4X3JA

Selection of fragments for kinase inhibitor design: decoration is key
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
280
structure length
234
Chain Sequence
VLKARMDAAIKELEVLCKLGHHPNIINLLLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRNLAARNILVGENYVAKIADFGLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Angiopoietin-1 receptor
publication title Selection of fragments for kinase inhibitor design: decoration is key.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 234
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4x3jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4x3jA01
2G9XA 3HMNA 3R01A 4G5JA 2VGOA 4MTAA 4F7NA 4AOIA 3DB6A 3QHRA 4A9RA 2YIQA 5HBJA 4TW9A 2QR7A 4FC0A 2GNIA 3PJ2A 1TQPA 5H9BA 4CG8A 2YIRA 3EKNA 4NZWB 4RMZA 4O96A 2QR8A 3TKHA 4BDKA 1KE5A 3LFBA 4NFNA 4G5PA 3I7BA 4U8ZA 3RPRA 4AS0A 5IDPA 4F0IA 4FKQA 5J9ZA 2CKOA 4RJ5A 1PYXA 4FL3A 4JRVA 4RWLA 4EOIA 5J9YA 4C62A 4E6AA 3EJ1A 3EL7A 3UZTA 3A7FA 3QXPA 4BGHA 5HE3A 1Q4LA 5CS6A 5HNGA 4JIKA 5E8XA 5EHLA 2BZKB 3VNTA 2NNWB 4YBJA 3EIDA 1PKGA 3FMLA 5EW3A 4U45A 4EOSA 4EOLA 2OF2A 2W1EA 3KRLA 2QOKA 2X4ZA 4I3ZA 4ZY5A 3LFDA 4XP3A 5EW9A 3QYWA 4O7WA 3BHHA 4QYGA 2ZM1A 4ZP5A 4E6DA 1H1SA 2GNHA 3MY1A 4HZRA 3FBVA 1U4DA 3E8EA 4O0WA 3DXPA 1QMZA 3TIYA 4Y5QA 3WF5A 4F9BA 4D1ZA 1BUHA 3H30A 4ZMEA 5C4KA 4F9CA 5EDRA 4JI9A 4PUZA 5CLPA 4X3FC 1TQIA 4FKLA 5D1JA 4DGGA 1OB3A 3PVWA 2BZJA 1GNGA 2RSVA 3TNIA 4DTKA 4BIEA 3FQHA 4NH1A 3D5UA 5JGDA 3A62A 4DG2E 4FTNA 2EVAA 4IWOA 5FEEA 5L6OA 3BRBA 4USDA 3M42A 4QMNA 2PY3A 2W06A 2J9MA 3MA6A 3KF4A 4IM2A 4QYFA 5AJQA 4C7TA 3IDPA 5AUWA 2PSQA 5HZNA 5ICPA 4KIQA 5AUXA 2F2CB 3DAKA 3C0IA 4FYNA 5CYIA 4F6UA 3WIGA 2UW0A 3QYZA 3V5PA 3PXQA 5C9CA 3SQQA 4FSYA 2KULA 4FV4A 2YM7A 2W4KA 4LRMA 3CPCA 4UALA 5M4FA 1ZYDA 2ZV2A 4FKPA 3IW7A 3NRMA 4NM5A 2E9UA 3V8TA 3C4WA 3CY2A 3ZU7A 2OH4A 3UVRA 2WTCA 2F4JA 5CF6A 2B9JA 3VQHA 3ZO1A 4LV8A 2G1TA 3T3VA 3D83A 3HRBA 4O7ZA 2V62A 3OWPA 2HK5A 3LVPA 1U54B 4TT7A 5AV4A 4FNXA 3CSVA 5LVOA 4ANNA 5I0BA 4FV2A 5CVGA 4FG9A 4JG6A 4UWCA 4CTCA 5J5SA 4RZWA 5A6OA 2YABA 3CD8A 2XIYA 4RWKA 4FV8A 5FWKK 4DC2A 5EQPA 3K3IA 4OR5A 4KBAA 4HNIA 3EN9A 3R00A 4WG5A 4ARKA 4C59A 3OUNB 2GNLA 4I92A 3TZ9A 3VHKA 4D9TA 4E5BA 3R8MA 3CD3A 3MH1A 3S3IA 3T8OA 3O51A 3QTUA 2EXMA 1ZYJA 4NCTA 5HIDA 3BQRA 3NUYA 4RQKA 3KCFA 2UZTA 4XG4A 2VV9A 1H07A 4JG8A 2GTMA 4FMQA 1H4LA 1SM2A 2XNBA 3D7ZA 3DBFA 3LFQA 4KIPA 5CSXA 5I3OA 4C0TA 4C4FA 5A4CA 2VTLA 5I5ZA 4ACHA 5GJFA 4D0XA 3H10A 2PZYA 2OSCA 5HG5A 3VUMA 4QD6A 3FMHA 3QAME 3DQXA 3AT2A 3HL7A 1B6CB 2OFUA 3I81A 4FOBA 4LMNA 3GFEA 4LUDA 2B0QA 4IVCA 4CMUA 1UNGA 1WBWA 3DBEA 4EI4A 2ITZA 2EB2A 5K5XA 3PWDA 5LVLA 3TKIA 2GHMA 3BU3A 3VRZA 5KZ0A 3LLTA 3KULB 5HG7A 2W4JA 4OT5A 5HEZA 3TACA 2YJSA 3I6WA 4X7QA 3IECA 4IJPA 4YZ9A 5FG8A 3UIBA 4L00A 3MVLA 4HYHA 2ITXA 5BNJA 3PSDA 4BIDA 3UPXA 5L2TA 1FVTA 3CY3A 4ZIMA 3MI9A 3MTFA 2HZ4A 2OIBA 3VWAA 3O2MA 1OKZA 3KQ7A 3QRUA 2JAMA 1NW1A 3RJCA 1Z5MA 3G5DA 5AX9A 3U6IA 3ZUTA 3FJQE 4N6ZA 4ACCA 1R3CA 3TV7A 1FINA 1WMKA 5K0XA 1UWHA 3C5UA 3QUPA 5DYJA 2IW8A 3IW5A 1H1QA 3WF8A 3VS5A 3IGOA 5EM7A 1H00A 3D9VA 3KMMA 3GXLA 3KN6A 1HCKA 4UZHA 1JSTA 1JNKA 5IEXA 3NIZA 4ERKA 4FKRA 4A9YA 2YZLA 2QU6A 2BZHB 4MXXA 4JOAA 5KMIA 3LW0A 4YNOA 3BYMA 5DRBA 4FIEA 3A7IA 1Q8TA 3SRVA 2X7GA 2OXXA 4U80A 4OT6A 4E73A 2YAKA 4RQVA 3B2TA 4Z3VA 3H3CA 4A06A 4GT3A 1OL6A 2X2MA 5DWRA 3HYHA 3D2KA 3TG1A 3VF8A 5M53A 4BY9E 5CSWA 4C58A 5D10A 4DYMA 3AMAA 5KZIA 4U41A 5KHXA 3I5ZA 2UVYA 2YIYA 5AV3A 5M4CA 4IH8A 4RC2A 4FT3A 3ITZA 4G3DA 3HGKA 3R6XA 2RFNA 4NYEA 3F7ZA 3KC3A 4GMYA 4F1OA 3JY9A 4G17A 4AW5A 1IG1A 3R2BA 3QWJA 4R6VA 4YC8A 1DI8A 2EXEA 3A7HA 3E88A 5C4LA 5BVOA 3C4CA 3HRFA 3NDMA 4BTMA 5TKDA 5IQEA 3D7TB 1P14A 1PXKA 4QMZA 3G15A 4N6YA 2JKQA 3QQLA 3NVMB 1SYKA 3CPBA 4FKGA 3Q53A 3QQKA 5IISA 5AM6A 3SGCA 4DEAA 1YXTA 2VNWA 2ZDTA 3OW4A 4TWCA 2W0JA 4FG7A 4FKUA 5DPVA 2E9OA 3GQLA 2CCHA 2EXCX 4FTIA 5EFQA 5HVJA 3ROYA 3W32A 3ORXA 4QOXA 4DT8A 2XKEA 1YRPA 3SOAA 5JSMA 3UYTA 3DDQA 5FM3A 4RFMA 2R0IA 3RVGA 4M68A 3RNYA 3MTLA 3ZFYA 4IIRA 3NZ0A 1ZOEA 3U4WA 1MUOA 3OBJA 4ZOGA 5FBNC 3BYOA 1ZMVA 4JJRA 2ZMDA 4AZTA 4LL5A 3R1QA 5DH3A 5CEKA 1WVWA 4AAAA 5HHWA 3L1SA 4CV8A 4USEA 1V0BA 2JKKA 2VTTA 3DXNA 2E9PA 1CKPA 3LLAA 3LXPA 2BHEA 2X2LA 3O8UA 2PK9A 5CTPA 2Q83A 3LM0A 3OROA 4GT5A 2WIHA 2ITVA 4RT7A 4UXQA 4EYJA 4PP7A 2W1GA 3THBA 3NWWA 5KO1A 4DFNA 5IUHA 5LMKC 3GCSA 4G34A 3QWKA 3WILA 2VU3A 3EQCA 3HA8A 3NAYA 4O81A 5H8BA 3VUKA 3KRWA 4WSYA 4FT0A 1VZOA 4IVDA 2E9NA 3RTPA 3EL8A 1OL7A 2YN8A 4XBRA 1W83A 2J0LA 2WZJA 2PL0A 2Y6OA 2ZM4A 4P5QA 5F94A 3QD2B 4AT4A 4IM3A 4N4SA 4CFWA 4CKIA 3B2WA 4F64A 3VF9A 2X7OA 4J71A 1ZAOA 4XG6A 2VWXA 3EFJA 1G8SA 3ZFMA 3BBTB 3ORNA 4BCQA 2BFYA 2VTAA 3W8LA 4AOTA 5AEPA 3R7VA 3PA4A 4UV0A 4DH3A 5E9EA 3E8CA 3O8PA 4JG7A 2X8EA 4EOQA 4HCVA 4O2ZA 5BUIA 2OI4X 5I9ZA 1FOTA 2HIWA 3BGPA 5KHWA 2C5YA 3DQWA 3R9DA 4DBXA 3L8VA 4J97A 4AU8A 5CSHA 2PZRA 3TDWA 2R9SA 4V01A 5AA9A 4U79A 4LOQA 5HCZA 3QTZA 5ANIA 3ZM9A 3PFQA 4G3EA 4MYGA 3H9FA 2QVSE 1OL1A 3Q5IA 4AFEA 4MVFA 4DE4A 4V0GB 4QMQA 2QU5A 3DU8A 2XP2A 2I0VA 3KXGA 2WTKB 4O0UA 4MF1A 