4MVFA 4AGWA 4WG4A 4IAKA 3UP2A 3ITZA 2CKOA 4ZMEA 3UZRA 4WO5A 3MB7A 4G3GA 4LGHA 5HE1A 3UQCA 2CCHA 3HV6A 3OY1A 4FL2A 3KREA 3PJ8A 3KRRA 3M1SA 3QZGA 4HGSA 4LRKA 2J2IB 1WBWA 4QYGA 3QD0A 2OJGA 3I7CA 3MVJA 4IMYA 1WBOA 4U97A 2F7XE 3IS5A 5E8SA 2OXXA 4NCTC 3IGGA 4S33A 3U9CA 3ZYAA 2W4KA 3AC4A 4MCVA 2RIOA 4J52A 4KIKB 5C03A 3FZOA 2BKZA 4IX5A 2HIWA 4IQ6A 3QC9A 4OAVB 3MPAA 5AIKA 4U6RA 3B8QA 2RF9A 2VTHA 4I93A 4N4SA 4RJ8A 2WFYA 3BQCA 2JFLA 2BTRA 4FK3A 4G1WA 3TT0A 1UKHA 4YZDA 3OY3A 1VYWA 1OBGA 3CEKA 4I6QA 3VBWA 1YI4A 2BAQA 1B39A 3OP5A 5D7AA 3I60A 3DXQA 3ORIA 5F9EA 1I44A 3QZHA 2C5OA 3O50A 3I5ZA 2VTLA 2VTRA 3CKXA 3TZ7A 4RVKA 3FPQA 1XBBA 1P2AA 1URCA 4DA5A 2XK3A 4YR8A 4AN3A 2J5FA 4IFCA 4FIEA 4W8DA 4I6FA 1I09A 2YN8A 3GC0A 2C1BA 2O3PA 4IX6A 4IM2A 1ZZ2A 4W9WA 1WBNA 5FEEA 2QHNA 3U55A 4TXCA 4QTAA 2XM8A 3K2LA 2FSOX 4RIOA 4FTUA 4BGQA 5BQ0A 2CNUA 1OBDA 4E6QA 4H1JA 1GZKA 2R3GA 2E9UA 2XKCA 5J1WA 2WQEA 5TE0A 5AA8A 4QOXA 1H1SA 2E9VA 3C4FA 4CRLA 5HG9A 1PKGA 1ZYLA 3V5WA 2GTMA 5HO6A 2XEZA 3CKWA 3RTPA 3QLFA 4EJ7A 3PJ1A 1SVEA 4ZP5A 3ZM9A 3NCZA 4G6NA 4UMUA 1BX6A 4ORKA 4U42A 4A07A 2BAKA 4FZFB 4JR7A 3I7BA 3MPMA 3CJGA 3PZHA 1KUTA 3CSVA 3R2BA 4ZMFA 5IDPA 4UXLA 3F7WA 4ZK5A 3NUAA 3NGAA 4FIGA 3BE9A 3UE4A 4WRGA 3OWPA 5JKGA 5L3AA 1QPCA 4GFGA 5M07A 3D0EA 4XNEA 4F63A 3COIA 3GU6A 4ITIA 4YNOA 5ANKA 2WTCA 4QYYA 3FY2A 4QMTA 4DFXE 4M68A 1NVSA 2VTTA 5AUUA 5KMIA 1TVOA 4FSTA 2XK9A 3DJ5A 4CMTA 1FVTA 4IC7A 4C3FA 5CANA 1YVJA 2ITZA 1JVPP 2QG5A 3Q9ZA 3R8MA 4F7JA 5HD4A 2JITA 3Q6UA 5GJFA 4H3PA 3OVVA 1WBVA 4LM5A 4LUDA 2EXCX 4AT5A 4NJ3A 1GIIA 4X2GA 3BLHA 1LUFA 4O27B 1Q41A 1M2PA 3WE4A 4CZUA 5F20A 5AUXA 3LIJA 3C9WA 3ZUVA 4R1VA 5HBEA 3UZPA 3PXYA 3ACJA 4O7NA 3F6XA 3L9PA 3QD4A 4FKQA 1NVQA 2OI4X 2YZAA 1J91A 3O2MA 2ITQA 4EOSA 4F0FA 4QMNA 4I5HA 5KKRC 3SRVB 2W4JA 4FIFA 3BHVA 4FV1A 4O2PA 3DQWA 1PXNA 5FTOA 4ACDA 4BCIA 4BL1A 5LVNA 2WTKB 2X1NA 1OMWA 1VJYA 2JFMA 2V0DA 5CXHA 2R3QA 2ZOQA 4MK0A 4P5QA 2VTNA 3FQSA 4OBOA 2XCKA 4DFBA 2XJ1A 3OCTA 4GYIA 2XUUA 4W4WA 2EB2A 3EQFA 1FQ1B 4XOZA 4AE9A 3EN7A 4FEUA 5M4IA 2J4ZA 3TXOA 3F88A 3W2OA 4OTIA 3MGYA 5DN3A 3IQ7A 3ODYX 4Z7HA 3S00A 3U6HA 2ZV8A 5HTCA 1BKXA 4APPA 1DI9A 2CCIA 3ORLA 5DT4A 1FMOE 3MBLA 3HNGA 1XBAA 3E64A 3FC1X 5E8WA 5AP1A 5KHWA 3PUPA 4FIIA 3ZO1A 4BDGA 4E6AA 3QTRA 5IA2A 5AWMA 3ET7A 4I3ZA 1JKSA 4E5AX 3FHIA 5LXMA 5HCYA 4PTGA 3QTUA 4DGLC 2R3RA 2OFUA 2I1MA 4FNXA 2QODA 4IIRA 1U4DA 4MYGA 4FEQA 3BI6A 4F9YA 4O83A 4NFNA 3JPVA 4D28A 5BVFA 4PDYA 5B0XA 2ZB1A 3W55A 4IVCA 4M66A 3ZLSA 3LFDA 4G6LA 3CPBA 1LEWA 3RJCA 3RM7A 3KA0A 4DT9A 4TPTA 5L2QA 3H10A 3FKLA 1KWPA 