4X3JA

Selection of fragments for kinase inhibitor design: decoration is key
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
280
structure length
234
Chain Sequence
VLKARMDAAIKELEVLCKLGHHPNIINLLLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRNLAARNILVGENYVAKIADFGLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
publication title Selection of fragments for kinase inhibitor design: decoration is key.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 234
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4x3jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4x3jA01
3CJFA 2EWAA 1VEBA 2FSTX 2OICA 4KKGA 4M15A 3MA6A 4HCVA 4ZXTA 3BRBA 2WEIA 2QO2A 1K3AA 4I0RA 3NNXA 1URCA 3FYJX 4PDOA 4AACA 2QR8A 2I6LA 5H9BA 5HX6A 4KSPA 2FUMA 3WE4A 4GU6A 4FKSA 4XP3A 3Q9ZA 1FGKA 2PVNA 4U40A 5EFQA 1YHVA 4IAIA 4XNEA 2BZIB 4ITIA 3DDQA 3P78A 4ITJA 1KOBA 2P0CA 3G0FA 5HHWA 2IZRA 2DYLA 4C35A 3BGZA 3H0YA 4G16A 3RPOA 4D2PA 1I44A 2W4JA 4L9IA 4M3QA 3NNUA 4MHAA 4EK6A 4NL0A 3LM5A 4X2KA 3G33A 2R4BA 4X7QA 3RAHA 2WMSA 3RWPA 5KBQA 3UOJA 3OT3A 4BDFA 4C58A 4IADA 4OAVB 1F3MC 5HEZA 2CNVA 5HNBA 5EHLA 5E90A 4ZJIA 4EHGA 3LQ8A 1XKKA 2QU6A 3DLSA 1XH8A 3LJ0A 3QU0A 4GSBA 4KWPA 4XUFA 4C3RA 4OBPA 4F6WA 3O2MA 4O27B 3R2BA 4C2WA 4FZDB 2PYWA 4MWIA 3R7YA 5K0KA 4FR4A 4OTGA 1JKKA 3PVBA 4U43A 4WHZA 3LFCA 2OZAB 1ND4A 3B8RA 4OT5A 4H39A 5A4TA 1IA8A 5ETCA 2VTIA 3UYTA 2XYUA 3PSDA 4Y5QA 4ZTQA 1PKDA 4O0XA 2IN6A 3BEGA 4ALUA 2PUNA 4C4FA 4O6LA 5CI6A 4EC9A 3UOKA 5IA3A 3Q2JA 3GC9A 2ITXA 3ZU7A 5LVMA 1FVRA 3GXLA 3KC3A 4RIOA 2WXVA 3Q04A 4FK6A 3QHWA 2UW8A 3KU2A 2QOOA 5C9CA 4CRSA 1XH6A 3BLHA 1K2PA 3R28A 4ACHA 3FLSA 3V5TA 2BMCA 4L7FA 2OLCA 3H10A 3QZGA 3TZ7A 4JAJA 4ENYA 3SX9A 1YXUA 5A9UA 3E93A 2GNGA 3UNZA 3HLLA 4YJQA 3VF9A 3E8CA 4YJTA 4CFNA 1DAWA 1YW2A 2X8EA 3KULB 2WQEA 2ESMA 3V04A 3R00A 3R04A 3LVPA 1PXPA 2E9PA 3QKMA 1WCCA 4O84A 3UOLA 4Y72A 3VO3A 2VWZA 4JG8A 4O0UA 4CEGA 2BALA 3ETAA 3ZSIA 1GZOA 3F2RA 3IGOA 5BVFA 1CMKE 2Z7SA 4J52A 3FEGA 4QPMA 1YXTA 2RF9A 4J53A 2WMXA 2DWBA 3FQSA 3PIXA 4I22A 4IB5A 3A61A 3I4BA 3OCBA 4LOPA 4BDJA 4DH8A 2UZOA 5LVOA 3BE9A 3HA6A 5A4LA 3MW1A 1NW1A 3R7UA 1YWNA 3PFQA 4ANLA 5FG8A 3ZUVA 4AA0A 3PLAE 3LXNA 2PSQA 2XM9A 3A7JA 2Y0AA 4FIIA 3BU6A 2C1BA 3FQEA 2W1FA 4LUEA 5BVNA 5FXQA 5IQHA 2J90A 4UX9A 1REJA 2IVSA 2OKRA 3CXWA 3E64A 3PRFA 4KS7A 4S2ZA 4RWLA 5CI7A 2QONA 4FV5A 2EB3A 1MUOA 3JUHA 1OKYA 2RGPA 2YDIA 4GIIA 3QCSA 2KULA 2XKEA 2YM8A 2GS6A 2UUEA 3OEFX 2XIXA 1MRYA 3V5LA 2XNPA 3MVMA 4JRVA 5IQEA 4LOQA 3C4ZA 2R3OA 4YLLA 4GFMA 4JT3A 4RJ4A 3ALNA 4E1ZA 2W1CA 3ZH8A 5FQDC 1XBAA 2BVAA 3W32A 5M4UA 3BGPA 3SA0A 1A06A 3HMIA 4RMZA 4EUUA 1Q3DA 3IW5A 3QQLA 1UKHA 3Q9XA 4QNAA 4I6BA 5J9YA 3TEIA 5EG3A 2W5BA 3R7EA 3W1FA 5LVPA 4G5JA 1PMEA 3TXOA 4U3YA 2AC5A 4ZZOA 1X8BA 3COIA 1V1KA 5FD2A 3ZDUA 2YCRA 1J3HA 4WG4A 4USDA 2VTPA 4TNDA 4DCAA 4LI5A 2IZUA 1G5SA 2YACA 5DGZA 3NVMB 3I1AA 4ASZA 2ITNA 4G3FA 5AUWA 2R3FA 3F3TA 4W4XA 3BQCA 3KF7A 4CXAA 1TKIA 4FX3A 2BRGA 4E20A 1XH9A 1U54A 2ACXA 3DJ7A 4KRDA 5BYYA 1BL7A 3PVUA 4O7VA 4QOXA 5CT7A 2PMLX 4YLKA 4GEOA 1OKWA 4FSQA 4I24A 5EI8A 2WPAA 4BZNA 4ANMA 4CMOA 5I5ZA 2XIRA 4OTHA 4CLJA 4YGAA 4H3QA 3ORLA 4FKUA 5JT2A 1OM1A 2CSNA 3VS2A 4CRLA 4QPAA 2NO3A 2ZB0A 4NH1A 4JG6A 1SYKA 2PUIA 4I41A 4ZSEA 1NVSA 2OIDA 1JNKA 3PY3A 4AG8A 1PMNA 3EQPA 1NT2A 4CFMA 3QLFA 4B8MA 4LQMA 1MP8A 2B7AA 2X1NA 2W1HA 4F1OA 1PHKA 4FV8A 5KMOA 1OIYA 4X3FA 3WF8A 1M7QA 4OBQA 3IDCA 3W33A 4X3JA 4HYSA 5EI2A 4QNYA 2YHVA 5HBJA 3DQWA 4W9XA 4EI4A 4OTDA 3TKIA 2FVDA 5J7BA 2EU9A 1RE8A 4DAWA 5DRBA 4EZ3A 4FV4A 4M66A 3VS5A 3ULIA 3QGWA 4FV9A 4X2NA 3I5ZA 4H3BA 3ZEPA 3R7VA 4CVAA 1HOWA 4UWYA 4RLKA 1YI6A 4ACMA 1YDTE 4YC3A 2C0OA 2Y8OA 4LOOA 3SRVB 2JIUA 3TNQB 4QP2A 4CT2A 4EOIA 2WOUA 3QX2A 1XH7A 4IVDA 1H00A 3QKLA 4M14A 4APCA 4DGLC 2OFUA 3AQVA 3HECA 4JR7A 1SZMA 1E9HA 5DFPA 3OP5A 4RVTA 2GNFA 4ASEA 3ZM9A 3R8UA 4CT1A 5J79A 4AZSA 1OVEA 4K9YA 3ORZA 3G5DA 3SV0A 3FZPA 3LFSA 5C8MA 3IW4A 4YTFA 4BDKA 1GIIA 5D1JA 4QTDA 4N6ZA 3W8LA 4KINA 2X0GA 3E88A 2VO3A 5IZFA 4WNMA 4BCQA 5KMMA 4F0GA 3U51A 5TR6A 4IVBA 4PUZA 2YIQA 1FVVA 2ETKA 2VTAA 4FT0A 4AZEA 4ERKA 1UU7A 2UW9A 2HZIA 2QD9A 3MA3A 3TV6A 3G90X 5TT7A 3LAUA 4EQUA 1CTPE 3JY9A 5E8WA 2PMNX 4IW0A 4QP9A 3A7GA 2XKCA 5IH6A 3FMLA 2Q0NA 3F5PA 2WOTA 1Z5MA 5BMMA 4EOKA 5LJJA 5IEXA 4MYGA 4RX8A 3V3VA 3P0MA 4JJRA 5HVYA 3FXZA 2WTVA 3UC4A 2J5FA 3ACJA 4BGQA 4IWPA 4K33A 3PZHA 2ONLA 4DH7A 4USEA 5M4CA 3DKOA 4RWKA 3IOPA 3PSCA 3EFKA 2ITVA 3UIBA 2GHMA 4BKYA 4ITHA 3VUMA 3RAKA 2QOCA 4AWIA 5L6PA 5GJDA 5J1WA 3VJNA 4FICA 3W2CA 4CMUA 2C6TA 4YPDA 4G31A 5J9ZA 2YCSA 4XBUA 4F0IA 3QBNA 4R6VA 4XLIA 2OJIA 4BVUA 4FEUA 5HQ0A 4ZSJA 2B9HA 4NFNA 2O3PA 4B0GA 4F63A 1O6KA 4RFMA 1NVRA 1O6YA 3CS9A 4FK3A 2WQOA 2EUFB 3P7BA 1W7HA 5E91A 2ITYA 1IAJA 4FYOA 2XP2A 2YFXA 5DR9A 2ZM4A 4FTCA 1BLXA 3ZLSA 2OJFE 2V62A 1J7UA 2E9VA 3HAMA 3U6IA 3ATTA 4U80A 5IQCA 4Z9LA 4ZEGA 4DGGA 1H8FA 3P5KA 3R1YA 3Q32A 4IWOA 3MH3A 4PTGA 5AM7A 3F6XA 5KE0A 3O7LB 4C2VA 4ENXA 3R30A 3L8VA 4X2JA 5AIRA 4BCIA 5HIDA 4O7WA 3IECA 3GP0A 2X39A 3LXLA 5HLNA 2ZDTA 4GUBA 3PY0A 2BKZA 4AGUA 4MH7A 4PMPA 5KKRC 