1YOMA 3I1AA 3S4QA 4TYJA 4PDPA 1YHVA 2XIXA 1J1CA 2OG8A 5GJDA 4MD8E 4QMVA 3C9WA 3LIJA 4FZAB 3DK7A 3G9LX 4YTCA 4K9YA 3O23A 5KMKA 5IA4A 3ETAA 4KIKB 4AT3A 5HVYA 4K77A 3VBTA 3BYVA 5TF9A 3BI6A 4IAKA 3CP9A 5ETAA 1JOWB 4FF8A 4FV7A 4NU1A 2UZBA 5AAFA 3ZBFA 4F6SA 3LKMA 2UW7A 4FNYA 2RFDA 3ZC6A 4BDAA 5E8VA 3VUDA 5E8WA 4AZEA 2WU6A 2BCJA 2VX3A 3JVSA 3OEZA 1U54A 4ZZOA 4XEYA 5A6NA 1OL5A 2C3KA 3OCBA 4IZ5A 4EH3A 5HTIA 3N4TA 3R7IA 3KXNA 2C3LA 2W9ZB 5ANJA 4F9WA 1JKLA 1H01A 2GQGA 2W1FA 1AGWA 2WMSA 4X0MA 1WVYA 4C4JA 1VR2A 3FMNA 4BDFA 3II5A 1H1WA 4IBMA 4PDSA 3Q5ZA 2IZTA 2OJ9A 4LUEA 4RLLA 2ZM3A 1DI9A 3DKFA 1REKA 2R3IA 4UEUA 3PY3A 2HXLA 4E7WA 1H28A 2BUJA 4FSNA 4ANOA 4FK6A 3AXWA 4EK8A 3AC4A 2ETKA 4YJTA 4XP0A 4A07A 3JY0A 4L45A 3OY1A 4RJ8A 1Q8UA 4BCJA 1H25A 5CU2A 1PMUA 3KVWA 3PSCA 5CASA 3IG7A 2PZPA 4WIHA 4I5MA 4GK3A 3UOLA 2B54A 2P33A 2ZJWA 2CKQA 4Y73A 4U3ZA 3A7JA 4BCOA 4C34A 4UX9A 5JRSA 2OO8X 2XIZA 2ERKA 2YCFA 2Y9QA 5CI7A 3NUUA 3PZHA 5IEYA 3IS5A 1YOJA 4EK5A 4QP4A 4QP7A 2UVXA 3NUXA 3VUTA 5LCJA 5IQHA 3QQFA 2QKWB 3PIZA 1XH7A 3DPKA 3KULA 3RPOA 2QOFA 2IZUA 2R7IA 3FYKX 2VZ6A 3DJ7A 1CKIA 1FMKA 3R7OA 3ZEWA 3ALOA 4MH7A 3MS9A 4W4WA 2JIUA 4NW6A 4NFMA 3R8PA 4Y46A 4NK9A 3ZC5A 3FEGA 4O0SA 2ZMCA 3CTJA 2HZ0A 3QQHA 4EUTA 5HGIA 5KMNA 4J99A 3HAVA 4FVQA 1YXXA 3F66A 2JDVA 5FP5A 2Z7LA 2C3JA 3Q60A 3D14A 1YKRA 3QALE 5AM7A 3DB8A 3DOGA 3WOWA 4MD9E 1XH5A 5HI2A 4CXAA 3CJFA 3H0YA 1JAMA 4BDGA 2DS1A 4OUCA 2BRGA 2Z7RA 3OCTA 3Q4UA 4CFUA 2X9FA 4GRBA 2DWBA 4QO9A 1H1RA 1XH8A 2PZIA 5HVKA 4H36A 4OTQA 3RAKA 3NNUA 4JDJA 4QMOA 4QQJA 3RP9A 3VS4A 4YU2A 2V55A 4FVPA 3R9NA 3QTIA 3GFWA 4GVAA 2C3IB 1SNUA 5TE0A 4F65A 3PP1A 3AC3A 2C6IA 1W84A 4NT4A 2WMWA 2Y4PA 4JDIA 4AW1A 3PTGA 1KE6A 3N4UA 2R3RA 5LCKA 3UQCA 4DEDA 2AYPA 3CE3A 5AR3A 4B8LA 1OMWA 2XF0A 1QPCA 2QLUA 4XG3A 1OECA 4BYJA 2XIKA 3D5VA 1SVGA 3HV5A 4NJ3A 4BDBA 4MCVA 5LMAA 3P23A 3PLSA 3UO5A 4BBMA 2WB8A 2O64A 3BHTA 4X6RA 5DT3A 3GGFA 3R28A 3EQPA 5HTCA 3NNWA 2RF9A 3DAJA 1ZLTA 2P2IA 1AQ1A 2CNVA 3KB7A 2OGVA 1ZWSA 2VO6A 4UXLA 2Z7SA 4Y85A 3SLSA 4QMYA 3AC8A 2YHVA 3GCUA 5LVPA 4RJ3A 2ITOA 1YHWA 1YVJA 4IADA 5CSVA 3WE4A 3ZFXA 3IQ7A 2UW6A 3NS9A 4FKOA 3GC0A 3WF9A 3FXWA 4FT9A 4BBFA 3E63A 4X3JA 5JFVA 3FLWA 5HO8A 3UVQA 4YC6A 4DEHA 3OVVA 5DNRA 3QCXA 4D2RA 5F1ZA 1JVPP 2BRNA 1JSVA 4HJOA 3VS2A 5B2KA 4DLIA 1XHAA 4F0GA 4R3RA 3A7GA 4ZEGA 4DEBA 2QOIA 4PTEA 2WIPA 3I4BA 3JYAA 4E20A 2YLEA 1BYGA 2W1CA 3FKLA 3PPZA 2B53A 2P0CA 3QQJA 3PIXA 5FP6A 2RKUA 2YITA 4XLIA 4OTHA 4BN1A 4Q9ZA 3A99A 4C3RA 2X81A 4FIGA 5ETFA 4X3FB 3P0MA 2CN8A 4ZK5A 1TKIA 4YHFA 4AUAA 3SW4A 3MY0A 3TWJA 5ITAA 1LEZA 3G9NA 3HA6A 3KXMA 2WTJA 1ZYSA 3Q3BA 1YWRA 2R64A 4CKRA 3ENHA 3HRCA 2J5FA 2XEZA 3F5UA 4MHAA 4AQCA 4AA4A 4JAIA 4J52A 3SVVA 4WG3A 3TJCA 3DV3A 4C2WA 3HEGA 3V51A 3MW1A 3PXRA 4K33A 4WBBB 1J7UA 3BKBA 4NW5A 1BL6A 2XEYA 3BCEA 3HV4A 4BICA 4AF3A 4JAJA 4D2WA 4GEOA 1NVQA 5ANOA 4PMSA 3BGZA 4YTIA 4GFOA 1JBPE 2J0IA 4LGDA 3HDNA 2JLDA 2WMRA 1ZXEA 5ACBC 4CCBA 3VW6A 1V1KA 4IC7A 5IEVA 3FZTA 3VBYA 3UC4A 4U43A 4FE2A 3NGAA 4EH9A 4OAUC 2XJ2A 3DBCA 3KK8A 3QHWA 4PDYA 1PXOA 3ZDIA 1KE7A 4H3QA 4EJNA 3FV8A 2J90A 3OP5A 4G3CA 3WYYA 3PYYA 2XCKA 4I0RA 3GC7A 1BLXA 2HAKA 3FSFA 2WHBA 5D41A 4BDEA 2VNYA 1UV5A 3CCNA 3KMWA 4HCTA 3E64A 1CMKE 4PTCA 5FLFA 3BU6A 4HGLA 1M14A 2UZUE 4QYYA 4BRXA 4OBPA 5HX8A 2WTIA 4NJDA 5G1XA 3FY2A 3NMUF 3DGKA 4KABA 2LGCA 5EDQA 4F9YA 4HW7A 5LQFA 2VO0A 4YHJA 5AX3A 4TN6A 4BCPA 5A4EA 4I4FA 4D5HA 3GP0A 5TOZA 4IAIA 1WBPA 2W96B 5CAVA 4C33A 3CKXA 3NVKI 3S95A 2X0GA 4R7IA 4LOPA 3HKOA 5I9UA 4A4LA 5IG1A 2BPMA 1LEWA 2IVSA 3GU8A 3REPA 2YAAA 2H9VA 2J50A 2E9VA 2YCSA 3LFSA 4V0GA 2YFXA 4JBQA 1IEPA 1O9UA 3CS9A 3PY1A 1SZMA 4H3PA 4U0IA 3TV6A 3MFTA 3W10A 4AACA 4MKCA 2HXQA 3EQGA 2FSOX 4DHFA 4RVTA 3ZUUA 4AX8A 4O2PA 4FEXA 2BR1A 5KKRB 4ITIA 4M8TA 2CDZA 2G2IA 1P2AA 4CT2A 5AFVA 4KIKA 4UBAA 5BMMA 4X2GA 3JPVA 5KMLA 4E5WA 3CEKA 3KFAA 3UVPA 2Q0NA 3V8WA 4B0GA 2AUHA 1E9HA 2ITQA 2FH9A 5LARA 2OJGA 4D1XA 4PDOA 4K8AA 3K5VA 4UYNA 4YLKA 4EONA 5AAEA 4DTBA 3G51A 2C6KA 3ZLYA 4N57A 3QLFA 2UZDA 4BCKA 4CFFA 2JEDA 3DKGA 4ASDA 3FPQA 2W17A 3D5WA 4D1SA 3QQUA 2P55A 2UW5A 3HUBA 4W4YA 1GZNA 3R9OA 3TUCA 4FSTA 3AGLA 3NCZA 4PL5A 3B8RA 3C4EA 4TTHB 5A54A 4DA5A 4AP7A 5JGBA 1SVEA 3E3BX 3TZ8A 3UYSA 4L3PA 4DTAA 4GVJA 2CGUA 2VWVA 2YDKA 2X6DA 5KNJA 4TNBA 3DY7A 5AP0A 2C5XA 1ZYCA 3NW5A 4H1MA 4X6QC 3VO3A 3EZRA 4R8QA 4IFGA 1CDKA 4TYHB 3F3TA 5A4QA 3LMHA 4EUUA 3CJGA 4C57A 4ACDA 3H9OA 1PXPA 1Y91A 5KUPA 2GQRA 4TKSA 3UZPA 3DFCB 1YXVA 2PMLX 3ZBXA 5T3QA 4KRCA 5KE0A 4BB4A 4BDJA 5HTBA 4ZTNA 5D11A 3QTXA 2WD1A 4WHZA 4YJUA 5AUUA 5IQBA 4GCJA 2JGZA 5EDPA 5CF4A 4XYFA 3PXFA 3B8QA 1F0QA 2VAGA 5LXMA 1R39A 2WMUA 3ZLWA 3C5IA 1UWJA 3RAHA 5I3RA 5H8EA 4WRSA 1OIQA 3MVJA 1Q24A 2E2BA 4RFZA 4RLKA 5G6VA 4BZDA 3CC6A 1FGKA 5GINE 5E8UA 4WSQA 3IW4A 5FEQA 4NCTC 3EYHA 3QFVA 4NSTA 5H3QA 3ANQA 3IW8A 4IZAA 2G15A 5IH5A 3P78A 4EORA 3GQIA 2PVNA 3AC5A 3SKCA 5AR4A 2VTIA 4OTRA 5CEIA 3R02A 5IA2A 3MPAA 2YJRA 1P4FA 3ORLA 4ZS4A 1H8FA 5F95A 3GC9A 4N0SA 5IUIA 4J98A 4TWOA 4FL1A 2IG7A 1JPAA 4DFZE 1PXLA 2QOCA 2CNUA 3OG7A 2QG5A 3DS6A 3OOMA 3QC9A 4QYEA 4ZS0A 5CF8A 