4J96A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic gain-of-function k659m mutation identified in cervical cancer.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
306
structure length
302
Chain Sequence
AGVSEYELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKMTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 302
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j96A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j96A01
3ROCA 4FZ6A 4MNEB 3JXWA 2Y4PA 3NAYA 4I0RA 3BEAA 2HZIA 5M57A 3LQ8A 1UVRA 4HVHA 2WTWA 4D9UA 3DTCA 3ORLA 4KS8A 3EFJA 3E92A 4RLKA 5CEOA 4E3CA 3A4OX 5FM2A 3KA0A 3DJ5A 5C03A 4RLLA 3SXRA 2VO7A 4FTNA 1OB3A 1CM8A 2C0IA 2XZSA 2P2IA 3U51A 4EQCA 4MQ1A 2C5OA 2UZBA 4WG4A 1NY3A 1R0EA 4UYAA 3FLZA 3QXPA 4WUAA 4U45A 3HAVA 3TUDA 4G31A 3RGFA 4BBMA 5IA0A 3D9VA 3U4UA 2OJFE 3ZRMA 1IRKA 5FEQA 4BC6A 3P78A 3VF8A 4YTCA 2V5QA 3P0MA 3WZDA 4DH5A 4YHTA 4RWKA 3LFBA 2E9PA 3IDCA 2VX3A 3V01A 1VZOA 1YXUA 3ZEPA 1B38A 1JWHA 4B7TA 5A46A 5C9CA 4H1MA 3TM0A 1X8BA 2ZV7A 3IPHA 4G3DA 4GEOA 4JX3A 4HYHA 2PUIA 4O0UA 2O8YA 2UW8A 2W0JA 5K3YA 4D9TA 4QP9A 3VWAA 4AU8A 4GV1A 1YW2A 3KMWA 1MQBA 4JRVA 5D11A 2B0QA 4E20A 4HJOA 2GFSA 2QU6A 3OC1A 3HA6A 3TJCA 4ANQA 3CPCA 1F0QA 5AUWA 2LAVA 4AZSA 3N4UA 4H05A 3FXXA 3FQHA 4O81A 3MJ1A 5EQYA 1Z9XA 3TT0A 3WZEA 4QMXA 3UGCA 5FTQA 3UOKA 1E1XA 3W55A 1ZYSA 3UG1A 2PMIA 2IVTA 3RJCA 4W4WA 3HMPA 4C02A 2ITNA 5FTGA 1CTPE 1CSNA 4DEGA 1STCE 5IEVA 3UNKA 4O86A 3SRVB 3PG3A 3FSKA 3A60A 5FD2A 4O7VA 3GU6A 2VTPA 4MXAA 1APME 3PJ8A 4R5SA 5TKDA 4K11A 4FIHA 4IM0A 4YLKA 4EK3A 3DKFA 3TACA 4BYIA 4FSWA 3UJGA 3F88A 4OGRA 3FUPA 4K77A 1WZYA 3TEIA 4KABA 4PL4A 4HGTA 4ITJA 4ARKA 5IUGA 2B9JA 3W8QA 1SNUA 2C6OA 3IG7A 3PXZA 2YM8A 5FEEA 3ZDIA 3DAJA 4JG6A 1XH5A 5IH6A 3Q4ZA 3FKOA 1OZ1A 4EOJA 5A6NA 3NCGA 2FA2A 5J9YA 4FV0A 4PMSA 4RIXA 1RW8A 4LV8A 2GPHA 1PYEA 3B8QA 4F0IA 5KZIA 4YC3A 4YHFA 1Q8WA 4HCTA 3I0QA 4EUUA 5DVRA 3V5LA 4PMMA 1OIYA 3PIZA 5CU3A 4AGDA 2CKPA 4AN2A 2C0OA 3VN9A 3WZUA 3LM0A 3BQRA 4YPSA 1FGIA 3NCZA 5HBHA 5HLPA 4F09A 1O6KA 3FWQA 3DXPA 1YWNA 4R3RA 3L1SA 2JDVA 3MPAA 4G2FA 2WEVA 4KKEA 4APCA 1OVEA 1VR2A 4E1ZA 3R21A 1H1PA 1R1WA 3Q60A 3UQCA 4JBOA 4JAJA 3DV3A 4RIYB 5IUIA 4D5KA 2XEYA 3GNIB 5F9EA 3PLSA 5G6VA 5JSMA 2XM9A 3RZBA 4KKGA 1H8FA 1WFCA 2FYSA 1Q62A 4K2RA 1FQ1B 2H96A 3COIA 3FC1X 3QTSA 4GK2A 2IVUA 2ZV2A 4QQJA 4GT4A 5E8WA 2Z8CA 5BQ0A 2B1PA 4U81A 4XX9A 2PHKA 4CFWA 3DB8A 4FT9A 4O83A 3LJ2A 4AAAA 5BVWA 1SVHA 2I40A 3QRIA 3AC3A 4UMPA 1YQJA 3I79A 3HMMA 5H2UA 2ITPA 5J1WA 3FMDA 4KIKB 4EH3A 1XR1A 4L7SA 4JIAA 2HW7A 1YWVA 2DWBA 4PP9A 4RC4A 2PVRA 4M69A 2FSTX 3P9JA 2R3JA 2PMOX 3KN6A 4FC0A 1J7IA 3QQKA 4FKPA 2VAGA 5LVLA 4MX9A 3S0OA 4QTDA 4RWIA 1W7HA 2OJ9A 3DZQA 4IB3A 2YCSA 2ITVA 3FKNA 4YSJA 3RPVA 2VTSA 4TY1A 3R8ZA 5CAOA 3F2RA 3QF9A 4U3ZA 3OT8A 4EHZA 3EKKA 2Z02A 3MB6A 3VJNA 2QLUA 3IGGA 5M4UA 3BI6A 3P23A 3PPJA 4PPCA 5EQEA 3MVLA 2BKZA 1H1SA 4MEDA 1OITA 1YRPA 4RQVA 4V0GB 4MCVA 2WMBA 3MW1A 4IXPA 5DEYA 5AWMA 3RTPA 3Q6UA 5EK7A 3ATSA 1AQ1A 4L3LA 2ERZE 2FB8A 2PVHA 3CLYA 2PUUA 2WOUA 4BKJA 5K5XA 3V8SA 2PSQA 3W33A 4ORKA 1VYWA 3MS9A 2WTKC 5FXSA 4RX7A 3RINA 1QPJA 4RGJA 2B4SB 4DGLC 2IPXA 3O17A 4E6AA 2OU7A 1WBTA 5E1EA 4V04A 4I5MA 3ZONA 4EONA 3MH3A 5LMKC 4R1YA 2I0EA 3QGWA 3RCDA 4O27B 3CTJA 3WZKA 3LXNA 3I60A 3O50A 4E4MA 4FIJA 4O91A 5CALA 3ORMA 5J5TA 5JGBA 4G5JA 1O9UA 1ATPE 2G01A 4FBXA 4MNFA 5CQUA 5KKRC 4N57A 3GBZA 4G5PA 3KXHA 3OCGA 4IB5A 2VO0A 3REPA 3FJQE 1M7QA 1MRVA 3CE3A 4J7BA 3CS9A 2VNWA 1OKVA 3R7YA 3EQFA 2BKKA 5EM5A 2CSNA 2FGIA 2FSLX 4USDA 5IEYA 3QL8A 4RIWB 4UZHA 3UG2A 5JKGA 2ITOA 4E4XA 2JAMA 4BTJA 3ZMMA 1Y57A 2QOQA 2BZIB 5F95A 2NRUA 5FEDA 1H0WA 4EH2A 3QKKA 3QUEA 5FDXA 2RGPA 2J51A 4ZIMA 2PULA 4PRJA 4XBRA 5LWMA 4J96A 3EQHA 3C51A 4F9BA 2W4JA 3NMUF 1IR3A 4ZY5A 5GZAA 4AE9A 4BN1A 3QX4A 3I81A 3NNUA 3NYOA 4C3FA 3QD0A 4UEUA 4NWMA 2RIOA 2X39A 4UYNA 4EOSA 1AD5A 4JG7A 4MQ2A 4IAZA 4FV9A 4FTOA 4X2FA 4WIHA 5IQBA 1LP4A 1UNHA 3VUMA 4C62A 3ZYAA 4BCNA 4RJ6A 2QR8A 3PA3A 4MBLA 3LCDA 5B7VA 1XHAA 3PA5A 2R64A 2W99B 3AC4A 2Z7RA 3H9FA 3LAUA 3ORZA 4RX5A 3ZXTA 4ZLOA 2R3GA 5AMNA 5CU4A 3PXYA 3FQEA 2J0JA 2EVAA 3LMGA 4FEQA 2IVSA 4NTSA 3WF7A 2OG8A 2C5VA 4B8MA 4FVRA 3TUBA 4NH1A 5L2WA 3ZO2A 2YM5A 4HPUE 3Q9ZA 2PVFA 4C38A 5IH5A 3SV0A 1TQIA 2YEXA 3EHAA 4YJPA 4DFBA 4UV0A 3DS6A 2PWLA 2YIQA 1KUTA 1KE7A 5IEXA 3EZVA 4CFMA 5LVOA 3IW6A 3NIEA 4QNYA 2YDIA 4HGEA 2HZ4A 4K0YA 4RJ3A 3JR1A 1NXKA 2W05A 2C6DA 2WQBA 3LFQA 5DOSA 5BYZA 3TWJA 4XHKB 2F4JA 3CY3A 4FSMA 3VBXA 2OGVA 4RG0A 3O8TA 1NW1A 2C68A 5AP0A 3FMMA 2UVYA 3S3IA 2GTNA 4APPA 5ACBC 3S1HA 3WE4A 4I6HA 3C0GA 4AOJA 4F7NA 3D7TA 3DDPA 3HDMA 5K9IA 3A8WA 5CEKA 1O6YA 5JFVA 4L68A 4KAOA 4WRGA 3C5UA 3UYTA 3LM5A 4X2JA 1H27A 4E7WA 3HP5A 4J53A 3WF9A 2ITUA 4MBIA 4DG0E 3TZMA 2R9SA 4I94A 3A7GA 2E2BA 3SXFA 4EYJA 5B2MA 4JOAA 4Y5QA 2BAKA 3PTGA 5FQDC 5L2QA 3AC2A 2GQGA 5F20A 3ZLSA 3WF5A 4BHNA 4JDKA 1GJOA 3C4XA 4KNBA 5M09A 3FZRA 4RJ4A 5LARA 3ET7A 5AV1A 3NLBA 3QCQA 4QPMA 3LLAA 3ULIA 3QALE 2WQMA 4G6LA 4XOZA 3R9HA 4GK3A 5E8UA 5EH0A 1PF8A 4YR8A 5JQ8A 5L8KA 4NT4A 3W8LA 1OKWA 2ZOQA 