2PULA 4UYNA 3MPAA 4X6RA 5BYZA 3DXPA 1XQZA 4NEUA 3TJDA 3F69A 4F7LA 5M56A 3TNIA 3Q5ZA 2I0VA 4DHFA 5I9ZA 2GU8A 4XRJA 4BGGA 3R6XA 4AS0A 5ITAA 1OL5A 5AX9A 3KXMA 3JVSA 5HE3A 5TE0A 3VUHA 4D2SA 3K54A 3VRZA 4TNBA 4C4IA 5L2SA 5C4LA 3BHVA 1DS5A 2YIWA 2YWPA 4EQMA 5F4NA 4DEAA 3F88A 3LFEA 4NCTA 4ZTNA 4D5HA 1YDRE 4PNKA 2VGOA 1LEZA 2IVUA 1R0EA 2YJRA 4RA4A 3CE3A 2WGJA 2WNTA 4ARKA 3D5WA 4Y8DA 4L43A 4G3GA 4ZTSA 2Y6OA 4RPVA 4FC0A 5J5SA 4BKJA 4S30A 5I4NA 5AR7A 2WD1A 4DEGA 4MBLA 4AP7A 5EKNA 3QRUA 4YZ9A 1OECA 3NPCA 2XK3A 2VTQA 5A4EA 5E7RA 5KZIA 2WTCA 3S00A 5LMKA 3RALA 4O7RA 3QCXA 3H9RA 4XLVA 4HGLA 3PYYA 3EZVA 5AP2A 5LWMA 2YZLA 4ZZMA 1JSVA 4N6YA 3CKXA 2XJ0A 4FKWA 4IWDA 4CFVA 4BDDA 3PVWA 5FDPA 5CF5A 3IS5A 2Y9QA 3OUNB 4F65A 3AMAA 3FL4A 1GAGA 4E4NA 4ZSAA 5J87A 4K8AA 3UO5A 5J7HA 3I6UA 4YJSA 3CSVA 2P4IA 3MWUA 4XYFA 4YZMA 1W83A 2XK4A 3F3UA 4YHJA 4XV1A 4HYHA 5L2QA 5CU4A 5BMSA 3E87A 4DE4A 4IX6A 4K77A 3QA0A 1P14A 1H25A 4U7ZA 4E6QA 2QQ7A 4QP8A 3MSSA 5KCVA 5IPJA 5DIAA 3PVGA 2XNOA 4UZHA 4DBNA 5L4QA 4FA2A 3GU5A 5FRIA 1G8AA 2QOHA 2XK8A 1B6CB 1KWPA 5JZNA 4E6AA 3LMIA 3R8PA 3ZLWA 3BGQA 3F66A 5DT4A 2PE2A 3EMGA 4ID7A 4DGMA 2W1EA 2BRBA 1FMKA 1E1XA 4FG7A 3L8PA 3VUGA 3NSZA 2BKKA 2V22A 2WELA 4APPA 1L3RE 3P08A 3Q4ZA 4F6UA 2C6LA 5M07A 5DYJA 2WKMA 2PK9A 2C5OA 2J50A 4PX6A 4FKQA 3L9NA 2VX0A 3LCKA 5HX8A 1YOJA 4JDHA 5FTOA 3G6GA 3HV4A 3VS6A 3LM0A 3QCQA 3W2SA 4AE9A 4EHVA 2HYYA 3TUCA 4K18A 5M57A 3UG2A 4W4VA 4YJNA 3Q5IA 2YDKA 3WF7A 3NNWA 1R39A 3HV5A 4LG4A 4AQCA 3KRXA 3VS3A 2C6OA 3A4OX 4JIKA 4IM3A 4RC4A 3T9IA 2CLXA 4KKEA 4J7BA 4JBPA 3MH0A 4RJ6A 2B55A 2QHNA 4RQKA 3AT4A 4XEYA 4O1OA 4S33A 3KXNA 1T45A 4O2PA 3GCSA 1ZLTA 4CKRA 4FBXA 4FZ7A 4O21A 3RVGA 3EOCA 3C4FA 3WBLA 2QHMA 2OI4X 2QO9A 4FNYA 4N70A 4R3CA 2JAVA 3KQ7A 4QP3A 2PZ5A 1WBNA 4DFLA 5JGBA 4QMTA 5AR8A 1Q62A 2P3GX 4AOTA 2PE0A 1BYGA 2JDTA 1S9JA 5E8SA 3CQEA 2VTSA 2GMXA 4FZ6A 3BU3A 3V5JA 3UZTA 5M51A 5BVKA 3HZTA 2JDVA 3VHEA 5HBHA 4GJ2A 3C5IA 2CHLA 1ZYCA 3R73A 2OJJA 3E63A 2J0LA 4ASDA 2OZAA 5GNKA 3VBWA 4FKOA 3HNGA 4EK3A 4FIHA 3CGFA 4I4EA 2XUUA 3QXOA 2XIKA 2XB7A 4PL3A 3TUDA 1U46A 3HX4A 4FKTA 2H8HA 4XBRA 5ANJA 1J1CA 3AT3A 3NUPA 2ZYBA 2HAKA 3GBZA 4YR8A 5JFSA 5BVOA 3PP0A 4QMYA 4DTKA 1OL6A 3ZMMA 3TDVA 4ASXA 4C02A 4Y95A 2ZV8A 3D94A 2XNGA 4LM5A 2GS2A 3UPXA 4DT8A 3O96A 5HCYA 5EM5A 5EYKA 2XRWA 3LJ1A 4KNBA 3VS0A 3SQQA 5KZ0A 5JRQA 4E5WA 3RAWA 4EOPA 1Q8TA 2HWOA 2X8IA 2FGIA 3KCFA 4AUAA 1IA9A 5CSVA 3KULA 5HORA 2BAKA 2VWIA 4BBEA 3PXKA 5JK3A 2R3HA 2BRHA 5M53A 2RFNA 2BR1A 4CKJA 5EQPA 1JKTA 3ODZX 4QMMA 3TJCA 3TTIA 3LOKA 4K1BA 3W55A 4RQVA 5GJGA 3DNEA 5JGAA 5C8KA 3IG7A 3LZBA 3RNIA 4W4YA 4BGHA 5J1VA 1YXVA 3E8NA 3QKKA 4CGAA 4A9RA 1WBOA 3DZOA 3HUBA 3PG3A 2VX3A 2UW7A 3GQIA 5CALA 5ANDA 5AUXA 5FEEA 4WIHA 2G9XA 4CTCA 1S9IA 5HE0A 3RM7A 5DEYA 4F1TA 4DH5A 4V05A 4CFUA 3UZRA 5CVHA 4GS6A 4LGGA 3TZMA 5H3QA 3FMHA 3WZJA 2CNQA 2FYSA 3G51A 1KE9A 3F61A 2YCFA 3QUEA 3ORNA 3CY3A 4JVGA 3DOGA 4O91A 4TYJA 5E1SA 4E4MA 4EL9A 1LUFA 1IG1A 3ROYA 2YEXA 3ZONA 5FGKA 1MQ4A 2ZM3A 3IDBA 3FMDA 3F7WA 2BDWA 3SXRA 4C38A 3SXSA 4ZLZA 2Z8CA 3C0IA 3HDMA 3RP9A 4GVAA 4NK9A 5JSMA 4KIQA 4UV0A 5TF9A 3R63A 5ANEA 3KY2A 5H8EA 2YM4A 3I7BA 2CJMA 5CXHA 5CXZA 1PXLA 4XOYA 3E8DA 4EZ5A 5IA5A 5IQAA 5D10A 3NR9A 4RVMA 4EZ7A 4DT9A 2PVYA 4YP8A 4DG3E 4TWOA 2GQSA 3CQWA 2X7GA 4RC2A 4PNIA 4DG2E 4OBOA 5IA1A 3GUBA 3ZBFA 4RX5A 2UW6A 2PTKA 2PMOX 4WSYA 3DXQA 4DINA 1JOWB 4EOQA 5JEBA 3DFAA 3MH1A 4QTCA 3A4PA 4J1RA 2O65A 3G9NA 5AR4A 4L3JA 2C5NA 3H0ZA 3R1SA 4YC8A 4FE2A 4ZY6A 3VUDA 4U81A 1Q4LA 1XHAA 5DA3A 5GZ9A 3R22A 5HO8A 1UNLA 4EH9A 4PPBA 1WVYA 3BHUA 1PXIA 4GG5A 4MCVA 1UVRA 4RX9A 5C8NA 3AD5A 4WT6A 1Y8GA 4DFBA 3DK3A 1PYXA 2YDJA 3G0EA 3UNJA 3DXNA 1V0PA 3QWJA 2WTWA 2BIKB 3PE1A 3QRIA 3V8TA 5TKDA 4JDIA 2YITA 3FJQE 4EJNA 3UQFA 3MESA 4DA5A 3WZDA 2JIIA 3PPJA 1YWRA 4N0SA 3UG1A 3P7CA 4O83A 2Y4IB 4Q2AA 4BCMA 3LLTA 4IX4A 3AD6A 3D2KA 4Y85A 4ACGA 4A4OA 4CFXA 4RVKA 2B9IA 4WA9A 4P90A 3COHA 4R7IA 3R7IA 3RNYA 4DEBA 4U44A 2C68A 3UC3A 3MI9A 2ETRA 3EIDA 4RIWA 5IISA 2UV2A 5AA8A 1Z57A 2GS7A 4U0IA 3LXKA 4FT9A 1OIRA 5IQDA 2BFYA 3QGYA 2OXYA 3OCGA 3PG1A 3MDYA 2UZNA 3FZSA 2IZTA 4TN6A 1Q24A 4OTFA 4KAOA 4L8MA 5IG1A 3PXQA 4Y5HA 3UGCA 1OL2A 5FM3A 3CCNA 2C3JA 2J6MA 3EN6A 1VYWA 1Q3WA 3FMJA 3GU6A 3MH2A 4IZAA 4AT3A 3OY1A 4AT4A 3WZUA 3GC7A 4I0SA 4RJ5A 5DT3A 3KMMA 1FPUA 4WG3A 2WU6A 3DAKA 2XK9A 3QD0A 5CY3A 4DFNA 5A4QA 5AP5A 4MWHA 5AUZA 2W1IA 3R9DA 3SRVA 3QCYA 4NFMA 4R5YA 4FL2A 2ZB1A 2VTLA 3VS1A 4AZVA 3ZO1A 2OF2A 1PXMA 1WBWA 3Q52A 3KRLA 4D4VA 4FKLA 2OSCA 2ZV9A 3I81A 3QTWA 4C62A 4AU8A 2RFDA 4FL1A 1OBDA 1PRYA 1IR3A 4IX3A 4FOCA 4O0VA 5AP1A 4AW1A 3CTHA 2XJ1A 3E5AA 3KEXA 3TUBA 5L2IA 1JBPE 2CMWA 1WVWA 4MXAA 4UWCA 3DK6A 2SRCA 5GHVA 2JBPA 3D9VA 2R3PA 4NM3A 4G6NA 4YTIA 3TM0A 5AIKA 3FPMA 4JBVA 2HW7A 3DBQA 5I9WA 4QP1A 2JGZA 2FO0A 4EONA 4HW7A 4PQNA 2JDOA 2VUWA 5EI6A 4ZY4A 5AP6A 2XCKA 2XMYA 2ZMDA 3PJ3A 4NYEA 3NRMA 4ORKA 1OPKA 3VW6A 4L53A 3WILA 2IPXA 3M2WA 4EORA 4IEBA 5EOBA 2NRUA 4HGSA 4F9WA 5CU6A 3KCKA 4FVQA 5M06A 3PJ1A 2PY3A 4JQ7A 3FI4A 3PY1A 1TQIA 2OH4A 3QD2B 5EDQA 4G3EA 4FKIA 3PXZA 3BYMA 4CFWA 4L3PA 5HIBA 