4X3JA

Selection of fragments for kinase inhibitor design: decoration is key
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
280
structure length
234
Chain Sequence
VLKARMDAAIKELEVLCKLGHHPNIINLLLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRNLAARNILVGENYVAKIADFGLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selection of fragments for kinase inhibitor design: decoration is key.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Angiopoietin-1 receptor
total genus 79
structure length 234
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4x3jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4x3jA01
1ZRZA 3QD4A 2ITYA 3L8SA 2YABA 3P7BA 4DEGA 3Q04A 4FT3A 3QL8A 2H6DA 2BRHA 3QALE 3PXYA 4JQ7A 4OTIA 2ESMA 4EUUA 4UN0C 4L42A 3C7QA 1BUHA 3HV4A 2JIUA 3BYOA 3F2AA 1KV1A 1R39A 4CG8A 2O0UA 4U7ZA 3DCVA 4GJ2A 5HVYA 4TYGA 3T9IA 4ENXA 5JFSA 4FNWA 3JY0A 3LJ2A 3QRUA 4FKLA 2QOHA 2X7OA 4BDEA 4R6VA 5C03A 4J96A 1BYGA 4IM0A 4IM2A 3PXZA 4IWOA 4ZOGA 2XS0A 4GFMA 1NT2A 2XIZA 2VNWA 3PIYA 4E5WA 5KO1A 4ZZNA 5IA1A 5ITAA 3OXTA 5CSXA 3UGCA 4OT5A 3UODA 1M17A 3UOHA 1TKIA 3VWAA 4KS8A 4PDYA 4N6ZA 1YHSA 2P33A 4FV4A 2QCSA 4U41A 4A4XA 3LMGA 3WF5A 5IQIA 3I0QA 2C6OA 2YJSA 2Y9QA 3OG7A 3CBLA 3UO4A 3MH0A 3Q2MA 1H08A 3NLBA 1M7NA 4FK3A 5EKOA 4AA4A 3BELA 4F9WA 4CYJA 2JBOA 3PVBA 2XF0A 2R3PA 4D4SA 3NNVA 4MQ2A 5BMSA 3VNTA 5EHYA 4K18A 1S9IA 2WMBA 4AAAA 4AT3A 4OR5A 5E8VA 5F4NA 3FDNA 4BGHA 1MRYA 1R1WA 3PA4A 3RI1A 2XB7A 3Q32A 3S95A 2JKOA 3CC6A 4BL1A 3II5A 1PYEA 5AUYA 3R00A 4BB4A 3QAME 4EZ7A 2CKOA 2YJRA 2C6LA 3VUTA 5HLWA 3A7GA 4JDKA 1FINA 3TNPC 2VO3A 4BF2A 2WHBA 3MJ2A 5DH3A 3R6XA 4L6QA 4FKIA 3QLGA 4ZSJA 4J97A 3Q96A 3GUBA 2WTIA 3SGCA 5D7VA 4EKKA 3R8ZA 4HNFA 4NIFB 3F2RA 2BFYA 2R7IA 3BZ3A 2B9JA 3CQEA 3F6XA 2XJ2A 1MP8A 3FI3A 3OMVA 4IC8A 5DHJA 5DWRA 1Q41A 4HGLA 4R5SA 5DT3A 2XNPA 3FEGA 3O0GA 3UP7A 2OH0E 5CXZA 2GNFA 2HWOA 4FTNA 1YXTA 2GNIA 3TM0A 4CGAA 2C3KA 2GHMA 3EN4A 4RJ6A 5BVKA 4JBOA 4O81A 4D2TA 4FTOA 2OICA 4J98A 4ASEA 3G0FA 3G6HA 5AP2A 4E20A 2Z02A 4ZZOA 4UALA 4BTMA 1QPJA 4E5BA 4IC7A 2WFYA 4ORKA 2X1NA 1V0OA 3MDYA 4NCTA 2GTNA 4BTJA 5DPVA 1JNKA 5CAPA 4WBOA 1JKKA 4CQGA 1ZAOA 2X6DA 2OIDA 3BU3A 4KIKB 3RK9A 4F1TA 2Z7QA 3IW8A 4F7JA 1OIQA 5CEIA 4CTBA 4BDFA 3C13A 5HI2A 1PJKA 4PL5A 4M0YA 2X4ZA 3RAIA 2ZM1A 1T45A 3Q3BA 2W9ZB 3ZZEA 1W0XC 2J50A 4YC3A 3GQIA 1M14A 3ZXZA 4RLKA 3A8WA 5J1VA 5A4QA 4L3LA 5JRSA 2XYNA 3M11A 5LVOA 4DFZE 2WMWA 2QKWB 1Q61A 3MA6A 1K2PA 2X39A 4RBLA 4LRMA 3KGAA 4J99A 2GHGA 1ZARA 3EYGA 4BIEA 5JZJA 4XJ0A 5FP5A 4Z9LA 1GIHA 5JEBA 2BPMA 2OH4A 4NYEA 4CT1A 5DNRA 3TKUA 3TDVA 2VU3A 4MKCA 5EH0A 4Z55A 4NM3A 4DTKA 1WCCA 2RFEA 1J3HA 4BFMA 5L4QA 3HNGA 4U79A 3VW6A 5D12A 4DTAA 1DM2A 2G2FA 2R4BA 2YM8A 2Y8OA 3LFDA 3KULA 1CDKA 1KE7A 5EQYA 4EBWA 2YDJA 4IDTA 4MAOA 1NVSA 4ERWA 2BR1A 2A1AB 5BPYA 3NUNA 5FDPA 4RJ7A 2W1DA 3CSVA 2WMAA 4YO6A 1OKVA 2XJ0A 1G8AA 4EH3A 3MY0A 4ID7A 2W1EA 3DKCA 1Q3WA 5CYIA 1FMKA 2W05A 3QC4A 1UKHA 3ALNA 