4J96A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic gain-of-function k659m mutation identified in cervical cancer.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
306
structure length
302
Chain Sequence
AGVSEYELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKMTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 302
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j96A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j96A01
2BFYA 4QRCA 4CKJA 3LLTA 4YJNA 4ACDA 4YTCA 3MY1A 4O7SA 4O7VA 4R77A 4QQ5A 3GENA 3QQJA 2I0HA 3LM5A 3E63A 2PUIA 2XIZA 2VX3A 4RX5A 1H00A 3D2KA 5GHVA 4EUTA 2BALA 3QTUA 5HD4A 2GS2A 4FKPA 3HMNA 4YZNA 2X9FA 5A54A 5CXZA 3DKFA 1FINA 4UXQA 4UV0A 1TVOA 1ZWSA 3FAAA 4XV2A 4CZUA 4FTIA 4GKIA 4FK3A 3EKNA 4AFJA 2Z7SA 3ALNA 4FV7A 1OUYA 3Q9ZA 4LRJA 5I0BA 2HZ4A 3PZHA 4IX5A 4QO9A 4A07A 3KXMA 1Q5KA 3OP5A 4OTFA 1UKIA 5DLSA 1YOMA 5M57A 2ITUA 3FZRA 1AGWA 1Q8TA 4NCTA 4IVDA 3DXNA 2DS1A 2GFCA 2OJ9A 4RJ3A 3ETAA 3R63A 2A0CX 2GPHA 1PKGA 2YISA 3PE1A 4FIHA 2BKKA 4YPDA 3QYZA 4G6OA 5DR6A 5ICPA 4FSWA 3KEXA 4BYJA 3NIZA 4AP7A 5ETFA 1OIUA 4Y83A 4HCVA 5B2KA 5HHWA 4IVBA 4DH8A 2GDOA 1SNXA 4FTQA 4MBIA 3C0GA 1QPCA 5E8XA 1Q8ZA 2GNHA 4BCOA 4D2PA 3I81A 5AUZA 4J53A 3ROCA 5CEPA 3NLBA 3B2WA 4FSZA 4U0IA 3RAHA 2BTSA 3ZXTA 2O8YA 4EOQA 5I3RA 3HMPA 3F61A 3MFSA 3FL4A 3L8XA 3OROA 3CPBA 3MH1A 3PRIA 3O8PA 2JDOA 4KKHA 4D2TA 1VYZA 4ALUA 4XV9A 2H34A 3K5UA 2YACA 5DH3A 1A9UA 4A9SA 4XRLA 3NR9A 4I6HA 5HIBA 4IX3A 4B0GA 4E4NA 4YC8A 3F5XA 3G51A 3Q04A 3DZOA 3DJ6A 4GS6A 3VIDA 4FIFA 5L2SA 3COKA 4K2RA 2UZVA 3PG1A 3UO6A 4OW8A 4QP3A 3TM0A 3NVKI 3KRJA 4D1SA 5CEOA 1M52A 4C58A 4FL3A 4GVJA 5EK7A 4QMNA 4E20A 2CPKE 4XEYA 4ALVA 1F5QA 2JLDA 2UZWE 4J8NA 4D2RA 3F9NA 3PWYA 4OTQA 4G17A 4RPVA 1F3MC 3FWQA 3D83A 3ORZA 3FQEA 4XH6A 3TZ7A 4GU9A 3GU5A 3LE6A 4BDKA 4BTFA 3UC4A 3QKLA 4E4MA 3RK7A 3QRKA 3LHJA 3SRVA 2GS7A 2ITXA 5HX8A 1BL6A 2UW3A 5KMMA 2WPAA 2REIA 3P23A 2PE1A 3EL8A 4FKSA 2VWYA 4HYSA 4PL3A 4RC2A 2CKPA 5KHXA 3DY7A 4PDYA 1KUTA 1RW8A 3NUXA 4GW8A 4H1JA 1OVEA 5HIEA 5L2IA 5C9CA 3CJFA 4J8MA 2RSVA 4QQJA 1MP8A 1JSTA 4JG8A 4USFA 4UWBA 2J51A 1LEZA 4KSPA 3F7ZA 3PSDA 2QU5A 3NSZA 3OT8A 2WTKB 2YM7A 4RLKA 5DNRA 3MJ2A 4O6EA 2LGCA 3BYOA 3PXRA 4BZNA 3MB7A 4U42A 3WE8A 2WMBA 3P5KA 5EHYA 4FA2A 5G6VA 5HU9A 2ITZA 3IECA 3MVLA 4LGDA 4TY1A 4OAUC 5E1EA 5IQIA 3OOMA 3KULB 1TQIA 4GSBA 5GJFA 5LVNA 3QAME 2Y7JA 4ZAUA 3LFDA 4FKTA 3TWJA 3VS1A 4FTMA 2E9VA 3FSFA 2VWXA 3QTSA 2WMRA 1T45A 1KOAA 5IISA 4B8MA 3DXQA 3CD3A 3JY9A 4E6CA 1YRPA 3IPHA 4U97A 2QO2A 2ZB0A 1H07A 3HMOA 3NNVA 1BLXA 2YM6A 3RALA 3UOHA 5L6OA 4I5HA 3ZUUA 1U54B 1ZZLA 4EYMA 2OZOA 3AD5A 3K3JA 2WMQA 3U4WA 3CTJA 4BCKA 1DI8A 4HCUA 4FOBA 4C4GA 4E4LA 3CIKA 5C1QB 2F7EE 3S2PA 3UPZA 5E4HA 2ZYBA 3NYOA 3R22A 3E7OA 4RJ4A 4AU8A 5ITAA 1R78A 2F2CB 3LQ5A 3MW1A 3QXOA 1XH8A 1UV5A 3EIDA 2JKQA 4M84A 2RGPA 3D9VA 3L8VA 3DZQA 3ORPA 4HGLA 4K1BA 2E2BA 4YO6A 3EQBA 5JFSA 5DR9A 1NT2A 3U6IA 4EJ7A 4YTIA 2I1MA 2PMOX 3FMDA 4BCNA 4U8ZA 4LI5A 2VWVA 3UP2A 2A1AB 3DB6A 5EYDA 3FPQA 4M97A 5H9BA 2RKUA 4IAIA 2O5KA 1PXPA 3RZBA 3KXXA 3OVVA 4C4JA 5TT7A 3C0HA 3E88A 1OL2A 3PG3A 4U9AA 1L8TA 4C4HA 4A4XA 2P33A 3DXPA 1V0PA 4M8TA 4M0YA 3TG1A 3ATSA 3VS4A 1OKWA 3OCGA 4EUUA 5IF1A 2XBJA 5AAEA 4PX6A 4N6YA 4FMQA 5EH0A 5GZ8A 3NWWA 4OTHA 3BRBA 3F6XA 3UZPA 4ZIMA 4C4EA 5IQAA 3ZDIA 4AS0A 4E73A 1UNGA 3V51A 2BZIB 3GC7A 3P08A 3PUPA 4PP9A 4YPSA 5F1ZA 4BI1A 5F4NA 2PYWA 3L8SA 2WB8A 4MBLA 3VS6A 3ZRKA 3TDWA 5E8SA 1BL7A 4UMUA 1OZ1A 1U46A 4Q5EA 4EK4A 3ZSGA 1GZNA 3QQKA 5M07A 3MTFA 3FMLA 4BDBA 5IEVA 5AV0A 3BYVA 1OUKA 2C1AA 4JG7A 2JD5A 5HOAA 1AD5A 3RAKA 3QTZA 4MYGA 2G2FA 1P14A 1YDRE 4OTWA 3V5PA 4UMPA 1OBDA 4K77A 5HBJA 3L9PA 4IX6A 4N6ZA 2DUVA 3CQUA 3E8EA 3NNWA 4FYOA 3P79A 1XBAA 2PUUA 3VNTA 2BTRA 3MS9A 4WA9A 4UZDA 5AR2A 3R9RA 3T3VA 3GU7A 3VS5A 3OMVA 3E3PA 3AC8A 3HV3A 1W8CA 5D41A 4N4SA 5CT7A 2B1PA 2WEVA 3QZGA 1U5QA 2XJ2A 3NUUA 5HTIA 2XK8A 3D0EA 2IZSA 4FTKA 4IWOA 2B9FA 3ZHPC 4IB3A 5IH4A 4O6LA 1PYEA 4RFZA 3V5LA 5J9YA 5AFVA 2CN5A 1H25A 2VTQA 4CNHA 5J9ZA 2PVHA 3U87A 4Y5QA 3WF8A 4AT5A 4A4OA 4YZCA 1GNGA 4KA3A 4AW2A 4I6BA 1PXJA 4U80A 3FLYA 1WVXA 2ZB1A 4PMMA 4O86A 3F3VA 3UNKA 3TL8A 3DBQA 4A4LA 5L6WL 5AP5A 3PXKA 3V3VA 5DEYA 3QCXA 3KK8A 4S31A 3RM6A 4ANMA 2F9GA 2WMWA 2X8DA 3D2IA 2QNJA 4NKAA 1UU3A 4RA5A 4ZSGA 5C8KA 3NCZA 4FKJA 4O0VA 4W4VA 4ZY5A 4CFFA 1F0QA 1YDSE 5EG3A 4Q9ZA 4G9CA 3BBWA 3NYVA 3PFQA 2CCIA 5IG1A 3SRVB 3RBWA 4X2FA 3B8QA 4E1ZA 2GHGA 3LCDA 1SMHA 4BWPA 2HY81 2G2HA 4U44A 2UW7A 1I09A 2F49A 5J95A 2BRHA 1YHWA 2NRUA 3VRZA 3ANQA 3EQHA 2I0YA 3HA8A 1UA2A 2F4JA 4EEVA 2NNWB 4BWXA 4V0GB 3QHRA 4DG2E 2YWPA 4YLJA 5BVKA 2PZPA 3RTPA 3OCTA 2WMAA 3T3UA 3OXZA 5FEDA 2X4ZA 3TIZA 3Q2JA 5AP2A 3TUCA 2HWOA 3D4QA 3R9OA 2E9UA 5FP6A 3VS0A 4JIKA 5KMLA 3RJCA 4R78A 2X2KA 4QP8A 5LARA 4DG0E 3NUPA 3OUNB 4ZZMA 3QUEA 2C3KA 3FC1X 4I94A 4LUEA 3W8QA 1Y8GA 5DT3A 2B52A 2OKRA 2OGVA 3DNEA 4JQ7A 4K0YA 3Q60A 5EI2A 4AFEA 1LPUA 2VTNA 2WQNA 2ZDTA 3UGCA 4BZDA 1OMWA 2HYYA 1VJYA 4BDGA 5JQ8A 2PPQA 4WG3A 1MRYA 4MXCA 4KINA 5KO1A 3PJ3A 4O81A 3V5JA 1E9HA 4AOJA 4ERWA 2J5FA 