2RIOA 4JL9A 5HZNA 4YLJA 3R0TA 3SKCA 4O38A 5HCXA 2UZUE 2HY0A 5FTGA 3KVXA 2IG7A 4JNWA 2J5EA 2J0MB 1REKA 4BCHA 4FZAB 1WZYA 3LIJA 5IA0A 4GT4A 4DG0E 4O7YA 4QMQA 3D5XA 2C5YA 4A7CA 3H4JA 4A9UA 5K9IA 2QOBA 4C0TA 5IKWA 3C1XA 5BX0A 3JS2A 1GZNA 2UW0A 4BTMA 3GCPA 1EH4A 4EOJA 4O0RA 4PMTA 4QO9A 1JAMA 2R3NA 1CM8A 1YXXA 3VQHA 5IH5A 4QQJA 3RPYA 3A99A 5DEWA 2JKOA 2A4LA 4XX9A 4L52A 3GCVA 5HNIX 5EHOA 5G6VA 5L2WA 2XNMA 2F49A 4LYNA 2WQMA 3RBWA 2ZV2A 2AYPA 3G9LX 2JAMA 4KUJA 2VD5A 3NX8A 4Z7HA 3DNDA 5H2UA 4AN9A 1L8TA 1JQHA 5CEKA 1YVJA 4ZTRA 4EH3A 5IUGA 5HLWA 1SNXA 4KBAA 3DQXA 4BF2A 3L9LA 4MF0A 3BYSA 4TYHB 5E4HA 3ZO3A 2QR7A 4H36A 3NMUF 3FMNA 5ICPA 5EW9A 3UOHA 4O82A 3VBVA 2XRUA 3N4VA 2IW8A 4AN2A 3HRCA 1P2AA 4KA3A 3A7IA 4DFYA 4YSMA 1RQQA 1YI3A 5F1ZA 5B7VA 4GK2A 3UNKA 3D4QA 2ZM1A 4OTWA 4LGDA 4EOMA 1YRPA 3ZUTA 4FNZA 3MVJA 4L42A 4YTHA 3IO7A 4BWKA 2JFLA 2C4GA 3FI8A 4ZJVA 2VO6A 2KTYA 2ZOQA 2H34A 4J98A 4BCGA 2F9GA 4C4HA 3FHIA 3LCTA 2GTMA 4JR3A 3DBFA 4YZNA 5CEMA 1ZWSA 4HCUA 5EDRA 1KUTA 4DTAA 5LOHA 4PP9A 5CZIA 4EUTA 4Z55A 4TW9A 5CVFA 2OBJA 3TTJA 3HA8A 3POZA 2ITZA 5LXMA 3RHXA 3OXTA 3UBDA 5CSXA 4E26A 5C1QB 4YZCA 3WZEA 3OUKA 4D1SA 3OEZA 4GYGA 4QPSA 4AA5A 2XH5A 4I20A 4TT7A 2V7AA 3HRFA 2CCHA 4FI1A 4GYIA 3FE3A 4I0TA 1YHWA 4DC2A 3D7TA 1H26A 2ZAZA 4NT4A 3PIZA 4FGBA 1H01A 2QVSE 3DJ5A 4O0WA 4YNEA 4QYFA 3TIYA 1Y6BA 4FNXA 4PF4A 4QQCA 3DV3A 4BR3A 3OFMA 1OIQA 1ZYSA 3HMPA 3SHEA 5CT0A 4CZYB 3KN6A 4U9AA 2YA9A 3T8OA 3UVRA 3ID6C 4D28A 1SM2A 3Q6WA 3CTQA 3BLRA 5C26A 5ETAA 5GJFA 5ETIA 3VS7A 3C4XA 4G6LA 2XNBA 2ERKA 3FMMA 3PWYA 2YIRA 2W96B 1QPEA 3NGAA 1UNGA 3D5UA 2HOGA 3FSFA 4ZK5A 3ZFXA 4FTUA 3OROA 1HCKA 4CZTA 1ERKA 2BTRA 2OFVA 1Q97A 4BI2A 3FKOA 3CD3A 2PHKA 3MIAA 4FTRA 3U54A 3K2LA 4UALA 3AC8A 3BCEA 3ORKA 2R0IA 2UZBA 4GH2A 4LL0A 4RIWB 3TI1A 1YWVA 5CSPA 2OF4A 3HMOA 3PTGA 5BVEA 1PF8A 5FBOA 3KXXA 4MVFA 4M0YA 4TYGA 3FLYA 2OG8A 5AAEA 3RK5A 3I0OA 4AW2A 3AT2A 4G5PA 2XVDA 4EBWA 5C01A 4I3ZA 2IO6A 4XRLA 3PPKA 3VIDA 5CAQA 3NYNA 4XG9A 4FNWA 5CAPA 3CLYA 4YMJA 3TNHA 4IFCA 4NSTA 2BZJA 5KMNA 3C4CA 2UW4A 4FMQA 3OVVA 4ALVA 3U4WA 2EXCX 4D4RA 3P9JA 4DLJA 1JLUE 2BZKB 2YAKA 4ZP5A 4QQ5A 2Y7JA 2WQNA 4XV2A 4S32A 4BCFA 2BCJA 3E7OA 3RCDA 5ACKA 5JN2A 1PY5A 4I92A 3AXWA 2PVJA 3COKA 3CEKA 2PE1A 4LL5A 1UKIA 3S2PA 4FGRA 2X6DA 5D7AA 4FV2A 2PL0A 3OW4A 5GINE 1ZAOA 4XP0A 3CTJA 3FZRA 4C34A 4FSRA 3D7ZA 4D58A 3ITZA 4E7WA 2CGWA 2R3JA 3GC0A 3IOKA 3NWWA 3KRWA 2GPHA 4XP2A 5HTIA 3RPSA 3AGMA 3UDBA 2QC6A 5KBRA 1Q5KA 1UA2A 3WARA 1UNHA 2C1AA 3TKHA 4HJOA 3TKUA 2WHBA 4F08A 2O0UA 4NW5A 5KUPA 4BDCA 4CLIA 4C4JA 4QMUA 4E6DA 4XCUA 5CSWA 3UQCA 1XBBA 2PZYA 3H3CA 4LRKA 3UMXA 4DH1A 2VWVA 4BI1A 4RWIA 3QTUA 5K5NA 5I3RA 3SDJA 1LP4A 2QLUA 5FWKK 3S95A 1CKPA 4GT3A 1MRVA 3BX5A 1PMUA 4PPCA 2J0IA 3AC2A 4RRVA 3ATSA 3UJGA 4XG7A 1Q41A 2Z7LA 3F2NA 4D2WA 4YPSA 4H58A 4HPTE 5EH0A 2G15A 4IDTA 2PVKA 4B6LA 2UZWE 4EH7A 3OWJA 5IEYA 4ERWA 3KKVA 4I93A 3UVPA 1W82A 2V5QA 4KSQA 3UZPA 1XJDA 3IDPA 3EH9A 4E6CA 1H27A 1BKXA 5JRSA 3ZDIA 5K0XA 5BYLA 3DCVA 5HTBA 3QRTA 3KRRA 4M68A 4DN5A 4BCNA 3BHTA 4F7JA 3MY5A 2E2BA 3IPHA 5AV1A 2VNYA 3QHRA 1JVPP 5M08A 5AUVA 4QD6A 3UQGA 3FPQA 4WNKA 2QOIA 4FTAA 3ZBXA 4AGCA 3VUTA 2WTKB 4FTKA 3EQHA 3UODA 3NEWA 3OTUA 3BZ3A 5CEIA 4EK4A 4IB3A 5FXSA 2QU5A 4J97A 2HZ0A 4QP4A 2XNNA 3ZYAA 1AD5A 4U42A 4OTQA 1GZ8A 4CFFA 2X81A 4A4LA 4XJ0A 5IA4A 4TYEA 2Z2WA 1JKLA 3ERKA 4D5KA 2NPQA 2ITUA 3ORPA 3ZOSA 5KMIA 5M44A 3IW6A 2J2IB 1WMKA 3ZLXA 3DJ6A 4I94A 3ZUUA 3SC1A 2VO0A 3WYYA 3N9XA 2JITA 4FV1A 4GVJA 1LPUA 3F5UA 2C6IA 3L9MA 4O0SA 5HESA 2WB8A 5AUUA 5DT0A 2ZMCA 1IASA 1P4OA 3OXIA 3SXFA 3PE2A 3ORIA 1H28A 4C3PA 3S1HA 3OG7A 1FOTA 1TQMA 3RPVA 4TRLA 3Q4UA 1ZYJA 3OT8A 4JXFA 2AUHA 5AMNA 3BI6A 3C5UA 2RKUA 2QURA 3RTPA 5L2TA 4II5A 4UXQA 4FOBA 1XWSA 3KVWA 1YDSE 3MFSA 4X2GA 1PXJA 3R21A 3SOAA 3DAJA 4MQ1A 2P55A 4X3FC 4LGHA 5HO7A 3NCGA 1FMOE 2UVYA 4RIYA 3U55A 3KK8A 4O2ZA 3DBDA 2CGVA 4X21A 3S0OA 4HPUE 3HKOA 4L67A 4FTOA 4MNEB 4ZIMA 5JGDA 3RPRA 4E8AA 4O7SA 3Q53A 3NIEA 4L45A 2BTSA 2R64A 4IDVA 2Y4PA 5EM6A 4EJ7A 3MN3A 1GNGA 4M12A 5CAVA 5JFWA 3IW8A 3TT0A 5L8LA 4I5CA 5ANOA 4ZJJA 3D7TB 2EXEA 2R9SA 3B2TA 3CY2A 2VN9A 2RSVA 3OW3A 3QTZA 4C8BA 3NW7A 4D4SA 4M7IA 4EK5A 2DS1A 5JKGA 3RHKA 2W9FB 2G01A 1ZOGA 4IIRA 1YOLA 2AC3A 4MKCA 3FY0A 1APME 1VYZA 4ANOA 3B2WA 3AMYA 2QLQA 2XZSA 4QTBA 3TCPA 5B0XA 5CU0A 4PTCA 3DBCA 3RZBA 2CN5A 3DKFA 5ANKA 3R7OA 4H1JA 3MS9A 3HV6A 3VUIA 5GIOE 4MD9E 4BL1A 4CYIA 4LMUA 2XNEA 2ZVAA 4HZSA 3I5NA 3MFRA 3GEQA 2PZPA 4FV3A 4HNFA 1OB3A 4BB4A 3P1AA 2C3LA 4NM0A 3GOKA 5HG5A 4GIHA 3WE8A 1ZZ2A 2GNIA 4HVDA 2GNJA 4Y46A 2X4ZA 3ZRLA 3TL8A 4GL9A 4WRGA 2XM8A 1H1WA 4YU2A 3NUXA 1HCLA 3NAXA 5ETFA 4YURA 3VW8A 4AW5A 2XKDA 4I4FA 2JDSA 1Q8YA 4EH5A 3C0GA 2WTJA 1NXKA 4UMQA 4DYMA 3FV8A 5DLSA 5KKRB 3GOPA 4FT5A 5AV4A 1H0VA 2ONLC 3BHYA 2F7ZE 4U41A 5I9UA 3RMFA 3WIKA 3QTIA 5B2LA 3RZFA 4N57A 5AP3A 4IE9A 2R3GA 3Q4TA 4EC8A 2H6DA 4GFOA 3GENA 3IW7A 3TZ9A 2OU7A 2F2UA 3ACKA 4XG8A 2UZEA 5FBNC 3EQBA 2X9EA 3GFEA 3OF0A 5EKOA 5AAFA 4BC6A 4C3FA 4IAKA 3AC3A 4EH4A 3O7LD 2R3LA 2JBOA 2DQ7X 4BI0A 3TZ8A 4TXCA 3C51A 5HVKA 2VRXA 2IVVA 3SAYA 4WOVA 