3UC4A 4W8EA 4RVKA 1ZYDA 3GU6A 3VHEA 4I5HA 4A9RA 1O6LA 4E6QA 3QD2B 3OY1A 4F7SA 4X7QA 2BRMA 2RIOA 5T68A 3UVQA 2EWAA 2F9GA 3UPZA 3FY0A 3WIGA 3Q4ZA 3TT0A 2EB2A 2VX0A 4CLJA 4BCJA 3NUYA 4NIFA 5EQPA 1ERKA 1QMZA 4MD7E 3PFQA 2EU9A 3ZBXA 2ETRA 5A54A 5KMOA 2ZJWA 3EQHA 5EI8A 5FM3A 4UWBA 1ZLTA 3OEFX 3CP9A 3GCPA 1JWHA 3O50A 4MNEB 5CALA 3QKMA 5AV3A 4IBMA 4IZAA 5C26A 5LJJA 3TL8A 5I9XA 4BBFA 4N57A 4II5A 3VJNA 5CSVA 2YLFA 3DFCB 3EN5A 3EIDA 3W2QA 3TZ9A 1JVPP 3QC9A 3V5TA 5DT4A 4I23A 3VQUA 4FV1A 3V6SA 1XH4A 4WD5A 5FD2A 4FSWA 4BDAA 1E9HA 1UNHA 4P5QA 4O7WA 3DKGA 5EQEA 3C4XA 5H8BA 1WMKA 5AWMA 3EH9A 4DBNA 4E93A 2FO0A 3HAVA 4EBVA 4YSJA 4V0GA 4L3PA 3GXLA 3A60A 3KL8A 4FYNA 4XG3A 5J8IA 3AD4A 3IECA 3KCFA 3MH2A 5JQ8A 4LV5A 2X9FA 3NS9A 5M09A 2V7AA 4FL1A 2BZKB 3ZLYA 2VWYA 4BDHA 2WIHA 4E26A 5IPJA 2C5XA 4LQMA 5HO6A 2QONA 2R3OA 2XK3A 3HUBA 4GJ3A 3F3WA 5GNKA 2WMXA 3D5UA 4IQ6A 3NIZA 4PDOA 4YHTA 2DYLA 5AUXA 3LKMA 4PP7A 5TR6A 3QQFA 3MVMA 3RVGA 2ITTA 1IG1A 3UNKA 3CS9A 1Q4LA 5FGKA 4E3CA 3CTJA 4ITHA 4QP4A 2YIYA 1SNUA 3OWKA 2G2IA 3O8TA 2QU5A 3EJ1A 3KRJA 4H1JA 4DG3E 2OZAA 3FJQE 4S31A 1H01A 1UU7A 2XKFA 3C5UA 1F5QA 3HV5A 1X8BA 3LCSA 3NCZA 3VUDA 1UU8A 3IW6A 4S2ZA 2PVFA 4XP3A 3ZDUA 2Z8CA 5T3QA 3WYYA 5AAGA 3S00A 4FBXA 2E9OA 3F3TA 1H25A 1F0QA 4XG2A 2YIQA 4RC4A 2W1FA 1H0WA 4F6WA 3TUCA 3ANQA 4PQNA 3LCDA 4KS7A 4LYNA 3QTRA 5M53A 3QZHA 3QFVA 5L6WL 2OFUA 3F5PA 4HGTA 4M69A 4RC3A 3W32A 4P4CA 4ANOA 2I7QA 3HP5A 3LFQA 4GVAA 2H96A 4F7NA 2QOKA 5IA3A 4AOIA 4FK6A 4IVAA 3D14A 2WTKC 4C2WA 4O21A 4MF0A 3S1HA 4U44A 4RIOA 3GT8A 3QD3A 4TPTA 3GENA 3NNXA 3CPCA 4IAAA 2WXVA 3QUDA 4DLIA 4PPBA 4EC8A 4RQVA 1Y8YA 2ITVA 2UW9A 3KXGA 3UQGA 5LCKA 3HEGA 3LXLA 5AP6A 3T9TA 4AN3A 3IG7A 2R3KA 4LRJA 4AE9A 4AT4A 4FL3A 5EOBA 5HESA 3VO3A 3H3CA 3LMIA 5AM7A 2PE0A 4YO4A 2BUJA 3C4ZA 2B53A 4RVLA 1M52A 2YCQA 3COMA 4KKEA 2B0QA 5CU3A 3V3VA 2IW8A 5FXRA 3IO7A 3VIDA 4E8AA 3ZCLA 1IRKA 3VUMA 4MXXA 5J9ZA 3GQLA 3RWQA 5CF8A 2X0GA 3SOAA 3ZONA 1Z9XA 3O51A 4UYAA 1GJOA 2CN5A 2DQ7X 2B1PA 3L1SA 4EJNA 4FEUA 3R8VA 3PPZA 4R5YA 4FKOA 1XQZA 1OB3A 5I9UA 3QA8A 5EYCA 3RWPA 3BHYA 2J0JA 5M51A 3TUBA 3NVKI 4NU1A 2PSQA 3CIKA 1HCKA 2PUNA 3BWJA 3E7OA 3NRMA 5ANEA 3W2CA 2I0YA 3QYZA 3U54A 3D0EA 4CSVA 1XH6A 3E8NA 2QVSE 2R3RA 3P79A 3QQHA 4P2KA 3W2OA 4AF3A 4ERKA 4UMPA 5I9ZA 3IDBA 1ATPE 2OBJA 1FOTA 2ITXA 2WOTA 4LL5A 1GIIA 3BBWA 1WBPA 3E3PA 3QRTA 3GU8A 1U5QA 3VS3A 2VD5A 1PXMA 1WBVA 3PPKA 1U54A 3OWLA 3PY3A 5JSMA 1LEWA 4ACCA 3VULA 5E92A 4EKLA 3GCQA 3QZGA 4XMOA 5E4HA 1JKSA 2BZJA 4TNDA 4EHVA 3FHIA 2GU8A 4IWPA 4AN2A 3DKOA 4GIHA 5IQEA 1ZMWA 4ACGA 2BROA 4OGRA 4K33A 5LMKC 4H3QA 4RWKA 4NM0A 4KIOA 3VC4A 4APPA 5HZNA 5IU2A 1UU3A 1ZY5A 2IWIA 3HGKA 3KF7A 4MXZA 4KUJA 3WZUA 5J79A 4FKWA 2PHKA 4QPMA 3DGKA 4C4EA 1Y8GA 3QUPA 5B0XA 4M15A 1B39A 5CF5A 5JN2A 4RFYA 5EYKA 3F82A 2BCJA 4BDJA 1YOLA 3NYNA 3MS9A 2PE2A 2QG7A 3C4WA 2BDFA 2UUEA 4DN5A 2HAKA 3I79A 3LFFA 4AZEA 4O0UA 4DCAA 5JFXA 1H07A 4AP7A 5JH6A 1VZOA 2BILB 1OUYA 4IAYA 