2B55A 3NRMA 4XG8A 3TKUA 2ERZE 2R9SA 2G15A 2VWBA 4ITJA 1REJA 3U6HA 2VTOA 3NNUA 5L8KA 3OF0A 5CEQA 4IAKA 4JAJA 4C3FA 5LCKA 3FXZA 4U3YA 4QTAA 3PJCA 3L1SA 2EB3A 4J95A 5HVJA 4HGEA 4LM5A 4D2WA 3ET7A 4JLCA 1HCLA 5EYCA 1M7NA 3FQSA 3BLHA 1IR3A 3EFLA 5HKMA 5GJDA 2XH5A 3ZFMA 1NVQA 5M56A 1CTPE 4GT4A 1VZOA 3ORTA 5CWZA 3AGMA 3W2SA 4HVSA 3QA0A 1R3CA 4UB7A 1HCKA 5CF8A 4AW1A 3IDPA 3QRJA 3NGAA 4AE9A 4R5SA 4IWDA 4BBEA 4FT3A 4F1MA 1H27A 2CKEA 4JG6A 4BY9E 4C38A 2XK4A 4RWJA 3S4QA 4ASXA 3LFAA 4KBAA 3RPOA 3OWLA 4NEUA 2VRXA 4RIYA 5H8BA 2VO0A 1AQ1A 3WZKA 3JR1A 2Y4IB 4IDTA 4GJ2A 1KV1A 5B2MA 5IDPA 3UOLA 2ITPA 4MHAA 2OG8A 5H2UA 1M17A 1PXIA 4FNYA 3LXLA 1KE7A 4GK4A 5E8WA 4EONA 2OJJA 2WTCA 2I6LA 2UZDA 3EZVA 4DFLA 3PVUA 5EW9A 4ZTMA 4DGMA 4BN1A 2CKOA 5AV2A 2QO9A 4J97A 2V7OA 3L9LA 2VX1A 4KIKA 4RVLA 3RWPA 3ZSIA 4ASDA 5AUTA 3PZEA 2YLFA 4JDHA 3P1AA 2AUHA 4Y73A 5ANDA 4ITHA 2PUNA 3VUDA 2C6IA 3H9OA 5AUYA 3CSVA 2QOQA 4U6RA 2V0DA 3SW7A 5A4QA 4BDEA 2WNTA 4KRCA 4AN9A 5I9ZA 1PMUA 4FT5A 1PXMA 2YITA 4HCTA 3ZZEA 1H4LA 2X6DA 4TYHB 4X2KA 3ZC5A 4IFGA 4G6NA 4F6WA 5A4TA 2PZYA 4F63A 3ZU7A 1Q99A 3D5XA 4JNWA 3GCPA 3RPYA 3TZ9A 3C4EA 1XO2B 3FQHA 4MH7A 4OBQA 5KKRB 1V1KA 5H3QA 5CLPA 4NW6A 4EOKA 3O50A 5ETCA 3Q4UA 4DINA 3EYHA 5F9EA 5FWKK 2JDSA 4O0SA 4KBCA 3U4UA 4CFVA 4AZVA 5CSWA 5J87A 3UPXA 3PPKA 1SZMA 1U5RA 5EM5A 2GTMA 4O7LA 3UDBA 4P7EA 2JKOA 5IQDA 4YLKA 4WNMA 4NYEA 4FNWA 5JRQA 5C03A 5LCJA 2YDKA 3DV3A 4FSQA 3WARA 3H0ZA 1V0OA 2ZV9A 3EFJA 4FZ6A 2QCSA 4AF3A 2HK5A 2QR7A 3I5NA 5HLPA 2BRBA 2ETMA 3QRIA 2J7TA 3FXWA 4QMUA 4TYGA 5FDXA 1Q97A 2PZ5A 4ZTHA 2WQBA 2GNJA 3HECA 3JS2A 3NUSA 4C61A 4L45A 2V55A 4JX3A 3VBWA 4E26A 4YR8A 3GB2A 4RA4A 5JZNA 4RQKA 2XM9A 2PULA 4UX9A 2ZJWA 4F9BA 3O71A 2X9EA 3EQIA 5LVOA 4C62A 1ND4A 3OTVA 2DWBA 5J7BA 4QYYA 2WEIA 3MSSA 2C5XA 5BMSA 2R3FA 5G1XA 3THBA 1JNKA 5BUIA 3LQ3A 4P5ZA 1M2PA 4LL5A 3C4CA 2JIUA 2OBJA 3QX2A 4AN2A 4BDAA 4J98A 2HZ0A 2UZTA 3BYUA 4BCMA 4BIBA 4BI0A 4QNAA 4R3RA 4EQCA 3MA6A 3PSBA 5GZAA 4H3PA 2BDJA 3C4XA 2YERA 3QC9A 4RQVA 2PMIA 4EH9A 5DN3A 2J5EA 3U54A 3DDPA 3G5DA 4BIEA 3UIMA 3IQ7A 2J2IB 2HAKA 2OI4X 3DJ5A 1IA8A 1ZARA 4IB1A 4J71A 1BYGA 1YVJA 4FL2A 3PJ2A 4JBPA 3BQRA 4ZTSA 3UO4A 4D28A 3MV5A 4EOLA 1ZYDA 5HORA 2GQSA 1UVRA 4IM3A 3TTIA 3EQRA 2YN8A 3W16A 4WT6A 3VW8A 2OU7A 1UU7A 4YBJA 4DEGA 2W9FB 1TQMA 3MVHA 5D9HA 4H1MA 5E91A 5AP4A 4O0RA 3UP7A 4DGGA 3REPA 4BHZA 4FTJA 1LR4A 5AIKA 3V6RA 5JN2A 2XJ1A 3FJQE 1J91A 5I3OA 4TWOA 2VX0A 3CR0A 3MFUA 4IM2A 2C6TA 4DCAA 2R2PA 4KWPA 5AMNA 4PF4A 4B4LA 3QTRA 3TJDA 5M51A 3R1NA 5M09A 4OLIA 3ZO4A 4FSYA 2C3JA 2UVYA 2W1DA 1MUOA 3AG9A 3D14A 3HGKA 4TWCA 4WBBB 5ANIA 1H26A 1WBOA 3HNGA 4QMMA 4YUQA 4CFWA 1G8AA 2R3JA 3PTGA 1VR2A 5I9UA 2BDFA 3SG9A 2C6OA 5IU2A 3QTWA 2BAQA 2C6EA 4MQ1A 4Y72A 3ZS5A 4ZSLA 3ZXZA 2WTIA 4EK3A 5T68A 3BWFA 4CRLA 1NA7A 3F5GA 3GC9A 3JVSA 4FV3A 5KX8A 3IGGA 4NU1A 3LVPA 1B39A 5HNIX 1K3AA 2PZRA 3TKHA 3Q6WA 3KY2A 4ZS0A 3EB0A 3NDMA 3LZBA 2VTMA 2IJMA 2XNBA 1SNUA 3IGOA 4QQCA 5DG5A 3R00A 4CYJA 3BELA 2JC6A 4ZZNA 3KGAA 4CVAA 3UYSA 1JLUE 2CGUA 3VQUA 4AZWA 1PKDA 4TTHB 4EYJA 3ULIA 3EN4A 4FUXA 4JT3A 4ANOA 3QX4A 2C47A 4AZSA 2ITQA 5D11A 4PMPA 3QKKA 2OF2A 4FIGA 5EYKA 4CFUA 3Q96A 3FLSA 5CXHA 3SVVA 1UKHA 2AC3A 5AP6A 4O7WA 1FMOE 4I0RA 4FSTA 4BCFA 5HLWA 3MH3A 2GNLA 4X3FA 4LQMA 4GT3A 4KKEA 2JIVA 3PJ1A 4C57A 3VF9A 5K0XA 3WYYA 3UOKA 3PP0A 4LUDA 4IB5A 3F3ZA 4S34A 3R8VA 4M67A 4S30A 5E90A 3NZ0A 4YC3A 1PY5A 5GIOE 4F7NA 2JEDA 1QPDA 3O7LB 3LCOA 2YHVA 2BAKA 2HW7A 4FVPA 4O2ZA 4AWIA 4PRJA 5FEQA 1YQJA 2XKCA 4C02A 3IO7A 4I5CA 4IAYA 3OEZA 1YXSA 2I0EA 2WMVA 4D1XA 3O23A 5CI6A 3HDMA 5TOZA 3POOA 4DITA 5FXRA 3S3IA 4UWYA 4DG3E 4XUFA 5DRDA 5CEMA 1FMKA 4JVGA 3ZC6A 1WBSA 4IC8A 3C9WA 3DDQA 4BGQA 3EHAA 3FY0A 3ENMA 3R2BA 4UEUA 3OTUA 4C2WA 3R1YA 4KIKB 3MPMA 3R7IA 3BCEA 4HPUE 4QTEA 2UV2A 3WOWA 2WQEA 2G01A 1ZMWA 5JKGA 3FZTA 4QMSA 3VAPA 3ORIA 3ZLWA 4FTLA 2OXDA 2W5HA 3F88A 3LMGA 3MFRA 5IPJA 1OPLA 3CPCA 5CVGA 3FHIA 3HP2A 2PK9A 4FKOA 1ZMUA 1WAKA 5H8EA 3V6SA 4WG5A 3WE4A 1O6KA 3QTIA 2O63A 3H0YA 4J99A 5KZ0A 3W8LA 3FKNA 3I5ZA 1JWHA 2QOLA 5BYZA 4RVTA 3FUPA 2C0IA 2B54A 2V7AA 2FSLX 2NP8A 3PP1A 4ZY6A 4YSMA 5EM7A 4DAWA 2C1BA 4H36A 5HVYA 5HCYA 5BQ0A 1WBWA 4I0SA 4MX9A 4F65A 2WGJA 5HICA 4BB4A 4BDDA 5CASA 3QKMA 3OG7A 2QOHA 4EOSA 4FSRA 3SOCA 5EM6A 2O64A 3B2TA 2QG5A 4QMPA 4AT3A 4NKSA 5M06A 2PY3A 3QD4A 1H1WA 2VAGA 4ZSEA 4F0GA 4O83A 1XH5A 1Y8YA 5IQBA 1H0VA 2JDVA 4CFXA 2CDZA 3AMBA 3EL7A 1H1PA 4BL1A 3WZDA 3TDVA 1ZYLA 1ZMVA 2WZJA 2ZAZA 3G2FA 5LVLA 2EWAA 2ZV2A 4W4XA 1YWRA 3FPMA 4FNXA 4YJSA 4ASEA 1YOLA 4EC8A 2X8IA 3BV2A 3OCBA 1G5SA 4BTJA 1JSUA 3QU0A 2BVAA 3NYNA 2UVZA 4RFYA 1CDKA 4UALA 5CZIA 4ZXTA 4JBQA 4EH2A 4ZMFA 5CSVA 3R7EA 5LMBA 5HVKA 2XF0A 4AA5A 2WMTA 2Q0NA 5AUVA 2XIRA 4JL9A 2WOTA 1YI3A 3AT2A 2J50A 3BBTB 4UMQA 4DCEA 4C3PA 5E7RA 3ZO2A 5GJGA 1YXVA 4FOCA 4AGUA 3QUPA 3TEIA 4BBMA 3ORXA 5ACKA 3COHA 3P9JA 4RZVA 4DTAA 2QLQA 3OBGA 3SKCA 1IAHA 4BTMA 1WMKA 1ZYSA 2XS0A 3A4PA 3BGZA 4H3BA 4RIXB 3WZEA 2GU8A 5JRSA 4FKIA 3AXWA 5IA5A 2IWIA 3EQDA 4EHGA 1U4DA 4TZRA 2QR8A 4BCHA 3QD0A 2VWWA 3VC4A 3UNJA 2OK1A 1SVGA 2YABA 