3F82A 4ACDA 3PXYA 3PRIA 1AGWA 5HCZA 4JBQA 4DEHA 3JPVA 4MQ2A 4FKGA 1H0WA 3OCTA 3VN9A 4YJPA 4EWQA 4A9SA 2X6EA 3GCQA 4FV6A 2B9FA 2VZ6A 4J8MA 4YHFA 5BNJA 4O1PA 3ZC6A 4DGNA 4QYYA 4A07A 3OCSA 5HI2A 2RFSA 3VBYA 3VQUA 4CMTA 1CSNA 4C59A 5LCJA 2CNUA 4ZS0A 2O5KA 1SVGA 2H9VA 5LQFA 5JQ8A 2OXXA 3A62A 2W1ZA 4AA4A 2X7FA 2W5HA 5T68A 4QMPA 2WMRA 4U79A 2VAGA 1UV5A 2X2KA 4NCTC 2ZJWA 3QD3A 3LQ3A 2FB8A 5D11A 4B4LA 3R7GA 5CQWA 3RWQA 4UWBA 3G2FA 3CJGA 4OW8A 2GNHA 2HCKA 4AGDA 4GW8A 3BE2A 3OD6X 2VWBA 4I21A 4MEDA 3RINA 2UW3A 2YERA 4TWCA 1KE5A 4R78A 4J71A 3OHTA 2HENA 1TVOA 3R8ZA 4A4XA 4FIEA 4QMVA 4F4PA 3N51A 4I5HA 3EJ1A 1R78A 3GU8A 4BFMA 5LMKC 4BZOA 1M7NA 1FGIA 1O9UA 3MVHA 3LMGA 2PUPA 3P79A 3BU5A 3IONA 3R1NA 4NUSA 4CD0A 1IRKA 4QMOA 3ZRMA 1WBPA 2GDOA 5FM2A 1ZRZA 5E92A 5AR3A 5HNGA 5IQGA 1PMVA 3SOCA 2ITQA 4BHNA 4D2VA 4IH8A 2C3IB 4WO5A 3NW5A 3O17A 2ITWA 4M84A 4WBOA 3LCOA 4A9TA 1NY3A 4KIKB 1KE7A 3Q96A 4LRMA 3P86A 4GCJA 2W0JA 3QQKA 2QOFA 4YJOA 3VBTA 3KF4A 4D4YA 3RAIA 4TKSA 2VWUA 3CQUA 3QUPA 4PL5A 5IDNA 3MY1A 1ZOHA 4F64A 5IEVA 2FA2A 4NJ3A 1BUHA 4CV9A 3PWDA 2QO7A 3M1SA 4F0FA 5BPYA 3BELA 4PL4A 4IJPA 3VC4A 3JYAA 2LAVA 3FXXA 4ZLOA 4ANQA 3FZ1A 2ZV7A 3TIZA 4MK0A 4IB1A 4PY1A 2ERZE 2ITOA 4GKHA 5AA9A 1YHSA 1UU9A 3FI3A 4M97A 4PP7A 1W8CA 5DR2A 4TYHA 3PIYA 1UU8A 2XS0A 5EW3A 2C30A 1W98A 5HG8A 4D1XA 3OMVA 3E3BX 3W2QA 2JDRA 3HV7A 2P33A 4W9WA 3F3VA 4FV0A 5DMZA 1GJOA 2HW6A 3V5WA 2VTRA 3ENHA 1Q8UA 2HWPA 4P5ZA 5CZHA 4IZ5A 3CPCA 5M4IA 1V0BA 2QNJA 2R0UA 2BFXA 3RI1A 2BILB 3FL5A 4F7SA 2PVLA 2J4ZA 4PMSA 3TWJA 3BHHA 4D2RA 5HD4A 3K5UA 2VTJA 3E92A 4RIYB 3DS6A 2B9JA 4WG5A 1Y6AA 4C7TA 2BPMA 4I6HA 4C4EA 1G8SA 2OXDA 4KIPA 3PDTA 4E4XA 1FQ1B 3FKNA 3ZZWA 2G1TA 2HIWA 3QTXA 4QRCA 4U97A 5KHWA 4G3CA 4FIFA 4Z7GA 3A7FA 3L9PA 4BRXA 4FKRA 3UVQA 4GKIA 5E8XA 5AR2A 2EXMA 3CPBA 2UVXA 3NIZA 4WKQA 3LFQA 4IANA 4O6EA 4OUCA 4TYIA 3ZXTA 4P7EA 4HVIA 3CC6A 3DTWA 3ROCA 3W10A 3GT8A 3GU7A 1P5EA 2RFEA 4XG6A 2A0CX 2VTOA 2JKKA 2PVFA 5B2KA 3FAAA 3MFUA 2XKFA 3V5PA 5H8BA 3HMMA 4TY1A 2X2MA 3HUCA 3SW4A 2YIXA 3NUUA 4FT7A 2FSOX 2F57A 3I7CA 3R8VA 1W0XC 2QOKA 1RW8A 4YJUA 3EL8A 3O51A 5DG5A 5IQIA 5T6KA 3FZOA 3PJ8A 4EHZA 3MPTA 3EQFA 3AMBA 3PA5A 1XH4A 1YOMA 4RX7A 5BQ0A 3QTRA 3VHKA 4GJ3A 1U59A 4BDBA 4NTTA 3NS9A 4JBOA 4DEEA 3UMWA 1IAHA 4IMYA 3B8QA 2WMVA 5A3XA 3EFJA 5J5TA 1KE8A 4EYMA 2OK1A 4O81A 4V01A 3IK3A 1GOLA 3U4UA 5ACBC 4UEUA 4YBKA 4IVCA 4R7BA 1OPLA 5J9LA 3HDNA 5HO6A 3VF8A 1E1VA 3NAYA 3DGKA 5HE1A 3ZSGA 3QXPA 2NRYA 3ZRKA 1U5RA 4DCEA 3SW7A 3FZTA 1YI4A 4KBCA 3SG8A 3VNTA 3S3IA 3ORMA 1T46A 4GU9A 4FSYA 2Z7RA 3AC1A 4BIBA 2I7QA 3R1QA 5HOAA 3A60A 3NW6A 3R01A 1ATPE 4ANNA 2C0TA 3Q9YA 4BCJA 1ZYDA 2PUUA 2QODA 4RSSA 4ZZNA 3LE6A 2BUJA 3LFNA 1MQBA 1OUKA 2QCSA 3VWAA 3WOWA 4H3PA 2PPQA 2JLDA 4IVAA 5E8VA 3DAEA 4JX7A 2J0KA 1PKGA 3QTSA 3CKWA 4I5PA 2Z7QA 3SGCA 1R1WA 4HOKA 1M2PA 3UO4A 4UXLA 5CEPA 4N4SA 3UIUA 5CENA 2BIYA 2LGCA 4AF3A 3JXWA 4IJ9A 2B4SB 3RM6A 3HVCA 2G2HA 4P2KA 4R1YA 4XV3A 4F1MA 5K5XA 3M11A 4PPAA 3ZO2A 3KREA 1YXSA 4M67A 2QOLA 3KFAA 1OZ1A 4KS8A 4X0MA 4YNOA 4KB8A 4WSQA 3SD0A 4CQEA 2W4OA 5ANIA 3LXPA 3W8QA 4O86A 4R77A 2B52A 3KA0A 4AW0A 1Y57A 4A06A 2O64A 3QA8A 5F95A 2J51A 2W1GA 3O0GA 3BPRA 5HG7A 3CGOA 4X2FA 4UZDA 3EN9A 3LFFA 5AJQA 4L00A 4GT5A 4UMTA 5M09A 4TWNA 4JQ8A 2I0YA 2WQBA 4MNFA 4FT3A 1Q8WA 1J91A 3MV5A 3F5XA 4DGOA 3FLZA 1WBTA 3D2IA 2VTMA 4BDAA 2EB2A 4XG4A 5AWMA 4CYJA 4HVSA 1Z9XA 4KIOA 4R7HA 2WIPA 5AEPA 4IHPA 2A19B 1CKIA 2YAAA 1OL7A 3MJ1A 4ZSGA 3R9NA 2NNWB 5FUTA 2WFYA 1MRUA 3QQHA 2UZTA 3H9FA 3OZ6A 5CYIA 3BEAA 4HNIA 4XV9A 4F7NA 4G6OA 4EWHA 4NM7A 3ALOA 3QQJA 5LMBA 4DFXE 4DH3A 2XK7A 3GFWA 1DI9A 5ANGA 1H08A 2V0DA 3DPKA 2UZVA 1M2RA 5DR6A 1KOAA 4AZFA 2C5XA 3K3JA 4ZMEA 3BQRA 5EW8A 2OJGA 3R2YA 3AC5A 3DU8A 4YZBA 4CQGA 3PJ2A 5HGIA 3EL7A 3MB6A 4RFYA 4BWXA 4IAZA 4PTEA 3I79A 4L46A 3QD4A 3HL7A 4DEDA 5H8GA 1KSWA 2YISA 4QTAA 2O8YA 2W17A 3ZFMA 4HVHA 4PDSA 2UZDA 4NJDA 4FSWA 4WNPA 3O23A 4IM2A 2YN8A 3EQGA 4WBBB 3K5VA 4J95A 5DRDA 4QMLA 5FXRA 3D5VA 4HGTA 2PU8A 2IWIA 1OIUA 3C13A 4F99A 1KE6A 2CKEA 3QZFA 4FODA 5FEDA 4A9YA 4F09A 4IC8A 5IA2A 5CSHA 2ZDUA 5I9XA 3FHRA 4FF8A 2CDZA 3OXZA 3C4WA 2R7BA 1LEWA 3W2PA 4QYGA 2FH9A 4FV7A 3FLWA 2A27A 3W18A 3C0HA 4B9DA 5JMSA 4BDHA 1OITA 4NWMA 4UYAA 4E3CA 3LLAA 3HYHA 5TO8A 1F0QA 2XA4A 3F3ZA 5CNNA 5L8KA 3UPZA 3G15A 5IF1A 4RJ8A 2BZHB 2OW3A 3TNWA 5E8YA 2YM6A 4EH2A 2PZIA 2XYNA 1M2QA 2OZOA 3WF6A 3BYOA 5L3AA 4D9TA 3IGGA 5TOZA 4IB0A 2BHHA 2W06A 2WZJA 3EQCA 3FUPA 4Q5HA 5AP4A 5AV2A 4FIJA 1QL6A 2BAQA 1CDKA 3TACA 4EKLA 5JH6A 3EHAA 3THBA 4MNEA 4O0TA 3MFTA 5AV0A 2E9UA 1QPJA 3ANRA 4MXOA 2Q83A 4EH6A 5AP0A 3QQFA 3LCDA 4UMPA 3Q6UA 5FP6A 1GZKA 4FUYA 4FKPA 3R9OA 3WYXA 1GIHA 1H4LA 4P4CA 3AOXA 4RJ7A 4QQTA 2PMIA 3PXRA 4JI9A 4M8TA 2QKWB 1K9AA 3HP2A 4R5SA 3T3VA 4Q9ZA 5A4CA 3CR0A 1H07A 2OO8X 2R3RA 2UVZA 4CG9A 4YZDA 3EB0A 1QMZA 4J96A 3ELJA 5EOLA 3TV7A 4YO6A 2YWVA 4G34A 5LVLA 4PDYA 4D55A 1XO2B 3QTQA 5IMXA 4UMRA 5IUHA 3QFVA 3PJCA 4QT1A 4FTLA 3ZZEA 3QF9A 3BIZA 5E8UA 4BKZA 5BVDA 2YM7A 5IH4A 5JFVA 3U9NA 4HVGA 4EKKA 2JKQA 5HD7A 3VBXA 4ZS4A 3EQDA 1G3NA 2XIZA 3QRKA 2WTDA 4OGRA 4U45A 