5TKDA 3BLQA 3O8UA 5DI1A 2PUIA 2JITA 1FVTA 3G90X 1IR3A 5DLSA 3SXSA 2OJJA 3ZYAA 4CKIA 3N4TA 4ZSEA 4C7TA 3H4JA 3FZOA 3F3UA 1KOBA 4O2PA 1URCA 4DTBA 4BCFA 4XUFA 5AX9A 1GOLA 4L45A 1MRUA 4IWQA 4APCA 4QTEA 3RP9A 5LMBA 3R2YA 4WNPA 3QQGA 4CFNA 1ZZLA 2RKUA 4BYJA 2JAVA 3CKXA 1XHAA 4O83A 2VWBA 4DH8A 1RJBA 4BWKA 2EVAA 4F4PA 5FEEA 4X3FB 4K0YA 2Q0BA 3KQ7A 3UG1A 3PG3A 3TZ8A 3EQDA 4YPDA 4CCBA 4EOKA 3U6JA 1PXKA 3PA5A 2NP8A 3R8LA 4MX9A 3WE8A 3FXWA 4NKSA 4M84A 4A9YA 5IQBA 2J0IA 5G1XA 5EG3A 1M2QA 1GZ8A 2UZLA 2XM8A 5FWKK 2F57A 3SG9A 1R78A 4QRCA 4I92A 5CZIA 5AUUA 4FSQA 2ERKA 4OTDA 5HTBA 2XBJA 3A7JA 4LGDA 2OXYA 4I5PA 2A4LA 2CKEA 4C4HA 3DV3A 4BDKA 5E8WA 4GH2A 3E88A 4E6DA 4O7RA 2J51A 1FMOE 5CS6A 3DK6A 2YAAA 4OTPA 5HU3A 2QHNA 3FMJA 5CI7A 4IAKA 2XIXA 3S4QA 5ANDA 3LQ3A 2GTMA 2R3GA 2CNQA 3U87A 1I09A 2P2HA 3I6UA 4L00A 1KUTA 3FZSA 4RG0A 1OVEA 3L9MA 2Y4PA 4A7CA 5KX8A 1FBNA 5HE1A 3FPQA 3FE3A 4ZK5A 5DBXA 3K54A 1E1XA 2WMRA 4FGBA 5CAUA 3HDMA 3DB8A 4ONAA 3HV6A 3MTLA 3F3VA 3R02A 2BRNA 3Q6WA 4K9YA 1KE8A 4CV9A 4ZTMA 5GIOE 2NPQA 4YJVA 4XBUA 4TN6A 3RINA 2Y7JA 2ZB0A 4FKPA 2C3JA 4YUQA 4BI1A 4BWXA 3TTIA 3UZRA 3TV6A 4QTAA 2YERA 3D9VA 1J1CA 3E92A 5CLPA 3R71A 4M8TA 5ANKA 2Z7RA 3ZO1A 3P0MA 3NEWA 4BCKA 3S0OA 4ACHA 4FMQA 4JL9A 3LM5A 4I21A 5AAFA 3A7IA 4Q9SA 3DBCA 4FTMA 4JXFA 4NM7A 4TWPA 1DS5A 3BBTB 4YJOA 1MQ4A 4CFFA 5LVMA 2RL5A 4DAWA 4FSMA 4QMXA 3MW1A 4QNYA 2JGZA 2YM6A 3GGFA 3OCSA 4FODA 4YJTA 2PVLA 1R0PA 2JKMA 4PL3A 1FVRA 3HYHA 3KK8A 1R0EA 5BVWA 5I0BA 4EYMA 5LQFA 4RX9A 4P5ZA 2WMSA 4JX3A 3P78A 4EWQA 1URWA 3KXXA 3WF9A 2DWBA 2R64A 1KWPA 2VTLA 2EXCX 2ZV2A 2C5YA 4ZSGA 4IVBA 4PP9A 5A14A 4HYUA 3RZFA 3HMMA 4L01A 4RA5A 5BMMA 3EZVA 5L2TA 3UNJA 1FQ1B 4XG4A 2WIPA 5AR8A 4BHNA 5M06A 4H1MA 1Q5KA 4FTLA 5E8UA 3ZZWA 4D28A 4AA0A 1H28A 4AW0A 3Q52A 2UVXA 2BMCA 4D55A 1HCLA 3SQQA 3SXRA 5AR5A 4BVUA 4QTBA 2B4SB 2ZVAA 4EOIA 4WRSA 1W8CA 3NNWA 3EKKA 4DEBA 2HZNA 4AGWA 4BKZA 3FMNA 2JLDA 3NNUA 1A48A 4QYYA 4C4FA 4CFVA 4NL0A 4FTAA 5IH6A 4BY9E 5DR9A 2C4GA 3UMXA 2IJMA 2FA2A 4IZ7A 4KD1A 4F7LA 3KC3A 4DE4A 3VBTA 5CNNA 1QPDA 4E5AX 1ZYJA 5IMXA 3BU5A 3Q4CA 3BYSA 2W9FB 4KKGA 1PY5A 4QD6A 5LXMA 4HCTA 2CGVA 4MXOA 4EOJA 3MH3A 3PPJA 4IAFA 4ANSA 5LVNA 4QTCA 3FYJX 3O7LB 3F66A 3PE1A 2G01A 3I60A 4D1ZA 4GKHA 2CJMA 3OF0A 3UJGA 3OVVA 4ALVA 3LW0A 4FEWA 1O9UA 4IAZA 2XNBA 3DXPA 1GAGA 5CSPA 3VN9A 3TKHA 2XEZA 3FY2A 4M68A 5IISA 3ITZA 3DBDA 4D1SA 2PMOX 4QNAA 4GK2A 3IDCA 3GU7A 5M4UA 2CHLA 3V5LA 4AXAA 3N9XA 3TNQB 4Y85A 3W2PA 1XH7A 3ORIA 3QX4A 4NKAA 4Y8DA 2PTKA 5J9YA 4DLJA 1NVRA 2PYWA 3PXQA 3BHUA 3BHVA 4N0SA 3FLQA 4JR3A 4FIEA 1Q8YA 3JYAA 4AZWA 4BDIA 4C33A 4EH2A 1YXVA 4ZTHA 3A7FA 2LAVA 4A07A 4I41A 1SM2A 5DRBA 2FSLX 4C34A 5B2MA 4C38A 5FLFA 3PZEA 1J7IA 4D0WA 2HYYA 4FZFB 4QMMA 5HBJA 2VTMA 2XVDA 1ZMUA 4FTJA 4UEUA 2GNJA 2YIXA 4QOXA 3W55A 4EK3A 1CM8A 3HLLA 4U9AA 5EM8A 3CY3A 3LXPA 5M08A 1P5EA 2HW7A 1WVWA 2OIQA 3T3UA 4ACMA 4BIDA 2J0MB 3N4VA 1YW2A 2C0IA 4IZYA 4O96A 3KVXA 5CT0A 5CAVA 3O23A 3U9CA 