3E8CA 5DR2A 3WZJA 4ENYA 3UQGA 1XWSA 3S95A 4I6FA 3TNQB 2R3NA 4IHPA 5LMKA 4M15A 2VTJA 2UW0A 4FIEA 4NFMA 4H39A 3CJGA 3QQLA 2BROA 4EOMA 3TUDA 2EXCX 4QPAA 5LVMA 3A7HA 4BRXA 4CXAA 2J4ZA 4KS8A 3H30A 5CNNA 5AWMA 4YJVA 5HQ0A 3R02A 5J1WA 3H9RA 4RFMA 2XIYA 3KQ7A 4XG7A 5K0KA 4M66A 3FC2A 3JY0A 4CYIA 5LJJA 2JKMA 1JKTA 4O1PA 3KXNA 3A4OX 5BYYA 2W17A 3RPSA 3Q9WA 5HG7A 2W4OA 4G3DA 4LRKA 3DTCA 1NVSA 4NFNA 2WIHA 3PPJA 4A9RA 4F9WA 5HI2A 3U8WA 2H9VA 3BE2A 3F2NA 4XMOA 4EOOA 3HKOA 4K9YA 3I0QA 4FIJA 4GUBA 5IKWA 4EK5A 2IO6A 1M7QA 4CG8A 1ZAOA 1A06A 2G2IA 3VWAA 4Y46A 4FSMA 3UVPA 4H05A 2Y9QA 3LQ8A 3V5TA 4XP3A 3I0OA 4PL4A 3SD0A 5AX9A 5FGKA 3RHXA 3GU6A 3DPKA 4KNBA 5T6KA 3K54A 4B9DA 5CVHA 2X0GA 3KK9A 4FYNA 2J0JA 4HNFA 1GZOA 4L53A 5AP7A 4RSSA 2KTYA 1CM8A 3AMYA 5C8MA 5JFWA 1WFCA 2JAVA 3E3BX 3FI4A 2XZSA 4X3FB 3SXSA 3VVHA 1S9JA 4AGDA 2JITA 3H4JA 3EQGA 4HGTA 4O0TA 4FVRA 1YXTA 3RM7A 1PRYA 4K33A 3R9DA 2I7QA 1QPEA 2VTLA 2V22A 3PIYA 3RZFA 3KMMA 5AV3A 4F7JA 5KE0A 4J96A 5CY3A 4TYEA 1DAWA 4D4SA 2ZVAA 3KMWA 2W5AA 4P4CA 5M4FA 3IW6A 3TIYA 4CMOA 3DGKA 4L7SA 5TO8A 4KUJA 3ZFYA 5E8UA 4O84A 3UZTA 1RDQE 5HLNA 3QYWA 1XH6A 1Q62A 4C7TA 3W2RA 3ACJA 3E8DA 3M2WA 2PSQA 3SXRA 5JFXA 4L44A 3PIXA 5IEXA 3TZMA 4YURA 4LMUA 4JAIA 3PXYA 3NMUF 4G16A 2PVKA 3DLSA 4C36A 5M53A 3H3CA 2Y6MA 1Q24A 3ZLXA 3N4UA 3VO3A 2BFXA 3PYYA 4ARKA 3EN5A 2YDIA 4RX9A 4V04A 4C0TA 4PDOA 3EN9A 5DWRA 2OZAA 3I7BA 4QYFA 3PA3A 5L8JA 3RI1A 2VO3A 4CLIA 2QD9A 3SXFA 4EZ7A 5HZNA 4XV1A 5ANKA 5CF4A 1Q8YA 4CTCA 4MNEA 1SVEA 2XNPA 3LCTA 3ZLYA 4GCJA 5AM7A 3IW4A 3QALE 3A8WA 2QURA 3GGFA 2BR1A 1TKIA 1ZYJA 3FBVA 4XLVA 1XBCA 4NIFA 4EOIA 2I0VA 4IZ7A 3Q5IA 3TACA 3IW5A 1OECA 3CCNA 4ENXA 4ITIA 4UN0C 3FV8A 4XG9A 5DPVA 2IW9A 3S00A 2WTJA 2CGVA 2PVRA 3PVWA 4R1VA 4HVHA 4XG3A 2XRWA 2Z60A 4O7RA 1UWHA 1LEWA 4FODA 1H0WA 2OJIA 4C59A 5KMIA 3G0FA 3TKIA 2ZMCA 4IW0A 3EN6A 5CF6A 4IBMA 3ACKA 3R9NA 4MF0A 3IOPA 5E9EA 4QMVA 3PXZA 2Y4IC 5CVFA 4FG9A 4EJNA 4USEA 4E8AA 5HO7A 3I1AA 4IC7A 5FTGA 3R83A 1R0PA 2GHLA 3D5UA 1DAYA 1DI9A 2HXQA 3GI3A 2OH0E 2Y4PA 3R8PA 3MGYA 3OW4A 5CTPA 5AM6A 5CS6A 2C6DA 4ZJIA 4D9TA 4X2GA 2FVDA 5CALA 3MVMA 5C4KA 2PZIA 4F1OA 4PPAA 2H96A 2RG5A 4BF2A 1QMZA 3G90X 5HG8A 3BU6A 4IQ6A 4R7HA 3CGFA 3DCVA 1CKJA 4N70A 1GIJA 1S9IA 3MJ1A 2GNGA 2X4FA 4I5PA 4DFZE 2BRNA 3NW7A 4R1YA 3G9LX 4IMYA 3OOGA 1APME 3SX9A 3DOGA 3FKOA 3KCFA 3OCSA 4GFGA 5EOBA 4E6QA 4IWPA 3SLSA 4DA5A 4FVQA 3OXIA 4PTCA 2XM8A 4KKGA 4BGGA 3DAJA 3PPZA 5CENA 5HBHA 5KKRC 3OFMA 3QRTA 4GU6A 4HPTE 4IANA 3V8WA 2CSNA 4AZTA 2W06A 1W84A 2RF9A 2Y0AA 2NRYA 2PVFA 5JGBA 3PA5A 4FI1A 4I21A 4TPTA 1O6LA 4H58A 3ERKA 3AD4A 3ZO1A 2PHKA 4YHJA 4R7BA 1JAMA 2RFDA 4Z7HA 2XYUA 2XK3A 2P2HA 3GUBA 3TTJA 4RLLA 4OT5A 3ID6C 1SM2A 4GH2A 3AC4A 1JPAA 3BYMA 3R71A 4BCJA 5IA3A 3GCSA 3NNXA 3AD6A 3LFFA 4F4PA 1CKPA 2W1IA 2GS6A 4Y95A 4D4RA 3FMJA 4BVUA 4FT9A 3WILA 3RHKA 4TW9A 5BVOA 4MBJA 3VHEA 5EQYA 4R3PA 4NH1A 3KKVA 2EXEA 3FMEA 4I0TA 5J8IA 1GJOA 3HVCA 3RCDA 2PUPA 5IQGA 5DGZA 4R3CA 2XYNA 5E92A 4BCGA 5DVRA 4ZJJA 4PDPA 5EDRA 4G5JA 3VBTA 4LV5A 3ORNA 3Q4TA 3TT0A 3HX4A 5KHWA 1MRVA 2UZUE 2HY0A 4N0SA 5CSHA 4AA0A 4EZ5A 3SAYA 3DK3A 3LXKA 2GNFA 2ONLC 3VJOA 2R3KA 3LJ1A 2PWLA 3OY1A 1NW1A 2BZHB 3ROYA 4DH7A 5JZJA 1QPJA 2B0QA 3P78A 4PTEA 4DFUA 1JKKA 3DQWA 3L9NA 4G3EA 1W7HA 4MXXA 4NSTA 1WBTA 4NM5A 3HMIA 4A9YA 4EOPA 2CHLA 3BPRA 3VHKA 2QOCA 4BGHA 2QKWB 2GQRA 4GEOA 4YGAA 2QI8A 3AMAA 4OTIA 1A48A 3MESA 3E92A 5AAFA 3CBLA 4AACA 2P4IA 1FVRA 4LGHA 4CFNA 3OT3A 2WFYA 2HENA 4U79A 2Z02A 5IUIA 5E1SA 3II5A 5EDQA 1Q8UA 2CN8A 4MK0A 4BKJA 1RE8A 5KUPA 2JAMA 1TQPA 2QODA 3F5UA 3W10A 4BIDA 3OZ6A 3P7CA 1SYKA 5B7VA 1YOJA 4L8MA 5AP3A 4A7CA 3IKAA 1OIQA 2CLXA 2EB2A 3FHRA 3NW5A 1Q3DA 4LL0A 4NM0A 3WI6A 3QL8A 3TV7A 4YMJA 1ZOEA 4WNOA 1PF8A 3CQWA 4PPBA 1OL6A 3RNYA 2CNQA 3KXGA 4QMWA 2ZDUA 5AP0A 3FKLA 4IWQA 5HIDA 3GU8A 4C33A 3IDCA 2BIKB 4CTBA 1XJDA 2YA9A 4EHEA 4C2VA 5KMOA 5FEEA 3NUYA 3CP9A 3D7ZA 4S2ZA 5LWMA 3DFAA 4O38A 4FV4A 4I3ZA 2ITTA 2C6KA 2OZAB 3VF8A 4ASZA 4RGJA 4FIIA 5JFVA 4ORKA 5BVNA 4TN6A 1X8BA 3I4BA 3HUCA 3D7TA 5IQHA 3Q5ZA 4UYNA 5D10A 2C6MA 4PMSA 4IB0A 2IVUA 3OD6X 4IZYA 3SG8A 2UUEA 4BI2A 2XIKA 3C50A 4RRVA 4YZBA 2YLEA 3DS6A 4UMTA 4KIPA 4WIHA 5TF9A 4DYMA 4O27B 4ZZOA 5CU4A 4XG2A 4XP2A 2C5NA 4FZFB 5ETAA 2R0UA 2BKZA 3UBDA 4YSJA 4GK3A 3UOJA 3A7FA 3FL5A 1M2RA 4TNDA 1R1WA 3ZEWA 4DT9A 4ZTNA 2ZM1A 1ERKA 4GIIA 4CRSA 4UY9A 4C37A 4GKHA 3DLZA 2JIIA 3RPVA 5ANJA 5TR6A 4F70A 4Z7GA 3HRCA 2PVJA 5EI6A 5HESA 2YM4A 4NWMA 4RMZA 4ZS4A 5D12A 1DS5A 4FKLA 5FUTA 5HEZA 2W4JA 4WRGA 5HE0A 5DEWA 5BVEA 4GFOA 4FTNA 5ANEA 2FYSA 4IVAA 4DFYA 4Z3VA 3R8UA 4E5BA 2X6EA 3BEGA 3GOPA 1YDTE 3QGYA 4YJTA 5DFPA 4NUSA 3G15A 2HELA 4HYHA 5IH6A 2OJFE 4PMTA 2VN9A 4I93A 4AG8A 4RX7A 2XCKA 2HOGA 2VD5A 2WMSA 4Q9SA 2YWVA 5LOHA 5EKOA 2R3HA 3RAWA 4APPA 4TKSA 4Y5HA 3HRFA 5AV1A 2WTVA 3OW3A 4K18A 3KL8A 5IA1A 5KBRA 4FSUA 2CGWA 3I79A 1JBPE 5BUJA 3KC3A 2WU6A 3QZIA 5GIPE 3C5UA 4JQEA 2PVYA 2X2MA 4EK6A 3VUKA 2YCQA 4QYGA 4EC9A 4JS8A 4F6UA 4MNFA 4FTCA 4RJ6A 5K4JA 4YC6A 1R39A 4YJPA 3BX5A 4DFNA 1ZRZA 3FDNA 3VUGA 3NIEA 4FEQA 2OWBA 4GV1A 4JDKA 3BHTA 