5CNOA 4MNEA 5HIDA 4UMQA 3EN6A 3GT8A 3PJCA 4GG7A 4GYGA 1U5QA 5K4IA 4FA2A 2X2KA 2HZIA 3LXNA 4PY1A 1P14A 4AFEA 3H30A 3CPCA 3OWLA 4DGNA 1CKJA 2B1PA 5KBQA 3COKA 3UP7A 3OWJA 3BRBA 2YJRA 3WIKA 2J50A 3LXKA 4Y73A 4XRJA 3T9TA 2CKPA 3PA5A 4X2JA 2YWPA 4U3YA 5AP0A 4BDFA 2BZHB 4M69A 4EUTA 4YHJA 1WBTA 3GFEA 5E91A 4U79A 3ZLYA 5A4EA 3FXXA 5H2UA 4RVLA 1JKTA 5BVKA 2X8IA 3FSFA 4XP3A 3GU7A 3VUTA 4A4OA 5HVKA 4EHVA 1CDKA 3VBTA 2R3OA 5F94A 4XS2A 3DK7A 1YQJA 4CNHA 5FUTA 4GVJA 2GNLA 4LV8A 2W99B 4G3DA 4N0SA 2ZVAA 4PX6A 4DTKA 4E6DA 5A54A 3DDQA 3DAJA 1SVHA 2XJ2A 1MRVA 3ACKA 5D7VA 4M14A 3GFWA 3RHXA 4M3QA 4R5YA 5K3YA 2ETMA 3D5WA 4DH8A 4YJSA 4G17A 3E88A 4USFA 3W2RA 5ANEA 5KMOA 1JSUA 4FTAA 1O6KA 3TDWA 3IW4A 4QYHA 3AT4A 3NW5A 3L8PA 2W5HA 2VTAA 5FM3A 4LFIA 3OXTA 4KD1A 1CKPA 3FBVA 3PA4A 4CQGA 3EQRA 3TM0A 3RNYA 1CTPE 4L01A 4LOPA 4XV1A 4AF3A 2FYSA 4CG8A 5KCVA 5AV4A 2ERZE 3BX5A 4BTFA 4WBBB 5I0BA 2XF0A 2XNPA 3EN5A 4W4XA 1AQ1A 4M8TA 1ND4A 3S2PA 2BMCA 2RG6A 3DDPA 4HVHA 4CKIA 3CR0A 5IH6A 5CU3A 5LVLA 4R7IA 3TI1A 4YO6A 2XZSA 3OWKA 4TWOA 4UWCA 1SMHA 3U8WA 4EZ3A 2R9SA 4ZAUA 5KZIA 3W8QA 3S4QA 4C58A 5L8LA 4XEYA 4ZSLA 2PZRA 5IU2A 1ZMWA 3TACA 2W5BA 4O1OA 3SXFA 3MFRA 5AFVA 2W05A 5I4NA 5C4LA 4MQ2A 4GT3A 5I3RA 1Q8TA 1KE6A 3ZXTA 2PVKA 4BF2A 4YBJA 4FF8A 3ZC6A 5H8EA 3VULA 4BDJA 4IJPA 3UVPA 1YHWA 3GEQA 5ITAA 3FMEA 3VS3A 4RMZA 3QQUA 3GOKA 3KCKA 3QU0A 4G34A 4ALUA 4Z55A 1Q97A 4E5WA 4EEVA 3O0GA 2QD9A 3UQFA 1J1CA 2UVYA 2R7BA 3CE3A 5M56A 4XLIA 5IH5A 2HK5A 2Z7LA 4FIHA 5AUWA 1UA2A 4I4FA 1A48A 1UU9A 2PMIA 2BFYA 2OZAA 3KXNA 4K33A 2YERA 4O7WA 3O7LB 2XEYA 3R71A 4I4EA 4BDHA 2IVVA 4ZTMA 4IZ5A 5LQFA 1XH4A 3OEFX 2O8YA 2NRYA 4QQCA 4BTKA 1IASA 4JRNA 4TTHB 1R0PA 4UYNA 4V0GB 3G0EA 3N4TA 3VIDA 3LFNA 2OK1A 4E73A 2VO6A 3HX4A 4O22A 4KIKA 5AP5A 4IZYA 2J7TA 3OOGA 4P5ZA 4D5HA 3KRWA 4FV0A 4BBFA 4F0GA 4OTFA 3NZ0A 4M7IA 3U51A 2IN6A 1RW8A 3DJ7A 3GC9A 2C6EA 5DEYA 5DLSA 5B2LA 3QLGA 4AW5A 4NJDA 5CU4A 5IQBA 2NPQA 4OBPA 3HGKA 2QOHA 3R83A 4WNOA 5HE0A 3DA6A 1U5RA 2PMNX 1JAMA 4M84A 2H6DA 3MH3A 2C1AA 4AOTA 4EHGA 1FOTA 3FLQA 4KSQA 4C34A 5H3QA 3KL8A 2R3PA 4O0RA 1Y8GA 4AOIA 2CJMA 5BMMA 3REPA 5E92A 2VTPA 2EB3A 3EMGA 1OKVA 3EWHA 4RA4A 3RCDA 3OTVA 4FT3A 3U87A 3FAAA 4ZS0A 3G6GA 5C01A 1PYXA 2WTKC 3PZEA 4DLJA 2C5NA 3GVUA 5IKWA 1S9JA 3ZU7A 5EW9A 3QBNA 4A4LA 4EOLA 4Z16A 2ITPA 3NAXA 3POZA 2VU3A 2NNWB 1TQIA 4I0RA 3DK3A 1H1PA 2WTVA 3HV5A 2DWBA 2PHKA 3D7ZA 4FKRA 2W0JA 4OT6A 3GBZA 4QMPA 5C1QB 3OBJA 5L2TA 4IAZA 4UMRA 4C59A 5CX9A 3TZ8A 2YABA 5HORA 2ZAZA 2JAMA 4LGDA 4BCKA 5KBRA 4GH2A 4TN6A 4DFLA 3MS9A 3R63A 3VHEA 3BELA 4F0IA 