2ETMA 4XG8A 4PTEA 2Y6MA 2V62A 4FSYA 4DINA 3RBWA 3KREA 3NZ0A 1ZOHA 5E8XA 4DEHA 4HVDA 4M97A 4PMPA 4TTHB 1KE5A 3A2CA 5DIAA 5HO8A 2BAQA 3DTWA 2JD5A 2X8IA 4IAIA 2W1ZA 4O27B 4BN1A 2XNOA 2IW6A 4W9XA 2GPHA 2UZOA 4PRJA 3U4UA 4GRBA 3SW7A 1BL6A 4UWYA 2OJIA 4TRLA 3QHRA 3GBZA 5DRDA 4JOAA 4JLCA 4ZLYA 4G2FA 5F9EA 2ONLC 5I5ZA 4UXLA 2YM4A 3R04A 2VAGA 4H58A 4OTQA 3RJCA 3VS5A 3AD5A 5AMNA 3WF6A 1SVGA 2XCHA 2WQNA 4R3CA 5HBEA 2W1GA 4ASZA 3U51A 2NO3A 3ERKA 1H0VA 1G8SA 4EONA 3K5UA 4MD9E 2BHHA 4O2ZA 4C02A 5KBQA 2GS2A 5ANGA 3KMUA 5AIKA 4IB3A 1XWSA 3DLSA 3VUIA 4ZAUA 1KSWA 4QMUA 2X81A 3ZMMA 5E8SA 3LFSA 5IQAA 3H9OA 2OF2A 4IX4A 4C35A 1E1VA 1YOMA 2UW8A 4XHKB 4KIQA 3FLYA 2J4ZA 3MWUA 3P23A 1W98A 2OZAB 3EB0A 3UC3A 3UG2A 3OBGA 4N70A 3HRFA 2F7ZE 3UYSA 2HY81 3UZPA 5I9WA 1YI4A 5D1JA 2WD1A 2SRCA 3DNEA 4KIPA 1OI9A 1ZMVA 1ZOGA 5EFQA 3RAHA 4CZYB 4QYGA 1H27A 3MI9A 3OCBA 3I6WA 3Q6UA 4GFGA 4JBQA 5EM6A 5LWMA 3SVVA 3L9PA 4X3FA 4Y73A 2PPQA 3EQGA 4KABA 1OITA 2WTKB 4O91A 4MWHA 4QP3A 3HMNA 3O96A 3OXZA 2YLEA 3OHTA 5JKGA 4DFUA 2OI4X 4YBKA 4ZS4A 4PTCA 4KSPA 3H9RA 3S2PA 2QU6A 2C3IB 3I5ZA 4HZRA 4NT4A 3C4CA 4O0TA 5IA0A 2IW9A 2ZV8A 2HY0A 1ZYSA 4FV7A 4D58A 1YHWA 3R83A 3UMWA 2FH9A 5HCZA 4CRLA 2GNGA 1QCFA 1Z5MA 2IVUA 1PXNA 3AG9A 4NFMA 4NH1A 4WSYA 3P86A 2A2AA 3KXZA 4M12A 3E62A 3B2WA 3GNIB 5IQGA 4OBQA 2ACXA 2JDTA 4F6SA 2QNJA 3VF9A 4LL0A 4RIYB 5DG5A 1K9AA 2ZDTA 3U6IA 3IQ7A 2Z60A 4KNBA 4TKSA 5EM7A 1OBDA 3ZTXA 4NEUA 3G9LX 4WUNA 3PY1A 4K6ZA 2XA4A 2B52A 3N4UA 4JDIA 2UZVA 4A06A 2WMUA 4BKJA 3NSZA 4C59A 4DGNA 4ZTRA 2FSTX 3OUKA 4RVTA 4KWPA 3P1AA 5M4IA 1STCE 1Q24A 2PU8A 1G3NA 5EK7A 3ULZA 3KRWA 3QCSA 4F70A 2QKRA 5HE0A 1H1SA 1Q8WA 4L7FA 1Q8UA 3BRBA 1UKIA 2BZHB 4GW8A 3FMMA 3QTZA 4CNHA 3D83A 4XOYA 4EH9A 3WF8A 3DAKA 4OBPA 2BHEA 1YI3A 2GQGA 2GFCA 3AT4A 4FNYA 2PUUA 1OKWA 4FSUA 4CVAA 5L8JA 3L8XA 4C62A 3B8RA 3HV3A 4GUEA 5DR2A 2C5OA 2Q0NA 2E2BA 3F3ZA 5IH5A 4JAJA 5BYZA 3VBXA 3MB6A 3QCYA 5L6OA 4BCOA 4DYMA 4D1XA 3SRVB 1CMKE 3R7OA 4W4YA 3VRYA 4EJ7A 4PMTA 1PMNA 2XP2A 4ZS0A 5B2LA 4UMQA 4QTDA 2FYSA 4YLLA 4BTKA 2W4JA 2B54A 4K8AA 3S3IA 4C0TA 3MESA 3E8CA 2QOOA 4DC2A 5DT0A 3LFEA 4U0IA 4Q9ZA 4YZCA 3R1YA 4UMRA 1ND4A 4YNEA 4MVFA 4BIBA 5IKWA 1VJYA 3OW4A 5BNJA 3W2SA 5EOLA 3GC8A 2VWUA 5D11A 5C9CA 3KEXA 4DT9A 3NYXA 2R9SA 3LE6A 4IJPA 5F1ZA 3JY9A 5A4EA 1U4DA 4FYOA 2X7GA 3QTSA 4RX5A 3PXFA 3OROA 4JG8A 3FLNC 3Q4UA 4XX9A 4YZBA 3RPSA 3VUHA 2WQEA 2J9MA 4QMLA 3PP0A 5CVFA 3E63A 1NW1A 2P4IA 3V51A 3ZC5A 4JRNA 4Y83A 5KMNA 5J95A 4BI2A 1OL1A 1ZOEA 3TWJA 2ZYBA 4I0RA 5CSWA 4ZP5A 4EQCA 1S9JA 4GYIA 4C36A 2YM3A 3MFTA 5IG1A 3AC4A 4RX8A 3PXKA 3NVMB 3FI2A 4YSMA 2GHLA 4RFMA 5H8GA 4Y46A 3O71A 2JIVA 3OUNB 1WBOA 4AFJA 2XZSA 4W9WA 1OBGA 4MXCA 3FC2A 3KMWA 2I0VA 4RMZA 2PULA 1BMKA 3EN7A 4WUAA 4HGEA 3D5XA 4I1ZA 2OLCA 1TQMA 4E1ZA 4KAOA 3ZFMA 3DAJA 2AUHA 1CTPE 2CGUA 2GMXA 3BX5A 3FHRA 3ZFXA 5AP1A 4OTWA 4NFNA 1YOJA 1XO2B 2HIWA 4R3PA 4ZLOA 3QTXA 2YDIA 1RE8A 4O7NA 1OKYA 4EOOA 3D7TB 3NCGA 3DY7A 1H24A 2IVVA 