5J79A 2BCJA 1B38A 3BHHA 4A06A 2IZUA 3FMMA 3UIUA 3VBVA 3UG1A 5IUGA 1K2PA 2P55A 3GEQA 2XKFA 4NT4A 4JJRA 3ZM4A 5DE2A 4L00A 4M69A 4BR3A 4NTSA 2R3PA 2W1EA 3NS9A 1J7IA 2QU6A 4FE2A 2FSTX 4AZFA 4EH6A 4YZ9A 5CNOA 4AA4A 2JDRA 5A4CA 2PMLX 2YJSA 3LFNA 3HUBA 4FG8A 1Y6AA 2WTDA 3DKOA 4QYHA 4XYFA 3IW8A 1OGUA 3V01A 4QPMA 1H1QA 4AZEA 2BRGA 4S33A 3AQVA 4XRJA 4EZ3A 3N51A 4G2FA 4O0XA 5L8LA 3R8ZA 2XK9A 4GG7A 5CU2A 1GY3A 1PXKA 3ZTXA 4IDVA 3EH9A 4E6AA 5JSMA 2XP2A 3OEFX 2QOFA 3D5VA 3QLGA 3HV5A 1XR1A 2DYLA 1H08A 3PY3A 4NM7A 4DGNA 4QTBA 2YM3A 2GMXA 3E7VA 5H8GA 5DMZA 3RKBA 4QYEA 4XV3A 3PWDA 4BDJA 4C4IA 4HW7A 2BDWA 3GFEA 4M14A 5C8NA 3NPCA 4D0WA 3U6JA 5L2QA 3UIXA 3PIZA 4CKRA 4BCQA 4D4YA 3H10A 5I5ZA 2F2UA 5AJQA 4RIOA 2A27A 2XEZA 4CT1A 5BPYA 2Z7RA 3ATTA 2OFUA 1BMKA 3FLNC 2QOKA 1UNHA 4WKQA 2PMNX 3BEAA 5CAOA 1K9AA 4FK6A 1W98A 3GCQA 3UIBA 2E9OA 3VUTA 4PPCA 4D9UA 3GNIB 2Z7QA 2R0IA 3Q6UA 3C51A 3B8RA 4IFCA 3LJ0A 4ZP5A 1KE6A 3ZUTA 4AUAA 3FXXA 2VGOA 4DT8A 4C3RA 2VTPA 3FI3A 2JFLA 2V5QA 4FNZA 2QG7A 2P2IA 4CGAA 3QGWA 3FZPA 1RQQA 4FV6A 5HG5A 2AYPA 4KS7A 4U43A 1IASA 2HWPA 1OIRA 2UZBA 3SV0A 1OIYA 4H3QA 4U45A 5C26A 1BUHA 5AUWA 3KF7A 4JXFA 3HP5A 3F2AA 5AA9A 2VTSA 2IVVA 5FQDC 3MH0A 4DLJA 1GIIA 4ID7A 4LRMA 5A46A 2CGXA 2R3RA 1H24A 2IPXA 4E3CA 4L01A 1I44A 2JBPA 4L3PA 3MN3A 4LG4A 5M55A 4CMUA 1GZ8A 3NAYA 4BDIA 1ZOGA 3KXHA 4NW5A 5CANA 3PE2A 2FB8A 3R9HA 2IW8A 3A7JA 4HYIA 3O17A 4JR7A 2WD1A 4TXCA 3RGFA 4IJPA 3TCPA 3VUMA 3W55A 4OTRA 5A6OA 1PMVA 3FI2A 3POZA 4ONAA 3KB7A 4F1TA 2UZNA 4W9WA 2Y6OA 2O0UA 3DK7A 4L9IA 1CKIA 2C0TA 3Q9XA 1OBGA 2W4KA 2B9JA 3QC4A 4FKUA 1BI8A 4OTPA 1MRUA 3QZFA 3WF5A 5I9VA 3OXTA 1PHKA 1OL7A 2BRMA 4X6RA 4QPSA 5EHLA 3TNPC 5J7HA 4OAVB 2ZM4A 5JH6A 1JKLA 4CZTA 5IUHA 1H1SA 5AR5A 4OBOA 4TL0A 4QP1A 3L8PA 3CLYA 1Q41A 4KB8A 3COMA 3AOXA 2YM5A 3BLQA 3QBNA 3E62A 5L2WA 4X3FC 3UO5A 4FR4A 3R04A 4MAOA 2SRCA 2ITNA 3CY2A 2EUFB 2FUMA 3OWPA 4FL1A 4RZWA 2R64A 3MBLA 4RIYB 3TNHA 4A9UA 3QD2B 2B53A 2OJGA 4L68A 2UW8A 2WTKC 3DKCA 2XEYA 4IACA 4XBRA 3VBXA 4D2VA 4O2PA 3LMHA 4IX4A 1U59A 4NL0A 4DGLC 2GFSA 4W8EA 2B4SB 4CV8A 1H28A 4EH8A 2W1CA 1Q61A 1WBVA 2CCHA 3R7GA 1FOTA 4CT2A 1URCA 4PQNA 2J9MA 2YDJA 2YAAA 3NCGA 4FEUA 3KCKA 3SGCA 3R30A 3S0OA 3ORMA 4FX3A 5EHOA 4BTKA 5KNJA 1KWPA 2AC5A 4LFIA 4RIWA 4QOXA 3LXPA 4O7ZA 3N9XA 5HX6A 4ERKA 5DRBA 4WNPA 2VTHA 5EDPA 2BZKB 3UG2A 4RG0A 3ZEPA 3EYGA 3KULA 2R4BA 5IDNA 3C0IA 3P7BA 4AN3A 1Y6BA 4DHFA 4YU2A 3VRYA 3HL7A 3EQFA 3VJNA 2UW5A 4JX7A 2O65A 5F20A 4FKVA 4OTGA 2C5YA 3O8UA 4BFMA 3KN6A 3D5WA 3SHEA 3MVJA 3HLLA 3PRFA 2BHEA 3FE3A 5DA3A 3TZ8A 3FY2A 4CCUA 5K4IA 5M08A 5A3XA 4F9CA 3V8SA 4BKYA 3R21A 2WOUA 3Q4CA 4I4FA 5FTQA 4M12A 4P5QA 3EFWA 2OICA 1U54A 3LM0A 3OBJA 4BCPA 3KFAA 3LFQA 4KAOA 4AW5A 1KE8A 1WBNA 1Z9XA 2JDTA 3PA4A 1JVPP 5CAPA 1YI4A 2J0IA 2VTIA 5M4UA 1PMNA 2UW9A 4ZLYA 3CTHA 4D55A 4BCIA 4GT5A 4EK8A 3BLRA 5A9UA 4X2NA 3LXNA 1YI6A 3OHTA 2JFMA 3ZRLA 4FZ7A 2BIYA 4O0YA 4EH7A 3GCUA 2QOBA 3GFWA 5EYMA 2ACXA 2QOOA 3Q2MA 3GT8A 4FGBA 4G3FA 4OUCA 4DLIA 2XIXA 2CJMA 3DBFA 4J7BA 3PY1A 1OKZA 4RWIA 4DEIA 3FMNA 3QRUA 1Y57A 4QP9A 2P3GX 2XA4A 1PYXA 2OW3A 3CKWA 2C30A 3C7QA 3BIZA 2WHBA 4NJ3A 5CU3A 5EW3A 5HO6A 4IEBA 3L9MA 5IH5A 4J52A 2Z8CA 4ZOGA 4MXYA 2RFNA 3TI1A 4DH1A 1ZXEA 4EHVA 4RX8A 3SC1A 3BE9A 4GRBA 3UYTA 2C68A 4V05A 2F7ZE 5IZFA 3AC2A 3IS5A 4DTKA 1H8FA 3MTLA 3OS3A 3QCSA 4MCVA 4GL9A 4MEDA 4RJ7A 2YEXA 5LVPA 4HGSA 3FZSA 5A4EA 5BX0A 3DQXA 5J5TA 3GQLA 2GQGA 3Q32A 1O6YA 4FBXA 4CLJA 3CEKA 5D1JA 3K5VA 5TE0A 4NCTC 3FMHA 5HO8A 3CQEA 5HE3A 3AC3A 4EORA 4O96A 4MWHA 3JVRA 1CSNA 4QP2A 5B2LA 4QMLA 3W1FA 2ZV8A 4AW0A 4DE4A 2W99B 3UNZA 1UWJA 3UQCA 4UXLA 3OWKA 3DBCA 3UC3A 1IRKA 3KMUA 1ZZ2A 5HG9A 1Y91A 4WNKA 2VWZA 4PNKA 2WAJA 1OL1A 4FF8A 3GVUA 3AC1A 5FXSA 4D0XA 5LMKC 4ANSA 3P7AA 4ZMEA 2KULA 3K2LA 3UMWA 5M44A 1WVYA 3R73A 3CY3A 2OXXA 4OR5A 2R3QA 3ZDUA 4B99A 2W96B 4AOIA 5BVDA 2E9PA 2PVLA 4IM0A 2QHMA 1OPJA 2J0MB 2X7FA 4NTTA 5AA8A 5HTBA 5L4QA 2CKQA 1QL6A 5FM3A 4EWHA 4YP8A 3F2RA 3E64A 5HD7A 4CKIA 3CKXA 5FLFA 3T9TA 4DC2A 5EQEA 4ANQA 5FBNC 2XNGA 2XMYA 4L52A 4RJ8A 2X81A 1OL5A 4DF3A 4FEVA 4O0WA 4PWNA 2VO7A 4QMOA 4QP6A 2YIXA 3JUHA 1Z5MA 4FZAB 3ENHA 3I60A 3TNWA 3DFCB 3A2CA 3SW4A 3TNIA 1R0EA 2YFXA 4ALWA 2BPMA 4PV0A 2VTRA 3DJ7A 3F5PA 5DBXA 4IADA 3WF6A 3BGPA 5J5SA 2YZLA 4D1ZA 5E8ZA 2IVTA 4KD1A 2F57A 3JXWA 1PXNA 4O7TA 4M13A 4W4WA 2VU3A 5E8TA 3SA0A 5C01A 4MXAA 2B7AA 2ZV7A 4DH3A 2R3MA 4NK9A 4BDCA 4YHFA 4PP7A 3LFCA 4O21A 4OBPA 3F7WA 3R7UA 4WO5A 3W2QA 3GOKA 3QCQA 4YTHA 5DOSA 1DM2A 4HYUA 4Q5HA 5CZHA 3C4WA 3GC0A 4LOPA 2VO6A 4AT4A 4IAAA 4PTGA 4F0IA 2J0KA 3RWQA 4E93A 5IMEA 2B9IA 2X2LA 2HXLA 4P2KA 3HV7A 5DT0A 3LFBA 3VQHA 1IAJA 3R8LA 2ZM3A 2BUJA 4L43A 1LUFA 1YWVA 2XNNA 4MXOA 3ZSHA 3LMIA 3G6GA 4D5KA 3TJCA 4V0GA 3QQUA 5AR8A 4F64A 4TRLA 1SVHA 4YZMA 2EXMA 1Z57A 2WMXA 3A60A 4NJDA 1J1CA 3RK5A 2WKMA 3HYHA 1J7LA 4K8AA 1ZY4A 4HVGA 1G3NA 3NEWA 3ODYX 4I41A 4F9YA 4Z16A 5GINE 4PL5A 4AGWA 1J7UA 1W83A 3MI9A 4G3GA 3HV6A 4RIWB 2OXYA 1ZYCA 2XKEA 3SQQA 4HNIA 5CYIA 2ETKA 2FSMX 2R7BA 3RK9A 1YHSA 5DT4A 3ZH8A 2JGZA 4D2SA 5KCVA 5IQEA 1UU9A 2W1GA 4GK2A 