4YLKA 5KO1A 3NIEA 4MH7A 3E62A 2J51A 5EHYA 2BRGA 3P08A 5TKDA 3Q5IA 3EKKA 4KKGA 5L6PA 4GKIA 3LCKA 4FYNA 3TTJA 4YNEA 4D58A 3P79A 5C26A 4EJNA 3WBLA 3UG2A 2HCKA 3QUEA 3IONA 4FV7A 3VW8A 5M4FA 5FTQA 3R7YA 4CG9A 1KV2A 1R39A 4HCTA 4RZVA 4XYFA 3ZXZA 4IW0A 5AR5A 2VO7A 2VWUA 4FTRA 4CFVA 3S1HA 3RPRA 5GZAA 3G5DA 3GUBA 2E9PA 3UDBA 3C5IA 2HELA 2XJ0A 1M2RA 3MTLA 5DEWA 4EH2A 4PDOA 2QQ7A 3QUPA 4IXPA 4U9AA 4KA3A 3E63A 3P0MA 4S34A 3AG9A 4Q2AA 3V6SA 3MFUA 3LCSA 4GJ2A 2VTOA 3JVRA 4U80A 5B2MA 4MF0A 4QQ5A 3I4BA 4CTBA 5CF5A 2WEVA 3TIZA 1YI6A 4KB8A 5CASA 3SW7A 4R1YA 3RVGA 3OW4A 3W32A 1CMKE 1OB3A 1BL7A 3OOMA 3ZFMA 4QMSA 4JXFA 3LFFA 4DTAA 1H24A 4XG3A 2OZOA 2YHVA 1K3AA 3OW3A 3Q96A 5EM5A 4MWIA 3NUXA 2YITA 4WG5A 2BUJA 3BV2A 4XRLA 5CT7A 3BBWA 3A7HA 3EKNA 4JG7A 4YLLA 5KZ0A 4L68A 1U54B 5E8ZA 3R00A 3R21A 4DINA 4JR3A 4ITHA 3CLYA 3QZFA 2VWZA 2JKMA 2QG7A 3DBEA 3P1AA 3V6RA 1H8FA 2XS0A 3RBWA 4DEGA 2B9FA 3EQHA 3UOLA 2YACA 3L1SA 3Q9XA 3DXNA 4H36A 5CVHA 4BGHA 4BBEA 4O7RA 3LKMA 3TG1A 3SX9A 4F1OA 5LMKC 1OL1A 4IWQA 4XJ0A 3H4JA 5HGIA 3WF7A 3HLLA 4YZMA 4B8MA 4X2NA 4JDIA 4ZY5A 4AOJA 4QP6A 1ZMVA 1ZYSA 4L8MA 4L52A 3NYOA 4XMOA 3ZO2A 4IFGA 2XVDA 2JKOA 2I6LA 4AU8A 5JEBA 1V0BA 2UZNA 4NKAA 5DPVA 5CEMA 4QMVA 5CI7A 3IO7A 2XNBA 3R22A 3VJOA 4BIDA 3FDNA 4D1XA 3PJ2A 4FGRA 3B2WA 4HCVA 3NW7A 3WE8A 4X3FB 4A9YA 3JR1A 1STCE 1X8BA 5CSVA 5FDXA 2R3FA 3FQHA 1OIUA 2X7GA 3FV8A 4ASZA 3BPRA 4QTEA 2HYYA 4MBJA 4YJVA 4HYUA 3NW6A 5CY3A 4FG8A 4LI5A 3ZRKA 4ANQA 2W5AA 2E2BA 3QD3A 4BDEA 2VD5A 4F70A 2HWPA 4V01A 3QGYA 3UGCA 3E92A 1GZ8A 5J5TA 1J3HA 3P7BA 4Q5EA 4JL9A 2OF2A 4OAUC 3EQBA 3E93A 3BU6A 3F7ZA 3FMHA 3DKOA 3H3CA 3KF7A 4L46A 3T3UA 3LFEA 1CKIA 1QPEA 4G16A 3TNHA 2B4SB 3AC5A
chains in the Genus database with same CATH superfamily
1GOLA 3QXOA 2QNJA 3FE3A 1IR3A 4UX9A 1WAKA 1PMVA 2R0IA 4HNIA 5IA4A 3QL8A 2BDWA 4MNEB 4XG8A 3DAKA 3Q53A 2OO8X 2Y0AA 3D5UA 4C38A 4IZAA 4JBQA 5J1VA 3MJ1A 3I6UA 4I22A 5JFVA 3BWFA 5M44A 2JIIA 3SXSA 4DEBA 3TV6A 4EQMA 3KU2A 3R9OA 4NKSA 5EOLA 1TQPA 4U41A 2QR7A 4YJNA 3UOJA 2BILB 4LOOA 4OTWA 5BUEA 2ZB0A 3FZPA 3HVCA 3QKMA 5KKRB 4BIEA 1YOLA 4RWKA 3KK9A 2BCJA 5HO8A 4DG0E 4P7EA 3QTXA 3I1AA 4YZBA 5H9BA 5E4HA 3Q32A 3GQIA 5FLFA 4B0GA 3C5UA 1OUYA 2BHHA 3VQHA 4DG2E 1FVVA 2REIA 2WMTA 2WXVA 4LGGA 4MQ1A 4NW6A 4D9TA 5LMKA 4FEXA 1Q3DA 1QMZA 2WGJA 2PU8A 3UOHA 2UZLA 1ZYJA 5B7VA 2OJFE 1PXIA 4FV4A 5EI8A 1J7IA 3A99A 2VTMA 4QMOA 4KINA 2HZ0A 4IJ9A 4GS6A 3FY0A 5F95A 4IE9A 2VTSA 4S2ZA 1PY5A 1RJBA 2HXQA 2A19B 4WT6A 2YISA 2YLEA 3OCGA 3UIXA 4FTKA 3ZBXA 3BYMA 4BWPA 2ZMDA 4YPDA 3BU5A 4GIIA 4EI4A 1OKZA 2WQNA 