3HMPA 5ETIA 5CU2A 4D2VA 4CQEA 2WKMA 4DFYA 3TEIA 3DAEA 5E8ZA 4BR3A 2XCKA 2VTPA 4MEDA 1H00A 2OXDA 4LFIA 1UA2A 5DEYA 5IEVA 2KULA 4DBXA 4G6OA 2F7EE 5CZHA 3BHTA 1MRVA 1IEPA 3FKOA 3U9NA 3TIZA 2BFXA 3VBYA 2JKQA 2JDSA 1PXOA 4H36A 2P55A 4EOQA 5E90A 1JQHA 3FZRA 4BGQA 3Q9ZA 2VTRA 1JKLA 4TNBA 3RZBA 2CGXA 1BI7A 2G2HA 4GT5A 3UOLA 4OTFA 4QQ5A 4CD0A 1DAWA 3AXWA 3NAYA 2PVKA 4GKIA 2REIA 3BCEA 1EH4A 3P7CA 4YJUA 3TXOA 3ZOSA 4CRSA 4LOPA 4Q5EA 5BVFA 3R22A 3SG8A 2LGCA 5FG8A 3HL7A 5H8EA 5EDRA 4I6HA 4FEXA 4RT7A 3F88A 1GY3A 5EW8A 2OKRA 4WA9A 4NTTA 3P08A 4B9DA 4EOSA 4IADA 4DHFA 4IM3A 3COKA 2G15A 5EI2A 4OUCA 3Q9YA 5HG7A 4YU2A 1UU9A 2WTDA 4Z7HA 5CEQA 4N4SA 2A27A 4IX3A 3DLZA 2X7FA 1U5RA 3M42A 3OW3A 1FVVA 3D2IA 2VWZA 2V5QA 3H0ZA 4J7BA 2PZRA 3EL7A 4TXCA 5IH4A 1PRYA 2GQRA 2RFSA 2OXXA 4CFWA 4CKJA 4GG7A 4J1RA 3IDPA 3ULIA 4IB1A 1A06A 3EFJA 2XRUA 4FV3A 4D4YA 5AP7A 4WG5A 4F64A 4GMYA 1OZ1A 5K5XA 1YHVA 3AC5A 3E8EA 4TY1A 4F0GA 4JAIA 2C6EA 2OWBA 4ZMFA 5L6PA 4ZY5A 4EHEA 3PXRA 4G3EA 1P4FA 4G5JA 4MD8E 4ZY6A 4I6QA 3V5JA 3CJGA 4JIAA 4AZVA 2OZOA 4AW1A 4DFNA 5FTQA 4EZ3A 4OLIA 2E9PA 2C1BA 4JNWA 5FEDA 3R8PA 3DZOA 5CY3A 4DG2E 3ET7A 4QP8A 3ZRKA 4EC9A 2QOFA 5TOZA 5HIEA 1J7UA 2R7BA 2Z2WA 1OIRA 2WAJA 1DI8A 3EFLA 3TV7A 2HZIA 3D15A 1FGKA 5M4FA 2OG8A 3OCGA 4AFEA 2PY3A 1KE9A 1OPJA 2X9EA 3NGAA 1RQQA 1OIUA 4NM5A 5BUIA 3FL4A 2R3JA 3NW5A 2XH5A 3PG1A 3IOKA 4QYEA 3V8TA 4D5KA 4HVIA 2ITZA 3F5XA 1MQBA 3ZSHA 5KBRA 4FE2A 2QLUA 4P7EA 5FDXA 5K9IA 1XJDA 1OECA 3WZJA 4C58A 3KRRA 2VTQA 1J1BA 2C69A 3OFMA 3I4BA 3VS1A 4G3CA 3R8MA 4R8QA 1BKXA 3QYWA 4RJ8A 3RPRA 4CMUA 4U40A 2PL0A 2XYUA 3PTGA 3RM7A 3MSSA 5CEMA 5ANJA 3B2TA 3LFCA 4F1OA 4U6RA 3ORLA 4YMJA 5HVKA 3JXWA 2XK6A 3PE2A 1UWJA 3GU4A 4L9IA 4G3GA 2JDVA 3RNIA 3DXNA 1QPCA 3Q9WA 5DYJA 3NUUA 3TUDA 3CGOA 3FQEA 5JZNA 5CASA 4EH6A 4FF8A 4QMTA 3OS3A 3I5NA 2ZAZA 5I3OA 4ASXA 3TNHA 5J87A 5EHOA 2BTRA 3ALOA 5J7BA 5GIPE 4ASDA 4ZSAA 2FUMA 3UTOA 5DFPA 4GEOA 3OCTA 4CFXA 3LFAA 3QCQA 4LM5A 3L8VA 3VJOA 5KHWA 2PZ5A 1W83A 4MXYA 1P14A 5AJQA 2QO2A 3CPBA 2YWPA 5LOHA 3LJ1A 2ZMDA 4EI4A 5CEPA 4KBKA 4NWMA 5K5NA 3GC9A 3SW4A 5L8KA 5GZ9A 1W82A 5IA2A 3HVCA 2HCKA 2PVJA 4LUDA 2VGPA 4XBRA 4RIXA 3ZO4A 2J2IB 2UW4A 2XUUA 2XK8A 4F63A 3QWKA 4BWPA 4I3ZA 3Q53A 3W16A 5CANA 2C1AA 3FZ1A 3KXNA 4DGLC 3ID6C 4JR7A 3ZXTA 4B4LA 2C6KA 4FKGA 4RJ4A 5EW3A 5LMAA 3A4OX 5LVPA 3W8LA 3T8OA 4KIKA 2YZLA 2JDRA 4FNXA 2W5AA 2YAKA 3IK3A 1OPLA 3EL8A 3TI1A 5CU6A 2BIYA 4C61A 4CZTA 3QBNA 3G15A 2WOUA 3PJ8A 4O1OA 4XYFA 3ETAA 4X2JA 1QL6A 3ZRLA 2P0CA 3BGQA 3PJ2A 1W84A 4N6YA 4PL4A 5CVHA 4AW5A 4C4IA 4L8MA 4C4GA 5HG8A 1SZMA 2JFLA 2Y0AA 3GOPA 2W0JA 4CZUA 3R1SA 3DBQA 3SV0A 4FV8A 4C8BA 5E91A 4QP9A 3R7UA 4AGCA 5IQFA 4QMYA 4Y72A 5CQWA 5CAOA 4BHZA 2PVYA 4FZAB 3F9NA 5T6KA 2BRGA 3DQWA 4GT3A 4ZJVA 1Q97A 1OL2A 1XR1A 5FXQA 3SX9A 5CF6A 4KBCA 4YJSA 2E9UA 3SA0A 4X0MA 2OJ9A 2XK7A 2ITNA 4BRXA 5J1WA 4YZNA 4TZRA 4RPVA 4BDGA 4LG4A 3PWYA 5E9EA 1SNXA 3PJCA 2HZ4A 5CI6A 4DGGA 4F1MA 4EK4A 3BQRA 