3DAEA 4X7QA 3CC6A 4WBOA 5DYJA 4MD7E 2ITOA 4DFXE 4FV9A 5ANOA 1J3HA 3D94A 5E8VA 1B6CB 5IQCA 4O91A 5HU3A 2IN6A 2J90A 2VGPA 3CD8A 1PJKA 5CSPA 5EKNA 4NZWB 2X1NA 2ITWA 5CEIA 3BQCA 5IA4A 2HCKA 3WYXA 5FD2A 2OIQA 1ZLTA 4JOAA 5CF5A 3UVQA 5ACBC 3SDJA 1P4FA 3QWJA 1V0BA 1ATPE 3HAVA 4MQ2A 5AIRA 3QFVA 2W1FA 3U9NA 5AP1A 2C6LA 4QTCA 3JPVA 3O2MA 4G5PA 2HZIA 4I92A 2OSCA 3HMMA 4DH5A 2QKRA 4GMYA 4CZYB 3N4TA 5IMXA 5K9IA 4HZRA 2W05A 1XBBA 3COIA 2RL5A 2W5BA 2Z7LA 2PTKA 1OKYA 2GNIA 3WIGA 3GXLA 3LJ2A 3Q3BA 4WOVA 4BHNA 2YCRA 4EHZA 3VBQA 4F09A 3NX8A 5EFQA 4GIHA 2Q83A 4GJ3A 1VEBA 2WQMA 3E87A 4UWCA 5L3AA 1Q3WA 3NW6A 4JIAA 1ZOHA 4HJOA 3BI6A 3IOKA 4EQUA 5CQUA 3V5QA 2XVDA 4EBWA 4HZSA 3ITZA 4R7IA 3R7YA 4O82A 2NO3A 2WU7A 3DAKA 2QHNA 3ZBXA 3MYGA 4F0FA 3R6XA 5KZIA 3UVRA 3I6UA 4LOOA 4IE9A 3GP0A 4II5A 4YHTA 1URWA 4RWKA 3LFSA 3ORKA 5C4LA 3QUDA 3FLQA 2OIBA 3CTQA 1W0XC 3DA6A 3F82A 4KSQA 3W2PA 1GIHA 3BHVA 4WSQA 3FI8A 2V62A 4I23A 3EZRA 4WRSA 2RG6A 1J1BA 2XRUA 4JI9A 1YWNA 2JBOA 3MH2A 3O96A 1REKA 3F3TA 1FVVA 4TYHA 3WZUA 5J1VA 3ZOSA 3QD3A 3QTXA 5AR7A 5DHJA 4KRDA 3OC1A 5CX9A 3A99A 1STCE 4I22A 2XNOA 3AC5A 3R0TA 4M7IA 4U3ZA 3NUAA 1W82A 3QTQA 4U5JA 4A9TA 2BAJA 3D15A 3PDTA 3T8OA 4ZTRA 5A6NA 4AX8A 3R2YA 4ANLA 4X21A 5CI7A 1FQ1B 3BU5A 2Y8OA 3MB6A 1OI9A 1YHVA 4RVMA 2UVXA 4HVIA 1PXLA 3W32A 1CMKE 2ZMDA 3FEGA 2OLCA 3IONA 3R7OA 1QCFA 2I40A 2QOIA 3EQPA 2R3GA 5K3YA 5HTCA 2G1TA 1FBNA 3UZRA 2NPQA 4FTRA 4PNIA 4IH8A 4DN5A 3O0GA 2G9XA 3BWJA 2WMUA 4YBKA 4FTTA 2IG7A 5CU0A 4FKGA 4XP0A 3PVGA 4EH3A 2PE2A 4XG6A 1YXXA 2W0JA 3IDBA 4LOQA 3G33A 3LOKA 3MDYA 1M2QA 3EWHA 2VV9A 3R01A 4G6LA 2YIRA 3U55A 4NM3A 2OH4A 2DQ7X 1XKKA 3RP9A 4DBXA 4I6QA 4XCUA 4YJRA 3ZLSA 4FV0A 2XNEA 4FV1A 4GG5A 4O0UA 3KRRA 4QMYA 4ANNA 4RVKA 3ZONA 2W9ZB 4AAAA 4YO4A 3E5AA 3DT1A 5AX3A 3NUNA 5CAUA 1L3RE 5CAVA 5FDPA 3PY0A 4FSNA 4IXPA 3N4VA 4D5HA 1NVRA 5IA0A 2PE0A 5HNBA 5EQPA 3HA6A 4OT6A 3R8MA 1OB3A 4GUEA 2ONLA 3ZO3A 4TYIA 4JDJA 3W2OA 4L3JA 3FLZA 3FMKA 3IK3A 3WBLA 4Q2AA 2UW4A 3P86A 4KABA 5FM2A 3RNIA 3ORLA 4DFBA 2W7XA 1P4OA 3OUKA 3VS7A 2CMWA 5M4CA 2VWIA 4WHZA 4ZY4A 4LYNA 4UZHA 4W9XA 4I1ZA 3KVWA 2YIQA 4ZJVA 3QA8A 4TWPA 5LMAA 1WZYA 5B0XA 3V04A 3ELJA 2XBAA 3HZTA 3PXFA 5EM8A 3ZBFA 2O2UA 2UZOA 5CU6A 4AQCA 2XB7A 2A4LA 3MPAA 4LMNA 4EL9A 3EJ1A 1PW2A 2RFSA 2W1HA 2ERKA 3A8XA 1KOBA 4W4YA 5T3QA 3WF7A 3Q4ZA 1NXKA 4OGRA 4DEAA 4FV8A 3ANRA 4EKKA 4CG9A 5HCZA 3R1QA 3LCKA 4O7NA 4XHKB 4R6VA 5FBOA 3W33A 2C3LA 4ZLZA 5M4IA 5JEBA 4QMXA 4B8LA 4XLIA 1BKXA 3T9IA 2YJRA 4G1WA 1OKVA 3EMGA 4FV5A 2IZRA 2OFVA 4CQGA 4FTAA 4IZ5A 4MD9E 4MTAA 4DEEA 2CNUA 3ODZX 4ZTQA 3C1XA 2LAVA 3MPTA 4L7FA 3M11A 4FTOA 1GAGA 4I4EA 2CNVA 3ZZWA 4JDIA 2FSOX 2WTWA 4EWQA 5FTOA 2GSFA 3QQFA 4MNEB 2XCHA 4USDA 4LGGA 4RT7A 3UMXA 3PXQA 3UODA 2QC6A 2PVNA 3EKKA 3PLSA 4L6QA 5HBEA 4EQMA 2ESMA 4K6ZA 5BVWA 1WBPA 4UMRA 1MQ4A 4NIFB 3DB8A 5JK3A 3KA0A 4BZOA 4I24A 2H8HA 4AOTA 3IW7A 2FGIA 3A7GA 3QWKA 2XK6A 2P0CA 1M14A 3KF4A 3LPBA 4ZSAA 2EU9A 5AADA 1P5EA 1YKRA 3F66A 2PL0A 5KBQA 2R3OA 4FKQA 2C0OA 4YNOA 3G6HA 5I9WA 2JKKA 2VTAA 4C35A 3LKMA 3Q53A 5JQ5A 3BGQA 2OO8X 4MF1A 3G9NA 4YJUA 4BICA 3O8TA 2C3IB 3DU8A 4I20A 4RJ5A 3KN5A 3BU3A 5A14A 4GYIA 4FT0A 4U40A 4DEDA 2XNMA 1E1XA 3OWJA 3UTOA 3VULA 3BKBA 2OIDA 1IG1A 3MFTA 5LWNA 4N57A 3GQIA 3MIAA 2B9HA 4F7SA 3UJGA 2GCDA 1XHAA 5GZ9A 4ACGA 4QP4A 5JT2A 2YIYA 2R3LA 5IQFA 4FT7A 4TYJA 5ANGA 3ZM9A 2QLUA 4FEXA 4L46A 2IW6A 3ALOA 4QMZA 2HIWA 5F94A 4QP7A 3BHYA 4U41A 4L42A 4R8QA 4Z9LA 2E9NA 3G0EA 3VUHA 3KRXA 4G31A 3VW6A 3CGOA 1BI7A 1T46A 4BDHA 3BV3A 1UU8A 2RIOA 5AUUA 1PMEA 4PY1A 4ZLOA 4IJ9A 4ANBA 3TV4A 5AV4A 4W8DA 4X0MA 3SOAA 3C13A 3DK6A 3DBEA 2OF4A 4CEGA 3UE4A 2WQOA 2YCFA 3M1SA 4FUYA 1KV2A 1O9UA 3FYKX 4L67A 4YJQA 4F6SA 5IA2A 4BWKA 4MWIA 1XH9A 4QQTA 3A61A 4C8BA 2HW6A 3O7LD 4ZTLA 4KBKA 3Q52A 3P4KA 1JQHA 5CSXA 5AEPA 5EI8A 2ETRA 3ZYAA 1BX6A 5DIAA 2H6DA 4CD0A 3KRWA 2VWUA 2C5OA 4JRNA 3WIKA 4ACHA 4C34A 3W2CA 3R7VA 4EOJA 1VYWA 2GHMA 2XUUA 4G9RA 4XOZA 3QQHA 4U7ZA 4WUNA 3F3UA 2VNWA 3U51A 1GOLA 2WXVA 4IIRA 3V5WA 3P0MA 4EKLA 5BUEA 3KU2A 4FZDB 1IA9A 3M42A 5HE1A 3ZFXA 2XK7A 4JQ8A 4Y85A 4CMTA 3KREA 4AE6A 4C4FA 4X2JA 1Q8WA 1FGIA 3TXOA 4UYAA 1EH4A 5DI1A 2GTNA 3MIYA 3V8TA 5JMSA 4JR3A 3BHUA 4JRVA 3PSCA 4MXZA 4E7WA 1WVWA 3AT4A 4MVFA 5AR4A 4TNBA 4YLLA 1WCCA 5CAQA 1XQZA 3R1SA 4QMTA 3DKGA 2UZEA 3LIJA 3I6WA 3MWUA 4B6LA 3RCJA 4U81A 3VN9A 5CQWA 1XH4A 4ACMA 2QQ7A 4G3CA 1JKSA 3TV6A 3UQFA 2XJ0A 3PJ8A 1JSVA 4S32A 1NY3A 5FP5A 4IAFA 3FZ1A 3NVMB 1KSWA 2C69A 5E8YA 3KXZA 1FGKA 3CS9A 1JOWB 1E1VA 2X8EA 4TWNA 2FO0A 4WG4A 4EH5A 3Q9YA 5K5NA 4YNEA 5HCXA 4QMQA 4RIXA 4IAZA 4M0ZA 2FA2A 3AT3A 3FSKA 1KE5A 2Q0BA 4B7TA 4GFMA 4DEBA 3ZRMA 4XG4A 2PVMA 3MY0A 4LV8A 4E6DA 4QTDA 4E5AX 3FYJX 3MA3A 3QLFA 3QXPA 4FICA 4ACCA 3O51A 4RC3A 3KVXA 5ETIA 2VNYA 5BNJA 4FKWA 4BC6A 3CE3A 4YTFA 5I4NA 1XH7A 4FV2A 5FG8A 4ZK5A 3LLAA 1PXOA 4D58A 1HOWA 2X39A 4CV9A 3RPRA 2F7XE 3R28A 3CXWA 4WSYA 2YIWA 3VBYA 3RMFA 4YZDA 1H1RA 3F3WA 4RWLA 4E4XA 4PUZA 5K5XA 3OY3A 5CT0A 4ZSJA 3RAIA 4CSVA 1OITA 3A7IA 4FTUA 4P90A 2WELA 3EQCA 4TT7A 5D7AA 4M3QA 1LP4A 2R7IA 3DTWA 3H9FA 