4D2RA 3EYHA 4O82A 2IEWA 4N70A 4O6EA 3RALA 3NNVA 3TUDA 1G3NA 4AW2A 3FMNA 3A7FA 4TWCA 3N4UA 4LRJA 2PMLX 3SOCA 4NYEA 4YMJA 4HJOA 2OH4A 3PXFA 4IX4A 3HAMA 2QOIA 3Q6WA 3MVHA 3CC6A 1H00A 3BEAA 3QD2B 2XIZA 1UNGA 3RWPA 3C50A 4BCHA 1U46A 2ITTA 3TKUA 1XO2B 4FT0A 3EZVA 3FLYA 1K9AA 1GNGA 3W16A 3OF0A 2C6LA 4PL4A 2YM8A 5DE2A 1KV1A 3HDNA 3F3ZA 4RC2A 5DHJA 2GNJA 4FSZA 4KIQA 3VUKA 2P2HA 4YTHA 4EH5A 3DBCA 4FL3A 5JZNA 2PYWA 3AOXA 3SG8A 4O7YA 2PVFA 3DOGA 5IUGA 1B38A 3PSDA 5DRBA 2IWIA 3IKAA 4FODA 2RFEA 3II5A 2ZJWA 3I0QA 4QPMA 4HCUA 4KRDA 4V04A 2R3NA 2RSVA 3DKFA 3R04A 5FQDC 1PHKA 4BZDA 3FEGA 2CNQA 2WTDA 3D15A 2W7XA 5M09A 2X0QA 4DEDA 2WMXA 3LQ3A 4G31A 2I0EA 3WZJA 2BIKB 3PSBA 1WBPA 4DC2A 3R1YA 3OG7A 4RX5A 2QVSE 3EFWA 3HV3A 3VAPA 2PUIA 4MNFA 4NWMA 2PE2A 3CQWA 4PL5A 2GU8A 2X4ZA 3I0OA 4GT5A 4V0GA 4FOBA 1JBPE 3FHRA 1KE8A 4IM3A 2OZAB 4DFYA 5A4TA 3ORPA 4FIJA 3VQUA 3W0QA 5M08A 3WZKA 4I94A 2J9MA 4FEWA 3L8SA 4BWXA 5CEKA 5DYJA 4ZSEA 3UQGA 4AFJA 2P0CA 2XM9A 4IVDA 5E8TA 4O7ZA 3W8LA 4IAYA 4R3RA 4V05A 3A2CA 2YM3A 4E73A 3LLAA 1H1RA 3ORNA 5AM7A 3QRJA 4BKYA 3SLSA 1YWRA 1ZLTA 4UZDA 3ZFXA 4N57A 4AZFA 3QQLA 4DH7A 4EL9A 3HRBA 5A46A 3ID6C 4B4LA 3ODZX 2X8EA 1W2FA 3G33A 3U4UA 3SKCA 3PFYA 4FZ7A 5M51A 4FTOA 4AAAA 5LMAA 4F7SA 3QTQA 4C35A 4EOJA 1WFCA 4AUAA 2W1EA 4TYGA 2HY0A 5JGAA 5K5XA 2LGCA 3OFMA 3TTIA 3FKNA 5HE3A 2VX0A 2QC6A 4JT3A 3K54A 4OLIA 4F4PA 3CY2A 4BVUA 5HG8A 4CT2A 4C4JA 2R3IA 2E9OA 4GK4A 5BVWA 2W9FB 5CEOA 3QZIA 3BGPA 3PYYA 3TNIA 3R1SA 4EH3A 4FT9A 4AN9A 1GZOA 4KS8A 5M4UA 3D5XA 3F3UA 3MA6A 3P78A 2ZYBA 3R8PA 5ETFA 2JKKA 3HMNA 3WZUA 4RJ6A 3T9IA 1V0PA 4EH6A 1DS5A 2CMWA 3C1XA 3NSZA 2PZIA 3O51A 3PXZA 5HX8A 3ORZA 5AUYA 4WSQA 4AX8A 3HAVA 4ZY6A 2GNHA 3CS9A 3CGFA 1MRUA 2X39A 4L67A 5AIRA 2Q0BA 2P4IA 4U5JA 3TNWA 2X2LA 3KEXA 3OCSA 4X6RA 3FI3A 4FSRA 2FB8A 3NCGA 1TQMA 3ZO3A 5AUTA 2XAOA 4GJ3A 4B7TA 4O6LA 4TYJA 3FI4A 5CLPA 3I5NA 5LWMA 3KMWA 1LP4A 3G9LX 3MIAA 4CT1A 2PSQA 5EG3A 4X3FC 1XKKA 5HHWA 3RNIA 3D94A 3KVXA 5J7HA 4NK9A 4AA4A 4R78A 4D4SA 4DEHA 1B6CB 3PG3A 2JC6A 3NUNA 5DA3A 3V5PA 3WF8A 4AQCA 5J5SA 2WMQA 3AGMA 1Y6BA 3D7TA 2VX3A 2VWVA 4YJOA 2AYPA 4EZ5A 2ZDUA 4C2WA 3O8PA 3RHKA 3SOAA 4GFMA 4FUYA 2WNTA 1ZYDA 4O81A 1TZDA 2VTJA 2WMVA 2X0PA 2XB7A 4OT5A 4NW5A 5FBOA 4APCA 1ERKA 3O71A 5DIAA 3QTWA 4WNMA 3BIZA 2IW8A 4RPVA 2C6OA 4XHKB 4CYJA 2C3JA 1G8AA 3H0YA 5FG8A 5IA1A 4GSBA 2G1TA 4IAIA 3VUGA 2O64A 2W9ZB 3VO3A 5EQPA 2JD5A 1P5EA 4D1SA 1UU3A 4DF3A 4UALA 4DGGA 4LRMA 4FKOA 3UC4A 4I21A 3TKHA 1OVEA 1Q5KA 2C30A 2GTNA 1PXOA 4JJRA 4D4YA 5TR6A 1O6YA 4ZJJA 4E5BA 4P4CA 5I9XA 5IA0A 5BUJA 2UV2A 