5K3YA 2FVDA 4JIAA 4CYIA 5CVFA 3OCGA 3ORZA 5E1EA 3N4VA 4R7HA 3QL8A 2CGVA 2PZ5A 4UZDA 4O22A 1GAGA 2FSTX 1T45A 2Y4IC 3DBDA 4O6EA 2R7BA 2R3FA 4R1VA 4CRLA 3LQ5A 1MRUA 3G2FA 3ZRLA 1OPLA 4G31A 4IJ9A 4JBPA 3BHVA 4O38A 4AA0A 5LWNA 4FI1A 5HLNA 1Q41A 5AP1A 4MXCA 1IRKA 1GZ8A 2QHNA 4C3FA 4V05A 4CLJA 5KBRA 4QMMA 2ITTA 4OTGA 3PXYA 5EKOA 3OTUA 4NTTA 4FTQA 3EFWA 3FC2A 2XM9A 3TEIA 3PJ1A 4YP8A 4DCAA 3MH2A 2CKPA 5C01A 1XBCA 1UNLA 3HP2A 4XV9A 3F3ZA 5BQ0A 3UO4A 4BWKA 5LJJA 4P90A 1W98A 5A46A 3JUHA 4LRJA 4FV1A 4NUSA 1A06A 3E8DA 1LP4A 2BRHA 3FLSA 5DVRA 3RPYA 1YWVA 4W4XA 5CSPA 4RIOA 3BEGA 3PZEA 2F57A 4XG7A 3OOGA 3WE8A 3ALNA 4PY1A 3ULIA 2JFMA 4CVAA 5GZ8A 3KKVA 5EYKA 1DAWA 3QF9A 1Y6BA 3PJ8A 3COMA 3FHRA 3ZH8A 3F3VA 2J4ZA 3A4PA 1MQBA 5HNIX 1Q8WA 3POZA 3AT3A 1JKTA 1YI6A 4WUNA 3TUBA 4F1TA 4L52A 5HLWA 4EBWA 4A9UA 1OIUA 3MSSA 5JT2A 3QGYA 2GS6A 2UZWE 3MY5A 3KA0A 4YZCA 3M2WA 4JX3A 4JT3A 3ZO2A 1BKXA 4U7ZA 3PRFA 3RKBA 1WBVA 2OZAB 2O2UA 3VS0A 3SG9A 4MBLA 3IKAA 3HVCA 2BRMA 1J3HA 4YPDA 5K4IA 3E3PA 3EN6A 2EU9A 4FICA 1EH4A 3MIAA 2O3PA 2VTOA 3P9JA 5FTQA 5AAGA 5L2WA 3ZS5A 2BMCA 3BZ3A 2R3JA 1QL6A 3L9MA 2OKRA 4EQMA 2C1BA 4APCA 4O7RA 3TT0A 1R78A 4KB8A 2UW4A 4GJ3A 5EM6A 5AUZA 3ZTXA 2BDFA 3MB7A 1RW8A 2A1AB 5L6PA 3UGCA 3HV6A 5CU6A 5HD7A 5GJGA 5IMEA 1J7IA 4FKVA 1NVSA 2VWUA 5CAOA 3W33A 3S1HA 4IB5A 1Q97A 2A27A 3TL8A 5DFPA 2BIYA 3GNIB 5M44A 2R0UA 3NUPA 4JLCA 2BDJA 3KREA 3E87A 4S31A 4YSJA 4X2FA 3TZMA 5F4NA 3HUCA 1YXUA 4M0YA 4E6CA 3NUNA 4XHKB 3RM7A 4CNHA 3KVXA 5EK7A 4ALVA 4FTTA 5M09A 4U42A 3L9LA 5J7HA 4DGLC 1H27A 4NM0A 3DZOA 4FSZA 5AR5A 4P7EA 2JIIA 3FI4A 4O7YA 2OIQA 3ZHPC 4BF2A 5EYDA 4WA9A 3FPMA 4YJRA 5ETCA 4FNWA 1NY3A 4YZDA 5CAUA 4IDVA 3ZYAA 2OH0E 3E8NA 4XV3A 4QP9A 2PUIA 4WNMA 3K2LA 4DF3A 3AD5A 3QU0A 5DR9A 2CLQA 1OKYA 3FYJX 3CQEA 3EHAA 1Q5KA 5CEMA 3DK3A 4HVGA 2VN9A 5GZ9A 3OTVA 4DCEA 5EOBA 2C0IA 1PXJA 3BYUA 5BYYA 3PY0A 3SXFA 1BL7A 3PWYA 5DR6A 2P3GX 2VGPA 4BTKA 2I1MA 4YURA 2OFVA 5ACKA 3FMEA 4C4GA 5ETIA 2HZNA 3QC4A 3R21A 3SHEA 2PMOX 4G1WA 3W2PA 1U59A 4FZ7A 1Z9XA 1ZZ2A 5C27A 5L8LA 3PVBA 3SAYA 4ALUA 5AV0A 4MXZA 3U6HA 1XO2B 2YA9A 4C2VA 1BMKA 5AV2A 2C1AA 3I79A 2ZB0A 2C0TA 4GV1A 4I93A 1FPUA 4EHZA 3TCPA 4AWIA 3GU5A 4DAWA 2QOLA 3E5AA 3UNZA 3PJCA 4S32A 2JBPA 1XR1A 3FL4A 3LAUA 3PRIA 3PA3A 4W8DA 4D2SA 2GMXA 4L9IA 5E1SA 3Q4TA 3QZFA 2PE2A 4IVBA 2BVAA 3VVHA 1PKDA 3R83A 2IO6A 1OVEA 3KCKA 3ZMMA 2XK3A 4ZSJA 4F7LA 1BX6A 5CANA 2I7QA 4FIJA 5D12A 4CYJA 3QCYA 3BU5A 4EK6A 4UB7A 2CCIA 3FXZA 2XKDA 4EOKA 4IWQA 5HU3A 1K2PA 5K5NA 4EK4A 4BDCA 3I60A 4IE9A 2IVVA 3EB0A 4I20A 4RWJA 4X2JA 2DUVA 3QX4A 4CD0A 3OT3A 4BKZA 3A60A 2W1ZA 2BHHA 3HMMA 3Q2MA 3NUSA 1A9UA 2OF4A 3NUAA 4L6QA 4CZUA 3ACKA 4ZLYA 1YDSE 4O82A 4M69B 2PULA 5I9VA 1GIHA 5JEBA 3QA0A 4FTCA 2QOQA 3F61A 3ZXZA 4BIBA 3UBDA 5B0XA 1OPKA 2CGXA 5AP6A 3WF7A 2P4IA 4F63A 5IA5A 5D7AA 5CNNA 2W7XA 4J96A 3F69A 3LOKA 4KKHA 2R3PA 3OFMA 4ANLA 5A4LA 4IQ6A 2ZV9A 4ASXA 4DEGA 4O7VA 4PMPA 4H1JA 3FKNA 5LOHA 4FGRA 1GZOA 3AMYA 2P2HA 2VWZA 4GW8A 4JBVA 4M13A 4H05A 1KOAA 4WKQA 2YM5A 5AP2A 4RIWB 3UOKA 1PXIA 2R3KA 4RWIA 3CIKA 2UZNA 3NCGA 4E6QA 3RALA 3KRRA 4FTOA 3BV2A 2WU7A 5EHOA 4I5PA 2WFYA 4P4CA 3LXKA 4IAFA 3IPHA 4G6OA 4AZFA 3GU4A 1OUKA 3CTQA 2X7FA 4GK2A 2Y0AA 4K2RA 2BTRA 3FLZA 3VC4A 2J6MA 4ZJJA 5HO7A 3R2YA 1FBNA 2IWIA 3E62A 2RFSA 4FKTA 2J2IB 2FSLX 2O0UA 4K18A 4TYEA 5DG5A 3PXZA 4TWPA 4B9DA 2CJMA 4Y83A 2Y7JA 3NW7A 4CMOA 3RZBA 4BTJA 1VYWA 1IAJA 4MX9A 3ZM4A 2W4OA 1M52A 1UVRA 3W2CA 1PMNA 2VUWA 2WAJA 2QG7A 3AGMA 1Q61A 3A8XA 2ERZE 2HCKA 2F9GA 3LHJA 3OMVA 3QZHA 3S2PA 5IU2A 4RX9A 4O0XA 3UQFA 1MRVA 5GZAA 4OLIA 3NLBA 3C51A 3N51A 2H34A 3OY3A 3R71A 4M97A 4O0VA 3IOPA 1W0XC 1QPJA 4AGCA 5HG8A 1KWPA 3FI8A 2J51A 4A9SA 4ENYA 2WQOA 2WOTA 3F82A 5E92A 2HW7A 4L68A 1Y6AA 2UW9A 4M67A 2R4BA 5H8GA 3V04A 4AW2A 4D28A 2X8IA 3HAMA 3EQDA 4IAYA 4PL4A 3ZRKA 5HKMA 2ITNA 2W05A 4JDKA 4K11A 4FGBA 4U6RA 3F88A 3MFSA 4I21A 3P79A 4DEEA 5M4UA 1ZMUA 3ODYX 3PVUA 2PVFA 2VTHA 5D9HA 5J95A 5IQAA 4YLLA 3DDPA 4FUXA 3ZLXA 3LXNA 2PVJA 3PDTA 4JX7A 2VTRA 4OTDA 4QMLA 1DM2A 2C4GA 2O65A 2VTPA 4PPBA 5CVHA 2PTKA 2WMVA 4FR4A 3QA8A 1G8AA 3BHYA 2VWBA 3AOXA 4ANBA 1GIIA 5HU9A 4RA5A 5EG3A 5GIPE 4BTFA 3VUGA 4ASZA 2V5QA 4KUJA 3EZVA 4LFIA 3WZJA 2IZRA 3RPVA 2XM8A 4DLJA 2XNOA 1SNXA 3I5NA 4DITA 4D2TA 4EWQA 1RE8A 2B9FA 4G2FA 3RI1A 3MA3A 3VW8A 4BCNA 4OAVB 4ID7A 5T68A 2VO7A 4F6WA 3BQCA 2JDTA 5HE0A 3GENA 1NA7A 2V7AA 1H24A 1PY5A 5IMXA 4ZY4A 4GJ2A 3NNXA 3R7EA 1KE8A 3ZOSA 5A4TA 4ZTSA 3KN5A 1KE9A 5KMMA 4GYIA 1S9JA 4J95A 2V0DA 3PJ3A 5JGAA 1Y8GA 4BCIA 4O1PA 3C4FA 3E93A 3KGAA 3R8UA 1J7LA 2OZOA 2OZAA 1R0PA 3ZO3A 5BX0A 3OWJA 5A3XA 1OITA 3LJ1A 2WMXA 5BVNA 3AD6A 3V5TA 2BAKA 3F5GA 2C69A 5IQIA 1WVXA 2J7TA 1G3NA 5AP4A 4J8NA 4L46A 1H0VA 3COHA 3R9RA 1MRYA 3DKOA 5FXSA 5ANDA 1H0WA 4EBVA 2VWYA 3OWKA 4IHPA 4JS8A 2DQ7X 4PWNA 3P08A 1UU7A 3BWJA 4BHZA 5J7BA 4AN9A 4QMUA 2ETMA 3GT8A 3F3WA 4B99A 5CT7A 2GHLA 3AQVA 5FDXA 2QURA 2GHGA 2OU7A 5IH6A 3PE2A 4EH4A 4L53A 4N70A 4QT1A 4AE6A 2VX0A 4XOYA 5FXQA 3T9TA 3UIMA 3QLGA 2W9FB 2R2PA 2HWPA 4F70A 1HCLA 4FZ6A 4GYGA 4IX6A 1OBGA 4BKJA 2XK9A 4Z7HA 3ET7A 3O96A 4D2VA 3TKUA 