2YM5A 4G17A 5CAUA 3SG9A 3Q60A 2OIQA 4GFGA 3SLSA 2XEYA 3G6HA 2BAJA 2H96A 4WD5A 2GCDA 5EM8A 3FLQA 5HKMA 5HE2A 4FSTA 3MYGA 5CEOA 2VWYA 5EYMA 5AUYA 2G2IA 3NDMA 5I9VA 3NVKI 4QMSA 4QMZA 3IQ7A 3ZXZA 5AX3A 3RGFA 3V51A 3NCZA 3NUYA 4J8NA 4S34A 2CGUA 4MX9A 2WEVA 4UN0C 2HZNA 3U6HA 5FEQA 3U8WA 4FEQA 1ZOEA 5KHXA 4BIEA 4L44A 3PXFA 4ACCA 3KXZA 2X2LA 3O71A 4ANBA 1VJYA 1PW2A 3KB7A 4BBMA 4BCPA 3BLQA 2HXQA 1NVQA 3SVVA 2BDFA 2XBAA 4E73A 4IQ6A 1FVTA 2C6MA 3V01A 3OBJA 5FDXA 3ZLYA 4ZLYA 5IQFA 2CN8A 3A7HA 5EQEA 3EWHA 3ODYX 4B8LA 3HGKA 3EFLA 1YKRA 4G3DA 4IZ7A 4AOJA 2PZRA 3F7ZA 2I40A 2WTKC 4JDKA 3KRJA 3EFWA 4RLLA 1LR4A 5AR5A 3U87A 4BBFA 4NIFB 3EN4A 4C4GA 2DUVA 3DLZA 4AXAA 2WMQA 4BYIA 2VU3A 4DFZE 3QC4A 3NYXA 4YJVA 4BZDA 4CG8A 1U5QA 3F9NA 4BN1A 2RL5A 4G2FA 2IVTA 3R8MA 4AN3A 3L1SA 3JR1A 5HG9A 5C27A 4H1MA 3BV2A 3REPA 4XG3A 3ZEWA 2VV9A 3ZHPC 4CV8A 5K4IA 3TG1A 5HTCA 3FC1X 3KXGA 4WRSA 3P7AA 4OTPA 4FTNA 5DNRA 3UO6A 4B7TA 2XF0A 2GFSA 2F2CB 4FIGA 2C5VA 3UP2A 4BHZA 4WUNA 4DF3A 3JVRA 4ZSLA 2CCIA 4JX3A 3CIKA 4V0GA 3TV4A 3WF9A 5EQYA 1H1PA 3LJ2A 1NA7A 1OKZA 2WU7A 3F2AA 4MXXA 4ONAA 3HP5A 3KGAA 5CTPA 4E93A 1UWJA 3D15A 3QUDA 3I60A 2B0QA 4F70A 4JIAA 5CF6A 1OL1A 1PJKA 4AOIA 3NYVA 4MD8E 4GUEA 4E5BA 3LKMA 3R8LA 5HICA 3KL8A 4NTSA 4CTBA 1DAYA 1BI7A 5BVWA 1JSUA 2X8DA 4JRNA 1GY3A 3ZFYA 2REIA 2GHLA 4AZTA 2BDJA 3ZM4A 4KD1A 5EHYA 2R7IA 3WIGA 4IAFA 2RG5A 3P4KA 1UU3A 2VNWA 3PA4A 5M55A 5AADA 3L8SA 4EOLA 2GQRA 2QI8A 4FSMA 2VTHA 3EYGA 3LFDA 4YBJA 4BWPA 1VR2A 3GQLA 4DFUA 3F5GA 3NUNA 2VWWA 2WMUA 3H30A 2PVRA 4HCTA 4L6QA 4PWNA 2ETMA 3LFAA 2B1PA 3FY2A 4FTIA 1OPJA 3POOA 4C37A 2J0JA 1URWA 3COMA 3BBWA 3R71A 4MBJA 4V04A 5HVJA 2YZAA 3T9TA 1ZY4A 3GNIB 3FMKA 4FG9A 5A14A 4U5JA 4HZRA 4CCUA 1WAKA 2FSLX 1RDQE 5HU9A 2Q0BA 3FC2A 3CD8A 4OAUC 2W99B 3DBEA 3QQGA 4FSUA 1PXKA 4KABA 5E9EA 4NU1A 3II5A 2YJSA 1Q99A 4HYIA 4RT7A 2GNLA 5CLPA 4DTBA 3O8UA 3OOMA 4HYUA 3HEGA 4J99A 4M69A 4D9UA 2WTIA 4YTCA 4ZTMA 4KIKA 3OS3A 5DOSA 3R9HA 1WBSA 2C6DA 3PZEA 2OH0E 3DA6A 2HXLA 2VO7A 1F5QA 2J7TA 3D83A 3Q3BA 4ZAUA 4KBKA 5HIEA 5F94A 5CF8A 4O7TA 4QMNA 1DM2A 4XH6A 4YJRA 3ZS5A 3FYKX 3ORTA 5GIPE 3FXWA 4OLIA 3MB7A 4FG8A 5G1XA 3W2RA 4FTJA 3QZHA 5B2MA 4NKAA 3KMUA 2F4JA 3DB8A 1BL6A 5D9HA 4O7LA 4YSJA 4G9RA 4C61A 3EZRA 4XG2A 1UWHA 5CU2A 4AFJA 4O96A 2B53A 2QG5A 1BI8A 1XBCA 2E9OA 1RJBA 3LFBA 2OIBA 3NNVA 5I3OA 4CNHA 3E8EA 2YLFA 3RKBA 4ANSA 4K11A 5EM7A 3FKLA 1KV2A 4GMYA 3HV3A 2X9FA 2GFCA 3LPBA 3RJCA 5KO1A 4IAAA 1R3CA 2YABA 4JDJA 3HMNA 2IJMA 3S4QA 3DY7A 3EQRA 4P5QA 4UMUA 5K3YA 4WNOA 4MTAA 4W8DA 1STCE 3EKKA 4I23A 4ZTLA 3ZSHA 1PYEA 2NP8A 3BYVA 3FMEA 1IEPA 4M13A 4AT5A 2PVHA 3LMHA 4F9YA 1ZZLA 4TZRA 1ZMWA 4U3ZA 3DFCB 5I9YA 3Q2MA 4QP7A 5DWRA 4QMXA 4Z3VA 4C36A 4L01A 4MD7E 4I6FA 3W2OA 5D12A 4LUDA 2RG6A 1A48A 2WMTA 3VBQA 4D1ZA 2BRNA 2I1MA 2VTTA 4BDIA 3QAME 4RA5A 4AZWA 4W8EA 5BUJA 5FLFA 4AE6A 4DITA 2IW9A 2I0HA 3HAVA 4L7SA 5L6WL 4F9CA 2V55A 2UW5A 4Q5EA 4RIXA 4CSVA 3Q9WA 3CP9A 4EK8A 2Y6MA 2C0IA 4EQCA 3PSBA 4LV5A 4NW6A 4DEIA 2CKPA 4RWJA 4RBLA 1U4DA 3PUPA 2GHGA 3GI3A 4MXCA 5EYDA 3QX4A 5IDPA 4BDGA 1B38A 4AX8A 5AAGA 5A6NA 4FTTA 5CANA 3WZKA 3OWPA 5DH3A 4O0YA 1P4FA 3RK9A 3UIMA 3VS4A 3C50A 3FBVA 4TTHB 4NZWB 3NLBA 4IZYA 2F7XE 4ZOGA 2IZSA 3UTOA 3A2CA 4LFIA 2XJ2A 4HGEA 2PVMA 2XEZA 5JFXA 3TDWA 2BHEA 3DK7A 3QZIA 4FSNA 4KRCA 1U54B 4XS2A 3BWJA 2Z60A 3GC8A 2QOQA 3H9OA 5L6OA 3FWQA 4QYHA 4UB7A 4RFZA 4FKJA 1WFCA 4F6SA 2HZ4A 2G2FA 2JKMA 3E3PA 3MGYA 4M0ZA 4R3PA 4RZVA 5I0BA 2CPKE 4AFEA 1JWHA 3AG9A 2VGPA 4QTEA 4EEVA 3AC4A 5EDPA 1W84A 4GRBA 3VVHA 3QLGA 2CLQA 3VRYA 4JG7A 4L3LA 2OJ9A 4IXPA 2R3MA 4EOOA 4EH8A 5AM6A 2XK6A 1OBGA 1H1SA 3MIYA 1I09A 4FSZA 4IAYA 3RCJA 4I6QA 5A6OA 2P2HA 3KN5A 3QQUA 1BMKA 3OWKA 3ENMA 2CKOA 4FYNA 4R1VA 4S31A 4X3FB 1QPDA 4K2RA 4TWPA 3BWFA 1J7LA 1ZXEA 3QRJA 3DTCA 4MBIA 4XOZA 5DBXA 3ZC5A 5IQBA 5CQUA 4YUQA 4RG0A 4E5AX 1QCFA 2W9ZB 5E8ZA 3WI6A 4YO4A 3BBTB 3OBGA 4Y73A 3HRBA 1J7IA 3QYWA 5LCKA 2WAJA 2JIVA 4QMWA 4BCKA 3MPMA 4EBVA 5CASA 4BDEA 4V0GB 4F9BA 4QP6A 5C03A 5K4JA 1H1RA 4OTRA 1AQ1A 3D14A 1SNUA 3ULZA 4JQEA 4TPTA 3VUKA 1OKVA 3QC9A 3GB2A 1R0PA 3O50A 4PDPA 3GGFA 4LMNA 3E7VA 5AFVA 4BY9E 3ANQA 1B39A 3F3WA 3I0QA 4IFGA 2GTNA 5HBEA 4Z16A 5KNJA 5AUTA 3ET7A 3OOGA 2WMBA 4ALWA 1M52A 2BRMA 5LVNA 3TNPC 3FSKA 5GZAA 3OY3A 2C6EA 2UZLA 2R3QA 3VULA 5C4KA 3BKBA 4PMMA 5DE2A 4B99A 5CU3A 3MTFA 4CCBA 4FTQA 2B54A 4G9CA 5F20A 4UBAA 3GVUA 4K0YA 4E4LA 3U9CA 4BTJA 5CAOA 2QKRA 3DB6A 5KMJA 4JOAA 4FTMA 1O6LA 3OWLA 2W7XA 3ORXA 3C7QA 4RVLA 4BICA 5DI1A 2R5TA 2HK5A 3GU4A 4PRJA 5CWZA 3PA3A 2CKQA 5JQ5A 1OMWA 3OC1A 4OR5A 2JEDA 3QALE 1DI8A 4I1ZA 4MF1A 5D7VA 4TL0A 1H24A 1SMHA 2GQGA 4DBXA 2HELA 2X7OA 4M69B 5DN3A 4AAAA 3D0EA 4FL3A 3PP1A 3ZCLA 5M4FA 1QPCA 5IU2A 3FQHA 1ZY5A 2X4FA 3AD4A 3OTVA 4CZUA 4YC6A 5CEQA 1OGUA 3MY0A 1YQJA 4NKSA 5DPVA 1Q61A 4FZFB 4IACA 4LV8A 3ZTXA 2WIHA 3EN7A 2JC6A 5AP7A 3MBLA 4BCOA 2R2PA 4BTKA 5CF4A 5DHJA 4U6RA 3MVLA 2BROA 2ITPA 3BV3A 1VZOA 3VAPA 1OI9A 1Y91A 1CKJA 2XCHA 5J95A 2Y4IC 2VTNA 1ZMUA 3A8WA 2C6KA 4JS8A 4FVPA 3MTLA 4JAIA 3KMWA 2QG7A 3LQ5A 2W05A 4GK3A 4QYEA 3NUAA 4K6ZA 4MXZA 3UP7A 4BYJA 1ZMVA 2V7OA 