5CAPA 5I5ZA 3F66A 3PWYA 4DBNA 4EOMA 1NT2A 3UTOA 1UVRA 2I40A 4BDIA 1U54A 4F9BA 3PTGA 3VNTA 4ALVA 3KQ7A 2BZJA 2WMAA 3NNUA 3BL9A 5IQFA 2FSTX 4YP8A 2YEXA 3D9VA 3KXMA 3FL5A 3MWUA 4O7LA 2ZM3A 3RPYA 1M2QA 2IVTA 2WMSA 4C4HA 2VGOA 2BIYA 1Q61A 4QRCA 5AUVA 3W2PA 2HW7A 2F2UA 3DY7A 3P7CA 4HVGA 2YLFA 5FXRA 1IG1A 2UW4A 3FSKA 4U7ZA 4L6QA 5AJQA 4X3JA 3DBDA 4EKLA 2OJJA 3BEGA 2UZOA 3ZEPA 2OF4A 3U4WA 4O7VA 3MTFA 4AG8A 4JAIA 2JDRA 3R6XA 2HWOA 1ZOHA 3P9JA 4L7SA 4XCUA 4AAYA 5A4QA 2JDSA 4BDAA 1H01A 4NIFA 1JKLA 3ALNA 3EIDA 4MXZA 4GG5A 5IUHA 2XNOA 4FEVA 1YWVA 3PRFA 2QOFA 5EKNA 1YXXA 2YIXA 4J7BA 4YJRA 2C0OA 4X3FA 4ASEA 2R3JA 4MBIA 2VTIA 1YXTA 4GVAA 4YC6A 1MQ4A 3BCEA 3F3WA 1OKWA 4EK4A 3PLSA 3ZDIA 5K4JA 3S0OA 2I0YA 5ANGA 4Q9ZA 2AC5A 1H1WA 5AUZA 2WTIA 4Z7GA 4CFUA 3MPTA 4R8QA 3D2KA 4FKVA 1Z5MA 1W2CA 1UWHA 3DCVA 1OIQA 5JZJA 2A1AB 2PZYA 5HBHA 2RFNA 1WBSA 3I81A 3QGWA 3EQCA 5JN2A 2ZV7A 4D2PA 3N9XA 3CCNA 3DKCA 5HU9A 3GU4A 3NUPA 3VJNA 5FTGA 2GSFA 1Q8ZA 3D5VA 4TRLA 4ANNA 4FTMA 4FG9A 4L00A 3T8OA 1GJOA 1OUKA 3DTWA 4FSMA 2FSLX 5HCXA 4FL1A 4EK5A 3QQHA 4YJPA 3CXWA 4QQJA 5HKMA 3VF9A 2YA9A 3F2NA 2UUEA 4DFNA 2J0LA 4YURA 4E6CA 4NM3A 3A7GA 4L9IA 3V3VA 1FGIA 2FH9A 3FYKX 3CD3A 4OBQA 4QPSA 4TKSA 5CWZA 4AZSA 4L43A 4CCBA 5TOZA 2JDTA 3HDMA 4M12A 3UNZA 4F9CA 5M06A 5EYCA 3TJCA 5E90A 2XH5A 2WIHA 3TJDA 1RDQE 2OIBA 1MRYA 2PVRA 5E9EA 1Q3WA 2NYAA 4L53A 4MHAA 3UG1A 3Q9YA 5GZ9A 2QKWB 4IWPA 1ZZLA 1SZMA 4C36A 3QKKA 4QD6A 4BCJA 2ITYA 4FVPA 5KE0A 3KXHA 1LEZA 2C5YA 5HG7A 4HGLA 3EQIA 3LM5A 1KE7A 5HESA 1H0WA 3NUUA 4CXAA 2PVMA 2W4OA 2VGPA 3KKVA 4UBAA 4UY9A 4CGAA 3BQRA 4HZRA 5ETIA 2Z7SA 2QHMA 4HYIA 4RX9A 3DT1A 4PUZA 1E9HA 3A62A 3MSSA 3O5AA 3K5UA 5D11A 3UVRA 3GNIB 5A14A 5T68A 3ZLXA 1O6LA 3OD6X 1UNLA 1W83A 2NRUA 3NYVA 3S95A 4DH3A 4E1ZA 4DCAA 3Q04A 2VX1A 1G8SA 4A4XA 4LYNA 3GC7A 3Q9WA 5EQEA 5KX8A 4EWHA 2UZVA 3COHA 2WMRA 3UO4A 3E87A 3A8WA 4C4IA 3G9NA 2UW6A 3FLNC 4BDBA 3F61A 3GXLA 5ANDA 3A4OX 4ERKA 3QX4A 3AC2A 2IZUA 4FKGA 1WVWA 5HU3A 3LVPA 3IW8A 3TMOA 5FXQA 2QOBA 3PE1A 5IQGA 4Y72A 5EFQA 4ZS4A 4HYHA 2R3HA 3R8ZA 2BR1A 4AQKA 4RSSA 5KHXA 4FJVA 2KTYA 1JKKA 2V7OA 3CIKA 4A9TA 4BWKA 5GIPE 1YKRA 2IZSA 2OXDA 1XH5A 4FKIA 1ZXEA 2I0HA 2UZEA 3IW7A 4ERWA 5F4NA 1Q4LA 5JGBA 3HRFA 1XMMA 5FP5A 4NM5A 2XK8A 4AXEA 3MJ2A 4FZAB 4RJ5A 5AR8A 4F64A 5CNNA 4F08A 3HRCA 3ORXA 3KB7A 3GCUA 4NUSA 3GENA 4EOIA 3JVSA 3OBGA 1REKA 3IECA 4YZ9A 3E8NA 4FTJA 3GCPA 3RINA 3SQQA 3FYJX 4EOOA 3R8VA 1H27A 3LOKA 4QTBA 2R3KA 2AQXA 5AR7A 2OU7A 4L7FA 3P5JC 5E1SA 2YDKA 1EH4A 2V7AA 4GV1A 5DH3A 4AE6A 2B9HA 3D14A 1NVRA 4QMUA 1KE9A 4BCFA 4O7SA 