4ZTRA 4CZTA 4WA9A 3P86A 4EK4A 4AN3A 4LMUA 2JITA 3IONA 3OXIA 3CGOA 3LFEA 4AFJA 3K3IA 4FICA 2JKKA 2PZYA 3GOPA 3ZUTA 1KE9A 2GDOA 2JAVA 1SVEA 3QHRA 4YZDA 5AR4A 3DLSA 4FVPA 5HNGA 3W2PA 2QO9A 2JDRA 2BIKB 2NPQA 2UZUE 3P4KA 2UW5A 3IO7A 3BE2A 3NUXA 3CKWA 3R1QA 4P5QA 5HOAA 1WBVA 3LLTA 4RPVA 2VTIA 5BVDA 3B2WA 1KE6A 3PIXA 1SVGA 1JKSA 4S34A 2JD5A 4ZTLA 4AA4A 4ENYA 5KKRB 4CMOA 4XV3A 4D58A 2R2PA 5HORA 3VBQA 3HV7A 3OCTA 4N4SA 1PRYA 3HRCA 3JVSA 3VRZA 2IW8A 2VTJA 4L42A 3HV5A 3I7CA 4DEIA 4TRLA 3SX9A 3E8CA 3DFCB 1QPCA 4U43A 4C34A 5KUPA 3ZDUA 4CG8A 4FSYA 3PUPA 3OS3A 4TT7A 4CFNA 2VWYA 2ERKA 4OW8A 3N4TA 1ZY5A 5IA1A 1KOAA 4F9AA 2H6DA 3RAIA 2WAJA 3EN4A 5EYCA 4PTGA 4GCJA 3W18A 3D2IA 3R04A 4PNKA 4MXCA 3ZUVA 4XG3A 2PVMA 3CBLA 3BYUA 2ZV9A 3RAKA 2C5YA 3GENA 4FKLA 2QOBA 5D7AA 4CT2A 5L2SA 5DEWA 4CFUA 5CAQA 4GJ3A 3LW0A 3MA3A 1U54B 4XG4A 4FSUA 5A54A 2J4ZA 4EH8A 1V0BA 5AAEA 2W17A 3SXSA 5A14A 2I0VA 3A7JA 3PVUA 1MP8A 4GSBA 4A07A 2UVXA 3G33A 3TKHA 3I5ZA 3GFWA 3GT8A 4LRJA 2ONLC 5JT2A 3UZTA 3NW6A 2C3KA 2OH0E 5KHWA 4EZ7A 1FOTA 3V3VA 3CEKA 3VS3A 2ESMA 2G15A 5T3QA 2UZDA 4L3PA 4LGDA 4H3QA 4AZVA 2QI8A 3G9NA 3NS9A 2WELA 5C1QB 2W1HA 4EHGA 3QQJA 5CLPA 3QLFA 2YACA 2B9IA 1S9IA 4ZZMA 2Q0NA 5EDPA 5AUUA 2XNEA 5I9WA 4JL9A 5J7HA 3R00A 3UZRA 1DAYA 3TNHA 5IF1A 2QOFA 1PKDA 5D9HA 4DCAA 4JJRA 4BDDA 4PP7A 3W2RA 1FPUA 3FYKX 2QONA 4CQGA 4PDSA 3UOHA 3C4CA 1BYGA 4J8MA 4PL5A 2GHLA 2C6TA 2CCIA 2XNBA 3RP9A 4I41A 2C6MA 4B6LA 3Q32A 4L44A 4R5YA 4AZFA 4YLJA 2WQNA 2CN8A 5GIOE 2BAQA 2O63A 4PMTA 4EORA 3IECA 5JGAA 3IKAA 4MAOA 3R8LA 2R3IA 4CV9A 4G9RA 2W1IA 3V8WA 3MFSA 5AM7A 4FTMA 2JLDA 3OXZA 3LIJA 3P1AA 3UODA 2C6KA 1YXSA 2P55A 3PA4A 4FOCA 2F2UA 5IKWA 3I7BA 3GC9A 3WIGA 4L6QA 3SOAA 1PXKA 4FUXA 4DEHA 4E8AA 4C4FA 4UMRA 1RE8A 5J7BA 4JRNA 1SNXA 4G17A 4XV9A 4I23A 3VF9A 4Y46A 4YU2A 1UU7A 2P33A 3R7OA 2VTAA 3KU2A 4ZEGA 2J0IA 4IWOA 3BGQA 1WAKA 4O7WA 1QMZA 2PMNX 2XIXA 3QZHA 4G16A 5E91A 3VUIA 4BTMA 5L2TA 1OKZA 3BV3A 4IZ7A 1JQHA 3BBTB 1JSVA 2V55A 3BRBA 3GU5A 4Y85A 2X7FA 2VTOA 4K6ZA 2R3RA 1IA9A 4UN0C 3L8SA 4PDPA 4AZEA 2WMAA 4NTTA 3N9XA 4DC2A 2YIXA 1OIRA 4KWPA 1PKGA 3Q52A 3TV7A 4QYHA 2GS2A 5HLWA 5KMMA 4FZDB 3UVQA 5JK3A 2B9FA 1Q3DA 2B54A 3TKUA 4HCVA 3UOJA 5H8EA 3V5WA 4YMJA 3BYMA 4M0YA 4ZSJA 1J91A 4F7SA 2QOLA 1E9HA 4RVLA 3PZEA 1YDRE 5HQ0A 1H07A 2X4FA 5TOZA 3RPOA 1ERKA 2GTMA 2JBOA 3C0IA 3IS5A 3F9NA 3K2LA 2XNMA 3LFSA 4EH6A 4IAIA 5DMZA 4O7NA 3TDWA 1YI6A 4K33A 4EOIA 2J90A 5HICA 3KEXA 3ORXA 1QPEA 2YM6A 4J95A 4HOKA 3HV4A 2W1DA 3VS5A 3OP5A 1U5QA 4ZSLA 4BHZA 4BVUA 5A4TA 3S00A 5IQDA 5E92A 2IWIA 2RFDA 4TYHB 3F3UA 4MXXA 4WBOA 4IC7A 4I0SA 4EOOA 3FY2A 4ENXA 3CXWA 3WIKA 5AV3A 3OWJA 3PXRA 4QP2A 4NK9A 5DT3A 3VUDA 5KHXA 2BHEA 4AFEA 1GIIA 2BILB 3ALOA 4UXLA 4KIOA 1T46A 5DR2A 4ACMA 3CKXA 2CGXA 3LJ1A 4D1ZA 2Z60A 4IWDA 4RVTA 2A0CX 4J8NA 3OY3A 2YIRA 3KXNA 4H58A 2XYNA 5CAPA 3G2FA 4E4NA 4YZMA 2R0IA 5I9VA 4AX8A 4F9WA 2A4LA 4O22A 5ETAA 1W8CA 4QMVA 2GQSA 4L43A 3RHKA 4NJ3A 2CCHA 1R0PA 2YM3A 2OW3A 3BU6A 3I4BA 3BQCA 4FA2A 2SRCA 4NEUA 4FGBA 3U9NA 4DFXE 5IDPA 2A27A 2WQOA 4BIDA 4J97A 1JBPE 3KMUA 4FV6A 4EZ3A 5AP7A 3ZXZA 1IASA 2BHHA 3QQLA 3DXNA 5HD7A 2JC6A 3LQ5A 4XLVA 3VAPA 4QMOA 5GIPE 1XH4A 4IFGA 3KREA 3FBVA 2QG5A 4IX5A 3VJOA 4BTFA 4EEVA 2PE1A 3GQIA 2VD5A 5IQCA 2W1FA 5A3XA 3F7WA 3HEGA 1T45A 5GJGA 1ND4A 3VW8A 4WOVA 3PSDA 5CXZA 4HVGA 4NU1A 4X2KA 3D4QA 2J7TA 4O82A 3V5TA 3C7QA 2BTRA 2BFYA 4NW6A 2JKOA 2VU3A 3MFUA 4C8BA 1FINA 4BB4A 3OMVA 2FSMX 1SM2A 1VJYA 2WIHA 4A9YA 4E6DA 4L67A 5AADA 2BUJA 3EL7A 3OTVA 3I0OA 1OMWA 3AC1A 3FXWA 1M2PA 4FKVA 1WBSA 3EQCA 3R7IA 4GKHA 3MBLA 3OOMA 3E8EA 1ZYCA 3CD3A 4IZAA 1ZMVA 3QWJA 3OD6X 4UY9A 1PXOA 3AD4A 3OF0A 3HYHA 5LMAA 4HVIA 2JDTA 3VQUA 4C4JA 4EBWA 4TL0A 1QL6A 3LMHA 2QD9A 3R1NA 3QZFA 3DJ7A 4WBBB 2OIDA 4IIRA 3UVRA 3R63A 4QMMA 3ORNA 4ZLZA 2RSVA 2BALA 3Q9WA 4WNMA 2QQ7A 4YO6A 1YI3A 3FL5A 4JQEA 4OTRA 4RJ7A 1JKLA 3RPYA 5AP4A 3CTQA 5FBOA 3IW8A 4BTKA 5FDPA 3LXKA 2BDFA 5J95A 4EHEA 4LOOA 3BLRA 5EDQA 3TNPC 2VX1A 2Q83A 2OZAB 1GIHA 2UUEA 4MBJA 3HDNA 3QYWA 3TV4A 4BCJA 5CT0A 2C6IA 2UW4A 3W2QA 2PU8A 2OWBA 3KXXA 4I20A 4UZDA 4ANSA 1OL1A 3G0FA 4O2ZA 3EB0A 5DR6A 2QKRA 1PY5A 2RKUA 4J99A 4G1WA 4A9RA 2EXEA 3R02A 3OZ6A 4QYYA 3COHA 5CASA 1XJDA 4F70A 3CD8A 4IAAA 5EYKA 3NSZA 4TYEA 5AIRA 4EH4A 3V51A 5A6OA 2W7XA 2NP8A 5DYJA 2P2HA 1R78A 5HE0A 1H1RA 3SKCA 4EQUA 5ANOA 2WKMA 3LJ0A 4X2NA 2QOOA 3H3CA 5EW3A 1Q8YA 3DPKA 4J98A 2YM4A 5L8JA 3MESA 4FEUA 3PWYA 4LUDA 1IAHA 3WARA 3PLAE 4A4OA 5A4LA 4XEYA 1OKYA 2AC3A 3H0YA 3MTFA 3PRFA 4UXQA 3RPSA 4D4YA 2XF0A 1GNGA 3CQUA 3D94A 5AP5A 3W2OA 3UQGA 4BZNA 4ZSAA 3FI8A 1YXXA 1S9JA 4P5ZA 4PUZA 4FEVA 5AUXA 3LZBA 3JY0A 3PVWA 4N0SA 5TO8A 4BDKA 4EOMA 1ZWSA 2I1MA 4FL2A 3MI9A 1WVXA 2XKDA 3KRJA 2IW6A 4IJ9A 2C3LA 2W4KA 3FYJX 5DR9A 5IMXA 4DINA 4FKJA 1GZOA 3LVPA 3OFMA 3AC8A 5I9ZA 4TWPA 1YXTA 2Z7LA 4FIEA 4QTAA 5CANA 1UU8A 1ZRZA 2QOCA 3PY1A 5BUIA 1M2RA 5CF6A 3E7VA 4Q2AA 4EOLA 5JZJA 4CLJA 5IA3A 3FLQA 2XJ2A 4R7HA 5IUHA 5DLSA 1DI8A 4ZJVA 4IMYA 2WTDA 3KGAA 4M0ZA 4BDHA 4YURA 5JMSA 1F5QA 3BBWA 3ANRA 3F61A 4I6BA 5IA2A 5KMJA 4JI9A 3POZA 4EWQA 2UW3A 