5E8TA 5AV3A 4RGJA 3NZ0A 3FDNA 5JZJA 1XH5A 4D0XA 5FTQA 3NYOA 3Q4CA 4BIDA 4IX5A 1XR1A 2OWBA 5CS6A 2A1AB 4O22A 1FBNA 3C9WA 4W4WA 5E1EA 3R83A 5LMAA 3EN5A 5FP5A 2A2AA 1M14A 4GG7A 4ZTHA 4G1WA 3R02A 1KV1A 3V5QA 5A46A 3O8PA 1ZARA 3QL8A 2IW6A 2W1DA 3LW0A 4FUXA 4FEWA 4GK4A 1PXOA 2VWXA 3QWKA 4PV0A 3V8WA 1JPAA 4R8QA 3EYHA 3RK7A 3UE4A 4XHKB 1PXNA 2O2UA 1SVHA 3QYZA 4FKVA 1JKSA 3K3IA 4WUAA 3N4TA 2R3IA 5LARA 2YCQA 2GSFA 4KKHA 3PLSA 4IBMA 4DLIA 5GZ8A 4ZY5A 5IUIA 4O7ZA 4AGWA 2YM3A 1V0OA 2YIYA 1Q8ZA 3C4EA 3WF5A 4EYJA 3BYUA 3IKAA 3NUSA 1FINA 5HU3A 3A8XA 5L8JA 3VJOA 2PWLA 3MJ2A 5A54A 2WO6A 4MAOA 2JD5A 4RIXB 4X6QC 4Y83A 5J8IA 5BUIA 5HLPA 4FEXA 3O8TA 5CX9A 1TQPA 2XIYA 1Y8YA 3V6SA 1OUYA 3DKCA 5EK7A 1BX6A 1H1QA 3EQIA 1M17A 2C69A 4C33A 4EHEA 2Z02A 5DVRA 2O63A 5BUEA 4RJ3A 1JSTA 4R3RA 4U8ZA 4OT6A 4NM5A 2YLEA 3TN8A 5LWNA 4EOSA 4O7NA 3EKNA 2E9NA 5CVGA 1ZYLA 3V6RA 5KX8A 2P2IA 3P23A 4FVRA 2R3KA 4GV1A 4MXYA 3ZO4A 4FEVA 4LRJA 4C57A 2VX1A 3DZQA 4IWQA 4RC3A 2FSMX 3L8XA 3JY0A 1A9UA 3FI2A 4F9AA 2F7EE 3KXHA 1WVXA 2JFMA 4D0WA 3UYSA 3DDPA 5KMLA 2XBJA 2ITTA 3LCSA 3LHJA 2OGVA 2I0EA 3V8SA 4H05A 5CNOA 3AGLA 2C3KA 2W5AA 4XMOA 2C47A 2EVAA 5D41A 3DKGA 4I5MA 5F9EA 3T3UA 5T3QA 1GIJA 4BTFA 4CKIA 5IMEA 3E62A 3FLNC 4IM0A 3U6JA 4UY9A 2WMAA 3I6WA 4RZWA 3PPZA 4YHTA 3N4UA 3GCUA 4L68A 4OTIA 2CGXA 4JLCA 2HY81 4USFA 3R9RA 1WBVA 4IC7A 2J9MA 1J1BA 3DT1A 4Q9SA 3UIXA 4D2TA 3W16A 2W4KA 5KMKA 3M42A 3KK9A 5EYCA 4ZMFA 2WMWA 1SVEA 3CBLA 4NIFA
chains in the Genus database with same CATH superfamily
3CJFA 2EWAA 1VEBA 2FSTX 2OICA 4KKGA 4M15A 3MA6A 4HCVA 4ZXTA 3BRBA 2WEIA 1TFFA 2QO2A 1K3AA 4I0RA 3NNXA 1URCA 3FYJX 4PDOA 4AACA 2QR8A 2I6LA 5H9BA 5HX6A 4KSPA 2FUMA 3TMOA 3WE4A 4GU6A 4FKSA 4XP3A 3Q9ZA 1FGKA 2PVNA 4U40A 5EFQA 1YHVA 4IAIA 4XNEA 2BZIB 4ITIA 3DDQA 3P78A 4ITJA 1KOBA 2P0CA 3G0FA 5HHWA 2IZRA 2DYLA 4C35A 3BGZA 3H0YA 4G16A 3RPOA 4D2PA 1I44A 2W4JA 4L9IA 4M3QA 3NNUA 4MHAA 4EK6A 4NL0A 3LM5A 4X2KA 3G33A 2R4BA 4X7QA 3RAHA 2WMSA 3RWPA 5KBQA 3UOJA 3OT3A 4BDFA 4C58A 4IADA 4OAVB 1F3MC 5HEZA 2CNVA 5HNBA 5EHLA 5E90A 4ZJIA 4EHGA 3LQ8A 1XKKA 2QU6A 3DLSA 1XH8A 3LJ0A 3QU0A 4GSBA 4KWPA 4XUFA 4C3RA 4OBPA 4F6WA 3O2MA 4O27B 3R2BA 4C2WA 4FZDB 2PYWA 4MWIA 3R7YA 5K0KA 4FR4A 4OTGA 1G8KA 1JKKA 3PVBA 4U43A 4WHZA 3LFCA 2OZAB 1ND4A 3B8RA 4OT5A 4H39A 5A4TA 1IA8A 5ETCA 2VTIA 3UYTA 2XYUA 3PSDA 4Y5QA 4ZTQA 1PKDA 4O0XA 2IN6A 3BEGA 4ALUA 2PUNA 4C4FA 4O6LA 5CI6A 4EC9A 3UOKA 5IA3A 3Q2JA 3GC9A 2ITXA 3ZU7A 5LVMA 1FVRA 3GXLA 3KC3A 4RIOA 2WXVA 3Q04A 4FK6A 3QHWA 2UW8A 3KU2A 2QOOA 5C9CA 4CRSA 1XH6A 3BLHA 1K2PA 3R28A 4ACHA 3FLSA 3V5TA 2BMCA 4L7FA 2OLCA 3H10A 3QZGA 3TZ7A 4JAJA 4ENYA 3SX9A 1YXUA 5A9UA 3E93A 2GNGA 3UNZA 3HLLA 4YJQA 3VF9A 3E8CA 4YJTA 4CFNA 1DAWA 1YW2A 2X8EA 3KULB 2WQEA 2ESMA 3V04A 3R00A 3R04A 3LVPA 1PXPA 2E9PA 3QKMA 1WCCA 4O84A 3UOLA 4Y72A 3VO3A 2VWZA 4JG8A 4O0UA 4CEGA 3AKKA 2BALA 3ETAA 3ZSIA 1GZOA 3F2RA 3IGOA 5BVFA 1CMKE 2Z7SA 4J52A 3FEGA 4QPMA 1YXTA 2RF9A 4J53A 2WMXA 2DWBA 3FQSA 3PIXA 4I22A 4IB5A 3A61A 3I4BA 3OCBA 4LOPA 4BDJA 4DH8A 2UZOA 5LVOA 3BE9A 3HA6A 5A4LA 3MW1A 1NW1A 4AXFA 3R7UA 1YWNA 3PFQA 4ANLA 5FG8A 3ZUVA 4AA0A 3PLAE 3LXNA 2PSQA 2XM9A 3A7JA 2Y0AA 4FIIA 3BU6A 2C1BA 3FQEA 2W1FA 4LUEA 5BVNA 5FXQA 5IQHA 2J90A 4UX9A 1REJA 2IVSA 2OKRA 3CXWA 3E64A 3PRFA 4KS7A 4S2ZA 4RWLA 5CI7A 2QONA 4FV5A 2EB3A 1MUOA 3JUHA 1OKYA 2RGPA 2YDIA 4GIIA 3QCSA 2KULA 2XKEA 2YM8A 2GS6A 2UUEA 3OEFX 2XIXA 1MRYA 3V5LA 2XNPA 3MVMA 4JRVA 5IQEA 4LOQA 3C4ZA 2R3OA 4YLLA 4GFMA 4JT3A 4RJ4A 3ALNA 4E1ZA 2W1CA 3ZH8A 5FQDC 1XBAA 2BVAA 3W32A 5M4UA 3BGPA 3SA0A 1A06A 3HMIA 4RMZA 4EUUA 1Q3DA 3IW5A 3QQLA 1UKHA 3Q9XA 4QNAA 4I6BA 5J9YA 3TEIA 5EG3A 2W5BA 3R7EA 3W1FA 3AKJA 5LVPA 4G5JA 1PMEA 3TXOA 4U3YA 2AC5A 4ZZOA 1X8BA 3COIA 1V1KA 5FD2A 3ZDUA 2YCRA 1J3HA 4WG4A 4USDA 2VTPA 4TNDA 4DCAA 4LI5A 2IZUA 1G5SA 2YACA 5DGZA 3NVMB 3I1AA 4ASZA 2ITNA 4G3FA 5AUWA 2R3FA 3F3TA 4W4XA 3BQCA 3KF7A 4CXAA 1TKIA 4FX3A 2BRGA 4E20A 1XH9A 1U54A 2ACXA 3DJ7A 4KRDA 5BYYA 1BL7A 3PVUA 4O7VA 4QOXA 5CT7A 2PMLX 4YLKA 4GEOA 1OKWA 4FSQA 4I24A 3W0SA 5EI8A 2WPAA 4BZNA 4ANMA 4CMOA 5I5ZA 2XIRA 4OTHA 4CLJA 4YGAA 4H3QA 3ORLA 4FKUA 5JT2A 1OM1A 2CSNA 3VS2A 4CRLA 4QPAA 2NO3A 2ZB0A 4NH1A 4JG6A 1SYKA 2PUIA 4I41A 4ZSEA 1NVSA 2OIDA 1JNKA 3PY3A 4AG8A 1PMNA 3EQPA 1NT2A 4CFMA 3QLFA 4B8MA 4LQMA 1MP8A 2B7AA 2X1NA 2W1HA 4F1OA 1PHKA 4FV8A 5KMOA 1OIYA 4X3FA 3WF8A 1M7QA 4OBQA 3IDCA 3VONA 3W33A 4X3JA 4HYSA 5EI2A 4QNYA 2YHVA 5HBJA 3NFGB 3DQWA 4W9XA 4EI4A 4OTDA 3TKIA 2FVDA 5J7BA 4AQKA 2EU9A 1RE8A 4DAWA 5DRBA 4EZ3A 4FV4A 4M66A 3VS5A 3ULIA 3QGWA 4FV9A 4X2NA 3I5ZA 4H3BA 3ZEPA 3R7VA 4CVAA 1HOWA 4UWYA 4RLKA 1YI6A 4ACMA 1YDTE 4YC3A 2C0OA 2Y8OA 4LOOA 3SRVB 2JIUA 3TNQB 4QP2A 4CT2A 4EOIA 2WOUA 3QX2A 1XH7A 4IVDA 1H00A 3QKLA 4M14A 4APCA 4DGLC 2OFUA 3AQVA 3HECA 4JR7A 1SZMA 1E9HA 5DFPA 3OP5A 4RVTA 2GNFA 4ASEA 3ZM9A 3R8UA 4CT1A 5J79A 4AZSA 1OVEA 4K9YA 3ORZA 3G5DA 3SV0A 3FZPA 3LFSA 5C8MA 3IW4A 4YTFA 4BDKA 1GIIA 5D1JA 4QTDA 4N6ZA 3W8LA 4KINA 2X0GA 3E88A 2VO3A 5IZFA 4WNMA 4BCQA 5KMMA 4F0GA 3U51A 5TR6A 4IVBA 4PUZA 2YIQA 1FVVA 2ETKA 2VTAA 4FT0A 4AZEA 4ERKA 1UU7A 