3NEWA 2PVYA 4Y85A 5GZ8A 4O84A 5D10A 4ONAA 2UW7A 2GFSA 5CI6A 4DH1A 3A8XA 4XP2A 1IAHA 4NZWB 1WVXA 4TYIA 4WRSA 4EKKA 4FG7A 4FNZA 4I0TA 3Q4UA 4YGAA 5IG1A 1BLXA 2O2UA 2Y9QA 1L3RE 4YJQA 1QL6A 4XG7A 5IQDA 2HY81 5DI1A 4I6LA 4NH1A 4FK6A 3A60A 3KRXA 4FSQA 4Y83A 3ORMA 3DK6A 4PMMA 4PTCA 4RBLA 5E1EA 4D5KA 5CSHA 3BYSA 1OKYA 2V55A 3R02A 4FT7A 4LUEA 4E4XA 4LMNA 4TT7A 2GS2A 3C0IA 4BFMA 3HA8A 5JH6A 2PUPA 3FWQA 4LG4A 4ZXTA 4AZTA 5HIEA 3G2FA 4RC3A 2ITVA 2QO2A 2C68A 4AGCA 4CFFA 4EK6A 4YBKA 3B2TA 4W8EA 3U6IA 1FVRA 2WO6A 3HEGA 3UODA 3ZCLA 4J8MA 3AQVA 3KC3A 2DQ7X 4JAJA 2ITUA 4HVIA 1PF8A 3KXXA 3CTQA 5H8GA 4G3CA 3MY5A 2C3LA 3FQEA 4O4FA 4Y5HA 4EZ7A 4ZZNA 3OHTA 2PY3A 2ONLC 4XX9A 3R7GA 3DGKA 5CSPA 4QYEA 5EW3A 3FLWA 1YOMA 3O7LD 4XG2A 5DRDA 3Q52A 3C0HA 3C4ZA 2F49A 3LJ1A 5AR3A 4IEBA 2F4JA 4U45A 4ASDA 2C6DA 3G90X 3VC4A 3UOKA 4EBVA 4I5PA 2GQSA 4AA5A 3EYGA 5CVFA 2A98A 4R3PA 3RPVA 4D4RA 1DI8A 3RGFA 4DTBA 3ROCA 4F99A 4ANLA 3TYKA 3LLTA 3FL4A 5FP6A 3IG7A 2IPXA 4H3QA 4D0XA 1OPKA 3W10A 1OL7A 5E8UA 3NDMA 5ACBC 5L2SA 3T3VA 2PZPA 4JDKA 4PQNA 3ZSIA 5J9LA 1W8CA 2Y8OA 3LJ0A 3DS6A 3M42A 4GU9A 3FZ1A 4OUCA 3ZSHA 4DEAA 1OGUA 3F5GA 4TY1A 3PP0A 5HEZA 2G2FA 4KS7A 3C0GA 4YTCA 4I92A 3IDBA 2YIQA 3NS9A 4RFYA 2ITOA 4FTIA 3RAKA 3AKKA 3RK7A 3PY1A 3VBQA 3I6WA 4W9XA 5AX9A 3ZLWA 2WQBA 1YHSA 3ENMA 1IRKA 1VEBA 3QWKA 4EC8A 2PWLA 2BPMA 3GCQA 1M14A 5K0KA 3THBA 5IEXA 2YZLA 1ZARA 1ZYCA 5CYIA 4C2VA 2BKKA 2W1DA 4QPAA 4HGEA 4EK3A 3PFQA 3U6JA 4BIBA 4RQKA 3LXPA 4QP9A 2EVAA 1YWNA 4FR4A 3GU8A 3LQ5A 4K18A 4RFZA 3UIMA 5C8NA 4H05A 4WNKA 4NL0A 2GHGA 3AMYA 3NVKI 3D7TB 3EQGA 3HV7A 5CSWA 1Q62A 3OC1A 3MDYA 2BAJA 4RQVA 3RAIA 4ACHA 3TCPA 1K2PA 4DHFA 3KK8A 4D55A 2YCRA 5HTBA 4KBKA 2GPHA 2YM4A 5EM7A 4EONA 4I6HA 3DU8A 3ATTA 5JFXA 1VR2A 2ONLA 5CF6A 1OL5A 4O0VA 4CVAA 2BVAA 2FUMA 3TUCA 2CN8A 3WF9A 4JBPA 4BDKA 3P4KA 3VS6A 2PVJA 4QQTA 3IDPA 5H8BA 3UDZA 3VUHA 4IAFA 3HP2A 5HE2A 5KMJA 4E20A 3QRTA 3QA8A 2HW6A 2R64A 4EOKA 3JUHA 4FMQA 3CD8A 5B2KA 5DFPA 2WU6A 4IDVA 4BKZA 4HPTE 4USEA 4EQCA 2CHLA 1Q8WA 2J0KA 3V5TA 3HUCA 3R9DA 3RI1A 2YIRA 3C7QA 4H58A 4QMQA 4QNYA 2UVZA 4MD7E 4D2WA 4ZTQA 3RCJA 4A9SA 1FPUA 1OECA 1JSVA 2P3GX 4JG6A 5HVYA 5JQ5A 4YLJA 3GU5A 3WF6A 1ST0A 4KABA 3MI9A 4DFUA 4MAOA 4OW8A 5AR4A 2PUNA 5E8XA 3PRIA 4G3FA 4RIYB 2ITNA 4OTPA 4Q9SA 5HG5A 2CKEA 3R8LA 4EYJA 1BL6A 5FEQA 4C33A 3MW1A 2B7AA 2BDJA 3PVUA 2YFXA 4LMUA 3W33A 2WMWA 3U54A 2QURA 2OH0E 3RAWA 3TZMA 4TL0A 1H25A 4NIFB 1JNKA 4XBRA 1R3CA 3NAYA 4QMWA 3EZRA 4IM0A 1DAYA 4IWDA 3PDTA 5C27A 4PP7A 2GQGA 4G6OA 4WKQA 3R9HA 3V01A 5GNKA 2PVLA 5AP7A 4HGTA 3VS2A 4CFNA 5CAUA 