3DKOA 2IJMA 4L46A 3PJ3A 4RIXB 4M13A 2BZHB 2VZ6A 3FE3A 3ROYA 4DTBA 2VRXA 2J0LA 3ZLWA 3K3JA 1DAWA 5DT4A 2YCRA 3BYOA 4BBEA 3PDTA 4BCPA 3KULB 2IZUA 2GCDA 3P08A 4JVGA 3VNTA 1NT2A 4I4EA 2WHBA 3PSCA 4NCTA 4YHJA 3NYNA 5DRBA 5LXMA 4GMYA 5ACKA 3KXMA 3VS4A 4F1TA 3FY0A 4HCUA 2V62A 2CNVA 4HNIA 5TR6A 2OXYA 5AR8A 3Q5ZA 3IW5A 4GFOA 2C1AA 2C47A 2GS7A 4QMWA 5HLNA 3QTXA 2YM7A 5H3QA 2FSOX 4M84A 4HNFA 4BDBA 2X8IA 4YZBA 3B8RA 4FKTA 2XA4A 4YJSA 1W82A 4U40A 2IG7A 4Y95A 3KN5A 4JS8A 3MH1A 3M42A 2J0MB 3KXGA 4RA4A 4UMTA 3TIYA 2YDJA 5IH4A 4J1RA 4K1BA 4AWIA 1CDKA 5GNKA 1Q8UA 1A48A 3D5VA 2BTSA 2CHLA 2R7BA 3EZRA 3GCVA 3UDBA 1OUKA 2IN6A 3MGYA 4IB1A 5CSHA 3EFLA 3SRVA 2X1NA 2IO6A 2F7EE 3EN5A 3OEFX 4XNEA 3UMXA 4AOIA 4FSZA 4DFYA 3UPXA 3VQHA 4L52A 4F9YA 3QLGA 3II5A 3BGPA 3R8PA 4F4PA 3FAAA 3F82A 1LUFA 4ZTSA 3RKBA 3MPMA 4FODA 2WMXA 4NM3A 2B55A 4U79A 4EQMA 4M69B 1XWSA 2OJGA 4PL3A 5T68A 3U55A 5AA8A 3U54A 3E7OA 1AGWA 4R7IA 3OCBA 1P5EA 4FTQA 1XH8A 2X7GA 3RWPA 4E6QA 4QP3A 3QQUA 3ZRLA 4WRSA 3EJ1A 5ICPA 3QA8A 4FEXA 3PP1A 3GC8A 4E26A 3BHYA 5ANGA 1M7NA 4UWCA 3C4EA 3FI3A 4ZLYA 2YZLA 1MRUA 2JDSA 5IZFA 1GZ8A 4FNZA 4FSTA 5DHJA 1UWHA 3LCTA 5BVNA 3TXOA 3D83A 4FYNA 2WO6A 3UTOA 2EB2A 3EQBA 5IQIA 4ZTQA 5I9YA 4CMUA 2PVNA 3MWUA 4TWOA 3PJ2A 1IEPA 2CPKE 4CFXA 4NZWB 4YPDA 4F1OA 3VIDA 3ZFXA 2W5BA 2QR7A 3QD4A 2PY3A 4TKSA 3LXLA 2HWPA 2YIWA 1PXPA 4B4LA 3U6IA 3DJ6A 1ZYDA 4QYGA 4XH6A 5EW8A 3WYXA 4D5HA 4K18A 1DS5A 4DN5A 4O0WA 2UVZA 1Q24A 4QTEA 4BWKA 3BU3A 4EHVA 1BL7A 4OTWA 3BELA 2R4BA 3PPKA 3F3ZA 5BVEA 4ANLA 4AT5A 2XBAA 3ID6C 4I5CA 3WF8A 2CNUA 3G9LX 4FIFA 4KIKA 4K8AA 4G3FA 5GJFA 2CN5A 2OFVA 3QRTA 4IVCA 2F9GA 1NVRA 1ZMWA 3FXZA 2ZB0A 5KBRA 2UZWE 1G5SA 4NL0A 4I24A 3DQWA 5M06A 2XNOA 4JDIA 4RZVA 4HVSA 3TNQB 4TXCA 2P4IA 3DBCA 5EM8A 4QQTA 4RA5A 3LFFA 4UBAA 1J3HA 3M1SA 4OTFA 4M7IA 3ZBFA 4BF2A 4CTCA 5J1VA 1PW2A 5HIEA 2Q0BA 3C0HA 4GU6A 4F65A 4DAWA 3NW7A 3N51A 3QHWA 2GNLA 2OLCA 1M2QA 4LI5A 4BCHA 5KMNA 2QURA 2REIA 4FTKA 3AQVA 3FSFA 4IAKA 3A7HA 4RVMA 5HTBA 4S32A 2E9OA 3O8UA 3QA0A 3R1SA 4EOPA 2Z7QA 5BVFA 5IMEA 4QYEA 3KL8A 3HRFA 2VUWA 5AUTA 3U9CA 4L01A 2XK4A 3EYHA 2GHMA 2C3JA 2XIZA 4IC8A 2BDJA 3AGMA 1BMKA 5E1SA 1Y8GA 4FIGA 1U59A 4BR3A 3QTZA 3P79A 4BDJA 4ASXA 3U6JA 3VS6A 2DUVA 2VNYA 5AP3A 1E1VA 3KCKA 1ZY4A 4QMLA 2YHVA 4F7LA 3M11A 4S30A 2QCSA 4R77A 3NR9A 4M97A 1REKA 1SMHA 4OT5A 4RBLA 5FXQA 5EI8A 5EHYA 3BPRA 5AAFA 3UIMA 5M07A 4LGHA 4DBNA 1Q99A 4G6NA 4O1OA 4QRCA 5GJDA 3AMYA 4QP6A 3S2PA 5JEBA 1KV2A 5JFXA 4RFMA 1KV1A 1PMUA 1Q5KA 4HW7A 3FZ1A 3DBQA 4MD9E 4CFFA 2XCKA 2E9UA 3UIXA 3V6RA 4EC9A 2VWBA 4JQ7A 3GVUA 5IPJA 5M56A 4X3FA 1XBBA 3AMBA 5H8GA 3A7FA 2NO3A 5D7VA 5ETIA 2UW7A 3A4PA 4WG3A 4RJ8A 3WBLA 3E62A 4A7CA 4CKRA 2UZEA 4KBAA 1YHWA 5DWRA 5CEQA 1W84A 4ACHA 5IQFA 5IQGA 2VTQA 3DZOA 4AOTA 3MIYA 1J1CA 3WILA 1URWA 4ZSEA 4FV8A 2I7QA 3V8TA 3UE4A 3A61A 3KVWA 5F1ZA 3SC1A 1P4OA 1FGKA 4ERKA 5EOBA 4ZOGA 2HCKA 4WNKA 4Z16A 1ZAOA 4PQNA 3KQ7A 3R7UA 5LCJA 3ATTA 5GZ8A 3TZ8A 4IWQA 5FTOA 4PMPA 4QMPA 3FHRA 3R83A 3HZTA 3RM7A 5HCXA 2PUPA 3OCSA 4XG6A 3ENMA 5FM3A 4BBFA 4U5JA 1JAMA 2OH4A 4UX9A 3PYYA 3MV5A 4KRCA 5H8BA 5IDNA 4JBPA 2ITTA 5CWZA 4FTAA 1OUYA 3ORTA 4FV2A 2RG6A 4BDAA 2PL0A 3P7AA 2ZDUA 4AA5A 1NVQA 3RAWA 2VN9A 1UA2A 4YUQA 4FK3A 4NUSA 4BIBA 2W1CA 4Q5EA 5DNRA 5E90A 3HGKA 3ODZX 4FSQA 4FKSA 3E8DA 4IADA 4KA3A 3VHEA 4D4SA 2YFXA 4QMTA 4XG9A 4D2RA 3OVVA 2YJRA 4ZS0A 1J1BA 5E8XA 3VS2A 4AGUA 1Y8YA 3HLLA 3P5KA 3BE9A 3DK6A 1ZZLA 1QCFA 3Q4CA 1A06A 3H4JA 3EN6A 4KSQA 1IAJA 1CMKE 3QQFA 4Z3VA 2VGPA 1HOWA 5B2KA 2YCFA 4RRVA 1W83A 4U7ZA 4F6SA 4WG5A 4KUJA 1UWJA 5A4QA 2XYUA 3R7VA 2H9VA 4IACA 3VUGA 4ZMEA 2ETKA 3DNDA 3BGZA 5AR3A 3HKOA 4I4FA 3SOCA 4DEEA 2A19B 4NM7A 5LCKA 1FVTA 2UW0A 5DG5A 2WFYA 2RFSA 3DDQA 3SW7A 5JRSA 4HVDA 2WTKB 4FTRA 5HU9A 2WMQA 2XMYA 2BCJA 3FHIA 4LRMA 4PPAA 5E8SA 5AUYA 4AACA 2XVDA 4I22A 2WZJA 5DRDA 2GNJA 2JFMA 4ZSGA 4AA0A 4GH2A 2OBJA 4RWLA 4LMNA 5AUZA 3M2WA 5C01A 1U4DA 1JPAA 3EFWA 2PE2A 3H10A 3KK8A 3D5WA 5E7RA 5HVJA 4D1XA 3QCSA 5I9XA 4N6ZA 3KY2A 4GIIA 3RALA 1GAGA 2J6MA 5FP5A 5CNOA 4C61A 3K54A 2QLQA 5CAVA 3NNVA 3NEWA 2PYWA 5CSVA 3E64A 3HL7A 3OWLA 4MK0A 3F69A 4JR3A 5CZHA 3CP9A 5HNIX 5K4IA 2OFUA 5J9LA 4NW5A 3S4QA 4GW8A 4YP8A 2WXVA 4GVAA 3Q04A 4L9IA 5L6WL 4BY9E 4IE9A 3OWKA 3LCOA 5CEIA 4EBVA 2F7ZE 5E8YA 3VBVA 4FZFB 4QD6A 1OPKA 1HCKA 2OJJA 1REJA 2FUMA 3RM6A 3QZGA 3AD6A 2PK9A 3R73A 3Q9YA 4FIIA 4BCKA 4BL1A 4TZRA 5AJQA 3ULZA 1LR4A 3KRWA 5CEMA 1PYXA 3R7GA 2W9FB 2QO2A 4XP3A 3Q4UA 3FPQA 4PDYA 4D2WA 3BEGA 3R9RA 4H3PA 5EG3A 2CKEA 3OW4A 4YTFA 3MFRA 3PRIA 4CKIA 3DNEA 2J5EA 1ZOEA 3BYSA 4KIQA 4E6CA 2OXXA 3L9MA 5EI6A 1WBWA 4IM3A 2HELA 1M52A 3FLYA 4PF4A 3NDMA 2OZOA 3OBGA 3SW4A 4AW5A 4ITIA 3PFQA 4IB0A 4O0YA 4RT7A 3Q4TA 4LYNA 2ACXA 3L9NA 2JGZA 4PX6A 4CCUA 4GUBA 4XG8A 5CX9A 3R2YA 4ANMA 5M4CA 2PVYA 1K3AA 4FKIA 4W9XA 5C27A 4L00A 2PUNA 5K0KA 4M12A 3FMNA 3F5PA 4W9WA 1BUHA 2QC6A 4YZCA 4IJPA 4BKZA 4DHFA 3WOWA 1PXMA 2R3FA 3FLWA 5KMKA 2YISA 3MPTA 5DFPA 2O2UA 2G1TA 5AP2A 2UZOA 1I44A 4L8MA 5HVYA 5HX8A 3NYXA 4ZTHA 1OBDA 1R39A 4BICA 4Z7HA 1UNGA 3HUBA 3GUBA 4W8DA 4QP8A 2WIPA 