4DBNA 3DNDA 4FG7A 3BZ3A 3FZOA 2BMCA 5TKDA 5AAGA 3I7CA 4XNEA 5HE2A 4F99A 2XKDA 4MKCA 3RVGA 4OTDA 5CEKA 5BYLA 3D7TB 3TN8A 4FGRA 5KMKA 2YZAA 4HVDA 2W1ZA 4YJOA 3WF9A 2ITYA 5FXQA 2CLQA 3GC8A 3HDNA 2J6MA 3AGLA 3BYSA 4CFMA 5HNGA 1IEPA 4F9AA 2A2AA 4XOYA 3U9CA 2UW6A 3RINA 4WD5A 3GCVA 4EBVA 4J1RA 5LQFA 3S1HA 2R3IA 1MQBA 4X3JA 3EFKA 4PDSA 4DGOA 2A19B 1YXUA 3HV4A 5BMMA 1KE9A 4CCBA 3GU4A 4UBAA 3C5IA 3A62A 3NYXA 5BVFA 3FLWA 4KIOA 2FH9A 2ITVA 4KIQA 4QNYA 2R5TA 4E5WA 2IZTA 5KMJA 1RJBA 4HOKA 2YAKA 4X6QC 3MY5A 3PLAE 2C5VA 3ZCLA 3QQGA 5D7VA 2VZ6A 4ZEGA 5IEYA 2IVSA 4JBVA 3NAXA 5AR3A 4O7YA 4EI4A 4QT1A 3LW0A 3F69A 4IZAA 4JBOA 4BYIA 4Y8DA 3QHWA 1ZY5A 4AXAA 1GZKA 2QONA 2VTTA 4XJ0A 3KRLA 1G8SA 2ZOQA 3HAMA 3EN7A 2EVAA 3C4ZA 2RFEA 3DBDA 3LCSA 4WUAA 4Z55A 1FPUA 3VS3A 4AGCA 5J9LA 1P2AA 2VUWA 3ZUVA 4FEWA 2BILB 2WIPA 5HGIA 3VUIA 4GYGA 3PVBA 4RBLA 2PU8A 3ULZA 4RC4A 3W18A 4EH4A 1UNLA 5KMNA 2C4GA 1OM1A 4APCA 4BKZA 2X7GA 2HZNA 4F7LA 4O1OA 2WO6A 4D4VA 3K3IA 4L3LA 4FKRA 5GNKA 3LFEA 4XX9A 4CQEA 5C27A 3QF9A 3GBZA 5L2TA 4I5MA 5FRIA 3E8NA 4DEHA 3QCYA 5AUXA 3EOCA 2X7OA 2Z2WA 5I9XA 5L6PA 2QVSE 4M68A 2BZJA 4XS2A 5JGDA 2QO7A 4K11A 3E93A 3JYAA 4GVAA 2J0LA 4IVCA 4O22A 3VS2A 5I9YA 2YM8A 1Q4LA 3LAUA 4QD6A 3ZMMA 3HEGA 1FVTA 5JGAA 1OPKA 1YW2A 3HRBA 4M69B 4MD8E 4R5YA 3IG7A 4FC0A 3QZHA 4V01A 5EOLA 4BDFA 4BBFA 3C4FA 4F08A 3TUBA 2BHHA 1H01A 5LXMA 5F95A 4DTBA 2O3PA 4XBUA 2YCSA 5A4LA 2UZLA 4G34A 5EW8A
chains in the Genus database with same CATH superfamily
2BFYA 4QRCA 4CKJA 3LLTA 4YJNA 4ACDA 4YTCA 3MY1A 4O7SA 4O7VA 4R77A 4QQ5A 3GENA 3QQJA 2I0HA 3LM5A 3E63A 2PUIA 2XIZA 2VX3A 4RX5A 1H00A 3D2KA 5GHVA 4EUTA 3W0MA 2BALA 3QTUA 5HD4A 2GS2A 4FKPA 3HMNA 4YZNA 2X9FA 5A54A 5CXZA 3DKFA 1FINA 4UXQA 4UV0A 1TVOA 1ZWSA 3FAAA 4XV2A 4CZUA 4FTIA 4GKIA 4FK3A 3EKNA 4AFJA 2Z7SA 3ALNA 4FV7A 1OUYA 3Q9ZA 4LRJA 5I0BA 2HZ4A 3PZHA 4IX5A 4QO9A 4A07A 3KXMA 1Q5KA 3OP5A 4OTFA 1UKIA 5DLSA 1YOMA 5M57A 2ITUA 3FZRA 1AGWA 1Q8TA 4NCTA 4IVDA 3DXNA 2DS1A 2GFCA 2OJ9A 4RJ3A 3ETAA 3R63A 2A0CX 2GPHA 1PKGA 2YISA 3PE1A 4FIHA 2BKKA 4YPDA 3QYZA 4G6OA 5DR6A 5ICPA 4FSWA 3KEXA 4BYJA 3NIZA 4AP7A 5ETFA 1OIUA 4Y83A 4HCVA 5B2KA 5HHWA 4IVBA 4DH8A 2GDOA 1ST0A 1SNXA 4FTQA 4MBIA 3C0GA 1QPCA 5E8XA 1Q8ZA 2GNHA 4BCOA 3P5JC 4D2PA 3I81A 5AUZA 4J53A 3ROCA 5CEPA 3NLBA 3B2WA 4FSZA 4U0IA 3RAHA 2BTSA 3ZXTA 2O8YA 4EOQA 5I3RA 3HMPA 3F61A 3MFSA 3FL4A 3L8XA 3OROA 3CPBA 3MH1A 3PRIA 3O8PA 2JDOA 4KKHA 4D2TA 1VYZA 4ALUA 4XV9A 2H34A 3K5UA 2YACA 5DH3A 1A9UA 4A9SA 4XRLA 3NR9A 4I6HA 5HIBA 4IX3A 4B0GA 4E4NA 4O4DA 4YC8A 3F5XA 3G51A 3Q04A 3DZOA 3DJ6A 4GS6A 3VIDA 4FIFA 5L2SA 3COKA 4K2RA 2UZVA 3PG1A 3UO6A 4OW8A 4QP3A 3TM0A 3NVKI 3KRJA 4D1SA 5CEOA 1M52A 4C58A 4FL3A 4GVJA 5EK7A 4QMNA 4E20A 2CPKE 4XEYA 4ALVA 1F5QA 2JLDA 2UZWE 4J8NA 4D2RA 3F9NA 3PWYA 4OTQA 4G17A 4RPVA 1F3MC 2ZFYA 3FWQA 3D83A 3ORZA 3FQEA 4XH6A 3TZ7A 4GU9A 3GU5A 3LE6A 4BDKA 4BTFA 3UC4A 3QKLA 4E4MA 3RK7A 3QRKA 3LHJA 3SRVA 3BL7A 2GS7A 2ITXA 5HX8A 1BL6A 2UW3A 5KMMA 2WPAA 2REIA 3P23A 2PE1A 3EL8A 2XANA 4FKSA 2VWYA 4HYSA 4PL3A 4RC2A 2CKPA 5KHXA 3DY7A 4PDYA 1KUTA 1RW8A 3NUXA 4GW8A 4H1JA 1OVEA 5HIEA 5L2IA 5C9CA 3CJFA 4J8MA 2RSVA 4QQJA 1MP8A 1JSTA 4JG8A 4USFA 4UWBA 2J51A 1LEZA 4KSPA 3F7ZA 3PSDA 2QU5A 3NSZA 3OT8A 2WTKB 2YM7A 4RLKA 5DNRA 3MJ2A 4O6EA 2LGCA 3BYOA 3PXRA 4BZNA 3MB7A 4U42A 3WE8A 2WMBA 3P5KA 4FRFA 5EHYA 5G6VA 4FA2A 5HU9A 2ITZA 3IECA 3MVLA 4LGDA 4TY1A 4OAUC 5E1EA 5IQIA 3OOMA 3KULB 1TQIA 4GSBA 5GJFA 5LVNA 3QAME 2Y7JA 4ZAUA 3LFDA 4FKTA 3TWJA 3VS1A 4FTMA 2E9VA 3FSFA 2VWXA 3QTSA 2WMRA 1T45A 1KOAA 5IISA 4B8MA 3DXQA 3CD3A 3JY9A 4E6CA 1YRPA 3IPHA 4U97A 2QO2A 2ZB0A 1H07A 3HMOA 3NNVA 1BLXA 2YM6A 3RALA 3UOHA 5L6OA 4I5HA 3ZUUA 1U54B 1ZZLA 4EYMA 2OZOA 3AD5A 3K3JA 2WMQA 3U4WA 3CTJA 4BCKA 1DI8A 4HCUA 4FOBA 4C4GA 4E4LA 3CIKA 5C1QB 2F7EE 3S2PA 3UPZA 5E4HA 2ZYBA 3NYOA 3R22A 3E7OA 4RJ4A 4AU8A 5ITAA 1R78A 2F2CB 3LQ5A 3MW1A 3QXOA 1XH8A 1UV5A 3EIDA 2JKQA 4M84A 2RGPA 3D9VA 3L8VA 3DZQA 3ORPA 4HGLA 4K1BA 2E2BA 4YO6A 3EQBA 5JFSA 5DR9A 1NT2A 3U6IA 4EJ7A 4YTIA 2I1MA 2PMOX 3FMDA 4BCNA 4U8ZA 4LI5A 2VWVA 3UP2A 2A1AB 3DB6A 5EYDA 3FPQA 4M97A 5H9BA 2RKUA 4IAIA 2O5KA 1PXPA 3RZBA 3KXXA 3OVVA 4C4JA 5TT7A 3C0HA 3E88A 1OL2A 3PG3A 4U9AA 1L8TA 4C4HA 4A4XA 2P33A 3DXPA 1V0PA 4M8TA 4M0YA 3TG1A 3ATSA 3VS4A 1OKWA 3OCGA 4EUUA 5IF1A 2XBJA 5AAEA 3PUFC 4PX6A 4N6YA 4FMQA 5EH0A 5GZ8A 4DHZA 3NWWA 4OTHA 3BRBA 3F6XA 3UZPA 4ZIMA 4C4EA 5IQAA 3ZDIA 4AS0A 4E73A 1UNGA 3V51A 2BZIB 3GC7A 3P08A 3PUPA 4PP9A 4YPSA 5F1ZA 4BI1A 5F4NA 2PYWA 3L8SA 2WB8A 4MBLA 3VS6A 3ZRKA 1XMLA 5E8SA 1BL7A 4UMUA 3TDWA 1OZ1A 1U46A 4Q5EA 4EK4A 3ZSGA 1GZNA 3QQKA 5M07A 3MTFA 3FMLA 4BDBA 5IEVA 5AV0A 3BYVA 1OUKA 2C1AA 4JG7A 2JD5A 5HOAA 1AD5A 3RAKA 3QTZA 4MYGA 2G2FA 1P14A 1YDRE 4OTWA 3V5PA 4UMPA 1OBDA 4K77A 5HBJA 3L9PA 4IX6A 4N6ZA 2DUVA 3CQUA 3E8EA 3NNWA 4FYOA 3P79A 1XBAA 2PUUA 3VNTA 2BTRA 3MS9A 4WA9A 4UZDA 5AR2A 3R9RA 3T3VA 3GU7A 3VS5A 3OMVA 3E3PA 3AC8A 3HV3A 1W8CA 5D41A 4N4SA 5CT7A 2B1PA 2WEVA 3QZGA 1U5QA 2XJ2A 3NUUA 5HTIA 2XK8A 3D0EA 2IZSA 4FTKA 4IWOA 2B9FA 3ZHPC 4IB3A 5IH4A 4O6LA 1PYEA 4RFZA 