1YDTE 2BROA 2Z2WA 3F2RA 1PJKA 4XOZA 3QKLA 2YWPA 5CNOA 5HCXA 3CLYA 1XH6A 3D5XA 2RFEA 3EMGA 4C37A 1A48A 1ZOGA 4WD5A 2WPAA 4EOOA 3OXTA 2JKMA 4WUAA 1JWHA 4ERWA 2XIRA 4M66A 2KTYA 4AGDA 3DJ6A 3FSKA 3HLLA 4BFMA 4G9RA 3ERKA 1RJBA 2Y6MA 3C13A 3L9PA 4GG7A 3FLQA 4JQ7A 4LL0A 1K9AA 1JSUA 2B7AA 3R8LA 3DBQA 3LXLA 3GB2A 3FDNA 4GS6A 3L8XA 5J87A 2WQNA 2XNEA 3EQFA 4QMTA 4S30A 4TWNA 3FMDA 4M0ZA 5JFWA 2G2FA 5CEOA 2WOUA 2XK4A 4XMOA 4JXFA 4QRCA 4I6HA 2BIKB 4AN2A 5F20A 2QKRA 4BZNA 3OD6X 4ENXA 1KV1A 3ANRA 4BCMA 4DFXE 5I9WA 1XKKA 5DA3A 4QMSA 1ATPE 1UU9A 3TJDA 3I7CA 2B4SB 2C6TA 2PHKA 3NR9A 2UZLA 4FV9A 4MF0A 5J8IA 1Q99A 4O6LA 4ITHA 3KXXA 2XS0A 4JQ8A 5CWZA 2A4LA 4KKGA 3D7TA 1MQ4A 3OBGA 5IZFA 3MVHA 4KS7A 3WF6A 5J9LA 2V7OA 1WBNA 1LPUA 4E26A 4IX3A 1Q62A 3PIYA 3R7UA 3SG8A 3PSBA 4QMWA 5FUTA 1O6YA 4YGAA 3W2SA 3FWQA 5HX6A 4IB3A 3HP5A 4YO6A 5IA3A 5CEPA 2Z8CA 4BWXA 4FIFA 5HORA 3LCDA 4YBKA 3TNQB 3R30A 4L3JA 3UE4A 3EKKA 4RVLA 2ONLA 3LMGA 4O0TA 4FG8A 1CTPE 2QCSA 2OJFE 4FTAA 4MXOA 4ZSLA 3G0FA 5JFXA 4R77A 3RCJA 2J5EA 5A9UA 4XX9A 3QKKA 3BLHA 4KWPA 1YDRE 3LFCA 3P7CA 3O0GA 3GCQA 4MXAA 5A14A 4PMMA 4QQ5A 4D0WA 3SC1A 4E4XA 2JAVA 3DKCA 2X9EA 1U5QA 2WTKC 3Q6UA 4XRLA 5B7VA 1PMEA 3LCTA 2A0CX 3EOCA 3JR1A 4PP9A 4O27B 4B8MA 3VBVA 5DHJA 3LJ0A 4EH8A 5M56A 4UMPA 4LGHA 1W82A 2F7EE 2UV2A 4M69A 3PG1A 3CGFA 1URWA 4ANQA 5IF1A 2X6EA 2Y4IB 4RA4A 4HVSA 2XK6A 4J7BA 5I4NA 3KU2A 3VQUA 3ATSA 5B2LA 3BLRA 1OKVA 5M51A 5IQCA 1FGIA 4L42A 3KXHA 3FAAA 4Q5EA 5KMOA 2H6DA 1WBSA 4BI2A 3AG9A 3PVGA 4QP2A 4RIWA 5HESA 1OKWA 4E93A 2GSFA 3ODZX 3VAPA 5JH6A 3HX4A 3H9RA 4B4LA 2GNFA 3M1SA 2GU8A 3POOA 4ORKA 2R3QA 1ZMWA 4MD7E 4FTUA 5JK3A 4RC4A 3W2QA 4FKJA 4I4EA 3ZRMA 5IUGA 3AMBA 2X4FA 4PNIA 4YTFA 3CR0A 4FUYA 4RC3A 2X8DA 3R63A 4NEUA 5F9EA 4WO5A 4EHGA 4USFA 1XWSA 3LCSA 2ZOQA 3QTRA 4HYUA 5HG9A 3ZO4A 4JVGA 1VYZA 3SRVB 2JDOA 3TV4A 4BI1A 3CTHA 5BMSA 4QTDA 2AC5A 2BKKA 5EQEA 3PE1A 3VUHA 5FD2A 1M2QA 4YJNA 1DS5A 4QTAA 3G6HA 1E1XA 4XP2A 5AP5A 1M2PA 3PUPA 5FEDA 2ITWA 2GTNA 2QC6A 2C5OA 4F9AA 4QP1A 5FDPA 4GSBA 4FZDB 2HENA 5JFSA 4KSPA 4CQGA 2EB3A 2AC3A 2OIDA 1U5RA 4PTGA 4RRVA 2WGJA 1WCCA 4B7TA 3DA6A 4O1OA 3CQWA 3ENMA 2HW6A 3FQSA 2WMBA 3LQ8A 4KRDA 5IH4A 2XMYA 4IX4A 3Q6WA 4RX8A 4TZRA 4F1MA 5KX8A 5EI6A 2JFLA 4G6LA 3GI3A 3EQHA 3ZZWA 4FTMA 4MBJA 4BGQA 4FV3A 4FEVA 2XKCA 4M14A 4K6ZA 5KBQA 4RX7A 5E8SA 3V6RA 4EZ7A 4EOJA 3ATTA 3CKWA 3EFLA 2BALA 1DAYA 4ZMFA 2UZEA 3NIEA 1GOLA 4FSQA 4FBXA 4ONAA 4C02A 5L8JA 2WQBA 2W1HA 3GU7A 3GOPA 4XBUA 2JIVA 1FMOE 4FKWA 3BBWA 2YDJA 2BFXA 3RPSA 2GDOA 5GNKA 5T6KA 2WEIA 4LMUA 4QP6A 2WMTA 2IW6A 3L9NA 3NYOA 2OXYA 3Q2JA 4E5AX 3UTOA 2CNQA 4Q5HA 5E7RA 2VWIA 3FY0A 3MH0A 1W7HA 3MDYA 5DE2A 1B38A 3K3JA 2WTDA 4PPCA 4IFCA 2O8YA 1Y8YA 4ACMA 4ANSA 3MWUA 2WQMA 3QD4A 4BCGA 4HPUE 4GG5A 4YUQA 3UQGA 3VJOA 4NIFB 5DLSA 3W16A 3W1FA 3MBLA 4I6QA 4S34A 3ZEPA 4D4YA 5EHYA 3BV3A 5J1VA 1M7NA 3BE9A 3G33A 2HYYA 4QNAA 3COKA 4RIXB 5HO6A 5C1QB 3EH9A 5K0KA 1JKKA 4ZTQA 2UVZA 3DLZA 3UP7A 4XNEA 3T3UA 3NSZA 3P7BA 2UZOA 2C68A 4HNFA 3FZSA 3TXOA 1IA8A 1F5QA 1YHSA 5BPYA 3MPMA 5AR7A 4DFUA 4G6NA 4IC8A 2ZYBA 3EYGA 3O50A 3CXWA 4L67A 3DCVA 4C38A 3ZSGA 4OTFA 2YCRA 4BBEA 2W1IA 4DEIA 4K1BA 3BWFA 3O71A 4J8MA 5LVMA 3RM6A 2NPQA 4MBIA 3JVRA 3W2OA 5IDNA 4PF4A 5BYLA 4E4NA 4H3BA 3UPZA 3EQBA 3R1NA 4ZLOA 4QTEA 3T9IA 4M3QA 4KNBA 3RGFA 4OTWA 4YJOA 3V5JA 1ZOHA 4WT6A 2V22A 4C8BA 4EKLA 2C5NA 5JMSA 4YZMA 5BYZA 5ANKA 3CQUA 3OT8A 3P4KA 5DRDA 1WZYA 4ALWA 4AE9A 2WNTA 4EK3A 4L7FA 4R7BA 4RFYA 1IASA 1XQZA 4R5YA 4AT5A 1P4OA 3P7AA 2XH5A 4YNEA 2PVYA 2FUMA 4ACGA 4EWHA 2XBAA 4L8MA 1YW2A 4XG2A 4YPSA 4CFXA 4DINA 4EKKA 2YLFA 1IAHA 4RIYB 1GIJA 4IW0A 3TI1A 2C0OA 4P2KA 3O8TA 5L4QA 3OUKA 4W9XA 4CZTA 2GNJA 1E1VA 2DYLA 2X1NA 3KXZA 5AR8A 3NEWA 2JBOA 3LFFA 1ZYLA 3F2AA 5CEQA 3TNHA 4NM3A 3QRTA 2ZDUA 3RAWA 5TR6A 1GY3A 4Z16A 2QOHA 4M84A 4L7SA 4UMQA 4C4HA 2PMNX 4Y95A 4CFVA 4Y5HA 4ZJVA 2XRWA 4MK0A 4FODA 4HVIA 4GL9A 4XUFA 4BDHA 2XK8A 3V5WA 2OK1A 3S0OA 2ZAZA 2ITPA 3D4QA 3PA5A 2C6EA 3V5QA 4O7LA 2QO2A 4L01A 4U40A 1ND4A 1NXKA 2GS2A 2W5AA 2YEXA 3NYNA 2XKFA 4GUBA 4I0TA 4TYGA 3V3VA 3V8SA 3FXXA 2OBJA 4GIIA 2J0MB 2XNGA 5EYCA 3R73A 3FC1X 2XRUA 2CHLA 4U3YA 4MNFA 4R5SA 4A7CA 1UNHA 3RK7A 3QRIA 1MP8A 3HMPA 4FSMA 4R3CA 5DMZA 4WNKA 3QBNA 4GFGA 2WXVA 4CV9A 3FZOA 4DGMA 5AP3A 2PVLA 4RJ7A 4W4VA 5AUTA 3OW3A 3G90X 4HPTE 3BLQA 4O7TA 3OS3A 5CQUA 4ASEA 1APME 2C6OA 5CF5A 3RK5A 3Q9WA 3QUEA 2QHMA 4YSMA 2XZSA 4FZFB 1FQ1B 3GEQA 3I6UA 5IQDA 4EOMA 3ELJA 2UUEA 4UYAA 4QNYA 2PUUA 2YACA 3QRKA 5L2IA 4O84A 5I9XA 2IJMA 5L2SA 3PP0A 4BCHA 4I6FA 3F7WA 4QYHA 3FHIA 4DG0E 4KKEA 3G0EA 4DFYA 4YMJA 2VX1A 4FSUA 2H96A 1PF8A 4X3FA 3KF7A 4IMYA 3OHTA 1YOLA 4GKHA 3OCSA 3AT4A 4IAZA 5FBOA 3P5KA 3CGOA 3NAXA 3A2CA 5FTOA 3C0HA 4DT9A 4I22A 3E92A 3U87A 2EUFB 4BDIA 4RX5A 5CQWA 4FEWA 1REJA 5C03A 3TTIA 4X2NA 1Y57A 3SXSA 2Y8OA 4IANA 5D7VA 4BWPA 4FIIA 4FTJA 3Q96A 2X39A 2XJ1A 5KKRC 2VTQA 4KA3A 4IAAA 4G3GA 4L44A 4DFBA 1PMVA 3DT1A 3NPCA 3PPJA 3VBXA 5HBHA 5JQ8A 4E1ZA 4AXAA 4AZWA 3FKOA 5AUYA 3ULZA 4FKSA 2YDIA 3MN3A 4GH2A 2IW9A 1LUFA 2HZIA 4F08A 1PRYA 4EL9A 3ID6C 4O86A 3WYXA 3V01A 3Q9ZA 1KOBA 