4DH8A 3UO5A 4YNEA 3ZEWA 1W0XC 4G3GA 4CYIA 3PJCA 3KRRA 4USEA 4D2PA 4KB8A 3MDYA 2C0TA 2YWPA 4FKRA 2IW9A 3V04A 4NYEA 1O6LA 5CYIA 5HG5A 3OT3A 4XOYA 4DH1A 4QMNA 4NKSA 4OTIA 5AX9A 3FC2A 3KFAA 4BIEA 5BVOA 4AZWA 2ZMCA 5IQAA 2UW6A 3QUPA 2HW6A 5J87A 4G9CA 4EK8A 4Z7GA 4PDOA 3FL4A 4D2SA 1K2PA 2YIYA 2QU5A 1OGUA 3RVGA 2JIVA 4ID7A 4RX8A 2HY0A 2X8EA 3CQWA 5BMSA 5A4EA 4FNYA 4FZ7A 4IEBA 5HCZA 3RWQA 3TL8A 3TNWA 2O64A 4UWYA 4BWPA 4GFGA 4JX7A 4W4VA 2GMXA 3PP0A 2R3LA 2XP2A 2JBPA 3BYVA 3QCXA 3NUNA 4G34A 4KD1A 5CSPA 5LVPA 1URCA 4IFCA 1GOLA 3LQ3A 1H01A 3NUYA 3PXKA 4O2PA 3LFDA 5EW9A 5JFSA 3QC4A 4FT3A 1V1KA 3CCNA 3DXQA 4R78A 2R3QA 2V0DA 2VWVA 4DEAA 3ZC6A 3A8XA 4FTJA 4K9YA 1ZLTA 2QVSE 2ZMDA 4LOPA 3ODYX 2BIYA 3Q53A 2VWUA 5HKMA 1Q61A 4GL9A 4BWXA 1V0PA 3OROA 4WHZA 3ZLXA 1F3MC 2ZB1A 3L8XA 4IDVA 4PV0A 1M17A 3R6XA 4CKJA 3EN7A 2X6EA 3EYGA 2O65A 4JDJA 4BDIA 4O0TA 2B7AA 5EHOA 4OT6A 4D55A 1PHKA 2WMUA 3RK9A 4N70A 3U87A 3ZTXA 4XBUA 2ETMA 3HV6A 4KKHA 3HA8A 3GU4A 2ITYA 4ERWA 2R7IA 3IK3A 4F99A 1H1QA 3O2MA 4FUYA 1LEZA 3L9PA 2BRNA 3KK9A 4NIFA 4QQ5A 5GHVA 3FPMA 4FTIA 5L2IA 3PY0A 4QMYA 1ZOHA 2UZLA 2I0HA 3FLSA 4PNIA 3IW4A 2R3PA 1H26A 3PJ1A 1H24A 3UO4A 1A9UA 4U0IA 2WNTA 3AT4A 4IX3A 5L6OA 2RF9A 4IZYA 4GT3A 4FV1A 4EL9A 4O7TA 4FVQA 3IGOA 5J79A 4WT6A 3QRJA 5I3RA 4GVJA 3GCQA 4YZ9A 3E3PA 3CQEA 5HIDA 3QXOA 4QPSA 2X2MA 2PPQA 2BZKB 2V7AA 4BGGA 4AS0A 5ANDA 2X9FA 5EDRA 1UU3A 4NCTC 4JBVA 1WVWA 4YC8A 4F7JA 2OJIA 4USFA 3G90X 3AT3A 5JQ5A 3UQFA 3EFKA 4ZMFA 2X9EA 2G2IA 3QTUA 5ETFA 4OAUC 5DH3A 4C4HA 1KSWA 3T3UA 3AG9A 1YDSE 5CI6A 3SDJA 5FGKA 4I92A 3I1AA 4YNOA 4BZOA 5IISA 3TNIA 4LUEA 2DS1A 2ZDTA 3MSSA 4OTPA 2XNGA 4WKQA 3GEQA 3FZTA 5D41A 3DA6A 5HIBA 3RK5A 3SQQA 5KX8A 4JBQA 3O71A 1BX6A 4X6RA 4XMOA 1I09A 4ANBA 4BZDA 3C9WA 3CTHA 3QAME 5TE0A 3W2SA 4DEDA 2UZNA 2PVJA 2CKQA 4FOBA 3DU8A 3RMFA 5M4FA 3MY1A 5HCYA 3TTIA 3BHHA 5G1XA 3UO6A 4EI4A 3E87A 5DGZA 3OHTA 4TWNA 1G3NA 2R5TA 4FT7A 3VUHA 5BMMA 4F0FA 3R8VA 3EQDA 3P7BA 4AXAA 4EJNA 4ZP5A 2YA9A 3ELJA 2C6LA 4OBOA 4BCGA 4C4IA 1OPLA 4ZTNA 2QG7A 2HWOA 2XEZA 3DBDA 4RSSA 5M51A 3OOGA 3VUTA 3T9IA 4X7QA 2EUFB 3G6GA 4JQ8A 4DYMA 1Z5MA 2OI4X 3DOGA 5KO1A 4GIHA 4R1VA 4FTCA 5CSXA 5A4CA 4YJNA 4D2TA 3BU5A 3I6WA 4EUTA 4CG9A 2BRBA 1YHSA 3F2NA 1BI8A 3N4VA 3GP0A 1BI7A 3NRMA 4RVKA 2F49A 4F6WA 3QBNA 3HAMA 3R8MA 2C1BA 4ANNA 4AT4A 4EWHA 4FTTA 3SG8A 2XRUA 4XYFA 4FX3A 5CS6A 3EMGA 4FTUA 5HBEA 4QMQA 3CGFA 2X6DA 4UWBA 2B53A 4E4LA 5F4NA 2YZAA 5HG7A 4QMZA 5M08A 3HV3A 3ZFYA 4H1JA 1UNLA 3POOA 1H1WA 4A9UA 3R2BA 2OF2A 4D28A 4AGCA 5CVGA 4XCUA 2CNQA 4ZZNA 4DGMA 4KINA 4UB7A 4CEGA 2JIUA 4LL0A 3O51A 3CJFA 1P14A 3QRKA 1B39A 3Q5IA 4L45A 3DB6A 4TN6A 4CXAA 2VO3A 3HX4A 3MB7A 4BFMA 5LOHA 1GZNA 5HHWA 4C3PA 2X8DA 4FSRA 5AM6A 1WCCA 1MQ4A 3QFVA 3VUKA 2RG5A 4ACGA 2CGUA 5AA9A 5KMIA 3AC5A 4GFMA 1K9AA 2EXCX 4RFZA 3SAYA 3HMNA 5BYYA 4RJ5A 3LCKA 4X2GA 4P4CA 1ZOGA 1BKXA 5K0XA 1XBCA 3OXTA 3EN9A 2WMVA 3D7ZA 3JPVA 4S2ZA 4ASEA 2GQRA 2VO6A 2XBJA 3Q9XA 4BCQA 3THBA 3ANQA 4A9SA 1OBGA 3ZFMA 2OZAA 2XB7A 3FMKA 4HYIA 3KF4A 2OF4A 3FZOA 4CFVA 4MNEA 3KCFA 1YI4A 4GG7A 4MHAA 4NFNA 4GU9A 4O1PA 2ITXA 4R3CA 4ZS4A 3FLNC 2EU9A 2X2KA 2Y0AA 3D5UA 1LEWA 3KMMA 4YJRA 4CZYB 2VWZA 4J71A 2YWVA 1MRYA 3DFAA 4XG7A 4ZXTA 3VULA 4F64A 2IZTA 4IVBA 3ZH8A 4W8EA 1FMKA 3H30A 3EQRA 3EL8A 2XK7A 1PXLA 3CR0A 3LFAA 4MXZA 4W4YA 3MJ2A 4OTGA 4U44A 3KB7A 2PZIA 3UP2A 2XNNA 4ZJJA 3OWPA 1YKRA 3T3VA 4NKAA 2UW9A 1H08A 4U9AA 4CRLA 5A9UA 2C5XA 1GZKA 4H36A 5DT0A 4ZAUA 1HCLA 3E88A 3KXZA 4Q9ZA 4FL3A 4E5AX 5B0XA 5AV0A 3NVKI 4O0SA 4OTHA 4D1SA 3G5DA 3T9TA 1KWPA 5HG8A 2VTRA 4ALWA 2B52A 4TTHB 5IU2A 3T8OA 2QKWB 3BLQA 4WD5A 4Q5HA 1U46A 1UV5A 4X3JA 2J2IB 2ITQA 3LFNA 1YVJA 4TW9A 4FT5A 4FG7A 5EYMA 4DG2E 3K5VA 2WTIA 4X3FC 4HYSA 2VTLA 5K4JA 5L6PA 5HTIA 4EJ7A 3QCYA 4A4LA 4QP4A 4S33A 5C8MA 4DG3E 4C0TA 4AZTA 3GU8A 4LM5A 1OL2A 3TCPA 5ANEA 1FMOE 3OW3A 5GZ9A 3ZO3A 4KSPA 5IQHA 2WMTA 3BKBA 4DT9A 4O6LA 3NUAA 3MFTA 4YJUA 3GI3A 3SG9A 3VBWA 3R0TA 3ZZWA 3BWJA 5D1JA 4CD0A 5CNNA 1TVOA 4W4XA 2BAJA 3F66A 4ACDA 5HE1A 3AOXA 1G8AA 4EZ5A 2XNPA 3HUCA 2XK8A 5EFQA 3IQ7A 5FBNC 3IDPA 3KULA 4RC2A 2XJ0A 2BROA 4JG8A 3C13A 4AE6A 3BLHA 1Q3WA 4YGAA 4I0TA 3DKCA 3KRLA 5AR2A 3KF7A 4JIKA 4I1ZA 2ITWA 3IDBA 3W32A 4BKYA 4DBXA 2PZRA 4ALUA 2X81A 2OKRA 1Q41A 4PPBA 2FH9A 5FWKK 1ZYLA 4X21A 3WF6A 3BIZA 3JS2A 3A62A 3FQSA 4HYUA 4Z9LA 3QZIA 2HK5A 3OTUA 3CC6A 4JDHA 4I6FA 4U42A 5DI1A 1J7LA 3GC7A 5EKNA 4C2VA 1IA8A 3HNGA 2UZVA 1ZXEA 4RFYA 1M14A 3UZPA 3SGCA 2YLEA 3BHVA 1PXIA 2IZRA 2A2AA 4DGOA 3K5UA 2W1ZA 3OUNB 4RIOA 4QP7A 3L8PA 4YC6A 1PXNA 3NNWA 3ZUUA 3CPBA 3PWDA 3NW5A 2R3KA 4M15A 4RIYA 3PIYA 5ITAA 1SZMA 2C30A 2EXMA 2J9MA 4FKOA 3GC0A 4LQMA 3ZRKA 4B9DA 5M44A 5M53A 1Q97A 1GY3A 2HZNA 3FKLA 3TZ7A 3Q2JA 4IX6A 3RAHA 2A1AB 4EKKA 5HBJA 1P4FA 4C2WA 3F6XA 3WZJA 3BCEA 2Y7JA 3L9LA 2RFEA 3QQHA 2IZSA 4PWNA 5D12A 5HE3A 4C33A 2XK9A 5L3AA 1JKTA 2WU6A 5HD4A 2VGOA 4DITA 4CCBA 2WMSA 2YJSA 2YITA 3E5AA 5IA4A 1H4LA 3BV2A 4MKCA 2W1GA 2C6EA 2BRHA 3KKVA 2R3NA 4FE2A 4YO4A 5E4HA 5EI2A 3HVCA 2PVLA 4ACCA 1KOBA 2JFLA 4DH7A 3NX8A 5T6KA 1OL6A 3IOPA 4CZUA 5AR7A 3NZ0A 