3V5LA 5J9YA 5AFVA 2CN5A 1H25A 2VTQA 4CNHA 5J9ZA 2PVHA 3U87A 4Y5QA 3WF8A 4AT5A 3AKJA 4A4OA 4YZCA 1GNGA 4KA3A 4AW2A 4I6BA 1PXJA 4U80A 3FLYA 1WVXA 2ZB1A 4PMMA 4O86A 3VONA 3UDSA 3F3VA 3UNKA 3TL8A 3DBQA 4A4LA 5L6WL 5AP5A 3PXKA 3V3VA 5DEYA 3QCXA 3KK8A 4S31A 3RM6A 4ANMA 2F9GA 2WMWA 2X8DA 3D2IA 2QNJA 4NKAA 1UU3A 4RA5A 4ZSGA 5C8KA 3NCZA 4FKJA 4O0VA 4W4VA 4ZY5A 4CFFA 1F0QA 1YDSE 5EG3A 1VLRA 4Q9ZA 4G9CA 3BBWA 3NYVA 3PFQA 2CCIA 5IG1A 3SRVB 3RBWA 4X2FA 3B8QA 4E1ZA 2GHGA 3LCDA 1SMHA 4BWPA 2HY81 2G2HA 4U44A 2UW7A 1I09A 2F49A 5J95A 2BRHA 1YHWA 2NRUA 3VRZA 3ANQA 3EQHA 2I0YA 3HA8A 1UA2A 2F4JA 4EEVA 2NNWB 4BWXA 4V0GB 3QHRA 4DG2E 2YWPA 4YLJA 5BVKA 2PZPA 3RTPA 3OCTA 2WMAA 3T3UA 3OXZA 5FEDA 2X4ZA 3TIZA 3Q2JA 5AP2A 3TUCA 2HWOA 3D4QA 3R9OA 2E9UA 5FP6A 3VS0A 4JIKA 5KMLA 3RJCA 4R78A 2X2KA 4QP8A 5LARA 4DG0E 3O5AA 3NUPA 3OUNB 4ZZMA 3QUEA 2C3KA 3FC1X 4I94A 4LUEA 3W8QA 4DHIB 1Y8GA 5DT3A 4DDIA 2B52A 2OKRA 2OGVA 3DNEA 4JQ7A 4K0YA 3Q60A 5EI2A 4AFEA 1LPUA 2VTNA 2WQNA 2ZDTA 3UGCA 4BZDA 1OMWA 2HYYA 1VJYA 4BDGA 5JQ8A 2PPQA 4WG3A 1MRYA 4MXCA 4KINA 5KO1A 3PJ3A 4O81A 3V5JA 1E9HA 4AOJA 4ERWA 2J5FA 2B55A 3NRMA 4XG8A 3TKUA 2ERZE 2R9SA 2G15A 2VWBA 4ITJA 1REJA 3U6HA 2VTOA 3NNUA 5L8KA 3OF0A 5CEQA 4IAKA 4JAJA 4C3FA 5LCKA 3FXZA 4U3YA 4QTAA 3PJCA 3L1SA 2EB3A 4J95A 5HVJA 4O4FA 4HGEA 4LM5A 4D2WA 3ET7A 4JLCA 1HCLA 5EYCA 1M7NA 3FQSA 3BLHA 1IR3A 3EFLA 5HKMA 5GJDA 2XH5A 3ZFMA 1NVQA 4AXFA 5M56A 1CTPE 4GT4A 1VZOA 3ORTA 5CWZA 3AGMA 3W2SA 4HVSA 3QA0A 1R3CA 4UB7A 1HCKA 5CF8A 4AW1A 3IDPA 3QRJA 3NGAA 4AE9A 4JMQA 4R5SA 4IWDA 4BBEA 4FT3A 4F1MA 1H27A 2CKEA 4JG6A 4BY9E 4C38A 2XK4A 4RWJA 3S4QA 4ASXA 3LFAA 4KBAA 3RPOA 3OWLA 4NEUA 2VRXA 4RIYA 5H8BA 2VO0A 1AQ1A 3WZKA 3JR1A 2Y4IB 4IDTA 4GJ2A 1KV1A 5B2MA 5IDPA 3UOLA 2ITPA 4MHAA 2OG8A 5H2UA 1M17A 1PXIA 4FNYA 3LXLA 1KE7A 4GK4A 5E8WA 4EONA 2OJJA 2WTCA 2I6LA 2UZDA 3EZVA 4DFLA 3PVUA 5EW9A 4ZTMA 4DGMA 4BN1A 2CKOA 5AV2A 2QO9A 4J97A 2V7OA 3L9LA 2VX1A 4KIKA 4RVLA 3RWPA 3ZSIA 4ASDA 5AUTA 3PZEA 2YLFA 4JDHA 3P1AA 2AUHA 4Y73A 5ANDA 4ITHA 2PUNA 3VUDA 2C6IA 3H9OA 5AUYA 3CSVA 2QOQA 4U6RA 2V0DA 3SW7A 5A4QA 4BDEA 2WNTA 4KRCA 4AN9A 5I9ZA 1PMUA 4FT5A 1PXMA 2YITA 4HCTA 3ZZEA 1H4LA 2X6DA 4TYHB 4X2KA 3ZC5A 4IFGA 4G6NA 4F6WA 5A4TA 2PZYA 4F63A 3ZU7A 1Q99A 3D5XA 4JNWA 3GCPA 3RPYA 3TZ9A 3C4EA 1XO2B 3FQHA 4MH7A 4OBQA 5KKRB 1V1KA 5H3QA 5CLPA 4NW6A 4EOKA 3O50A 5ETCA 3Q4UA 4DINA 3EYHA 5F9EA 5FWKK 2JDSA 4O0SA 4KBCA 3U4UA 4CFVA 4AZVA 5CSWA 5J87A 3UPXA 3PPKA 1SZMA 1U5RA 5EM5A 2GTMA 4O7LA 3UDBA 4P7EA 2JKOA 5IQDA 4YLKA 4WNMA 4NYEA 4FNWA 5JRQA 5C03A 5LCJA 2YDKA 3DV3A 4FSQA 3WARA 3H0ZA 1V0OA 2ZV9A 3EFJA 4FZ6A 2QCSA 4AF3A 2HK5A 2QR7A 3I5NA 5HLPA 2BRBA 2ETMA 3QRIA 2J7TA 3FXWA 4QMUA 4TYGA 5FDXA 1Q97A 2PZ5A 4ZTHA 2WQBA 2GNJA 3HECA 3JS2A 3NUSA 4C61A 4L45A 2V55A 4JX3A 3VBWA 2AEGA 4E26A 4YR8A 3GB2A 4RA4A 5JZNA 4RQKA 2XM9A 2PULA 4UX9A 2ZJWA 4F9BA 3O71A 2X9EA 3EQIA 5LVOA 4C62A 1ND4A 3OTVA 2DWBA 5J7BA 4QDEA 4QYYA 2WEIA 3MSSA 2C5XA 5BMSA 2R3FA 5G1XA 3THBA 1JNKA 5BUIA 3LQ3A 4P5ZA 1M2PA 4LL5A 3C4CA 2JIUA 2OBJA 3QX2A 4AN2A 4BDAA 4J98A 2HZ0A 2UZTA 3BYUA 4BCMA 4BIBA 4BI0A 4QNAA 4R3RA 4EQCA 3MA6A 3PSBA 5GZAA 4H3PA 2BDJA 3C4XA 2YERA 3QC9A 4RQVA 2PMIA 4EH9A 5DN3A 2J5EA 3U54A 3DDPA 3G5DA 4BIEA 3UIMA 3IQ7A 2J2IB 2HAKA 2OI4X 3DJ5A 1IA8A 1ZARA 4IB1A 4J71A 1BYGA 1YVJA 4FL2A 3PJ2A 4JBPA 3BQRA 4ZTSA 3UO4A 4D28A 3MV5A 4EOLA 1ZYDA 5HORA 2GQSA 1UVRA 4IM3A 3TTIA 3EQRA 2YN8A 3W16A 4WT6A 3VW8A 2OU7A 1UU7A 4YBJA 4DEGA 2W9FB 1TQMA 3MVHA 5D9HA 4H1MA 5E91A 5AP4A 4O0RA 3UP7A 4DGGA 3REPA 4BHZA 4FTJA 1LR4A 5AIKA 3V6RA 5JN2A 4F78A 2XJ1A 3FJQE 1J91A 5I3OA 4TWOA 2VX0A 3CR0A 3MFUA 4IM2A 2C6TA 4DCAA 2R2PA 4KWPA 5AMNA 4PF4A 4B4LA 3QTRA 3TJDA 5M51A 3R1NA 5M09A 4OLIA 3ZO4A 4FSYA 2C3JA 2UVYA 2W1DA 1MUOA 3AG9A 3D14A 3HGKA 4TWCA 4WBBB 5ANIA 1H26A 1WBOA 3HNGA 4QMMA 4YUQA 4CFWA 1G8AA 2R3JA 3PTGA 1VR2A 5I9UA 2BDFA 3SG9A 2C6OA 5IU2A 3QTWA 2BAQA 2C6EA 4MQ1A 4Y72A 3ZS5A 4ZSLA 3ZXZA 2WTIA 4EK3A 5T68A 3BWFA 4CRLA 1NA7A 3F5GA 3GC9A 3JVSA 4FV3A 5KX8A 3IGGA 4NU1A 3LVPA 1B39A 5HNIX 1K3AA 2PZRA 3TKHA 3Q6WA 3KY2A 4ZS0A 3EB0A 3NDMA 3LZBA 2VTMA 2IJMA 2XNBA 1SNUA 3IGOA 4QQCA 5DG5A 3R00A 4CYJA 3BELA 2JC6A 4ZZNA 3KGAA 4CVAA 3UYSA 1JLUE 2CGUA 3VQUA 4AZWA 1PKDA 4TTHB 4EYJA 3ULIA 3EN4A 4FUXA 4JT3A 4ANOA 3QX4A 2C47A 4AZSA 2ITQA 5D11A 4PMPA 3QKKA 2OF2A 4FIGA 5EYKA 4CFUA 3Q96A 3FLSA 5CXHA 3SVVA 1UKHA 2AC3A 5AP6A 4O7WA 1FMOE 4I0RA 4FSTA 4BCFA 5HLWA 3MH3A 2GNLA 4X3FA 3BL9A 4LQMA 4GT3A 4KKEA 2JIVA 3PJ1A 4C57A 3VF9A 5K0XA 3WYYA 3UOKA 3PP0A 4LUDA 4IB5A 3F3ZA 4S34A 3R8VA 4M67A 4S30A 5E90A 3NZ0A 4YC3A 1PY5A 5GIOE 4F7NA 2JEDA 1QPDA 3O7LB 3LCOA 2YHVA 2BAKA 2HW7A 4FVPA 4O2ZA 4AWIA 4PRJA 5FEQA 1YQJA 2XKCA 4C02A 3IO7A 4I5CA 4IAYA 3OEZA 1YXSA 2I0EA 2WMVA 4O4BB 4D1XA 3O23A 5CI6A 3HDMA 5TOZA 3POOA 4DITA 5FXRA 3S3IA 4UWYA 4DG3E 4XUFA 5DRDA 5CEMA 1FMKA 4JVGA 3ZC6A 1WBSA 4IC8A 3C9WA 3DDQA 4BGQA 3EHAA 3FY0A 3ENMA 3R2BA 4UEUA 3OTUA 4C2WA 3R1YA 4KIKB 3MPMA 3R7IA 3BCEA 4HPUE 4QTEA 2UV2A 3WOWA 2WQEA 2G01A 1ZMWA 5JKGA 3FZTA 4QMSA 3VAPA 3ORIA 3ZLWA 4FTLA 2OXDA 2W5HA 3F88A 3LMGA 