4EH9A 5KNJA 5I9VA 5LJJA 3KIOC 4RWJA 3Q2JA 4II5A 4JDJA 3OUKA 3Q2MA 3RPSA 1DAWA 4Y46A 2ETRA 2PULA 1J1BA 4JS8A 1V1KA 2Y4PA 4QTCA 5HNGA 4RGJA 5I9WA 4R7BA 5J87A 3Q4ZA 3C51A 4RFMA 2DS1A 2PVHA 4MBLA 2GMXA 2XNEA 3IDCA 4LL0A 3PY3A 4BCNA 2WIPA 4M15A 5CU2A 1SNXA 3DKGA 4C61A 1FBNA 4F9WA 1OL2A 4W4VA 5L6OA 5FM2A 4ZTHA 2ITWA 5IDNA 3RM6A 2OW3A 3M11A 2YCFA 4MXOA 2IZRA 2J6MA 3ROYA 1PXPA 4AWIA 4S30A 5LOHA 4GCJA 5C9CA 2ESMA 5EDPA 2BROA 3MVLA 4C4GA 1XR1A 3BYVA 3DLZA 3VS7A 2H96A 1JQHA 2NO3A 3EN4A 4XV3A 3V8WA 4DEIA 4DITA 2X0GA 1PXKA 1WMKA 4IWOA 4PPCA 1U59A 4HPUE 4AW0A 5DVRA 2V5QA 4ACCA 5JK3A 5CF4A 4M97A 3D83A 4O2ZA 3ZO4A 5A3XA 2W17A 4FSNA 4O0YA 3N4VA 4HW7A 1P4OA 4AGDA 2C3KA 4C8BA 2ITXA 3RK5A 1PJKA 3ULZA 2W1HA 4FVRA 2PE0A 4YZCA 3ENHA 4QDEA 2WHBA 2Z7QA 3WZEA 4FTNA 5EKOA 2PZ5A 4DYMA 5A9UA 3CQEA 4UMPA 3AT3A 1AD5A 2J5EA 5CEQA 4AXAA 4BI2A 3QWJA 4FRFA 2C0TA 3P5KA 5CU6A 4FKTA 4E4MA 3NFGB 3Q4TA 2W96B 3A7JA 2JEDA 2QR8A 3PG1A 3QALE 2BDFA 4FI1A 3CQUA 2C69A 4UMTA 3LJ2A 4WBOA 4HNFA 3R7OA 3AMBA 2O0UA 2CLQA 2UZUE 4H1MA 2RL5A 4PDPA 4C0TA 2G15A 2VNWA 3HKOA 1BI8A 4FUXA 4CCUA 1PW2A 4ZEGA 4YUQA 4WUNA 1BI7A 4EH8A 3G51A 1Y6AA 1BMKA 4C4EA 3V5JA 2CKQA 1PMUA 3HMOA 3K5VA 1T45A 2GS6A 5ETCA 4BDDA 4RT7A 2XNGA 4K9YA 1Q99A 4CD0A 4XH6A 2XRUA 4R7HA 3LCOA 5ICPA 3ULIA 2Y7JA 1UV5A 4C4FA 4GUBA 2HENA 4GU6A 3HL7A 1XJDA 5ANJA 3CP9A 1ZMUA 3TIYA 4O86A 5I9UA 2B9IA 4P90A 2X6DA 3PIXA 2R4BA 4KBAA 2RG5A 4CRSA 3NUYA 2BALA 4XUFA 3JY9A 1KOBA 3PXQA 2YM6A 4LOQA 4GFOA 3JY0A 2JBOA 2OBJA 4JIKA 4YC3A 3LPBA 4RLKA 4NFMA 2WQMA 3F5UA 4GKHA 4HVDA 2Z60A 2CPKE 5DT0A 3MN3A 3KVWA 3WYXA 3OTUA 3E5AA 2ETKA 3UC3A 5EM8A 5HNIX 3PY0A 3R1NA 3BL7A 1YI3A 4B6LA 1OL6A 2H8HA 2WD1A 5BPYA 5AEPA 3R7EA 4BKJA 4ZZMA 3R9RA 4R6VA 5CS6A 4E7WA 5E8VA 2JKQA 2OFVA 4JVGA 4QT1A 4TYEA 5BV3A 3PPJA 3AKLA 3QTSA 4U81A 1PMEA 4LQMA 4XV2A 5FEDA 2PUUA 3HECA 5C8KA 4L3PA 3SXRA 2AUHA 5IA5A 3MY0A 3IPHA 3LE6A 3UIUA 1WVYA 4UWYA 2WB8A 4CZTA 4ANSA 4JBVA 2B52A 2UZWE 4OTGA 5FXSA 4X2KA 4C3PA 1Q24A 4KKHA 2J90A 3R28A 4FOCA 4J99A 3CBLA 4QO9A 3CGOA 3IOKA 4FTQA 4O7TA 4FV3A 4ZZOA 5AAGA 5JRQA 4DBXA 3C4WA 5DNRA 4FV9A 4CMOA 1A06A 5IQIA 2QU6A 2IZTA 3Q4CA 2OXYA 3SD0A 3LMHA 4FICA 4WA9A 3LFQA 3R7VA 3HYHA 5FRIA 2XMYA 2GHLA 4ZTSA 5EI2A 2UZTA 2JBPA 5EHOA 4IANA 2VTQA 5LCJA 1XMLA 1SYKA 5CZHA 5AV2A 1CSNA 2JIUA 2YCQA 4MKCA 3WI6A 2Y6MA 4ZLYA 4CKRA 5G1XA 5GIOE 5EYKA 5TF9A 1IA9A 1UU7A 4ARKA 5IMEA 4ZTRA 4U3ZA 5D12A 4X7QA 2Q0NA 4RWLA 3GCVA 2VWBA 1QPDA 3ZHPC 5K9IA 4X0MA 1KSWA 3K3JA 3F2AA 4DGOA 2UVXA 3KRJA 5CSXA 5J7BA 3ZC5A 3DJ6A 2WU7A 2XKEA 2SRCA 3H0ZA 4QDVA 2YM7A 4KIOA 