3MY5A 4G3EA 1NA7A 3JY9A 1DM2A 1XO2B 3E93A 1JSUA 3LXPA 4O7RA 3WE8A 1JNKA 3O96A 2W1EA 4FZAB 4O21A 4Q9SA 2Y6OA 3EQPA 3F5XA 4I5PA 4U8ZA 4Y8DA 4MF1A 4DLJA 3H9OA 2WTVA 5FRIA 3UNJA 1BLXA 3VBYA 5BX0A 4G6OA 2FVDA 4I3ZA 4EKLA 4FT0A 5CZIA 5J9ZA 1RQQA 4HGLA 2YAKA 2JIIA 3NUUA 4DT8A 1PMNA 3EQIA 2GU8A 3F5GA 2GNIA 3F2AA 3QTIA 4FYOA 5IA5A 4F1MA 3H9RA 3SA0A 4E5WA 4NFMA 3DKGA 2PE0A 5HE2A 2ZVAA 5M55A 2QOIA 4V0GA 4ZZOA 2H8HA 3QYZA 2X4ZA 4H3BA 1G8SA 2PMLX 5LJJA 2HAKA 2XJ1A 2UV2A 3ORKA 4ASZA 3IW7A 2R0UA 4L3JA 4F6UA 4WUNA 3UMWA 3VVHA 5CXHA 4BDFA 1H28A 4GYIA 4P7EA 3MA6A 4RZWA 3RBWA 3V6SA 4CT1A 4DFNA 3R8UA 4AW2A 3MTLA 4DF3A 3H0ZA 2XM8A 2WEIA 3OEZA 4FV7A 4DCEA 1KE5A 4II5A 4AQCA 4X3FB 4C37A 5CT7A 4XP2A 3LOKA 4CSVA 2KULA 3D2KA 4V01A 1Z57A 4KBKA 4JLCA 3R9OA 1SYKA 5HU3A 4CQEA 3F3WA 3G6HA 4QYFA 4O7YA 4DH3A 2W96B 3C4WA 1WMKA 3GCSA 4O96A 2C69A 5DN3A 2WTJA 3HECA 3R71A 3QTWA 5EQPA 4HGSA 5AP6A 3ZSIA 4MXOA 4GRBA 2P3GX 3FEGA 2AYPA 2W5AA 1NVSA 5LMBA 3R7EA 3PVBA 5I0BA 4HPTE 4FKQA 3GGFA 3MH2A 1Q8TA 4IVDA 4MWHA 5E9EA 3P7CA 4MD7E 3AXWA 3GB2A 4YJOA 1WBNA 4R3PA 4Y83A 5CF8A 4BCOA 3ZLYA 3BHUA 3G51A 4V05A 1FVRA 4O6EA 2HOGA 4RIWA 3ZM4A 2NRYA 5TF9A 4DEBA 4Y5HA 2OICA 3EWHA 4J52A 4RWJA 3ETAA 4ANOA 5C8NA 2XIYA 3KC3A 4QO9A 1FVVA 4UALA 4QMSA 2QODA 3DTWA 4FV3A 4ALVA 4AUAA 2E9VA 5CF5A 2WPAA 4IH8A 2V22A 4MTAA 3ORPA 3R22A 5AUVA 2ZM1A 3VW6A 3JVRA 4DE4A 4XRLA 3PG1A 3DT1A 5E8VA 5AEPA 2ZJWA 3KRXA 3D7TB 5HZNA 3O7LD 2DYLA 2X2LA 3PPZA 4ONAA 4WNPA 3QQGA 3VRYA 2F2CB 3VO3A 3ZOSA 3DGKA 2LGCA 4TYIA 3QKLA 4KBCA 2PTKA 5I9UA 1YHVA 4EOKA 4R6VA 2RL5A 4GS6A 3VS7A 4E93A 1RJBA 1PMEA 3FI2A 3O7LB 3UIUA 4IM2A 2Z2WA 4CRSA 4BGQA 3ZS5A 4AN9A 3ZSGA 5CAUA 3VC4A 3DK7A 5CU2A 2ITZA 1BL6A 3CY2A 3RZFA 2I6LA 4EH5A 3RK7A 1RDQE 2XKCA 2H34A 4CTBA 4P90A 1ZMUA 4QQCA 2BRMA 3A99A 5AV4A 2RFNA 4OAVB 4U97A 4BRXA 5EKOA 4X0MA 5HGIA 3NPCA 3OUKA 5CEPA 2QO7A 3S95A 3LKMA 4O38A 2VTNA 4G3CA 4HZRA 4QT1A 4IX4A 5JRQA 3ACJA 4DTKA 1H0VA 5GINE 3RNYA 4BCMA 4IAFA 1JKKA 3CIKA 4I21A 5JFWA 1XKKA 3UP7A 4R7BA 2DQ7X 2XH5A 2EWAA 4HZSA 1JLUE 2AC5A 3IOKA 4GJ2A 3UPZA 4FGRA 3VS0A 5BUEA 2P0CA 2QHMA 3U4WA 4IZ5A 3DAEA 4XS2A 3RI1A 5HNBA 4FF8A 1Q8ZA 4FR4A 4MD8E 4AGWA 3MYGA 2VWWA 2FO0A 3MIAA 1VYZA 1PMVA 3ORIA 1FBNA 4YJTA 4YBKA 4YSMA 4FKWA 3W10A 4EK6A 3U8WA 4M66A 5DBXA 3WI6A 3DY7A 4IDTA 4LFIA 4BCFA 4KS7A 4Y73A 1UKIA 3CJGA 3OG7A 4M14A 4FV5A 4RX9A 1YOMA 5CTPA 5FG8A 3LMIA 5C4LA 3FDNA 4C36A 3LFCA 3ERKA 3FMLA 3E63A 3TZ9A 2YAAA 5AX3A 4OR5A 5FLFA 4IHPA 1OL7A 2J0KA 4GUEA 3AT2A 3I6UA 4M68A 4OTQA 4AP7A 4F9CA 2WU7A 2UZTA 5I4NA 4M67A 3Q96A 4AW1A 5IQEA 5HO7A 3NIZA 5HEZA 2C5NA 3PE1A 3TV6A 4O7LA 1VEBA 4YZNA 2B9HA 3TG1A 3V5QA 4EC8A 4PTEA 5HG9A 5M4IA 3WYYA 2G9XA 2JKQA 5EM7A 4DA5A 4L53A 2G2HA 5BYLA 2PVKA 2Z7SA 2J50A 5DIAA 3QGYA 2XKEA 2XIRA 3QD2B 3R9DA 4EH7A 1QPDA 2PZPA 4GT5A 4OUCA 2KTYA 3HRBA 4YTHA 3SHEA 3TIZA 2BFXA 1LPUA 1MUOA 2F57A 3FI4A 4FKGA 5EYDA 4C3RA 2YDKA 3QU0A 1JOWB 1H00A 3ACKA 1PXJA 3QTQA 4FSNA 3JYAA 4FNWA 4R8QA 5KZ0A 5LMKA 1CKIA 5C4KA 4DTAA 4NSTA 5AV2A 3I5NA 3DLZA 4XV2A 5AP1A 3BZ3A 4EOQA 4DGGA 1Y6AA 2X7OA 4DGNA 4GYGA 4RMZA 2GHGA 1UKHA 2ETRA 2OK1A 3UNZA 4BI2A 5KNJA 4C57A 3R28A 4S31A 5CU0A 3EH9A 4QNAA 2BRGA 4LOQA 3R30A 2VV9A 5CENA 2GNGA 3G0EA 2W06A 2O0UA 5FXRA 2Y6MA 4GG5A 5F94A 4YTIA 5J8IA 3GXLA 2ZV8A 4MVFA 3OBJA 4XP0A 4Y72A 3DBFA 5HESA 4C4GA 3NUSA 5HX6A 4IVAA 2WOTA 5ANIA 4FKUA 5FP6A 3UVPA 2JEDA 5ANKA 5L4QA 3FMEA 3UIBA 3C50A 3BWFA 3O0GA 4WSYA 2BPMA 4DFZE 1J7UA 3GQLA 2ZYBA 4Z55A 1TQMA 3NGAA 4RC3A 4U6RA 5CI7A 1OIQA 3COMA 1WBPA 2HY81 2Y4IC 4FTLA 1OI9A 4BI1A 4C58A 5LVMA 1V0OA 1U54A 3QD3A 4AT3A 3GOKA 4CYJA 2YN8A 1ZYJA 4CMTA 2GS6A 5LVNA 3KVXA 3PZHA 5JZNA 4NJDA 4XLIA 4MXYA 4FNXA 4DFLA 3QC9A 4WNOA 2AUHA 3PVGA 4C4EA 3FV8A 4C35A 3ZBXA 4WO5A 2ZM4A 3HMOA 2WQEA 3VS1A 3DQXA 3D15A 4A06A 3MY0A 3RCJA 2XUUA 3D14A 4CVAA 5KBQA 3PXFA 3U6HA 4MWIA 5IG1A 4IW0A 2EB3A 3DCVA 4H39A 1H25A 1L3RE 1L8TA 4LL5A 4O84A 3SLSA 4UMQA 2CGWA 1B6CB 4TYGA 3ZU7A 5B2LA 4IQ6A 2R3HA 3TTJA 3W1FA 4BDEA 4BCIA 3V5JA 4ASDA 2O3PA 2HXQA 1Y91A 3A2CA 5L8LA 1OECA 3QRUA 3GFEA 4JNWA 2I0YA 4MH7A 1YOLA 5E8ZA 4BI0A 5HTCA 4D2VA 4YBJA 3C4FA 4TNBA 5EOLA 4IBMA 4XRJA 3ZHPC 5E8TA 4AF3A 2CDZA 4C59A 3ALNA 3ZO1A 2CGVA 4C7TA 4AW0A 4KIPA 2WTCA 3D5XA 4EH9A 3HMIA 2XCHA 4TYJA 1XH6A 1UU9A 4JR7A 4FG9A 4B99A 1OL5A 4I93A 4CLIA 2ZM3A 4BDCA 5JN2A 4O7SA 2CLQA 2QOKA 3E8NA 4TNDA 3UC4A 5CVHA 1PJKA 3RPRA 2VTTA 3TUCA 3NAXA 4FEWA 1CKPA 4NIFB 3DAKA 4DFUA 3L8VA 4FG8A 4OBQA 5ANJA 3R01A 3SD0A 2V7OA 4D0XA 2G2FA 3LCSA 5KMLA 4B8LA 4LGGA 3PE2A 4EK5A 4LV5A 1JVPP 4F0GA 4NM0A 2QHNA 3GCUA 3ZO4A 3ZCLA 2J5FA 4A4XA 3BHTA 2W5HA 4AG8A 5LWNA 4BYJA 1ZARA 2YABA 4CV8A 5AFVA 2X0GA 4OTDA 3DK3A 2HIWA 4CNHA 5CVFA 3V5PA 3FZPA 2R3OA 3BX5A 3TKIA 4XJ0A 4I5HA 4O0XA 3PSBA 1TKIA 5CU6A 4PTCA 3SVVA 1YOJA 2YCQA 4JXFA 5CY3A 1W98A 4OLIA 1P2AA 1Y6BA 1U5RA 4UMUA 3GCPA 3QKMA 4TPTA 5KE0A 3NYVA 4ZTMA 1OM1A 3C1XA 2OXDA 4RQKA 2JKMA 2W9ZB 2GNFA 4QPAA 3FZSA 4TWCA 1R3CA 4IWPA 3W2CA 2GNHA 4YJVA 3C5IA 1ZZ2A 2NNWB 2WB8A 4B0GA 2WMRA 2OIQA 2QOHA 2BDWA 3D0EA 2Y8OA 3ITZA 3O8PA 4OBPA 5AR5A 1XQZA 1XH9A 