4CRSA 3R04A 4W8EA 3R0TA 3TDVA 4MAOA 3QRJA 1KV2A 5EI8A 3HZTA 4Y72A 4AGWA 2C6LA 1PW2A 2YM3A 3DNDA 4HGEA 5BUEA 5AUVA 2W5BA 3SOCA 3W8QA 1O6KA 3C1XA 3FZ1A 4JR3A 3VRYA 2GQSA 3WZEA 1KUTA 5DT0A 5GHVA 4CSVA 4PPAA 4TXCA 5DEWA 2UW3A 1LR4A 1QPDA 4FOCA 4C4EA 4LOOA 3RMFA 2FGIA 5K9IA 3FZRA 4AA5A 3BX5A 3WI6A 3TIZA 4H58A 1WFCA 5AADA 2C6MA 4P5ZA 5TO8A 4CLIA 4CZYB 3QTSA 3MFRA 1Q3DA 2R3OA 4FYOA 4GT4A 3VS1A 5J79A 3SXRA 3PXKA 5C8MA 3LFNA 3LJ2A 5FTGA 3RZFA 3UJGA 4I94A 3TN8A 2WELA 4LM5A 5HLPA 4BZOA 4ZSEA 3A8WA 3KEXA 4FTRA 2NRYA 3MJ1A 4YJPA 1UKHA 1SMHA 3O17A 2I0HA 3F5XA 4FNZA 5BVEA 5CZIA 2GNGA 3R22A 3NYXA 3QGWA 5HIEA 1SVHA 2QOOA 2OXDA 4MQ2A 4AFJA 4XJ0A 3TUDA 5AWMA 1J1BA 4UWYA 1R1WA 2RG5A 2GFCA 3BE2A 4B6LA 1QPEA 4CT1A 3IDBA 2JKOA 2FO0A 5H2UA 4PNKA 4QTCA 4IWDA 5EQYA 3NNVA 3WZKA 4RJ6A 5JQ5A 4FA2A 4ZAUA 5B2MA 4D4RA 4UY9A 1QCFA 3HDMA 3IDCA 1H26A 3CBLA 3FMMA 4I5CA 4QP3A 4UWBA 5DEYA 3DXQA 3SD0A 1XJDA 3LFEA 4RGJA 3UO6A 3W2RA 1R0EA 3ZZEA 3E7VA 4DH5A 4CKJA 4FKIA 2I0EA 2YM6A 3DZQA 4C61A 4DFLA 4BR3A 4DBNA 2F7ZE 4EH2A 5BVKA 1UU3A 4GUEA 1UKIA 2PE0A 4NL0A 3QZIA 4U9AA 4BDDA 2J0KA 4X21A 3A4OX 3Q32A 3MVMA 4Z9LA 5DR2A 4IEBA 4BCFA 2YM8A 4GU9A 3TNPC 3L8PA 2CSNA 5AIKA 4TYHA 1ZY5A 2B9IA 4YJSA 2ZB1A 3ZSHA 3PPKA 4C3PA 4BC6A 2QO9A 4ZZNA 2RL5A 4F99A 3RNIA 5HICA 2R3MA 2YIXA 3FL5A 3HNGA 3PG3A 4NIFA 2VTMA 4CG9A 2RG6A 4GU6A 5FGKA 3SDJA 4EYMA 3KY2A 3G6GA 4EC9A 5E8TA 4HGTA 4KAOA 4RIXA 1VJYA 2YIWA 4AGUA 3VULA 3MH3A 4D4VA 4F4PA 3H4JA 3VJNA 4YO4A 2W5HA 4YJVA 5CT0A 5L2QA 3IO7A 3QX2A 4U5JA 3EN4A 5HOAA 1V0PA 3BHUA 2ETRA 3LFAA 3IOKA 3Q04A 5CAPA 4LI5A 1NT2A 2PUPA 3TNWA 2CN5A 3FE3A 5FRIA 3IONA 1ERKA 4XRJA 4KINA 4YZBA 4UN0C 3V5LA 3EWHA 2REIA 3UDBA 4L3LA 2BDWA 2IVUA 4IX5A 4XCUA 4IM0A 5JZNA 1U46A 3U9CA 4UMUA 3ZONA 3UG2A 4ITJA 2ESMA 2RGPA 4XH6A 1WBOA 3O7LD 3KRJA 4JNWA 3A61A 3RAIA 3DFAA 5J5TA 2WTWA 3ORIA 4ZSAA 2W99B 3ORMA 3LQ3A 5E4HA 3K5UA 4EQCA 2I40A 2YERA 4R78A 3DJ5A 1M2RA 4OTPA 5CZHA 4PMTA 1JKSA 3DNEA 1RDQE 5E8ZA 1Q8ZA 3JXWA 2ZV8A 4II5A 2BTSA 3DTCA 1YQJA 3R1YA 3UOHA 4BKYA 2HELA 2LAVA 2R3GA 3SA0A 4PL3A 1TQMA 3C4XA 1M17A 2JITA 3UC3A 4F7JA 4DH7A 2IN6A 3P1AA 5HE2A 1BI7A 1YI3A 1GJOA 3FI3A 3GC8A 4O0YA 3UODA 4IB0A 2WMQA 3K54A 4LGGA 1XBBA 4YR8A 3UOJA 3D0EA 3VBQA 4HVDA 3R7YA 4MXYA 2XYUA 5DI1A 4J1RA 2ZVAA 4RIYA 1Q3WA 1X8BA 1ZZLA 3OF0A 5CI6A 3W18A 3RBWA 4TPTA 1V0OA 3ACJA 4D5KA 1XH9A 5AV1A 3WARA 1L3RE 1WBTA 4MNEB 5M06A 3KL8A 1STCE 2X2KA 4TL0A 3EQIA 4OBQA 1YXSA 3OZ6A 1L8TA 5DIAA 2PU8A 3OWLA 3RK9A 2R3LA 4HYSA 3MIYA 1PXMA 4IB1A 3E7OA 3OXIA 1RQQA 4YLJA 2JC6A 4GIHA 2NP8A 4I0SA 4K0YA 1ZARA 4CGAA 4I5HA 1T46A 4CEGA 3QD0A 4ZXTA 4S2ZA 4QPSA 1YWNA 3PLAE 1ZRZA 3LM5A 2A19B 4KBKA 2XBJA 3DLSA 1I44A 4A4OA 2QLQA 5LMKA 3F6XA 4DH8A 3BPRA 2G2HA 4RSSA 2YCQA 4RG0A 2OJIA 2CGWA 2OW3A 4TYIA 2OLCA 4MWIA 2C6DA 4H39A 4RZVA 4CMTA 2F49A 3MGYA 3BGQA 4I23A 5L6WL 2VTJA 5DN3A 3ZDUA 2BAQA 4EEVA 2BKZA 3RWQA 2FB8A 4TNDA 5CU0A 3KMUA 4GKIA 2IVTA 4M12A 2C5VA 4NKAA 4DH1A 1Z57A 3U6JA 2C30A 3MPTA 5KMJA 4ZJIA 3ZXTA 5KCVA 4V04A 3F3UA 4QQTA 3FQEA 3BEAA 3QQGA 4U97A 4L43A 5M55A 1H1PA 4C4IA 4IDTA 5DOSA 4NTSA 5EOLA 3QXOA 3DTWA 4ZSGA 3HV3A 4BVUA 2WKMA 4FIHA 4QMXA 4QP8A 3P86A 4FT5A 5DBXA 4C35A 5DT4A 5M57A 5LVNA 3LCOA 4I6BA 2Z02A 3MJ2A 2IZSA 3F5PA 4KIOA 3KK9A 3D15A 2FSMX 1OGUA 3C4ZA 3RWPA 3UZRA 2VRXA 3LPBA 2YZAA 4UMTA 4YC3A 4ZY6A 3VN9A 3EFKA 4DG3E 3ORTA 4OGRA 4FEQA 4LRKA 2XA4A 3TZ7A 3U4UA 3KRXA 3UIUA 5L8KA 2VTNA 2UW8A 2XK7A 4E4MA 4EOPA 5HD4A 2A2AA 3DK6A 2B9HA 2PYWA 4XG8A 1PYEA 1URCA 4CTBA 3Q4ZA 3U55A 3JS2A 4CFMA 5HQ0A 4YJQA 5AA8A 3QD3A 2B52A 3ZLSA 2QO7A 1P5EA 2F2UA 5EKNA 3LMIA 2VO3A 3QTWA 4KBCA 3VIDA 5M07A 2ONLC 3BIZA 2CKEA 3I0OA 4FV5A 3Q4CA 3HECA 2O63A 3MB6A 5L3AA 3IGGA 4PV0A 4O91A 4PRJA 4FX3A 4XLVA 4NM7A 4EH5A 3Q9XA 4WNPA 2PWLA 3F2NA 3HMOA 3VS6A 2PVKA 5JKGA 3GBZA 5CENA 3ORKA 4Y8DA 5I9YA 3MESA 3NW6A 3OEFX 1JQHA 1W8CA 1YI4A 2BZIB 4WRGA 4MWHA 4O0RA 2JD5A 4BHNA 2JDRA 2QD9A 2UZVA 4OBOA 3FMKA 3GVUA 3HMIA 3QCQA 4HCUA 1UU8A 4WOVA 2RIOA 5DGZA 2PUNA 4IVAA 3ZCLA 1OPJA 3VUIA 4OTIA 3WZDA 2FYSA 3D2IA 4D4SA 2W1DA 3GCPA 2PVRA 3UMXA 1FVRA 2NRUA 4DGOA 5EH0A 3R1SA 3AC1A 2XNNA 3R7GA 1HOWA 3U51A 3ZUVA 2PVMA 2FA2A 5E8YA 2JDSA 5BVWA 4EQUA 4IZ7A 4NKSA 4JL9A 3H0ZA 2G01A 3L8SA 4AN3A 1VEBA 3IW6A 2GS7A 5K4JA 1OZ1A 4E3CA 3Q9YA 4LG4A 2F7XE 1O6LA 1S9IA 2C47A 3WBLA 4FTLA 2XCHA 5CU3A 2HOGA 2NO3A 4I1ZA 1XH4A 2WTVA 2BRBA 3SX9A 1H08A 2ITYA 2GPHA 3C7QA 5HNBA 4DN5A 2ACXA 4FVRA 3U9NA 3UP2A 3VHEA 4F09A 4APPA 3NYVA 4QPMA 5E90A 4F7SA 5CALA 2PE1A 4FT7A 4ZZMA 2R5TA 5AMNA 5IQGA 4C36A 5GIOE 2QOBA 2HWOA 4BI0A 4FV0A 2XVDA 1OIRA 3AC2A 3Q52A 4XG9A 4RBLA 1ZY4A 4RVMA 4FEUA 4EJ7A 3O7LB 3C0GA 1M7QA 1J91A 3AD4A 4AOJA 1K3AA 1NVRA 1G5SA 4QTBA 3ZSIA 4W9WA 4CQEA 3ROCA 2XYNA 3UNJA 5JN2A 4ANMA 2OJJA 3TTJA 4F0FA 2QONA 4I24A 2ZV7A 3UNKA 4KD1A 1OBDA 2Z60A 4IZYA 4Z7GA 1KSWA 4LV5A 4TRLA 4YTHA 3MYGA 4G3FA 4HGSA 4HZSA 2HY81 3RINA 2B1PA 5FM2A 4HOKA 1CKJA 5CXZA 4WNOA 5M08A 4QMPA 2QNJA 4D58A 2GCDA 3M11A 5TT7A 2PVHA 3LCKA 2QODA 3FZPA 3QUDA 5EM5A 5HCYA 4HYIA 3EN5A 2YM4A 2R3NA 4FSWA 4FK3A 3OC1A 2OICA 4GFMA 1FVVA 4Q9SA 4XV1A 2XNPA 4EZ3A 3GU6A 5CX9A 