2UW9A 2HZIA 2QD9A 3MA3A 3TV6A 3G90X 5TT7A 3LAUA 4EQUA 1CTPE 3JY9A 5E8WA 2PMNX 4IW0A 4QP9A 3A7GA 2XKCA 5IH6A 3FMLA 2Q0NA 3F5PA 2WOTA 1Z5MA 5BMMA 4EOKA 5LJJA 5IEXA 4MYGA 4RX8A 3V3VA 3P0MA 4JJRA 5HVYA 3FXZA 2WTVA 3UC4A 2J5FA 3ACJA 4BGQA 4IWPA 4K33A 3PZHA 2ONLA 4DH7A 4USEA 5M4CA 3DKOA 4RWKA 4AXDA 3IOPA 3PSCA 3EFKA 2ITVA 3UIBA 2GHMA 4BKYA 4ITHA 3VUMA 3RAKA 2QOCA 4AWIA 5L6PA 5GJDA 5J1WA 3VJNA 4FICA 3W2CA 4CMUA 2C6TA 4YPDA 4G31A 5J9ZA 2YCSA 4XBUA 4F0IA 3QBNA 4R6VA 4XLIA 2OJIA 4BVUA 4FEUA 5HQ0A 4ZSJA 2B9HA 4NFNA 2O3PA 4B0GA 4F63A 1O6KA 4RFMA 1NVRA 1O6YA 3CS9A 4FK3A 2WQOA 2EUFB 3P7BA 1W7HA 5E91A 2ITYA 1IAJA 4FYOA 2XP2A 2YFXA 5DR9A 2ZM4A 4FTCA 1BLXA 3ZLSA 2OJFE 2V62A 1J7UA 2E9VA 3HAMA 3U6IA 3ATTA 4U80A 5IQCA 4Z9LA 4ZEGA 4DGGA 1H8FA 3P5KA 3R1YA 3Q32A 4IWOA 3MH3A 4PTGA 5AM7A 3F6XA 5KE0A 3O7LB 4C2VA 4ENXA 3R30A 3L8VA 4X2JA 5AIRA 4BCIA 5HIDA 4O7WA 3IECA 3GP0A 2X39A 3LXLA 5HLNA 2ZDTA 2IF8A 4GUBA 3PY0A 2BKZA 4AGUA 4MH7A 4PMPA 5KKRC 2PULA 4UYNA 3MPAA 4X6RA 5BYZA 3DXPA 1XQZA 4NEUA 3TJDA 3F69A 4F7LA 5M56A 3TNIA 3Q5ZA 2I0VA 4DHFA 5I9ZA 2GU8A 4XRJA 4BGGA 3R6XA 4AS0A 5ITAA 1OL5A 5AX9A 3KXMA 3JVSA 5HE3A 5TE0A 3VUHA 4D2SA 3K54A 3VRZA 4TNBA 4C4IA 5L2SA 5C4LA 3BHVA 1DS5A 2YIWA 2YWPA 4EQMA 5F4NA 4DEAA 3F88A 3LFEA 4NCTA 4ZTNA 4D5HA 1YDRE 4PNKA 2VGOA 1LEZA 2IVUA 4F78A 1R0EA 2YJRA 4RA4A 3CE3A 2WGJA 2WNTA 4ARKA 3D5WA 4Y8DA 4L43A 4G3GA 4ZTSA 2Y6OA 4RPVA 4FC0A 5J5SA 4BKJA 4S30A 5I4NA 5AR7A 2WD1A 4DEGA 4MBLA 4AP7A 5EKNA 3QRUA 4YZ9A 1OECA 3NPCA 2XK3A 2VTQA 5A4EA 5E7RA 5KZIA 2WTCA 3S00A 5LMKA 3RALA 4O7RA 3QCXA 3H9RA 4XLVA 4HGLA 3PYYA 3EZVA 5AP2A 5LWMA 2YZLA 4ZZMA 1JSVA 4N6YA 3CKXA 2XJ0A 4FKWA 4IWDA 4CFVA 3UDSA 4BDDA 3PVWA 5FDPA 5CF5A 3IS5A 2Y9QA 3OUNB 4F65A 3AMAA 3FL4A 1GAGA 4E4NA 4ZSAA 5J87A 4K8AA 3UO5A 5J7HA 3I6UA 4YJSA 3CSVA 2P4IA 3MWUA 4XYFA 4YZMA 1W83A 2XK4A 3F3UA 4YHJA 4XV1A 4HYHA 5L2QA 5CU4A 5BMSA 3E87A 4DE4A 4IX6A 4K77A 3QA0A 1P14A 1H25A 4U7ZA 4E6QA 2QQ7A 4QP8A 1ST0A 3MSSA 5KCVA 5IPJA 5DIAA 4O4CA 3PVGA 2XNOA 4UZHA 4DBNA 5L4QA 4FA2A 3GU5A 5FRIA 1G8AA 2QOHA 2XK8A 1B6CB 1KWPA 5JZNA 4E6AA 3LMIA 3R8PA 3ZLWA 3BGQA 3F66A 5DT4A 2PE2A 3EMGA 4ID7A 4DGMA 2W1EA 2BRBA 1FMKA 1E1XA 4FG7A 3L8PA 3VUGA 3NSZA 2BKKA 2V22A 2WELA 4APPA 1L3RE 3P08A 3Q4ZA 4F6UA 2C6LA 5M07A 5DYJA 2WKMA 2PK9A 2C5OA 2J50A 4PX6A 4FKQA 3L9NA 2VX0A 3LCKA 5HX8A 1YOJA 4JDHA 5FTOA 3G6GA 3HV4A 3VS6A 3LM0A 3QCQA 3W2SA 4AE9A 4EHVA 2HYYA 3TUCA 4K18A 5M57A 3UG2A 4W4VA 4YJNA 3Q5IA 2YDKA 3WF7A 3NNWA 1R39A 3HV5A 4LG4A 4AQCA 3KRXA 3VS3A 2C6OA 3A4OX 4JIKA 4IM3A 4RC4A 3T9IA 2CLXA 4KKEA 4J7BA 4JBPA 3MH0A 4RJ6A 2B55A 2QHNA 4RQKA 3AT4A 4O4EA 4O1OA 4XEYA 4S33A 3KXNA 1T45A 4O2PA 3GCSA 1ZLTA 4CKRA 4FBXA 4FZ7A 4O21A 3RVGA 3EOCA 3C4FA 3WBLA 2QHMA 2OI4X 2QO9A 4FNYA 4N70A 4R3CA 2JAVA 2X0QA 3KQ7A 4QP3A 2PZ5A 1WBNA 4DFLA 5JGBA 4QMTA 5AR8A 1Q62A 2P3GX 4AOTA 2PE0A 1BYGA 2JDTA 1S9JA 3KIOC 5E8SA 2AEGA 3CQEA 2VTSA 2GMXA 4FZ6A 3BU3A 3V5JA 3UZTA 5M51A 5BVKA 3HZTA 2JDVA 3VHEA 5HBHA 4GJ2A 3C5IA 2CHLA 1ZYCA 4AXCA 3R73A 2OJJA 3E63A 2J0LA 4ASDA 2OZAA 5GNKA 3VBWA 4FKOA 3HNGA 4EK3A 4FIHA 3CGFA 4I4EA 2XUUA 3QXOA 2XIKA 2XB7A 4PL3A 3TUDA 1U46A 3HX4A 4FKTA 2H8HA 4XBRA 5ANJA 1J1CA 3AT3A 3NUPA 2ZYBA 2HAKA 3GBZA 4YR8A 5JFSA 5BVOA 3PP0A 4QMYA 4DTKA 1OL6A 3ZMMA 3TDVA 4ASXA 4C02A 4Y95A 2ZV8A 3D94A 1VLRA 2XNGA 4LM5A 2GS2A 3UPXA 4DT8A 3O96A 5HCYA 5EM5A 3P5JC 5EYKA 2XRWA 3LJ1A 4KNBA 3VS0A 3SQQA 5KZ0A 5JRQA 4E5WA 3RAWA 4EOPA 1Q8TA 2HWOA 2X8IA 2FGIA 3KCFA 4AUAA 1IA9A 5CSVA 3KULA 5HORA 2BAKA 2VWIA 4BBEA 3PXKA 5JK3A 2R3HA 2BRHA 5M53A 2RFNA 2BR1A 4CKJA 5EQPA 1JKTA 3ODZX 4QMMA 3TJCA 3TTIA 3LOKA 4K1BA 3W55A 4RQVA 5GJGA 3DNEA 5JGAA 5C8KA 3IG7A 3LZBA 3RNIA 4W4YA 4BGHA 5J1VA 1YXVA 3E8NA 3QKKA 4CGAA 4A9RA 1WBOA 3DZOA 3HUBA 3PG3A 2VX3A 2UW7A 3GQIA 5CALA 5ANDA 5AUXA 5FEEA 4WIHA 2G9XA 4CTCA 1S9IA 5HE0A 3RM7A 5DEYA 4F1TA 4DH5A 4V05A 4CFUA 3UZRA 5CVHA 4GS6A 4LGGA 3TZMA 5H3QA 3FMHA 3WZJA 2CNQA 2FYSA 3G51A 1KE9A 3F61A 2YCFA 3QUEA 3ORNA 3CY3A 4JVGA 3DOGA 4O91A 4TYJA 5E1SA 4E4MA 4EL9A 1LUFA 1IG1A 3ROYA 2YEXA 3ZONA 5FGKA 1MQ4A 2ZM3A 3IDBA 3FMDA 3F7WA 2BDWA 3SXRA 4C38A 3SXSA 4ZLZA 2Z8CA 3C0IA 3HDMA 3RP9A 4GVAA 4NK9A 5JSMA 4KIQA 4UV0A 5TF9A 3R63A 5ANEA 3KY2A 5H8EA 2YM4A 3I7BA 2CJMA 4I6LA 5CXHA 5CXZA 1PXLA 4XOYA 1W2CA 3E8DA 4EZ5A 5IA5A 5IQAA 5D10A 3NR9A 4RVMA 4EZ7A 4DT9A 2PVYA 4YP8A 4DG3E 4TWOA 2GQSA 3CQWA 2X7GA 4RC2A 4PNIA 4DG2E 4OBOA 5IA1A 3GUBA 3ZBFA 4RX5A 2UW6A 2PTKA 2PMOX 4WSYA 3DXQA 4DINA 1JOWB 4EOQA 5JEBA 3DFAA 3MH1A 4QTCA 3A4PA 4J1RA 2O65A 3G9NA 5AR4A 4L3JA 2C5NA 3H0ZA 3R1SA 4YC8A 4FE2A 4ZY6A 3VUDA 4U81A 1Q4LA 1XHAA 5DA3A 5GZ9A 3R22A 5HO8A 1UNLA 4EH9A 4PPBA 1WVYA 3BHUA 1PXIA 4GG5A 4MCVA 1UVRA 4RX9A 5C8NA 3AD5A 4WT6A 1Y8GA 4DFBA 3DK3A 1PYXA 2YDJA 3G0EA 3UNJA 3DXNA 1V0PA 3QWJA 2WTWA 2BIKB 3PE1A 3QRIA 3V8TA 5TKDA 4JDIA 2YITA 3FJQE 4EJNA 3UQFA 3MESA 4DA5A 3WZDA 2JIIA 3PPJA 1YWRA 4N0SA 3UG1A 3P7CA 4O83A 2Y4IB 4Q2AA 4BCMA 3LLTA 4IX4A 3AD6A 3D2KA 4Y85A 4ACGA 4A4OA 4CFXA 4RVKA 2B9IA 4WA9A 4P90A 3COHA 4R7IA 3R7IA 3RNYA 4DEBA 2NYAA 4U44A 2C68A 3UC3A 3MI9A 2ETRA 3EIDA 4RIWA 5IISA 2UV2A 5AA8A 