5AV1A 4FA2A 4D4RA 3OD6X 2PWLA 2EXMA 5FBOA 3FYKX 5HGIA 4E4LA 2FVDA 3MJ1A 3ZC6A 4YNOA 1LEZA 2BDWA 2R3NA 3BYMA 4IACA 5HKMA 4EYJA 5HNIX 4OAVB 4FKUA 3AGMA 3TNWA 1YWRA 2VTTA 3ROCA 1U54B 4PNKA 4AS0A 3DB6A 3HECA 3CLYA 4NSTA 1PKDA 4IVCA 1B38A 4BBEA 5LCJA 5D9HA 5BVEA 2AYPA 2J7TA 3OZ6A 4M7IA 3NPCA 5BQ0A 2JEDA 3OP5A 3RHKA 2PVNA 4QP1A 4WO5A 3QTUA 3IPHA 4C3RA 4YC6A 2UW7A 2R3MA 1AD5A 4FL2A 4UYNA 2XM9A 4GL9A 4O0WA 3SKCA 5KZIA 2UZEA 2W1HA 4FTQA 5DEWA 2VWXA 4PNIA 2OW3A 3DBEA 3PP1A 4F65A 5FEQA 4AZFA 5JFWA 3ENHA 1LP4A 2F2UA 4BKYA 4E7WA 2Z7SA 4QYHA 3ZEWA 4M3QA 3FBVA 2O5KA 3D5VA 3HRCA 3L9NA 4MTAA 5HD7A 3VQHA 3BE2A 3ZSIA 1SVEA 5EM5A 5ETFA 4EL9A 4D5HA 4YTFA 2I0HA 2X2MA 3QUEA 4X2FA 5M55A 4E6CA 4AW2A 4BCGA 2HK5A 3DQXA 3TTJA 3Q60A 4PPCA 1KV2A 4IDVA 4LGGA 4RGJA 4D2SA 3PJ3A 4XG6A 4C2VA 3MPAA 4DH3A 2QURA 3C9WA 3A99A 2ZDUA 3BU6A 4O84A 3DDQA 4CTCA 1PMVA 4EOLA 4BDBA 3CR0A 4IWDA 5ETAA 4H05A 2PVMA 4L3JA 3KKVA 5JGAA 4DGMA 4IFGA 4B8MA 3HDNA 3R28A 4RIWB 5AV0A 2ONLA 5IA4A 4ANNA 4U3ZA 4PX6A 2PMLX 3MFRA 4AZSA 2AC3A 3VW8A 4BCPA 4R1YA 3P4KA 4BDCA 1OUKA 3M2WA 5HE3A 4HGSA 5HBHA 1YQJA 3AT3A 5KKRC 4L67A 5ACKA 3PDTA 3UOKA 1Y91A 3UZTA 3R7IA 4HOKA 5BVDA 5M4CA 3RGFA 3U6HA 5EYMA 4K77A 4HW7A 4USDA 4KB8A 2R3HA 2YM7A 3V8WA 1OPKA 3MTFA 3KA0A 1Z57A 4DEEA 2IG7A 2KTYA 3MVJA 4D0XA 4QMWA 3C1XA 2I6LA 4CFUA 3GC0A 4LI5A 2VNYA 2WMTA 3QQUA 4I4EA 4UZDA 4ZZMA 2RGPA 5HTCA 5L3AA 3QHWA 3QCXA 4EH7A 3EQFA 4IVDA 5HIBA 3HA8A 3LFNA 2ZM4A 5HCYA 2GDOA 2IZUA 1YXUA 3BQCA 2WELA 1CKIA 3FLWA 1UNGA 2CN8A 4CFMA 5AUVA 1PF8A 4QP6A 3KRLA 3TZMA 4ZMEA 5KKRB 4AOJA 1P4OA 2BKZA 3NUAA 4FV5A 3D94A 3C5IA 3TKIA 3BKBA 3EMGA 4I24A 5DOSA 2O63A 2CLQA 1WBTA 1ZZ2A 2AC5A 3DNDA 1NVQA 4GUBA 3UQFA 4AWIA 3FZPA 3H9FA 3VBWA 5CTPA 4WOVA 4Z16A 2BTSA 2FGIA 3FMKA 2WQOA 2W17A 5DMZA 4EK6A 2UZWE 4BCHA 4G6NA 3BE9A 4RRVA 4XG7A 2B7AA 3R21A 4O86A 3LQ5A 2E9NA 5AUTA 4ITJA 3PYYA 4JDJA 3UIBA 5A46A 2C5VA 1PHKA 2BVAA 4WHZA 4AT5A 3MPTA 2PZPA 4NJ3A 3TCPA 3UVRA 3OWPA 3DJ5A 5AEPA 4ANLA 4DFLA 5CSHA 1APME 5IMEA 4J8MA 4RJ3A 3BLRA 1LR4A 1REKA 3FL5A 4L43A 4L46A 3PLSA 5E1EA 2UZTA 3ZBFA 5IQHA 4I5CA 2VTJA 4RIXB 5I3RA 4O6EA 2RFNA 3ACJA 4FVRA 4EWHA 5I9YA 5JT2A 4XLIA 2GFSA 3OOMA 3C50A 4B0GA 2QLQA 5BUJA 5K3YA 4QMOA 3K2LA 3CJFA 4YURA 3AOXA 3OOGA 3FV8A 4G3FA 4QMSA 4R1VA 3ZFYA 3LZBA 3RPOA 1G5SA 2J5EA 1BLXA 2VWVA 4FT7A 1BL7A 3KCKA 3G6GA 2R3FA 2FSMX 4G3DA 3ZHPC 5EHLA 4MBIA 2VWWA 3MN3A 4O0VA 3DS6A 3GOKA 2A19B 3CQWA 4H3BA 4XNEA 4BZDA 4EK5A 4TL0A 3A62A 1H4LA 4JT3A 2PVRA 1WBSA 4FX3A 4IFCA 5LVLA 4D9TA 3A4PA 4I0TA 4F9YA 4UMUA 2X8DA 4O0SA 4C3PA 1WAKA 4MYGA 3QZFA 3TV4A 2W1CA 5KUPA 3O7LD 1YWNA 4MQ1A 4FTTA 4ANQA 4QMVA 4WKQA 2WTJA 1XKKA 3AGLA 5IEYA 2C0TA 3PLAE 4M67A 3BPRA 3W1FA 4EQMA 4JJRA 5M56A 3MGYA 4XRLA 3F5GA 1OL5A 2J0LA 3B8QA 4V0GB 4L52A 3WI6A 5HX6A 4YHFA 2YCSA 2Z7LA 2UZDA 3GP0A 3KULB 3V5WA 5M44A 3ATSA 3KU2A 4E4MA 3V01A 4LGHA 1B6CB 3QXOA 3UYTA 3P7AA 2XKCA 2JFMA 1OIYA 4Q2AA 2Y6OA 4RIWA 5EDQA 5FXSA 1OKZA 4FTCA 4TWOA 1NXKA 