5BVKA 4A9TA 4QP1A 3LPBA 3EIDA 3GU7A 3NNXA 3EKNA 4JT3A 4QTBA 4QOXA 3A7IA 2BMCA 3F5UA 3QWKA 4O7ZA 3Q2MA 4ITHA 3F3TA 4FMQA 4PY1A 1YWRA 2OO8X 4JAIA 2HYYA 4DLIA 4LRKA 3VHKA 3ZSHA 2YLFA 1CKJA 4WSQA 5CQWA 2R3MA 5LQFA 2F7XE 2W4OA 2WD1A 4TYHA 1KE8A 2C3IB 5AAGA 4O0RA 5C26A 3B2TA 2ZAZA 5DA3A 3RNIA 2XIKA 3ZZEA 2GSFA 3UBDA 4ZY6A 4F08A 2YERA 4D4VA 3FMJA 3Q6WA 4IANA 1TQPA 4M3QA 3PXQA 1EH4A 3F7ZA 5HO6A 4YJQA 3COKA 3Q3BA 4XUFA 4ZK5A 4ZJIA 3NWWA 4NM5A 2XK6A 5HI2A 4F63A 5KCVA 4O0VA 5CF4A 2CMWA 3QUDA 5C8KA 5HVKA 1WBOA 4XV1A 4M8TA 3R9NA 1JSTA 3VBTA 1DI9A 2Y4IB 5EM6A 5FUTA 4QMUA 5J5SA 2BR1A 2O5KA 2VTHA 3PY3A 2WMWA 2BVAA 3JUHA 4CGAA 3UC3A 2Y9QA 3MN3A 5D10A 2ONLA 3TI1A 3F3VA 5KMOA 1XH7A 4I6QA 1XBAA 5H9BA 3LHJA 4EYMA 1Q4LA 4YLLA 1OPJA 3HP2A 2OIBA 4P2KA 4U3YA 5EHLA 4FK6A 2XS0A 2JDOA 3CSVA 1IG1A 2VX0A 3MVJA 5TT7A 1WVYA 2VWXA 2HXLA 2WGJA 3E3BX 2QNJA 5DE2A 3MH0A 3UYSA 4GKIA 2HZ0A 2PZ5A 3FMHA 3DBEA 5BUJA 3ENHA 1GIJA 3LE6A 3QTRA 3C4ZA 3W16A 5DPVA 4D4RA 2IVVA 2VTMA 3MVHA 4IAYA 3R1YA 3UOLA 2VWIA 2XK3A 3MVMA 4BGHA 1OIUA 2XRWA 4QTCA 5BPYA 4N6YA 2E9NA 2BZJA 3EQGA 2HENA 5JH6A 4BDGA 4U80A 5AIKA 1YXVA 5I3OA 2OSCA 3EOCA 3NUPA 4E73A 5ETCA 2CLXA 3O23A 4E5BA 5JGDA 3ZM9A 3AD5A 4FV4A 4U41A 2C4GA 4ZY4A 3NVMB 3OY1A 4GK4A 3TN8A 5HO8A 3RHXA 2CKOA 3TDVA 3AMAA 4MF0A 4KRDA 2CJMA 4D0WA 1YDTE 2XKFA 3G15A 2GFCA 3QX2A 4FI1A 4L7FA 3AGLA 4XG2A 5K5NA 4MYGA 5BNJA 4FL1A 4LG4A 5I5ZA 4X6QC 3TJDA 5CSWA 3ZC5A
chains in the Genus database with same CATH superfamily
3ROCA 4FZ6A 4MNEB 3JXWA 2Y4PA 3NAYA 4I0RA 3BEAA 2HZIA 5M57A 3LQ8A 1UVRA 4HVHA 2WTWA 4D9UA 3DTCA 3ORLA 4KS8A 3EFJA 3E92A 4RLKA 5CEOA 4E3CA 3A4OX 5FM2A 3KA0A 3DJ5A 5C03A 4RLLA 3SXRA 2VO7A 4FTNA 1OB3A 1CM8A 2C0IA 2XZSA 2P2IA 3U51A 4EQCA 4MQ1A 2C5OA 2UZBA 4WG4A 3UDSA 1NY3A 4I6LA 1R0EA 4UYAA 3FLZA 3QXPA 4WUAA 4U45A 3HAVA 3TUDA 4G31A 3RGFA 4BBMA 5IA0A 3D9VA 3U4UA 2OJFE 3ZRMA 1IRKA 5FEQA 2AEGA 4BC6A 3P78A 3VF8A 4YTCA 2V5QA 3P0MA 3WZDA 4DH5A 4YHTA 4RWKA 3LFBA 2E9PA 3IDCA 2VX3A 3V01A 1VZOA 1YXUA 3ZEPA 1B38A 1JWHA 4B7TA 5A46A 5C9CA 4H1MA 3TM0A 1X8BA 2ZV7A 3IPHA 4G3DA 4GEOA 4JX3A 4HYHA 2PUIA 4O0UA 2O8YA 2UW8A 2W0JA 5K3YA 1VLRA 4D9TA 4QP9A 3VWAA 4AU8A 4GV1A 1YW2A 3KMWA 1MQBA 4JRVA 5D11A 2B0QA 4E20A 4HJOA 2GFSA 2QU6A 3OC1A 3HA6A 3TJCA 4ANQA 3CPCA 1F0QA 5AUWA 2LAVA 4AZSA 3N4UA 4H05A 3FXXA 3FQHA 4O81A 3MJ1A 5EQYA 1Z9XA 3TT0A 3WZEA 4QMXA 3UGCA 3UDTA 5FTQA 3UOKA 1E1XA 3W55A 1ZYSA 3UG1A 2PMIA 2IVTA 3RJCA 4W4WA 3HMPA 4C02A 2ITNA 5FTGA 1CTPE 1CSNA 4DEGA 1STCE 5IEVA 3UNKA 4O86A 3SRVB 3PG3A 3FSKA 3A60A 5FD2A 4O7VA 3GU6A 2VTPA 4MXAA 1APME 3PJ8A 4R5SA 5TKDA 4K11A 4FIHA 4IM0A 4YLKA 4EK3A 3DKFA 3TACA 4BYIA 4FSWA 3UJGA 3F88A 4OGRA 3FUPA 4K77A 1WZYA 3TEIA 4KABA 4PL4A 4HGTA 4ITJA 4ARKA 5IUGA 2B9JA 3W8QA 1SNUA 2C6OA 3IG7A 3PXZA 2YM8A 5FEEA 3ZDIA 3DAJA 4JG6A 1XH5A 5IH6A 3Q4ZA 3FKOA 1OZ1A 4EOJA 5A6NA 3NCGA 2FA2A 5J9YA 4FV0A 4PMSA 4RIXA 1RW8A 4LV8A 2GPHA 1PYEA 3B8QA 4F0IA 5KZIA 4YC3A 4YHFA 1Q8WA 4HCTA 3I0QA 4EUUA 5DVRA 3V5LA 4PMMA 1OIYA 3PIZA 5CU3A 4AGDA 2CKPA 4AN2A 2C0OA 3VN9A 3WZUA 3LM0A 3BQRA 4YPSA 1FGIA 3NCZA 5HBHA 5HLPA 4F09A 1O6KA 3FWQA 3DXPA 1YWNA 4R3RA 3L1SA 2JDVA 3MPAA 4G2FA 2WEVA 4KKEA 4APCA 1OVEA 1VR2A 4E1ZA 3R21A 1H1PA 1R1WA 3Q60A 3UQCA 1ST4A 4JBOA 4JAJA 3DV3A 4RIYB 5IUIA 4D5KA 2XEYA 3GNIB 5F9EA 3PLSA 5G6VA 5JSMA 2XM9A 3RZBA 4KKGA 1H8FA 1WFCA 2FYSA 1Q62A 4K2RA 1FQ1B 2H96A 3COIA 3FC1X 3QTSA 4GK2A 2IVUA 2ZV2A 4QQJA 4GT4A 5E8WA 2Z8CA 5BQ0A 2B1PA 4U81A 4XX9A 2PHKA 4CFWA 3DB8A 4FT9A 4O83A 3LJ2A 4AAAA 5BVWA 1SVHA 2I40A 3QRIA 3AC3A 4UMPA 1YQJA 3I79A 3HMMA 5H2UA 2ITPA 5J1WA 3FMDA 4KIKB 4EH3A 1XR1A 4L7SA 4JIAA 2HW7A 1YWVA 2DWBA 4PP9A 4RC4A 2PVRA 4M69A 2FSTX 3P9JA 2R3JA 2PMOX 3KN6A 4FC0A 1J7IA 3QQKA 4FKPA 2VAGA 5LVLA 4MX9A 3S0OA 4QTDA 4RWIA 1W7HA 2OJ9A 3DZQA 4IB3A 2YCSA 2ITVA 3FKNA 4YSJA 3RPVA 2VTSA 4TY1A 3R8ZA 5CAOA 3F2RA 3QF9A 4U3ZA 3OT8A 4EHZA 3EKKA 2Z02A 3MB6A 3VJNA 2QLUA 3IGGA 5M4UA 3BI6A 5EQPA 3P23A 3PPJA 4PPCA 5EQEA 3MVLA 2BKZA 1H1SA 4MEDA 1OITA 1YRPA 4RQVA 4V0GB 4MCVA 2WMBA 3MW1A 4IXPA 5DEYA 5AWMA 3RTPA 3Q6UA 5EK7A 3ATSA 1AQ1A 4L3LA 2ERZE 2FB8A 2PVHA 3CLYA 2PUUA 2WOUA 4BKJA 5K5XA 3V8SA 2PSQA 3W33A 4ORKA 1VYWA 4LDTA 3MS9A 2WTKC 5FXSA 4RX7A 3RINA 1W2DA 4JMQA 1QPJA 4RGJA 2B4SB 4DGLC 2IPXA 3O17A 4E6AA 2OU7A 1WBTA 5E1EA 4V04A 4I5MA 3ZONA 4EONA 3MH3A 5LMKC 4R1YA 2I0EA 3QGWA 3RCDA 4O27B 3CTJA 3WZKA 3LXNA 3I60A 3O50A 4E4MA 4FIJA 4O91A 5CALA 4FJVA 3ORMA 5J5TA 5JGBA 4G5JA 1O9UA 1ATPE 2G01A 4FBXA 4MNFA 5CQUA 5KKRC 4N57A 3GBZA 4G5PA 3KXHA 3OCGA 4IB5A 2VO0A 3REPA 3FJQE 1M7QA 1MRVA 3CE3A 1OGYA 4J7BA 3CS9A 2VNWA 1OKVA 3R7YA 3EQFA 2BKKA 5EM5A 2CSNA 2FGIA 2FSLX 4USDA 5IEYA 3QL8A 4RIWB 4UZHA 3UG2A 5JKGA 2ITOA 4E4XA 2JAMA 4BTJA 3ZMMA 1Y57A 2QOQA 2BZIB 5F95A 2NRUA 5FEDA 1H0WA 4EH2A 3QKKA 4AXDA 3QUEA 5FDXA 2RGPA 2J51A 4ZIMA 2PULA 4PRJA 4XBRA 5LWMA 4J96A 3EQHA 3C51A 4F9BA 2W4JA 3NMUF 1IR3A 4ZY5A 5GZAA 4AE9A 4BN1A 3QX4A 3I81A 2X0PA 3NNUA 3NYOA 4C3FA 3QD0A 4UEUA 4NWMA 2RIOA 2X39A 4UYNA 4EOSA 1AD5A 3AKKA 4JG7A 4MQ2A 4IAZA 4FV9A 4FTOA 4X2FA 4WIHA 5IQBA 1LP4A 1UNHA 3VUMA 4C62A 