5M4IA 3R9HA 3FUPA 4I41A 3VS7A 1CM8A 3C50A 4G16A 4D55A 4HVHA 1IA9A 4D9UA 4KSQA 4O7SA 4IACA 2WEVA 3LE6A 1OM1A 5FQDC 2CMWA 3D94A 4JBOA 1UA2A 4CFNA 4EZ5A 2YISA 2XB7A 2EWAA 2XJ0A 2R3HA 2WO6A 5AIRA 4Q2AA 1Q8YA 4FL2A 2Q0BA 5BUJA 4ZTLA 2GFSA 4BYIA 3GCVA 1OUYA 5BVFA 5LWMA 4OW8A 5C8KA 1OL2A 2XUUA 4A4XA 2I6LA 2WQEA 2WMAA 4RVKA 4JQEA 4EH7A 4O21A 4GK4A 3DAEA 5ANEA 4E4LA 4AG8A 1I09A 2I0YA 4YHTA 2O5KA 4FTKA 4FSRA 2CPKE 5AP7A 4O7NA 3I0QA 3SW7A 3QKMA 5IA0A 5CXHA 3RCDA 2VTSA 4MQ1A 5E91A 4ZTMA 4O83A 3WIKA 3WZUA 3LZBA 4AZVA 4YZNA 3FMJA 4QQCA 5CAQA 5BVDA 4NWMA 1JLUE 2SRCA 4XS2A 5CU4A 5EW8A 2YWVA 2QQ7A 4X2KA 3UMWA 4UMRA 3HV7A 5IA1A 3BELA 3ORPA 5HIBA 4J53A 1BI8A 4XV2A 2OWBA 3RHKA 4BGGA 1PXNA 4WBOA 1OIYA 1AD5A 1XBAA 3IK3A 4ZTRA 4M15A 3COIA 5HBEA 4AZSA 5LMBA 3BYSA 2IPXA 4G9CA 5CY3A 1F3MC 1WAKA 4PQNA 4U44A 4EHVA 5IKWA 4R1YA 5HE1A 5ANGA 4S33A 3NX8A 4PX6A 5IPJA 3TM0A 4TY1A 2Z7QA 3EN7A 4M7IA 5AR2A 5C26A 2XNMA 3W55A 4EHEA 2PMIA 3GOKA 4MNEA 3R8VA 3UG1A 4EH6A 2H8HA 4JRNA 4MEDA 4D2PA 3FI2A 3QTQA 4FV6A 2HY0A 4ZTHA 4E8AA 3R8ZA 2B55A 3N9XA 4IWPA 4RPVA 4WG4A 2BILB 5EYMA 3VS3A 3SV0A 4U81A 4BL1A 4ZLZA 4KS8A 5C8NA 2VD5A 3RHXA 1B39A 3S00A 5EM8A 4JDHA 4A9TA 4Z55A 1TVOA 5FXRA 4CCUA 3U8WA 2J0JA 4AW0A 1OI9A 3OXZA 4RJ4A 3U54A 3MV5A 5IQFA 5JRQA 3FLYA 3QZGA 4DGNA 2BAJA 3FLNC 3VBWA 4IXPA 3EQRA 1GZKA 3MFUA 4LYNA 4R3PA 1CSNA 3V6SA 2ITUA 4QPAA 4LQMA 2PPQA 4JR7A 2VWWA 5J1WA 3UIXA 2CLXA 2QI8A 3F9NA 3QCSA 5EI2A 3GUBA 5JZJA 4EC8A 1PHKA 1IR3A
chains in the Genus database with same CATH superfamily
2G9XA 3HMNA 3R01A 4G5JA 2VGOA 4MTAA 4F7NA 4AOIA 3DB6A 3QHRA 4A9RA 2YIQA 5HBJA 4TW9A 2QR7A 4FC0A 2GNIA 3PJ2A 1TQPA 5H9BA 4CG8A 2YIRA 3EKNA 4NZWB 4RMZA 4O96A 2QR8A 3TKHA 4BDKA 1KE5A 3LFBA 4NFNA 4G5PA 3I7BA 4U8ZA 3RPRA 4AS0A 5IDPA 4F0IA 4FKQA 5J9ZA 2CKOA 4RJ5A 1PYXA 4FL3A 4JRVA 4RWLA 4EOIA 5J9YA 4C62A 4E6AA 3EJ1A 3EL7A 3UZTA 3A7FA 3QXPA 4BGHA 5HE3A 1Q4LA 5CS6A 5HNGA 4JIKA 5E8XA 5EHLA 2BZKB 3VNTA 2NNWB 4YBJA 3EIDA 1PKGA 3FMLA 5EW3A 4U45A 4EOSA 4EOLA 2OF2A 2W1EA 3P5JC 3KRLA 2QOKA 4O4DA 2X4ZA 4I3ZA 4ZY5A 3LFDA 4XP3A 5EW9A 3QYWA 4O7WA 3BHHA 4QYGA 2ZM1A 4ZP5A 4E6DA 1H1SA 2GNHA 3MY1A 4HZRA 3FBVA 1U4DA 3E8EA 4O0WA 3DXPA 1QMZA 3TIYA 4Y5QA 3WF5A 4F9BA 4D1ZA 1BUHA 3H30A 4ZMEA 5C4KA 4F9CA 5EDRA 4JI9A 4PUZA 5CLPA 4X3FC 1TQIA 4FKLA 5D1JA 4DGGA 1OB3A 3PVWA 2BZJA 1GNGA 2RSVA 3TNIA 4DTKA 4BIEA 3FQHA 4NH1A 3D5UA 5JGDA 3A62A 4DG2E 4FTNA 2EVAA 4IWOA 5FEEA 5L6OA 3BRBA 4USDA 3M42A 4QMNA 2PY3A 2W06A 2J9MA 3MA6A 3KF4A 4IM2A 4QYFA 5AJQA 4C7TA 3IDPA 5AUWA 2PSQA 5HZNA 5ICPA 4KIQA 4FRFA 2F2CB 3DAKA 3C0IA 4FYNA 5AUXA 5CYIA 4F6UA 3WIGA 2UW0A 3QYZA 3V5PA 3PXQA 5C9CA 3SQQA 4FSYA 2KULA 4FV4A 2YM7A 2W4KA 4LRMA 3CPCA 4UALA 5M4FA 1ZYDA 2ZV2A 4FKPA 3IW7A 3NRMA 4NM5A 2E9UA 3V8TA 3C4WA 3CY2A 3ZU7A 2OH4A 3UVRA 2WTCA 2F4JA 5CF6A 2B9JA 3VQHA 3ZO1A 4LV8A 2G1TA 3T3VA 3D83A 3HRBA 4O7ZA 2V62A 2X0PA 2HK5A 3LVPA 3OWPA 1U54B 4TT7A 5AV4A 4FNXA 3CSVA 5LVOA 4ANNA 5I0BA 4FV2A 5CVGA 4FG9A 4JG6A 4UWCA 4CTCA 5J5SA 4RZWA 5A6OA 2YABA 3CD8A 2XIYA 4RWKA 4FV8A 5FWKK 4DC2A 5EQPA 3K3IA 4OR5A 4KBAA 4HNIA 3EN9A 3R00A 4WG5A 4ARKA 4C59A 3OUNB 2GNLA 4I92A 3TZ9A 3VHKA 4D9TA 4E5BA 1TZDA 3R8MA 3CD3A 3MH1A 3S3IA 3T8OA 3O51A 3QTUA 2EXMA 1ZYJA 4NCTA 5HIDA 3BQRA 3NUYA 4RQKA 3KCFA 2UZTA 4XG4A 2VV9A 4AXFA 1H07A 4JG8A 2GTMA 4FMQA 1H4LA 1SM2A 2XNBA 3D7ZA 3DBFA 3LFQA 4KIPA 5CSXA 5I3OA 4C0TA 4C4FA 5A4CA 2VTLA 5I5ZA 4ACHA 5GJFA 4D0XA 3H10A 2PZYA 2OSCA 5HG5A 3VUMA 4QD6A 3FMHA 3QAME 3DQXA 3AT2A 3HL7A 1B6CB 2OFUA 3I81A 4FOBA 4LMNA 3GFEA 4LUDA 2B0QA 4IVCA 4CMUA 1UNGA 1WBWA 3DBEA 4EI4A 2ITZA 2EB2A 5K5XA 3PWDA 5LVLA 3TKIA 2GHMA 3BU3A 3VRZA 5KZ0A 3LLTA 3KULB 5HG7A 2W4JA 4OT5A 5HEZA 3TACA 2YJSA 3I6WA 4X7QA 3IECA 4IJPA 4YZ9A 5FG8A 3UIBA 4L00A 3MVLA 4HYHA 2ITXA 5BNJA 3PSDA 4BIDA 3UPXA 5L2TA 1FVTA 3CY3A 4ZIMA 3MI9A 3MTFA 2HZ4A 2OIBA 3VWAA 3O2MA 1OKZA 3KQ7A 3QRUA 2JAMA 1NW1A 3RJCA 1Z5MA 3G5DA 5AX9A 3U6IA 3ZUTA 3FJQE 4N6ZA 4ACCA 1R3CA 3TV7A 1FINA 1WMKA 5K0XA 1UWHA 3C5UA 3QUPA 5DYJA 2IW8A 3IW5A 1H1QA 3WF8A 3VS5A 3IGOA 5EM7A 1H00A 3D9VA 3KMMA 3GXLA 3KN6A 1HCKA 4UZHA 1JSTA 1JNKA 5IEXA 3NIZA 4ERKA 4FKRA 4A9YA 2YZLA 2QU6A 2BZHB 4MXXA 4JOAA 5KMIA 3LW0A 4YNOA 3BYMA 5DRBA 4FIEA 3A7IA 1Q8TA 3SRVA 2X7GA 2OXXA 4U80A 4OT6A 4E73A 3KIOC 2YAKA 4RQVA 3B2TA 4Z3VA 3H3CA 4A06A 4GT3A 1OL6A 2X2MA 5DWRA 3HYHA 3D2KA 3TG1A 3VF8A 5M53A 4BY9E 5CSWA 4C58A 5D10A 4DYMA 3AMAA 5KZIA 4U41A 5KHXA 3I5ZA 2UVYA 2YIYA 5AV3A 5M4CA 4IH8A 4RC2A 4FT3A 3ITZA 4G3DA 3HGKA 3R6XA 2RFNA 4NYEA 3F7ZA 3KC3A 4GMYA 4F1OA 3JY9A 4G17A 4AW5A 1IG1A 3R2BA 3QWJA 4R6VA 4YC8A 1DI8A 2EXEA 3A7HA 3E88A 5C4LA 5BVOA 3C4CA 3HRFA 3NDMA 4BTMA 5TKDA 5IQEA 3D7TB 1P14A 1PXKA 4QMZA 3G15A 4N6YA 2JKQA 3QQLA 3NVMB 1SYKA 3CPBA 4FKGA 3Q53A 3QQKA 5IISA 5AM6A 3SGCA 4DEAA 1YXTA 2VNWA 2ZDTA 3OW4A 4TWCA 2W0JA 4FG7A 4FKUA 5DPVA 2E9OA 3GQLA 2CCHA 2EXCX 4FTIA 5EFQA 5HVJA 3ROYA 3W32A 3ORXA 4QOXA 4DT8A 2XKEA 1YRPA 3SOAA 5JSMA 3UYTA 3DDQA 5FM3A 4RFMA 2R0IA 3RVGA 4M68A 3RNYA 3MTLA 2IF8A 3ZFYA 4IIRA 3NZ0A 1ZOEA 3U4WA 1MUOA 3OBJA 4ZOGA 5FBNC 3BYOA 1ZMVA 4JJRA 2ZMDA 4AZTA 4LL5A 5BV3A 3R1QA 5DH3A 