4OBOA 1IA8A 3IGOA 3R7YA 4NCTC 4GIIA 4F99A 5AP0A 2CSNA 2GSFA 4BCMA 5D41A 2CCIA 4U97A 4GU9A 1YXSA 4U3YA 3EQPA 4RZWA 4ZSLA 5FQDC 1JLUE 5KMLA 2ZOQA 5D7AA 3VS0A 5A4TA 3BYVA 5HOAA 2CKQA 2RSVA 3U55A 5L2WA 3EQBA 4C4JA 3O17A 3ZS5A 4B8LA 1Q3DA 4FZ7A 2ZMCA 3BGPA 5JK3A 1Q62A 3ACKA 3EHAA 3QQKA 5A6OA 3F61A 5HG9A 5AV4A 4G5PA 2XEYA 5H2UA 4YC8A 3I81A 3KXMA 4O6LA 3BHHA 4AUAA 1M2PA 4G34A 5EI6A 4JS8A 4JG6A 5HCXA 2VX1A 3W2RA 5IQDA 4CKRA 4FR4A 3AT2A 2X6EA 3UVPA 2UVYA 4OT6A 3AC3A 4O82A 5FTOA 3KXHA 4JG7A 5GJFA 3G5DA 3C4FA 4U81A 3R1QA 1XBAA 3ZLWA 4DGOA 2GNHA 3LAUA 3T3VA 3DTCA 5ANOA 3U4WA 2NNWB 2UVZA 4K1BA 5KZ0A 4FEQA 3JVSA 3SC1A 5G6VA 5CT7A 4FTKA 5E1SA 2C6MA 3CD8A 3SDJA 2IZSA 5KMJA 4YTHA 4UMTA 4QMQA 3QRKA 3DBFA 4FGRA 2CGWA 4IB0A 3WOWA 4GS6A 2O8YA 2QR8A 5C8MA 3IW4A 2ITWA 2EXEA 4YZ9A 5KMKA 3W8QA 3JR1A 2GNLA 2HENA 4F6UA 4ZEGA 4O0YA 3LCKA 2BAJA 1PMUA 1U59A 1PKGA 3FKLA 2PK9A 2BRBA 4QMZA 1KOAA 3NMUF 5M07A 4QO9A 1WFCA 2WU6A 5L2QA 1GZOA 3OWJA 2JBPA 2UZUE 5J9LA 5GZAA 2GS6A 3FXXA 5A9UA 5CEKA 2CPKE 4QPSA 1H1PA 5KCVA 3FLZA 1KE6A 2VN9A 2QC6A 4TYHA 4FOBA 4NUSA 4NW6A 4PMSA 3DU8A 4QPAA 2ETKA 1A9UA 3NR9A 2CLXA 3EZRA 2NRUA 4Z3VA 2VTSA 3BEAA 3FAAA 1CKJA 3H0YA 3PA3A 5TF9A 5JGBA 2R3QA 4ZIMA 1YWVA 3C0HA 2WQBA 3R7GA 4FVQA 4FG8A 3RAWA 4E6AA 4XEYA 4AA5A 2WPAA 5HU9A 4DH1A 5AA9A 3QA0A 2OFVA 4KRDA 4DFXE 2GS7A 3CEKA 5A4CA 3GVUA 4AGUA 2IN6A 4IIRA 4Y95A 2J5FA 5L2IA 3F7ZA 2XJ1A 1YVJA 4BI0A 4FIIA 3OT3A 5HIDA 3LCOA 4M13A 2RFDA 3AMBA 5HORA 4YJRA 4ZXTA 2QO9A 4NW5A 5A4LA 2HELA 2OK1A 5HQ0A 3GB2A 4A9TA 2V22A 1YXXA 5E7RA 5F94A 3QRJA 4ARKA 2RF9A 3DZQA 3PWDA 5B2KA 3UPXA 2H8HA 4EEVA 4R7IA 4YLJA 3VS2A 5BYYA 4O7VA 3R9OA 3WIKA 5HLPA 1O6KA 4LRKA 3ZLXA 2CKPA 4FIGA 2F2CB 4YLKA 4IZ5A 2YISA 5KE0A 4X3JA 2C30A 1H26A 3SHEA 2H9VA 3VS4A 4BZOA 4OAUC 4XV3A 1UNLA 4XLVA 3LFBA 2WTVA 2I1MA 5FBNC 4HYIA 4DA5A 4IB5A 5BVOA 4FOCA 5TT7A 2ITUA 3LLTA 1O6YA 3NIEA 4FTIA 2YN8A 1QPEA 3QQJA 1L8TA 3EKNA 4U42A 3D2KA 2VTOA 2X8EA 3D4QA 3EQIA 4FSRA 3UE4A 5HTIA 4WBBB 4UZHA 4DG0E 5ICPA 4FZ6A 5AM6A 2UZNA 2WQMA 4FKTA 4I6FA 2W4KA 4FUXA 3PVGA 4OTRA 3OEZA 3KN5A 5EKNA 4LUEA 3Q5IA 1CSNA 3RPVA 4RIYA 2XNGA 4O0RA 4U5JA 2R3IA 3WF7A 2BIKB 3NWWA 3QGYA 4MBLA 2XBAA 2BAKA 3RM6A 3EN6A 2Y4IC 5ANIA 1GZKA 4L53A 3WZKA 3RNYA 4I20A 3RHXA 3SRVA 2OO8X 4GU6A 4H3PA 4IX6A 4FICA 2E9VA 2I40A 2CDZA 1WVYA 3R8UA 4JDHA 2UW3A 4IHPA 3R9DA 5K4JA 2Q83A 5FTGA 5A6NA 2XK9A 4B99A 3HA6A 3VHKA 4I93A 5F20A 3RCDA 4FTUA 4BDDA 5AIRA 5LWNA 4ZLZA 2W06A 3DOGA 4X21A 3ATTA 3R7VA 2XIKA 4MHAA 5AAEA 3N51A 4D2PA 3MFUA 2PZIA 4YGAA 3ORPA 5M57A 4PDPA 3CQUA 3ZEPA 2QQ7A 5AP4A 4YJNA 4I94A 2G1TA 4D2WA 5IZFA 4GK3A 2FSOX 3TJCA 3PSCA 4YPSA 2JKKA 3QKKA 4PUZA 3BWFA 4LOQA 4MXAA 3FMLA 3QWJA 3CKWA 2EUFB 3PVUA 4D4VA 3PUPA 3LHJA 2XIYA 2XNEA 5HVJA 2CCHA 2BDJA 4W8DA 3TNIA 2HXQA 4O38A 2C6TA 3EQRA 3FC1X 4IEBA 4J52A 3EYHA 4BYIA 3UIMA 4R77A 4ALWA 5GJDA 2X4FA 3BEGA 5IA5A 4EOPA 2C68A 4XOZA 5E8YA 1R3CA 2ZV9A 3SXFA 2PMIA 4WRGA 5DR6A 3WE4A 4FEVA 1ZXEA 4I5MA 