3ZYAA 4BCNA 4RJ6A 2QR8A 3PA3A 4MBLA 3LCDA 5B7VA 1XHAA 3PA5A 2R64A 2W99B 3AC4A 2Z7RA 3H9FA 3LAUA 3ORZA 4RX5A 3ZXTA 4ZLOA 2R3GA 5AMNA 5CU4A 3PXYA 3FQEA 2J0JA 2EVAA 3LMGA 4FEQA 2IVSA 4NTSA 3WF7A 2OG8A 2C5VA 4B8MA 4FVRA 3TUBA 4NH1A 5L2WA 3ZO2A 2YM5A 4HPUE 3Q9ZA 2PVFA 4C38A 5IH5A 3SV0A 1TQIA 2YEXA 3EHAA 4YJPA 4DFBA 4UV0A 3DS6A 2PWLA 2YIQA 1KUTA 1KE7A 5IEXA 3EZVA 4CFMA 5LVOA 3IW6A 3NIEA 4QNYA 4QDVA 2YDIA 4HGEA 2HZ4A 4K0YA 4RJ3A 3JR1A 1NXKA 2W05A 2C6DA 2WQBA 3LFQA 5DOSA 5BYZA 3TWJA 4XHKB 2F4JA 3CY3A 4FSMA 3VBXA 2OGVA 4RG0A 3O8TA 1NW1A 2C68A 5AP0A 3FMMA 2UVYA 3S3IA 2GTNA 4APPA 5ACBC 3S1HA 3WE4A 4I6HA 3C0GA 4AOJA 4F7NA 3D7TA 3DDPA 3HDMA 5K9IA 3A8WA 5CEKA 1O6YA 5JFVA 4LV7A 4L68A 4KAOA 4WRGA 3C5UA 3UYTA 3LM5A 4X2JA 1H27A 4E7WA 3HP5A 4J53A 3WF9A 2ITUA 4MBIA 4DG0E 3TZMA 2R9SA 4I94A 3A7GA 2E2BA 3SXFA 4EYJA 5B2MA 4JOAA 4Y5QA 2BAKA 3PTGA 5FQDC 5L2QA 3AC2A 2GQGA 5F20A 3ZLSA 3WF5A 4BHNA 3PUFC 4JDKA 1GJOA 3C4XA 4KNBA 5M09A 3FZRA 4RJ4A 5LARA 3ET7A 5AV1A 3NLBA 3QCQA 4QPMA 3LLAA 3ULIA 3QALE 2WQMA 4G6LA 4XOZA 3R9HA 4GK3A 5E8UA 5EH0A 1PF8A 4YR8A 5JQ8A 5L8KA 4NT4A 3W8LA 1OKWA 2ZOQA 4ZTRA 4CZTA 4WA9A 3P86A 4EK4A 4AN3A 4LMUA 2JITA 3IONA 3OXIA 3CGOA 3LFEA 4AFJA 3K3IA 4FICA 2JKKA 2PZYA 3O5AA 3GOPA 3ZUTA 1KE9A 2GDOA 2JAVA 1SVEA 3QHRA 4YZDA 5AR4A 3DLSA 4FVPA 5HNGA 3W2PA 2QO9A 2JDRA 2BIKB 2NPQA 2UZUE 3P4KA 2UW5A 3IO7A 3BE2A 3NUXA 3CKWA 3R1QA 4P5QA 5HOAA 1WBVA 3LLTA 4RPVA 2VTIA 5BVDA 4BJJB 3B2WA 1XMLA 1KE6A 3PIXA 1SVGA 1JKSA 4S34A 2JD5A 4ZTLA 4AA4A 4ENYA 5KKRB 4CMOA 4XV3A 4D58A 2R2PA 5HORA 3VBQA 3HV7A 3OCTA 4N4SA 1PRYA 3HRCA 3JVSA 3VRZA 2IW8A 2VTJA 4L42A 3HV5A 3I7CA 4DEIA 4TRLA 3SX9A 3E8CA 3DFCB 1QPCA 4U43A 4C34A 5KUPA 3ZDUA 4CG8A 4FSYA 3PUPA 3OS3A 4TT7A 4CFNA 2VWYA 2ERKA 4OW8A 3N4TA 1ZY5A 5IA1A 1KOAA 4F9AA 2H6DA 3RAIA 2WAJA 3EN4A 5EYCA 4PTGA 4GCJA 3W18A 3D2IA 3R04A 4PNKA 4MXCA 3ZUVA 4XG3A 2PVMA 3CBLA 3BYUA 2ZV9A 3RAKA 2C5YA 3GENA 4FKLA 2QOBA 5D7AA 4CT2A 5L2SA 5DEWA 4CFUA 5CAQA 4GJ3A 3LW0A 3MA3A 1U54B 4XG4A 4FSUA 5A54A 2J4ZA 4EH8A 1V0BA 5AAEA 2W17A 3SXSA 5A14A 2I0VA 3A7JA 3PVUA 1MP8A 4GSBA 4A07A 2UVXA 3G33A 3TKHA 3I5ZA 3GFWA 3GT8A 4LRJA 2ONLC 3TYKA 5JT2A 3UZTA 3NW6A 2C3KA 2OH0E 5KHWA 4EZ7A 1FOTA 3V3VA 3CEKA 3VS3A 2ESMA 2G15A 5T3QA 2UZDA 4L3PA 4LGDA 4H3QA 4AZVA 4MUQA 2QI8A 3G9NA 3NS9A 2WELA 5C1QB 2W1HA 4EHGA 3QQJA 5CLPA 3QLFA 2YACA 2B9IA 1S9IA 4ZZMA 2Q0NA 5EDPA 5AUUA 2XNEA 5I9WA 4JL9A 5J7HA 3R00A 3UZRA 1DAYA 3TNHA 5IF1A 2QOFA 1PKDA 5D9HA 4DCAA 4JJRA 4BDDA 4PP7A 3W2RA 1FPUA 3FYKX 2QONA 4CQGA 4PDSA 3UOHA 3C4CA 1BYGA 4J8MA 4PL5A 2GHLA 2C6TA 2CCIA 2XNBA 3RP9A 4I41A 2C6MA 4B6LA 3Q32A 4L44A 4R5YA 4AZFA 4YLJA 2WQNA 2CN8A 5GIOE 2BAQA 2O63A 4PMTA 4EORA 3IECA 5JGAA 3IKAA 4MAOA 3R8LA 2R3IA 4CV9A 4G9RA 2W1IA 3V8WA 3MFSA 5AM7A 4FTMA 2JLDA 3OXZA 3LIJA 3P1AA 3UODA 2C6KA 1YXSA 2P55A 3PA4A 4FOCA 2F2UA 5IKWA 3I7BA 3GC9A 3WIGA 4L6QA 3SOAA 1PXKA 4FUXA 4DEHA 4E8AA 4C4FA 4UMRA 1RE8A 5J7BA 4JRNA 1SNXA 4G17A 4XV9A 4I23A 3VF9A 4Y46A 4YU2A 1UU7A 2P33A 3R7OA 2VTAA 3KU2A 4ZEGA 2J0IA 4IWOA 3BGQA 1WAKA 4O7WA 1QMZA 2PMNX 2XIXA 3QZHA 4G16A 5E91A 3VUIA 4BTMA 5L2TA 1OKZA 3BV3A 4IZ7A 1JQHA 3BBTB 1JSVA 2V55A 3BRBA 3GU5A 4Y85A 2X7FA 2VTOA 4K6ZA 2R3RA 1IA9A 4UN0C 3L8SA 4PDPA 4AZEA 2WMAA 4NTTA 3N9XA 4DC2A 2YIXA 1OIRA 4KWPA 1PKGA 3Q52A 3TV7A 4QYHA 2GS2A 5HLWA 5KMMA 4FZDB 3UVQA 1G8KA 5JK3A 2B9FA 1Q3DA 2B54A 3TKUA 4HCVA 3UOJA 4DDGA 5H8EA 3V5WA 4YMJA 3BYMA 4M0YA 4ZSJA 1J91A 4F7SA 2QOLA 1E9HA 4RVLA 3PZEA 1YDRE 5HQ0A 1H07A 2X4FA 5TOZA 3RPOA 1ERKA 2GTMA 2JBOA 3C0IA 3IS5A 3F9NA 3K2LA 2XNMA 3LFSA 4EH6A 4IAIA 5DMZA 4O7NA 3TDWA 1YI6A 4K33A 4EOIA 2J90A 5HICA 3KEXA 3ORXA 1QPEA 2YM6A 4J95A 4HOKA 3HV4A 2W1DA 3VS5A 3OP5A 1U5QA 4ZSLA 4BHZA 4BVUA 5A4TA 3S00A 5IQDA 5E92A 2IWIA 2RFDA 4TYHB 3F3UA 4MXXA 4WBOA 4IC7A 4I0SA 4EOOA 3FY2A 4ENXA 3CXWA 3WIKA 5AV3A 3OWJA 3PXRA 4QP2A 4NK9A 5DT3A 3VUDA 5KHXA 2BHEA 4AFEA 1GIIA 2BILB 3ALOA 4UXLA 4KIOA 1T46A 5DR2A 4ACMA 3CKXA 2CGXA 3LJ1A 4D1ZA 2Z60A 4IWDA 4RVTA 2A0CX 4J8NA 3OY3A 2YIRA 3KXNA 4H58A 2XYNA 5CAPA 3G2FA 4E4NA 4YZMA 2R0IA 5I9VA 4AX8A 4F9WA 2A4LA 4O22A 5ETAA 1W8CA 4QMVA 2GQSA 4L43A 3RHKA 4NJ3A 2CCHA 1R0PA 2YM3A 2OW3A 3BU6A 3I4BA 3BQCA 4FA2A 2SRCA 4NEUA 4FGBA 3U9NA 4DFXE 5IDPA 2A27A 2WQOA 4BIDA 4J97A 1JBPE 3KMUA 4FV6A 4EZ3A 5AP7A 3ZXZA 3W0QA 1IASA 2BHHA 3QQLA 3DXNA 5HD7A 2JC6A 3LQ5A 4XLVA 3VAPA 4QMOA 5GIPE 1XH4A 4IFGA 3KREA 3FBVA 2QG5A 4IX5A 3VJOA 4BTFA 4EEVA 2PE1A 3GQIA 2VD5A 5IQCA 2W1FA 5A3XA 3F7WA 3HEGA 1T45A 5GJGA 1ND4A 3VW8A 4WOVA 3PSDA 5CXZA 4HVGA 4NU1A 4X2KA 3D4QA 2J7TA 4O82A 3V5TA 3C7QA 2BTRA 2BFYA 4NW6A 2JKOA 2VU3A 2X0QA 3MFUA 4C8BA 1FINA 4BB4A 3OMVA 2FSMX 1SM2A 1VJYA 2WIHA 4A9YA 4E6DA 4L67A 5AADA 2BUJA 3EL7A 3OTVA 3I0OA 1OMWA 3AC1A 3FXWA 1M2PA 4FKVA 1WBSA 3EQCA 3R7IA 4GKHA 3MBLA 3OOMA 3E8EA 1ZYCA 3CD3A 4IZAA 1ZMVA 3QWJA 3OD6X 4UY9A 1PXOA 3AD4A 3OF0A 3HYHA 5LMAA 4HVIA 2JDTA 3VQUA 4C4JA 4EBWA 4TL0A 1QL6A 3LMHA 2QD9A 3R1NA 3QZFA 3DJ7A 4WBBB 2OIDA 4IIRA 3UVRA 3R63A 4QMMA 3ORNA 4ZLZA 2RSVA 2BALA 3Q9WA 4WNMA 2QQ7A 4YO6A 1YI3A 3FL5A 4JQEA 4OTRA 4RJ7A 1JKLA 3RPYA 5AP4A 