1Z57A 2GS7A 4U0IA 3LXKA 4FT9A 1OIRA 5IQDA 2BFYA 3QGYA 2OXYA 3OCGA 3PG1A 3MDYA 2UZNA 3FZSA 2IZTA 4TN6A 1Q24A 4OTFA 4KAOA 4L8MA 5IG1A 3PXQA 4Y5HA 3UGCA 1OL2A 5FM3A 3CCNA 2C3JA 2J6MA 3EN6A 1VYWA 1Q3WA 3FMJA 3GU6A 3MH2A 4IZAA 4AT3A 3OY1A 4AT4A 3WZUA 3GC7A 4I0SA 4RJ5A 5DT3A 3KMMA 1FPUA 4WG3A 2WU6A 3DAKA 2XK9A 3QD0A 5CY3A 4DFNA 5A4QA 5AP5A 4MWHA 5AUZA 2W1IA 3R9DA 3SRVA 3QCYA 4NFMA 4R5YA 4FL2A 2ZB1A 2VTLA 3VS1A 4AZVA 3ZO1A 2OF2A 1PXMA 1WBWA 3Q52A 3KRLA 4D4VA 4FKLA 2OSCA 4QDEA 2ZV9A 3I81A 3QTWA 4C62A 4AU8A 2RFDA 4FL1A 1OBDA 1PRYA 1IR3A 4IX3A 3W0NA 4FOCA 4O0VA 5AP1A 4AW1A 3CTHA 2XJ1A 3E5AA 3KEXA 3TUBA 5L2IA 1JBPE 2CMWA 1WVWA 4MXAA 4UWCA 3DK6A 2SRCA 5GHVA 2JBPA 3D9VA 2R3PA 4NM3A 4G6NA 4YTIA 3TM0A 5AIKA 3FPMA 4JBVA 2HW7A 3DBQA 5I9WA 4QP1A 2JGZA 2FO0A 4EONA 4HW7A 4PQNA 2JDOA 2VUWA 5EI6A 4ZY4A 5AP6A 2XCKA 2XMYA 2ZMDA 3PJ3A 4NYEA 3NRMA 4ORKA 1OPKA 3VW6A 4L53A 3WILA 2IPXA 3M2WA 4EORA 4IEBA 5EOBA 2NRUA 4HGSA 4F9WA 5CU6A 3KCKA 4FVQA 5M06A 3PJ1A 2PY3A 4JQ7A 3FI4A 3PY1A 1TQIA 2OH4A 3QD2B 5EDQA 4MUQA 4G3EA 4FKIA 3PXZA 3BYMA 4CFWA 4L3PA 5HIBA 2RIOA 4JL9A 5HZNA 4YLJA 3R0TA 3SKCA 4O38A 5HCXA 2UZUE 2HY0A 5FTGA 3KVXA 2IG7A 4JNWA 2J5EA 2J0MB 1REKA 4BCHA 4FZAB 1WZYA 3LIJA 5IA0A 4GT4A 4DG0E 1XMMA 4O7YA 4QMQA 3D5XA 2C5YA 4A7CA 3H4JA 4A9UA 5K9IA 2QOBA 4C0TA 5IKWA 3C1XA 5BX0A 3JS2A 1GZNA 2UW0A 4BTMA 3GCPA 1EH4A 4EOJA 4O0RA 4PMTA 4QO9A 1JAMA 2R3NA 1CM8A 1YXXA 4O4DA 3VQHA 4QQJA 3RPYA 5IH5A 3A99A 5DEWA 2JKOA 2A4LA 4XX9A 4L52A 3GCVA 5HNIX 5EHOA 5G6VA 5L2WA 2XNMA 2F49A 4LYNA 2WQMA 3RBWA 2ZV2A 2AYPA 3G9LX 2JAMA 4KUJA 2VD5A 3NX8A 2X0OA 4Z7HA 3DNDA 5H2UA 4AN9A 1L8TA 1JQHA 5CEKA 1YVJA 4ZTRA 4EH3A 5IUGA 5HLWA 1SNXA 4KBAA 3DQXA 4BF2A 3L9LA 4MF0A 3BYSA 4TYHB 2XALA 3ZO3A 2QR7A 4H36A 5E4HA 3NMUF 3FMNA 3UDTA 5ICPA 5EW9A 3UOHA 4O82A 3VBVA 2XRUA 3N4VA 2IW8A 4AN2A 3HRCA 1P2AA 4KA3A 3A7IA 4DFYA 4YSMA 1RQQA 1YI3A 5F1ZA 5B7VA 4GK2A 3UNKA 3D4QA 2ZM1A 4OTWA 4LGDA 4EOMA 4DHJA 1YRPA 3ZUTA 4FNZA 3MVJA 4L42A 4YTHA 3IO7A 4BWKA 2JFLA 2C4GA 3FI8A 4ZJVA 2VO6A 2KTYA 2ZOQA 2H34A 4J98A 4BCGA 2F9GA 4C4HA 3FHIA 3LCTA 2GTMA 4JR3A 3DBFA 4YZNA 5CEMA 1ZWSA 4HCUA 5EDRA 1KUTA 4FJVA 3W0RA 4DTAA 5LOHA 4PP9A 5CZIA 4EUTA 4Z55A 4TW9A 5CVFA 2OBJA 3TTJA 3HA8A 3POZA 2ITZA 5LXMA 3RHXA 3OXTA 3UBDA 5CSXA 4E26A 5C1QB 4YZCA 3WZEA 3OUKA 4D1SA 3OEZA 4GYGA 4QPSA 4AA5A 2XH5A 4I20A 4TT7A 2V7AA 3HRFA 2CCHA 4FI1A 4GYIA 3FE3A 4I0TA 1YHWA 4DC2A 3D7TA 1H26A 2ZAZA 4NT4A 3PIZA 4FGBA 1H01A 2QVSE 3DJ5A 4O0WA 4YNEA 4QYFA 3TIYA 1Y6BA 4FNXA 4PF4A 4QQCA 3DV3A 4BR3A 3OFMA 1OIQA 1ZYSA 3HMPA 3SHEA 5CT0A 4CZYB 3KN6A 4U9AA 2YA9A 3T8OA 3UVRA 3ID6C 4D28A 1SM2A 3Q6WA 3CTQA 3BLRA 5C26A 5ETAA 5GJFA 5ETIA 3VS7A 3C4XA 4G6LA 2XNBA 2ERKA 3FMMA 3PWYA 2YIRA 2W96B 1QPEA 3NGAA 1UNGA 3D5UA 2HOGA 3FSFA 4ZK5A 3ZFXA 4DHIB 4FTUA 3OROA 1HCKA 4CZTA 1ERKA 2BTRA 2OFVA 1Q97A 4BI2A 3FKOA 3CD3A 2PHKA 3MIAA 4FTRA 3U54A 3K2LA 4UALA 3AC8A 3BCEA 3ORKA 2R0IA 2UZBA 4GH2A 4LL0A 4RIWB 1G8JA 3TI1A 1YWVA 5CSPA 2OF4A 3HMOA 3PTGA 5BVEA 1PF8A 5FBOA 3KXXA 4MVFA 4M0YA 4TYGA 3FLYA 2OG8A 5AAEA 3RK5A 3I0OA 4AW2A 3AT2A 4G5PA 2XVDA 4EBWA 5C01A 4I3ZA 2IO6A 4XRLA 3PPKA 3VIDA 5CAQA 3NYNA 4XG9A 4FNWA 5CAPA 3CLYA 4YMJA 3TNHA 4IFCA 4NSTA 2BZJA 5KMNA 3C4CA 2UW4A 4FMQA 3OVVA 4ALVA 3U4WA 2EXCX 4D4RA 3P9JA 4DLJA 1JLUE 2BZKB 2YAKA 4ZP5A 4QQ5A 2Y7JA 2WQNA 4XV2A 4S32A 4BCFA 2BCJA 3E7OA 3RCDA 5ACKA 5JN2A 1PY5A 4I92A 3AXWA 2PVJA 3COKA 3CEKA 2PE1A 4LL5A 1UKIA 3S2PA 4FGRA 2X6DA 2ZFYA 5D7AA 4FV2A 2PL0A 3OW4A 5GINE 1ZAOA 4XP0A 3CTJA 3FZRA 4C34A 4FSRA 3D7ZA 4D58A 3ITZA 4E7WA 2CGWA 2R3JA 3GC0A 3IOKA 3NWWA 3KRWA 2GPHA 4XP2A 5HTIA 3RPSA 3AGMA 3UDBA 2QC6A 5KBRA 1Q5KA 1UA2A 3WARA 1UNHA 2C1AA 3TKHA 4HJOA 3TKUA 2WHBA 4F08A 2O0UA 4NW5A 5KUPA 4BDCA 4CLIA 4C4JA 4QMUA 4E6DA 4XCUA 5CSWA 3UQCA 1XBBA 2PZYA 3H3CA 4LRKA 3UMXA 4DH1A 2VWVA 2IEWA 4BI1A 4RWIA 3QTUA 5K5NA 5I3RA 3SDJA 1LP4A 2QLUA 5FWKK 3S95A 1CKPA 4GT3A 1MRVA 3BX5A 1PMUA 4PPCA 4BJJB 2J0IA 3AC2A 4AXEA 4RRVA 3ATSA 3UJGA 4XG7A 1Q41A 2Z7LA 3F2NA 4D2WA 4YPSA 4H58A 4HPTE 5EH0A 2G15A 4IDTA 2PVKA 4B6LA 2UZWE 4EH7A 3OWJA 5IEYA 4ERWA 3KKVA 4I93A 3UVPA 1W82A 2V5QA 4KSQA 3UZPA 1XJDA 3IDPA 3EH9A 4E6CA 1H27A 1BKXA 5JRSA 3ZDIA 5K0XA 5BYLA 3DCVA 5HTBA 3QRTA 3KRRA 4M68A 4DN5A 4BCNA 3BHTA 4F7JA 3MY5A 2E2BA 3IPHA 5AV1A 2VNYA 3QHRA 1JVPP 5M08A 5AUVA 4QD6A 3UQGA 3FPQA 4WNKA 2QOIA 4FTAA 3ZBXA 4AGCA 3VUTA 2WTKB 4FTKA 3EQHA 3UODA 3NEWA 3OTUA 3BZ3A 5CEIA 4EK4A 4IB3A 5FXSA 2QU5A 4J97A 2HZ0A 4QP4A 2XNNA 3ZYAA 4JMQA 1AD5A 4U42A 4OTQA 1GZ8A 4CFFA 2X81A 4A4LA 4XJ0A 5IA4A 4TYEA 2Z2WA 1JKLA 3ERKA 4D5KA 2NPQA 2ITUA 3ORPA 3ZOSA 5KMIA 5M44A 3IW6A 2J2IB 1WMKA 3ZLXA 3DJ6A 4I94A 3ZUUA 3SC1A 2VO0A 3WYYA 3N9XA 2JITA 4FV1A 4GVJA 1LPUA 3F5UA 2C6IA 3L9MA 4O0SA 3ML1A 5HESA 3W0QA 2WB8A 5AUUA 5DT0A 2ZMCA 1IASA 1P4OA 3OXIA 3SXFA 3PE2A 3ORIA 1H28A 4C3PA 3S1HA 2AQXA 3OG7A 1FOTA 1TQMA 2X0PA 3RPVA 4TRLA 3Q4UA 1ZYJA 3OT8A 4JXFA 2AUHA 5AMNA 3BI6A 3C5UA 2RKUA 4FRFA 2QURA 3RTPA 5L2TA 4II5A 4UXQA 4FOBA 1XWSA 3KVWA 1YDSE 3MFSA 4X2GA 1PXJA 3R21A 3SOAA 3DAJA 4MQ1A 2P55A 4X3FC 3W0PA 4LGHA 5HO7A 3NCGA 1FMOE 2UVYA 4RIYA 3U55A 3KK8A