3HZTA 4DFZE 5FBNC 1REJA 3R0TA 4BTJA 3W0OA 3O17A 3ORTA 3QRIA 1YHVA 4FV8A 2GNGA 4AT4A 4EWQA 4TNDA 5EHLA 4TYHB 3ALOA 5CENA 3W2CA 3E8EA 4M67A 4O38A 4UEUA 2XKFA 3BU3A 4BR3A 3NIZA 4YC8A 3ZZWA 2WAJA 3O8TA 4BC6A 3E7VA 4PMPA 3DTCA 3GGFA 3BBTB 3DLSA 1JOWB 2A0CX 2VWXA 5LVOA 2EU9A 3VW6A 2VO3A 2G2IA 2GHMA 5BVEA 4PNKA 4UV0A 1O9UA 3KGAA 5L6WL 5GJDA 2Z02A 3MESA 2FSMX 3MY1A 4FNWA 4PP9A 5EYDA 1FGKA 4JOAA 4PPAA 5HNBA 5BMSA 5HLWA 2YDJA 2CGUA 3VBXA 1GY3A 4BJJA 4JX7A 5DR6A 3W1FA 4Z9LA 3KMUA 3DNDA 3NRMA 3QYWA 4GL9A 3TL8A 4PL3A 4E3CA 4RLLA 4EH4A 1DM2A 1MQBA 3V5LA 5HIBA 5L4QA 2VWYA 2WTWA 5M53A 2XK7A 4CZYB 2BRHA 4EK8A 4I1ZA 3C4EA 3NPCA 1Y57A 3P23A 4NTTA 4OTRA 3BV3A 2XYNA 2OGVA 4U8ZA 3MB6A 4A9UA 3MVMA 5A4LA 2J0IA 1PYEA 2C0IA 2QKRA 3GB2A 4JLCA 3BHTA 3QKLA 3AXWA 3L9MA 2FVDA 2VO0A 4YSMA 1VZOA 3UMXA 4ZLOA 3TN8A 2PVNA 3FMKA 4Y8DA 4D2SA 2BRBA 4G9RA 4YHFA 1W7HA 4G2FA 3EN9A 4J97A 1YXUA 3SAYA 5TT7A 4F6UA 3NR9A 3H9RA 5A4CA 5HOAA 1NY3A 5LVMA 3DFAA 2XKDA 2WTJA 3OXZA 3OZ6A 4YJTA 3KN6A 2ZMCA 4O0SA 2YAAA 5TO8A 1ZAOA 4UXQA 4NCTA 2UW5A 3QF9A 3KULA 4FZ6A 3QA0A 3MH2A 4JRVA 3F3VA 1E1XA 3FI2A 3R30A 4G5PA 4BB4A 4LL5A 2C6TA 1SVGA 2E9NA 2OIQA 4LV7A 2JDVA 2I0VA 1TKIA 2WKMA 4IDTA 4K8AA 4I5MA 3PIZA 2DUVA 3ANQA 1F5QA 4QMMA 5HI2A 5AAEA 1OM1A 2IVUA 5M57A 3HUBA 4RJ4A 2Q83A 2YM5A 3K3IA 4G3EA 5BVOA 2B55A 1SNUA 3QQKA 4PF4A 4RIYA 5EOBA 1OI9A 2QLQA 3R8UA 1R0EA 3NLBA 5HO7A 1XH6A 3G15A 3D4QA 4L3LA 4BRXA 4D0WA 4R77A 1AGWA 2V22A 1RQQA 3E7OA 1FINA 1H4LA 1ZOEA 4ZIMA 3UZTA 2IW6A 5LVPA 4IX3A 4EC9A 5C8MA 4PRJA 3A7IA 3FZRA 3QXPA 2F57A 4ZSAA 4FTLA 4E93A 3C13A 3JS2A 3PVGA 4FX3A 2GNIA 3DXPA 2QOOA 4F1TA 3ZH8A 5BX0A 4GEOA 5CZIA 5IA3A 5HBJA 2YIWA 5AP3A 2OJIA 4AS0A 4CSVA 3R7IA 1F0QA 2B53A 3QCQA 3QHWA 3TV7A 2UW3A 5AP2A 3QYZA 4KWPA 5EYMA 3CTHA 1W84A 3EOCA 5HTIA 4YU2A 5LWNA 4YO4A 2XIXA 2IF8A 3L8XA 4ZY4A 2XK6A 3R7UA 1J7LA 3NMUF 4YJUA 4QP8A 3HMIA 1KE5A 4AT3A 2P2IA 2PMOX 2RGPA 3S3IA 4RRVA 3BLAA 3RAHA 4CLJA 3DB6A 4N6ZA 2GCDA 2WZJA 3AC1A 3L8VA 3LZBA 4TW9A 2R7IA 4C7TA 4Y95A 4QP3A 5BVDA 2BTSA 4DAWA 4WHZA 3MIYA 1F3MC 3AT2A 3QX2A 4O1PA 5ANOA 1JSTA 4FV5A 5DG5A 1LR4A 2R5TA 3DNEA 3UBDA 3VUDA 4FSUA 1OPJA 3EJ1A 4PWNA 4XG6A 3PPKA 4IB0A 5IQAA 4UZHA 4ZSJA 2UW9A 5AV0A 2Y4IB 4TNBA 4O0XA 4PV0A 1WZYA 1UU8A 2VV9A 2QOCA 4KNBA 5G6VA 2XA4A 1XBCA 2YAKA 1KOAA 2C47A 4XBUA 5JGDA 4HOKA 5DOSA 3NYXA 3MV5A 5CVGA 4OTDA 4ANOA 3DB8A 3I79A 4CLIA 4ASXA 4CQEA 1TFFA 3W18A 1NXKA 1R1WA 4QP2A 4BZOA 2YJSA 4WSYA 2XNMA 4FZDB 4D2VA 5GHVA 1HCKA 5BYLA 3N51A 4GK3A 2FA2A 1M52A 3E3BX 3EQDA 4AZWA 2FGIA 2BZIB 4XV9A 4BICA 3EL7A 3DV3A 3SHEA 4JNWA