5CEKA 2XALA 1WVWA 4AAAA 5HHWA 3L1SA 4CV8A 4USEA 1V0BA 2JKKA 2VTTA 3DXNA 2E9PA 1CKPA 3LLAA 3LXPA 2BHEA 2X2LA 3O8UA 2PK9A 5CTPA 2Q83A 3LM0A 3OROA 4GT5A 2WIHA 2ITVA 4RT7A 4UXQA 4EYJA 4PP7A 2W1GA 3THBA 3NWWA 5KO1A 4DFNA 5IUHA 5LMKC 3GCSA 4G34A 3QWKA 3WILA 2VU3A 3EQCA 3HA8A 3NAYA 4O81A 5H8BA 3VUKA 3KRWA 4WSYA 4FT0A 1VZOA 4IVDA 2E9NA 3RTPA 3EL8A 1OL7A 2YN8A 4XBRA 1W83A 2J0LA 2WZJA 2PL0A 2Y6OA 2ZM4A 4P5QA 5F94A 3QD2B 4AT4A 4IM3A 4N4SA 4CFWA 4CKIA 3B2WA 4F64A 3VF9A 2X7OA 4J71A 1ZAOA 4XG6A 2VWXA 3EFJA 1G8SA 3ZFMA 3BBTB 3ORNA 4BCQA 2BFYA 2VTAA 3W8LA 4AOTA 5AEPA 3R7VA 3PA4A 4UV0A 4DH3A 5E9EA 3E8CA 3O8PA 4JG7A 2X8EA 4EOQA 4HCVA 4O2ZA 5BUIA 2OI4X 5I9ZA 1FOTA 2HIWA 3BGPA 5KHWA 2C5YA 3DQWA 3R9DA 4DBXA 3L8VA 4J97A 4AU8A 5CSHA 2PZRA 3TDWA 2R9SA 4V01A 5AA9A 4U79A 4LOQA 5HCZA 3QTZA 5ANIA 3ZM9A 3PFQA 4G3EA 4MYGA 3H9FA 2QVSE 1OL1A 3Q5IA 4AFEA 4MVFA 4DE4A 4V0GB 4QMQA 2QU5A 3DU8A 2XP2A 2I0VA 3KXGA 2WTKB 4O0UA 4MF1A 1YOMA 3I1AA 3S4QA 4TYJA 4PDPA 1YHVA 2XIXA 1J1CA 2OG8A 5GJDA 4MD8E 4QMVA 3C9WA 3LIJA 4FZAB 3DK7A 3G9LX 4YTCA 4K9YA 3O23A 5KMKA 5IA4A 3ETAA 4KIKB 4AT3A 5HVYA 4K77A 3VBTA 3BYVA 5TF9A 3BI6A 4IAKA 3CP9A 5ETAA 1JOWB 4FF8A 4FV7A 4NU1A 2UZBA 5AAFA 3ZBFA 4F6SA 3LKMA 2UW7A 4FNYA 2RFDA 3ZC6A 4BDAA 5E8VA 3VUDA 5E8WA 4AZEA 2WU6A 2BCJA 2VX3A 3JVSA 3OEZA 1U54A 4ZZOA 4XEYA 5A6NA 1OL5A 2C3KA 3OCBA 4IZ5A 4EH3A 5HTIA 3N4TA 3UDZA 3R7IA 3KXNA 2C3LA 2W9ZB 5ANJA 4F9WA 1JKLA 1H01A 2GQGA 2W1FA 1AGWA 2WMSA 4X0MA 1WVYA 4C4JA 1VR2A 3FMNA 4BDFA 3II5A 1H1WA 4IBMA 4PDSA 3Q5ZA 2IZTA 2OJ9A 4LUEA 4RLLA 2ZM3A 1DI9A 3DKFA 1REKA 2R3IA 4UEUA 3PY3A 2HXLA 4E7WA 1H28A 2BUJA 4FSNA 4ANOA 4FK6A 3AXWA 4EK8A 3AC4A 2ETKA 4YJTA 4XP0A 4A07A 3JY0A 4L45A 3OY1A 4RJ8A 1OGYA 1Q8UA 4BCJA 1H25A 5CU2A 1PMUA 3KVWA 2XAOA 3PSCA 5CASA 3IG7A 2PZPA 4WIHA 4I5MA 4GK3A 3UOLA 2B54A 2P33A 2ZJWA 2CKQA 4Y73A 4U3ZA 3A7JA 4BCOA 4C34A 4UX9A 5JRSA 2OO8X 2XIZA 2ERKA 2YCFA 2Y9QA 5CI7A 3NUUA 3PZHA 5IEYA 3IS5A 1YOJA 4EK5A 4QP4A 4QP7A 2UVXA 3NUXA 3VUTA 4QEBA 5LCJA 5IQHA 3QQFA 2QKWB 3PIZA 1XH7A 3DPKA 3KULA 3RPOA 2QOFA 2IZUA 2R7IA 3FYKX 2VZ6A 3DJ7A 1CKIA 1FMKA 3R7OA 3ZEWA 3ALOA 4MH7A 3MS9A 4W4WA 2JIUA 4NW6A 4NFMA 3R8PA 4Y46A 4NK9A 3ZC5A 3FEGA 4O0SA 2ZMCA 3CTJA 2HZ0A 3QQHA 4EUTA 5HGIA 5KMNA 4J99A 3HAVA 4FVQA 1YXXA 3F66A 2JDVA 5FP5A 2Z7LA 2C3JA 3Q60A 3D14A 1YKRA 3QALE 5AM7A 3DB8A 3DOGA 3WOWA 4MD9E 1XH5A 5HI2A 4CXAA 3AKKA 3CJFA 3H0YA 1JAMA 4BDGA 2DS1A 4OUCA 2BRGA 2Z7RA 3OCTA 3Q4UA 4CFUA 2X9FA 4GRBA 2DWBA 4QO9A 1H1RA 1XH8A 2PZIA 5HVKA 4H36A 4OTQA 3RAKA 3NNUA 4JDJA 4QMOA 4QQJA 3RP9A 3VS4A 4YU2A 2V55A 4FVPA 3R9NA 3QTIA 3GFWA 4GVAA 2C3IB 1SNUA 5TE0A 4F65A 3PP1A 3AC3A 2C6IA 1W84A 4NT4A 2WMWA 2Y4PA 4JDIA 4AW1A 3PTGA 1KE6A 3N4UA 2R3RA 5LCKA 3UQCA 4DEDA 2AYPA 3CE3A 5AR3A 4B8LA 1OMWA 2XF0A 1QPCA 2QLUA 4XG3A 1OECA 4BYJA 2XIKA 3D5VA 1SVGA 3HV5A 4NJ3A 4BDBA 4MCVA 5LMAA 3P23A 3PLSA 3UO5A 4BBMA 2WB8A 2O64A 3BHTA 4X6RA 5DT3A 3GGFA 3R28A 3EQPA 5HTCA 3NNWA 2RF9A 3DAJA 1ZLTA 2P2IA 1AQ1A 2CNVA 3KB7A 2OGVA 1ZWSA 2VO6A 4UXLA 2Z7SA 4Y85A 3SLSA 4QMYA 3AC8A 2YHVA 3GCUA 5LVPA 4RJ3A 2ITOA 1YHWA 1YVJA 4IADA 5CSVA 3WE4A 3ZFXA 3IQ7A 2UW6A 3NS9A 4FKOA 3GC0A 3WF9A 3FXWA 4FT9A 4BBFA 3E63A 4X3JA 5JFVA 3FLWA 5HO8A 3UVQA 4YC6A 4DEHA 3OVVA 5DNRA 3QCXA 4D2RA 5F1ZA 1JVPP 2BRNA 1JSVA 4HJOA 3VS2A 5B2KA 4DLIA 1XHAA 4F0GA 4R3RA 3A7GA 4ZEGA 4DEBA 2QOIA 4PTEA 2WIPA 3I4BA 3JYAA 4E20A 2YLEA 1BYGA 2W1CA 3FKLA 3PPZA 2B53A 2P0CA 3QQJA 3PIXA 5FP6A 2RKUA 2YITA 4XLIA 4OTHA 4BN1A 4Q9ZA 3A99A 4C3RA 2X81A 4FIGA 5ETFA 4X3FB 3P0MA 2CN8A 4ZK5A 1TKIA 4YHFA 4AUAA 3SW4A 3MY0A 3TWJA 5ITAA 1LEZA 3G9NA 3HA6A 3KXMA 2WTJA 1ZYSA 3Q3BA 1YWRA 2R64A 4CKRA 3ENHA 3HRCA 2J5FA 2XEZA 3F5UA 4MHAA 4AQCA 4AA4A 4JAIA 4J52A 3SVVA 4WG3A 3TJCA 3DV3A 4C2WA 3HEGA 3V51A 1TFFA 3MW1A 3PXRA 4K33A 4WBBB 1J7UA 3BKBA 4NW5A 1BL6A 2XEYA 3BCEA 3HV4A 4BICA 4AF3A 4JAJA 4D2WA 4GEOA 1NVQA 5ANOA 4PMSA 3BGZA 4YTIA 4GFOA 1JBPE 2J0IA 4LGDA 3HDNA 2JLDA 2WMRA 1ZXEA 5ACBC 4CCBA 3VW6A 1V1KA 4IC7A 5IEVA 3FZTA 3VBYA 3W0RA 3UC4A 4U43A 4FE2A 3NGAA 4EH9A 4OAUC 2XJ2A 3DBCA 3KK8A 3QHWA 4PDYA 1PXOA 3ZDIA 1KE7A 4H3QA 4EJNA 3FV8A 2J90A 3OP5A 4G3CA 3WYYA 3PYYA 2XCKA 4I0RA 3GC7A 1BLXA 2HAKA 3FSFA 2WHBA 5D41A 4BDEA 2VNYA 1UV5A 3CCNA 3KMWA 4HCTA 3E64A 1CMKE 4PTCA 5FLFA 3BU6A 4HGLA 1M14A 2UZUE 4QYYA 4BRXA 4OBPA 5HX8A 2WTIA 4NJDA 5G1XA 3FY2A 3NMUF 3DGKA 4KABA 2LGCA 5EDQA 4F9YA 4HW7A 5LQFA 2VO0A 4YHJA 5AX3A 4TN6A 4BCPA 5A4EA 4I4FA 4D5HA 3GP0A 5TOZA 4IAIA 1WBPA 2W96B 5CAVA 4C33A 3CKXA 3NVKI 3S95A 2X0GA 4R7IA 4LOPA 3HKOA 5I9UA 4A4LA 5IG1A 2BPMA 1LEWA 2IVSA 3GU8A 3REPA 2YAAA 2H9VA 2J50A 2E9VA 2YCSA 3LFSA 4V0GA 2YFXA 4JBQA 1IEPA 1O9UA 3CS9A 3PY1A 1SZMA 4H3PA 4U0IA 3TV6A 3MFTA 3W10A 4AACA 4MKCA 2HXQA 3EQGA 2FSOX 4DHFA 4RVTA 3ZUUA 4AX8A 4O2PA 4FEXA 2BR1A 5KKRB 4ITIA 4M8TA 2CDZA 2G2IA 1P2AA 3W0NA 4CT2A 5AFVA 4KIKA 4UBAA 5BMMA 4X2GA 3JPVA 5KMLA 4E5WA 3CEKA 3KFAA 3W0MA 1W2CA 2Q0NA 3UVPA 3V8WA 4B0GA 2AUHA 1E9HA 2ITQA 2FH9A 5LARA 2OJGA 4D1XA 4PDOA 4K8AA 3K5VA 4UYNA 4YLKA 4EONA 5AAEA 4DTBA 3G51A 2C6KA 3ZLYA 4N57A 3QLFA 2UZDA 4BCKA 4CFFA 2JEDA 3DKGA 4ASDA 3FPQA 2W17A 3D5WA 