3CTQA 5FBOA 3IW8A 4BTKA 5FDPA 3LXKA 2BDFA 5J95A 4EHEA 4LOOA 3BLRA 5EDQA 3TNPC 2VX1A 2Q83A 2OZAB 1GIHA 2UUEA 4MBJA 3HDNA 3QYWA 3TV4A 4BCJA 5CT0A 2C6IA 2UW4A 3W2QA 2PU8A 2OWBA 3KXXA 4I20A 4UZDA 4ANSA 1OL1A 3G0FA 4O2ZA 3EB0A 5DR6A 2QKRA 1PY5A 2RKUA 4J99A 4G1WA 4A9RA 2EXEA 3R02A 3OZ6A 4QYYA 3COHA 5CASA 1XJDA 4F70A 3CD8A 4IAAA 5EYKA 3NSZA 4TYEA 5AIRA 4EH4A 3V51A 5A6OA 2W7XA 2NP8A 5DYJA 2P2HA 1R78A 5HE0A 1H1RA 3SKCA 4EQUA 5ANOA 2WKMA 3LJ0A 4O4BB 2QOOA 4X2NA 3H3CA 5EW3A 1Q8YA 3DPKA 4J98A 2YM4A 4O4EA 5L8JA 3MESA 4FEUA 3PWYA 4LUDA 1IAHA 3WARA 3PLAE 4A4OA 5A4LA 2NYAA 4XEYA 1OKYA 2AC3A 3H0YA 3MTFA 3PRFA 4UXQA 3RPSA 4D4YA 4O4FA 2XF0A 1GNGA 3CQUA 3D94A 5AP5A 3W2OA 3UQGA 4BZNA 4ZSAA 3FI8A 1YXXA 1S9JA 4P5ZA 4PUZA 4FEVA 5AUXA 3LZBA 3JY0A 3PVWA 4N0SA 5TO8A 4BDKA 4EOMA 1ZWSA 2I1MA 4FL2A 3MI9A 1WVXA 2XKDA 3KRJA 2IW6A 4IJ9A 2C3LA 2W4KA 3FYJX 5DR9A 5IMXA 4DINA 4FKJA 1GZOA 3LVPA 3OFMA 3AC8A 5I9ZA 4TWPA 1YXTA 2Z7LA 4FIEA 4QTAA 5CANA 1UU8A 1ZRZA 2QOCA 3PY1A 5BUIA 1M2RA 5CF6A 3E7VA 4Q2AA 4EOLA 5JZJA 4CLJA 5IA3A 3FLQA 2XJ2A 4R7HA 5IUHA 5DLSA 4AQKA 1DI8A 4ZJVA 4IMYA 2WTDA 3KGAA 4M0ZA 4BDHA 4YURA 5JMSA 1F5QA 3BBWA 3ANRA 3F61A 4I6BA 5IA2A 4AXCA 5KMJA 4JI9A 3POZA 4EWQA 2UW3A 3DKOA 2IJMA 4L46A 3PJ3A 4RIXB 4M13A 2BZHB 2VZ6A 3FE3A 3ROYA 4DTBA 2VRXA 2J0LA 3ZLWA 3K3JA 1DAWA 5DT4A 2YCRA 3BYOA 1W2FA 4BBEA 3PDTA 4BCPA 3KULB 2IZUA 2GCDA 3P08A 4JVGA 3VNTA 1NT2A 4I4EA 2WHBA 3PSCA 4NCTA 4YHJA 3NYNA 5DRBA 5LXMA 4GMYA 5ACKA 3KXMA 3VS4A 4F1TA 3FY0A 4HCUA 2V62A 2CNVA 4HNIA 5TR6A 2OXYA 3W0RA 5AR8A 3Q5ZA 3IW5A 4GFOA 2C1AA 2C47A 2GS7A 4QMWA 5HLNA 3QTXA 2YM7A 5H3QA 2FSOX 4M84A 4HNFA 4BDBA 2X8IA 4YZBA 3B8RA 4FKTA 2XA4A 4YJSA 1W82A 4U40A 2IG7A 4Y95A 3KN5A 4JS8A 3MH1A 3M42A 2J0MB 3KXGA 4RA4A 4UMTA 3TIYA 2YDJA 5IH4A 4J1RA 4K1BA 4AWIA 1CDKA 5GNKA 1Q8UA 1A48A 3D5VA 2BTSA 2CHLA 2R7BA 3EZRA 3GCVA 3UDBA 1OUKA 2IN6A 3MGYA 4IB1A 5CSHA 3EFLA 3SRVA 2X1NA 2IO6A 2F7EE 3EN5A 3OEFX 4XNEA 3UMXA 4AOIA 2XALA 4FSZA 4DFYA 3UPXA 3VQHA 4L52A 4F9YA 3QLGA 3II5A 3BGPA 3R8PA 4F4PA 3FAAA 3F82A 1LUFA 4ZTSA 3RKBA 3MPMA 4FODA 2WMXA 4NM3A 2B55A 4U79A 4EQMA 4M69B 1XWSA 2OJGA 4PL3A 5T68A 3KIOC 3U55A 5AA8A 3U54A 3E7OA 1AGWA 4R7IA 3OCBA 1P5EA 4FTQA 1XH8A 2X7GA 3RWPA 4E6QA 4QP3A 3QQUA 3ZRLA 4WRSA 3EJ1A 5ICPA 3QA8A 4FEXA 3PP1A 3GC8A 4E26A 3BHYA 5ANGA 1M7NA 4UWCA 3C4EA 3FI3A 4ZLYA 2YZLA 1MRUA 2JDSA 5IZFA 1GZ8A 4FNZA 4FSTA 5DHJA 1UWHA 3LCTA 5BVNA 3TXOA 3D83A 4FYNA 2WO6A 3UTOA 2EB2A 3EQBA 5IQIA 4ZTQA 5I9YA 4CMUA 2PVNA 3MWUA 4TWOA 3PJ2A 1IEPA 2CPKE 4CFXA 4NZWB 4YPDA 4F1OA 3VIDA 3ZFXA 2W5BA 2QR7A 3QD4A 2PY3A 4TKSA 3LXLA 2HWPA 2YIWA 1PXPA 4B4LA 3U6IA 3DJ6A 1ZYDA 4QYGA 4XH6A 5EW8A 3WYXA 4D5HA 4K18A 1DS5A 4DN5A 4O0WA 2UVZA 1Q24A 4QTEA 4BWKA 3BU3A 4EHVA 1BL7A 4OTWA 3BELA 2R4BA 3PPKA 3F3ZA 5BVEA 4ANLA 4AT5A 2XBAA 3ID6C 4I5CA 3WF8A 2CNUA 3G9LX 4FIFA 4KIKA 4K8AA 4G3FA 5GJFA 2CN5A 2OFVA 3QRTA 4IVCA 2F9GA 1NVRA 1ZMWA 3FXZA 2ZB0A 5KBRA 2UZWE 1G5SA 4NL0A 4I24A 1TZDA 3DQWA 5M06A 2XNOA 4JDIA 4RZVA 4HVSA 3TNQB 4TXCA 2P4IA 3DBCA 5EM8A 4QQTA 4RA5A 3LFFA 4UBAA 1J3HA 3M1SA 4OTFA 4M7IA 3ZBFA 4BF2A 4CTCA 5J1VA 1PW2A 5HIEA 2Q0BA 3C0HA 4GU6A 4F65A 4DAWA 3NW7A 3N51A 3QHWA 2GNLA 2OLCA 1M2QA 4LI5A 4BCHA 5KMNA 2QURA 2REIA 4FTKA 3AQVA 3FSFA 4IAKA 3A7HA 4RVMA 5HTBA 4S32A 2E9OA 3O8UA 3QA0A 3R1SA 4EOPA 2Z7QA 5BVFA 5IMEA 4QYEA 3KL8A 3HRFA 2VUWA 5AUTA 3U9CA 4L01A 2XK4A 3EYHA 2GHMA 2C3JA 2XIZA 4IC8A 2BDJA 3AGMA 1BMKA 5E1SA 1Y8GA 4FIGA 1U59A 4BR3A 3QTZA 3P79A 4BDJA 4ASXA 3U6JA 3VS6A 2DUVA 2VNYA 5AP3A 1E1VA 3KCKA 1ZY4A 4QMLA 2YHVA 4F7LA 3M11A 4S30A 2QCSA 4R77A 3NR9A 4M97A 1REKA 1SMHA 2A98A 4OT5A 4RBLA 5EI8A 5EHYA 3BPRA 5FXQA 3UIMA 5M07A 4LGHA 4DBNA 1Q99A 4G6NA 4O1OA 4QRCA 5GJDA 3AMYA 4QP6A 4FRFA 3S2PA 5JEBA 1KV2A 5JFXA 4RFMA 1KV1A 1PMUA 1Q5KA 4HW7A 3FZ1A 3DBQA 4MD9E 4CFFA 2XCKA 2E9UA 3UIXA 3V6RA 4EC9A 2VWBA 4JQ7A 3GVUA 5IPJA 5M56A 4X3FA 1XBBA 3AMBA 5H8GA 3A7FA 2NO3A 5D7VA 5ETIA 2UW7A 3A4PA 4WG3A 4RJ8A 3WBLA 3E62A 4A7CA 4CKRA 2UZEA 4KBAA 1YHWA 5DWRA 5CEQA 1W84A 4ACHA 5IQFA 5IQGA 2VTQA 3DZOA 4AOTA 3MIYA 1J1CA 3WILA 1URWA 4ZSEA 4FV8A 2I7QA 3V8TA 3UE4A 3A61A 3KVWA 5F1ZA 3SC1A 1P4OA 1FGKA 4ERKA 5EOBA 4ZOGA 2HCKA 4WNKA 4Z16A 1ZAOA 4PQNA 3KQ7A 3R7UA 5LCJA 3ATTA 5GZ8A 3TZ8A 3BL9A 4IWQA 5FTOA 4PMPA 4QMPA 3FHRA 3R83A 3HZTA 3RM7A 5HCXA 2PUPA 3OCSA 4XG6A 3ENMA 5FM3A 4BBFA 4U5JA 1JAMA 2OH4A 4UX9A 3PYYA 3MV5A 4KRCA 5H8BA 5IDNA 4JBPA 2ITTA 5CWZA 4AXEA 4FTAA 1OUYA 3ORTA 4FV2A 2RG6A 4BDAA 2PL0A 3P7AA 2ZDUA 4AA5A 1NVQA 3RAWA 2VN9A 1UA2A 4YUQA 4FK3A 4NUSA 4BIBA 2W1CA 4Q5EA 5DNRA 5E90A 3HGKA 3ODZX 4FSQA 4FKSA 3E8DA 4IADA 4KA3A 3VHEA 4D4SA 2YFXA 4QMTA 4XG9A 4D2RA 3OVVA 2YJRA 4ZS0A 1J1BA 5E8XA 3VS2A 4AGUA 1Y8YA 3HLLA 3P5KA 3BE9A 3DK6A 1ZZLA 1QCFA 3Q4CA 1A06A 3H4JA 3EN6A 4KSQA 1IAJA 1CMKE 3QQFA 4Z3VA 2VGPA 1HOWA 5B2KA 2YCFA 4RRVA 4DHIB 1W83A 4U7ZA 4F6SA 4WG5A 4KUJA 1UWJA 5A4QA 2XYUA 3R7VA 2H9VA 4IACA 3VUGA 4ZMEA 2ETKA 3DNDA 3BGZA 5AR3A 3HKOA 2IEWA 4I4FA 3SOCA 4DEEA 2A19B 4NM7A 5LCKA 1FVTA 2UW0A 5DG5A 2WFYA 2RFSA 3DDQA 3SW7A 5JRSA 4HVDA 2WTKB 4FTRA 5HU9A 2WMQA 2XMYA 2BCJA