3MFRA 5IPJA 1OPLA 3CPCA 5CVGA 3FHIA 3HP2A 2PK9A 4FKOA 1ZMUA 1WAKA 5H8EA 3V6SA 4WG5A 3WE4A 1O6KA 3QTIA 2O63A 3H0YA 4J99A 5KZ0A 3W8LA 3FKNA 3I5ZA 1JWHA 2QOLA 5BYZA 3TMOA 4RVTA 3FUPA 2C0IA 2B54A 2V7AA 2FSLX 2NP8A 4AXCA 3PP1A 4ZY6A 4YSMA 5EM7A 4DAWA 2C1BA 4H36A 5HVYA 5HCYA 5BQ0A 1WBWA 4I0SA 4MX9A 4F65A 2WGJA 5HICA 4BB4A 4BDDA 5CASA 3QKMA 1G8JA 3OG7A 2QOHA 4EOSA 4FSRA 3SOCA 3W0QA 5EM6A 2O64A 3B2TA 2QG5A 4QMPA 4AT3A 4NKSA 5M06A 2PY3A 3QD4A 1H1WA 2VAGA 4ZSEA 4F0GA 4O83A 1XH5A 1Y8YA 5IQBA 1H0VA 2JDVA 4CFXA 2CDZA 3AMBA 3EL7A 1H1PA 4BL1A 3WZDA 3TDVA 3NFFB 1ZYLA 1ZMVA 2WZJA 2ZAZA 3G2FA 5LVLA 2EWAA 2ZV2A 4W4XA 1YWRA 3FPMA 4FNXA 4YJSA 4ASEA 1YOLA 4EC8A 2X8IA 3BV2A 3OCBA 1G5SA 4BTJA 1JSUA 3QU0A 2BVAA 3NYNA 2UVZA 4RFYA 1CDKA 4UALA 5CZIA 4ZXTA 4JBQA 4EH2A 4ZMFA 5CSVA 3R7EA 5LMBA 5HVKA 2XF0A 4AA5A 2WMTA 2Q0NA 5AUVA 2XIRA 4JL9A 2WOTA 1YI3A 3AT2A 2J50A 3BBTB 4UMQA 4DCEA 4C3PA 5E7RA 3ZO2A 5GJGA 1YXVA 4FOCA 4AGUA 3QUPA 3TEIA 4BBMA 3ORXA 5ACKA 3COHA 3P9JA 4RZVA 4DTAA 2QLQA 3OBGA 3SKCA 1IAHA 4BTMA 1WMKA 1ZYSA 2XS0A 3A4PA 3BGZA 4H3BA 4RIXB 3WZEA 2GU8A 5JRSA 4FKIA 3AXWA 5IA5A 2IWIA 3EQDA 4EHGA 1U4DA 4TZRA 2QR8A 4BCHA 3QD0A 2VWWA 3VC4A 3UNJA 2OK1A 1SVGA 2YABA 3E8CA 5DR2A 3NFGB 3WZJA 4ENYA 3UQGA 1XWSA 3S95A 4I6FA 3TNQB 2R3NA 4IHPA 5LMKA 4M15A 2VTJA 2UW0A 4FIEA 4NFMA 4H39A 3CJGA 3QQLA 2BROA 4EOMA 3TUDA 2EXCX 4QPAA 5LVMA 3A7HA 4BRXA 4CXAA 2J4ZA 4KS8A 3H30A 5CNNA 5AWMA 4YJVA 5HQ0A 3R02A 5J1WA 3H9RA 4RFMA 2XIYA 3W0SA 3KQ7A 4XG7A 5K0KA 4M66A 3FC2A 3JY0A 4CYIA 5LJJA 2JKMA 1JKTA 4O1PA 3KXNA 3A4OX 5BYYA 2W17A 3RPSA 3Q9WA 5HG7A 2W4OA 3W0RA 4G3DA 4LRKA 3DTCA 1NVSA 4NFNA 3PFYA 2WIHA 3PPJA 4A9RA 4F9WA 5HI2A 3U8WA 2H9VA 3BE2A 3F2NA 4XMOA 4EOOA 3HKOA 3UDZA 4K9YA 3I0QA 4FIJA 4GUBA 5IKWA 4EK5A 2IO6A 1M7QA 4CG8A 1ZAOA 1A06A 2G2IA 3VWAA 4Y46A 4FSMA 3UVPA 4H05A 2Y9QA 3LQ8A 3V5TA 4XP3A 3I0OA 4PL4A 3SD0A 5AX9A 5FGKA 3RHXA 3GU6A 3DPKA 4KNBA 5T6KA 3K54A 4B9DA 5CVHA 2X0GA 3KK9A 4FYNA 2J0JA 4HNFA 1GZOA 4L53A 5AP7A 4RSSA 2KTYA 1CM8A 3AMYA 5C8MA 5JFWA 1WFCA 2JAVA 3E3BX 3FI4A 2XZSA 4X3FB 3SXSA 3VVHA 1S9JA 4AGDA 2JITA 3H4JA 3EQGA 4HGTA 4O0TA 4FVRA 1YXTA 3RM7A 1PRYA 4K33A 3R9DA 2I7QA 1QPEA 2VTLA 2V22A 3PIYA 3RZFA 3KMMA 5AV3A 4F7JA 5KE0A 4J96A 5CY3A 4TYEA 1DAWA 4D4SA 2ZVAA 3KMWA 2W5AA 4P4CA 5M4FA 3IW6A 3TIYA 4CMOA 3DGKA 4L7SA 5TO8A 4KUJA 3ZFYA 5E8UA 4O4CA 4O84A 3UZTA 1RDQE 5HLNA 3QYWA 1XH6A 1Q62A 4C7TA 3W2RA 3ACJA 3E8DA 3M2WA 2PSQA 3SXRA 5JFXA 4L44A 3PIXA 5IEXA 3TZMA 3W0NA 4YURA 4LMUA 4JAIA 3PXYA 3NMUF 4G16A 2PVKA 3DLSA 4C36A 5M53A 4DDGA 3H3CA 2Y6MA 1Q24A 3ZLXA 3N4UA 3VO3A 2BFXA 3PYYA 2X0OA 4ARKA 3EN5A 2YDIA 4RX9A 4V04A 4C0TA 4PDOA 3EN9A 5DWRA 2OZAA 3I7BA 4QYFA 3PA3A 5L8JA 3RI1A 2VO3A 4CLIA 2QD9A 3SXFA 4EZ7A 5HZNA 4XV1A 5ANKA 5CF4A 1Q8YA 4CTCA 4MNEA 1SVEA 2XNPA 3LCTA 3ZLYA 4GCJA 5AM7A 3IW4A 3QALE 3A8WA 2QURA 3GGFA 2BR1A 1TKIA 1ZYJA 3FBVA 4XLVA 1XBCA 4NIFA 4EOIA 2I0VA 4IZ7A 3Q5IA 3TACA 3IW5A 1OECA 3CCNA 4ENXA 4ITIA 4UN0C 3FV8A 4XG9A 5DPVA 2IW9A 3S00A 2WTJA 2CGVA 2PVRA 3PVWA 4R1VA 4HVHA 4XG3A 2XRWA 2Z60A 4O7RA 1UWHA 1LEWA 4FODA 1H0WA 2OJIA 4C59A 5KMIA 3G0FA 3TKIA 2ZMCA 4IW0A 3EN6A 5CF6A 4IBMA 3ACKA 3R9NA 4MF0A 3IOPA 5E9EA 4QMVA 3PXZA 2Y4IC 5CVFA 2XAOA 4FG9A 4EJNA 4USEA 4E8AA 5HO7A 3I1AA 4IC7A 5FTGA 3R83A 1R0PA 2GHLA 3D5UA 1DAYA 1DI9A 2HXQA 3GI3A 2OH0E 2Y4PA 3R8PA 3MGYA 3OW4A 5CTPA 5AM6A 5CS6A 2C6DA 4ZJIA 4D9TA 4X2GA 2FVDA 5CALA 3MVMA 5C4KA 2PZIA 4F1OA 4PPAA 2H96A 2RG5A 4BF2A 1QMZA 3G90X 5HG8A 3BU6A 4IQ6A 4R7HA 3CGFA 3DCVA 1CKJA 4N70A 1GIJA 4DHJA 1S9IA 3MJ1A 2GNGA 2X4FA 4I5PA 4DFZE 1OGYA 2BRNA 3NW7A 4R1YA 4BJJA 3G9LX 4IMYA 3OOGA 1APME 3SX9A 3DOGA 3FKOA 3KCFA 3OCSA 4GFGA 5EOBA 4E6QA 4IWPA 3SLSA 4DA5A 4FVQA 3OXIA 4PTCA 2XM8A 4KKGA 4BGGA 3DAJA 3PPZA 5CENA 5HBHA 5KKRC 3OFMA 3QRTA 4GU6A 4HPTE 4IANA 3V8WA 2CSNA 4AZTA 2W06A 1W84A 2RF9A 2Y0AA 2NRYA 2PVFA 5JGBA 3PA5A 4FI1A 4I21A 4TPTA 1O6LA 4H58A 3ERKA 3AD4A 3ZO1A 2PHKA 4YHJA 4R7BA 1JAMA 2RFDA 4Z7HA 2XYUA 2XK3A 2P2HA 3GUBA 3TTJA 4RLLA 4OT5A 3ID6C 1SM2A 4GH2A 3AC4A 1JPAA 3BYMA 3R71A 4BCJA 5IA3A 3GCSA 3NNXA 3AD6A 3LFFA 4F4PA 1CKPA 2W1IA 2GS6A 4Y95A 4D4RA 3FMJA 4BVUA 4FT9A 3WILA 3RHKA 4TW9A 5BVOA 4MBJA 3VHEA 5EQYA 4R3PA 4NH1A 3KKVA 2EXEA 3FMEA 4I0TA 5J8IA 1GJOA 3HVCA 3RCDA 2PUPA 5IQGA 5DGZA 4R3CA 2XYNA 5E92A 4BCGA 5DVRA 4ZJJA 4PDPA 5EDRA 4G5JA 3VBTA 4LV5A 3ORNA 3Q4TA 3TT0A 3HX4A 5KHWA 1MRVA 2UZUE 2HY0A 4N0SA 5CSHA 4AA0A 4EZ5A 3SAYA 3DK3A 3LXKA 2GNFA 2ONLC 3AKLA 3VJOA 2R3KA 3LJ1A 2PWLA 3OY1A 1NW1A 2BZHB 3ROYA 4DH7A 5JZJA 1QPJA 2B0QA 3P78A 4PTEA 4MUQA 4DFUA 1JKKA 3DQWA 3L9NA 4G3EA 1W7HA 4MXXA 4NSTA 1WBTA 4NM5A 3HMIA 4A9YA 4EOPA 2CHLA 3BPRA 3VHKA 2QOCA 4BGHA 2QKWB 2GQRA 4GEOA 3UDTA 4YGAA 2QI8A 3AMAA 4OTIA 1A48A 3MESA 3E92A 5AAFA 3CBLA 4AACA 2P4IA 1FVRA 4LGHA 4CFNA 3OT3A 2WFYA 2HENA 4U79A 2Z02A 5IUIA 5E1SA 3II5A 5EDQA 1Q8UA 2CN8A 4MK0A 4BKJA 1RE8A 5KUPA 2JAMA 1TQPA 2QODA 3F5UA 3W10A 4BIDA 3OZ6A 3P7CA 1SYKA 5B7VA 1YOJA 4L8MA 5AP3A 4A7CA 3IKAA 1OIQA 2CLXA 2EB2A 3FHRA 3NW5A 1Q3DA 4LL0A 4NM0A 3WI6A 3QL8A 3TV7A 4YMJA 1ZOEA 4WNOA 1PF8A 4QDVA 3CQWA 4PPBA