4D1SA 3QQUA 2P55A 2UW5A 3HUBA 4W4YA 1GZNA 3R9OA 3TUCA 4FSTA 3AGLA 3NCZA 4PL5A 3B8RA 3C4EA 4TTHB 5A54A 4DA5A 4AP7A 5JGBA 1SVEA 3E3BX 3TZ8A 3UYSA 4L3PA 4DTAA 4GVJA 2CGUA 2VWVA 2YDKA 2X6DA 5KNJA 4TNBA 3DY7A 5AP0A 2C5XA 1ZYCA 3NW5A 4H1MA 4X6QC 3VO3A 3EZRA 4R8QA 4IFGA 1CDKA 4TYHB 3F3TA 5A4QA 3LMHA 4EUUA 3CJGA 4C57A 4ACDA 3H9OA 4DDIA 1PXPA 1Y91A 5KUPA 2GQRA 4TKSA 3UZPA 3DFCB 1YXVA 2PMLX 3ZBXA 5T3QA 4KRCA 5KE0A 4BB4A 4BDJA 5HTBA 4ZTNA 5D11A 3QTXA 2WD1A 4WHZA 4YJUA 5AUUA 5IQBA 3W0PA 4GCJA 2JGZA 5EDPA 4QDEA 5CF4A 4XYFA 3PXFA 3B8QA 1F0QA 2VAGA 5LXMA 1R39A 2WMUA 3ZLWA 3C5IA 1UWJA 3RAHA 5I3RA 5H8EA 4WRSA 1OIQA 3MVJA 1Q24A 2E2BA 4RFZA 4RLKA 5G6VA 4BZDA 3CC6A 1FGKA 5GINE 5E8UA 4WSQA 3IW4A 5FEQA 4NCTC 3EYHA 3QFVA 4NSTA 5H3QA 3ANQA 3IW8A 4IZAA 2G15A 5IH5A 3P78A 4EORA 3GQIA 2PVNA 3AC5A 3SKCA 5AR4A 2VTIA 4OTRA 5CEIA 3R02A 5IA2A 3MPAA 2YJRA 1P4FA 3ORLA 4ZS4A 1H8FA 5F95A 3GC9A 4N0SA 5IUIA 4J98A 4TWOA 4FL1A 2IG7A 1JPAA 4DFZE 1PXLA 2QOCA 2CNUA 3OG7A 2QG5A 3DS6A 3OOMA 3QC9A 4QYEA 4ZS0A 5CF8A 5K3YA 2FVDA 4JIAA 4CYIA 5CVFA 3OCGA 3ORZA 5E1EA 3N4VA 4R7HA 3QL8A 2CGVA 2PZ5A 4UZDA 4O22A 1GAGA 2FSTX 1T45A 2Y4IC 3DBDA 4O6EA 2R7BA 2R3FA 4R1VA 4CRLA 3LQ5A 1MRUA 3G2FA 3ZRLA 1OPLA 4G31A 4IJ9A 4JBPA 3BHVA 4O38A 4AA0A 5LWNA 4FI1A 5HLNA 1Q41A 5AP1A 4MXCA 1IRKA 1GZ8A 2QHNA 4C3FA 4V05A 4CLJA 5KBRA 4QMMA 2ITTA 4OTGA 3PXYA 5EKOA 3OTUA 4NTTA 4FTQA 3EFWA 3FC2A 2XM9A 3TEIA 3PJ1A 4YP8A 3AKLA 3MH2A 2CKPA 4DCAA 5C01A 1XBCA 1UNLA 2XANA 3HP2A 4XV9A 3F3ZA 5BQ0A 2AEGA 3UO4A 4BWKA 5LJJA 4P90A 1W98A 5A46A 3JUHA 4LRJA 4FV1A 4NUSA 1A06A 3E8DA 1LP4A 2BRHA 3FLSA 5DVRA 3RPYA 1YWVA 4W4XA 5CSPA 4F78A 4RIOA 3BEGA 3PZEA 2F57A 4XG7A 3OOGA 3WE8A 3ALNA 4PY1A 3ULIA 2JFMA 4CVAA 5GZ8A 3KKVA 5EYKA 1DAWA 3QF9A 1Y6BA 3PJ8A 3COMA 3FHRA 3ZH8A 3F3VA 2J4ZA 3A4PA 1MQBA 5HNIX 1Q8WA 3POZA 3AT3A 1JKTA 1YI6A 4WUNA 3TUBA 4F1TA 4L52A 5HLWA 4EBWA 4A9UA 1OIUA 3MSSA 5JT2A 3QGYA 2GS6A 2UZWE 3MY5A 3KA0A 4YZCA 3M2WA 4JX3A 4JT3A 3ZO2A 1BKXA 4U7ZA 3PRFA 3RKBA 1WBVA 2OZAB 2O2UA 3VS0A 3SG9A 4MBLA 3IKAA 3HVCA 2BRMA 1J3HA 4YPDA 4FJVA 5K4IA 3E3PA 3EN6A 2EU9A 4FICA 1EH4A 3MIAA 2O3PA 2VTOA 3P9JA 5FTQA 5AAGA 5L2WA 3ZS5A 2BMCA 3BZ3A 2R3JA 1QL6A 3L9MA 2OKRA 4EQMA 2C1BA 4APCA 4O7RA 3TT0A 4AQKA 1R78A 1XMMA 4KB8A 2UW4A 4GJ3A 5EM6A 5AUZA 3ZTXA 2BDFA 3MB7A 1RW8A 2A1AB 5L6PA 3UGCA 3HV6A 5CU6A 5HD7A 4AXCA 5GJGA 5IMEA 1J7IA 4FKVA 1NVSA 2VWUA 5CAOA 3W33A 3S1HA 4IB5A 1Q97A 2A27A 3TL8A 5DFPA 2BIYA 3GNIB 5M44A 2R0UA 3NUPA 4JLCA 2BDJA 3KREA 3E87A 4S31A 4YSJA 4X2FA 3TZMA 5F4NA 3HUCA 1YXUA 4M0YA 4E6CA 3NUNA 4XHKB 3RM7A 4CNHA 3KVXA 5EK7A 4O4EA 4ALVA 4FTTA 5M09A 4U42A 3L9LA 5J7HA 4DGLC 1H27A 4NM0A 3DZOA 4FSZA 5AR5A 4P7EA 2JIIA 3FI4A 4O7YA 4AAYA 2OIQA 3ZHPC 4BF2A 5EYDA 4WA9A 3FPMA 4YJRA 5ETCA 4FNWA 1NY3A 4YZDA 5CAUA 4IDVA 3UDSA 3ZYAA 3PFYA 2OH0E 3E8NA 4XV3A 4QP9A 2PUIA 4WNMA 3K2LA 4DF3A 3AD5A 3QU0A 5DR9A 2CLQA 1OKYA 3FYJX 3CQEA 3EHAA 1Q5KA 5CEMA 3DK3A 4HVGA 3NFFB 2VN9A 5GZ9A 3OTVA 4DCEA 5EOBA 2C0IA 1PXJA 3BYUA 5BYYA 3PY0A 3SXFA 1BL7A 3PWYA 5DR6A 2P3GX 2VGPA 4BTKA 2I1MA 4YURA 2OFVA 5ACKA 3FMEA 4C4GA 5ETIA 2HZNA 3QC4A 3R21A 3SHEA 2PMOX 4G1WA 3W2PA 1U59A 4FZ7A 1Z9XA 1ZZ2A 5C27A 5L8LA 3PVBA 3SAYA 4ALUA 5AV0A 4MXZA 3U6HA 1XO2B 2YA9A 4C2VA 1BMKA 5AV2A 2C1AA 3I79A 2ZB0A 2C0TA 4GV1A 4I93A 1FPUA 4EHZA 3TCPA 4AWIA 3GU5A 4DAWA 2QOLA 3E5AA 3UNZA 3PJCA 4S32A 2JBPA 1XR1A 3FL4A 3LAUA 3PRIA 3PA3A 4W8DA 4D2SA 2GMXA 4L9IA 5E1SA 3Q4TA 3QZFA 2PE2A 4IVBA 2BVAA 3VVHA 1PKDA 3R83A 2IO6A 1OVEA 3KCKA 3ZMMA 2XK3A 4ZSJA 4F7LA 1BX6A 5CANA 2I7QA 4FIJA 5D12A 4CYJA 3QCYA 3BU5A 4EK6A 4UB7A 2CCIA 3FXZA 2XKDA 4EOKA 4IWQA 5HU3A 1K2PA 5K5NA 4EK4A 4BDCA 3I60A 4IE9A 2IVVA 3EB0A 4I20A 4RWJA 4X2JA 2DUVA 3QX4A 4CD0A 3OT3A 4BKZA 3A60A 2W1ZA 2BHHA 3HMMA 4I6LA 3Q2MA 3NUSA 1A9UA 2OF4A 3NUAA 4L6QA 4CZUA 3ACKA 4ZLYA 1YDSE 4O82A 4M69B 2PULA 5I9VA 1GIHA 5JEBA 3QA0A 4FTCA 2QOQA 3F61A 3ZXZA 4BIBA 3UBDA 5B0XA 1OPKA 2CGXA 5AP6A 3WF7A 2P4IA 4F63A 5IA5A 5D7AA 5CNNA 2W7XA 4J96A 3F69A 3LOKA 4KKHA 2R3PA 3OFMA 4ANLA 5A4LA 4IQ6A 2ZV9A 4ASXA 4DEGA 4O7VA 4PMPA 4H1JA 3FKNA 5LOHA 4FGRA 1GZOA 3AMYA 2P2HA 2VWZA 4GW8A 4JBVA 4M13A 4H05A 1KOAA 4WKQA 2YM5A 5AP2A 4RIWB 3UOKA 1PXIA 2R3KA 4RWIA 3CIKA 2UZNA 3NCGA 4E6QA 3RALA 3KRRA 4FTOA 3BV2A 2WU7A 5EHOA 4I5PA 2WFYA 4P4CA 3LXKA 4IAFA 3IPHA 4G6OA 4AZFA 3GU4A 4MUQA 1OUKA 3CTQA 2X7FA 4GK2A 2Y0AA 4K2RA 2BTRA 3FLZA 3VC4A 2J6MA 4ZJJA 5HO7A 3R2YA 1FBNA 2IWIA 3E62A 2RFSA 4FKTA 2J2IB 2FSLX 2O0UA 4K18A 4TYEA 5DG5A 3PXZA 4TWPA 4B9DA 2CJMA 4Y83A 2Y7JA 3NW7A 4CMOA 3RZBA 4BTJA 1VYWA 1IAJA 4MX9A 3ZM4A 2W4OA 1M52A 1UVRA 3W2CA 1PMNA 2VUWA 2WAJA 2QG7A 3AGMA 1Q61A 3A8XA 2ERZE 2HCKA 2F9GA 3LHJA 3OMVA 3QZHA 3S2PA 5IU2A 4RX9A 4O0XA 3UQFA 1MRVA 5GZAA 4OLIA 3NLBA 3C51A 3N51A 2H34A 3OY3A 3R71A 4M97A 4O0VA 3IOPA 1W0XC 1QPJA 4AGCA 5HG8A 1KWPA 3FI8A 2J51A 4A9SA 4ENYA 2WQOA 2WOTA 3F82A 5E92A 2HW7A 4L68A 1Y6AA 2UW9A 4M67A 2R4BA 5H8GA 3V04A 4AW2A 4D28A 2X8IA 3HAMA 3EQDA 4IAYA 4PL4A 3ZRKA 5HKMA 2ITNA 2W05A 4JDKA 4K11A 4FGBA 4U6RA 3F88A 3MFSA 4I21A 3P79A 4DEEA 5M4UA 1ZMUA 3ODYX 3PVUA 2PVFA 2VTHA 5D9HA 5J95A 5IQAA 4YLL