2ERZE 4J71A 3U8WA 3OBJA 3UOJA 4EQUA 1Y57A 1ZWSA 5DA3A 2C3LA 1IASA 3HMOA 3EN9A 4IE9A 3PIZA 3KFAA 2XK4A 1GZNA 3RK5A 4A4LA 4HNIA 3C0IA 4FT0A 3OC1A 4KBAA 5JGDA 2WEIA 2B55A 3E87A 5AR2A 3A61A 4HJOA 3FMHA 4HVHA 2HW6A 4BBMA 3PZHA 4XH6A 5DVRA 2VZ6A 2UZBA 4GT4A 3HAMA 5GHVA 3V8SA 2YITA 5KMIA 1NA7A 3DFAA 3HKOA 4HYSA 1H1RA 2YFXA 4WNOA 4L44A 5CENA 4ZJJA 4ZTLA 2PE1A 3UO6A 3L8PA 5AA8A 5I4NA 3CY2A 2HZ0A 3MIYA 3DPKA 3BYUA 5CAQA 5ACBC 4I6BA 2OSCA 4IW0A 3TJDA 3PSBA 3V6RA 3CTQA 3F69A 3NAXA 4O1PA 3A8XA 2JDOA 2YM5A 5HO7A 3CCNA 1H1QA 2DUVA 3MVHA 4KKHA 4UV0A 4YZMA 5H3QA 5HHWA 5CX9A 2J6MA 1FGIA 3NUPA 3TN8A 3FI8A 1LPUA 3V5PA 4YTCA 3ZU7A 2B9FA 4R7HA 4FV0A 4WNKA 4FI1A 4MK0A 3MBLA 3MY5A 3REPA 2B9HA 2VWIA 2W4OA 2YEXA 3OY3A 3FZTA 4FKSA 1WBNA 3HMIA 1JOWB 3ODZX 1VEBA 4RA4A 5KNJA 3NYOA 3P9JA 3KVWA 3R9HA 4R7BA 3ORKA 4G1WA 2W5BA 4RJ5A 1Q99A 3VS6A 4F9CA 2X2KA 3MFSA 2ZV7A 4DH7A 3SLSA 5KMMA 5EYDA 3LXNA 1Y6BA 2C47A 2ITQA 2UW0A 3BV3A 4U43A 4UB7A 4EOMA 4KSQA 3LLAA 3LMHA 5BYLA 4O7TA 4QMNA 4IXPA 2EB3A 3VUGA 5AX3A 4FSZA 2C5NA 4CCUA 4HVGA 1PXLA 4HYHA 4BCIA 4D9UA 4O7SA 3IONA 1ZYLA 2PVHA 2OF4A 3O8PA 4G9RA 4GCJA 4NZWB 2XNMA 3C4EA 3PRIA 4TW9A 4AX8A 4EUTA 2XIRA 3R9NA 3E93A 4AOTA 4PPAA 4F09A 3M1SA 4GVJA 3GI3A 3ANRA 1K3AA 4J8NA 1XBCA 4UXQA 4CXAA 3PIXA 4ZJIA 2I0EA 1V1KA 5C01A 1F3MC 4ACDA 3ODYX 4D2RA 1AQ1A 4HPUE 1BI8A 3ORMA 5HX8A 1H1WA 4WT6A 4U45A 2OJFE 4L7SA 4X3FC 1TVOA 2HWPA 2R3LA 3G2FA 1V0PA 3WYXA 3CXWA 3QLFA 4K2RA 4PMMA 4FZDB 3LPBA 2B9IA 2RG6A 3H30A 4FSTA 5LARA 1W7HA 2IVTA 4I4FA 4EK8A 4OW8A 4QQJA 3C51A 2QOLA 3UO5A 2WMVA 3COIA 2O2UA 2QOBA 3LQ8A 4UWCA 3W18A 4CV8A 1HOWA 1OGUA 3PY0A 4MCVA 2XNNA 3ZSGA 5JRQA 3AMYA 4Y5QA 1PMEA 4CMOA 2VGOA 4YP8A 3NYVA 2ZM3A 5K0KA 4DFBA 3MH1A 3D7TA 3IS5A 4FVPA 2QG5A 4AQCA 2R5TA 4JRVA 2GQSA 3G9NA 1XBBA 3ELJA 4RSSA 3CE3A 1RDQE 3PSDA 4FKVA 2YCRA 3QXPA 1CKPA 3WBLA 4PWNA 3V5QA 3ZO3A 3VUKA 2YIWA 4AGDA 1Q8ZA 2HOGA 3CTHA 4FG7A 3LXKA 2BALA 4O7LA 4WNMA 1UVRA 3RK7A 1JKTA 3G0EA 3R2BA 5HEZA 4CG9A 1SVHA 3HP2A 4PY1A 5CU0A 4NJDA 1DAYA 4V05A 3RMFA 4G6LA 3MV5A 3DDPA 4FKQA 3MB7A 4XP0A 2ITOA 3UDBA 3I7BA 3UNZA 3AC8A 4BCNA 2WTCA 4E73A 3RTPA 4ENYA 3DJ7A 4AG8A 3NUXA 3QQLA 3ORNA 3Q2JA 3EFWA 2W5HA 2YIRA 4E4NA 1M2RA 4GFOA 5CVGA 5C8NA 1DI9A 3GFWA 2YCFA 3EWHA 4XRJA 4FV2A 4QQCA 2IZRA 1WBWA 3G33A 3GCSA 5AR4A 3ZDIA 3ZRMA 2W7XA 4X6QC 1V0BA 4YHJA 3FMDA 2VO0A 3A7HA 3FLSA 3GEQA 4RWJA 4FIJA 4DH5A 3BI6A 3SAYA 2OU7A 5CU4A 3BGZA 4TYIA 4ZTSA 4X2NA 2QOQA 2YDKA 4M14A 5IDNA 3LJ0A 2O64A 4EH8A 4V01A 2F7XE 1JSTA 5FM2A 3WZEA 4AE6A 2V7OA 1PXJA 3R9RA 4LV8A 2IVSA 5JFVA 2XRWA 5AUZA 2YHVA 2X2LA 3VRZA 3VAPA 4HZSA 5CXHA 3MA3A 4GK4A 4W4VA 1YKRA 3BIZA 2PUPA 4AZTA 2VTNA 4LMUA 5TE0A 1PW2A 2F49A 2IO6A 2QOCA 4TYJA 3TIYA 5CNOA 5IQCA 2RG5A 3OXIA 5IDPA 3OTUA 1TQPA 4UY9A 5F95A 4QQTA 4TWNA 1AGWA 4TYEA 3GFEA 5FP6A 4FV6A 5J7HA 2OGVA 2WO6A 1WVXA 2GCDA 2VV9A 3QTWA 4JI9A 4DEDA 3DK7A 4F0FA 1PXPA 1SYKA 3K3JA 4JQEA 4MNFA 5AFVA 2W99B 3QD0A 3RPYA 4C3FA 3E64A 4LOOA 4X2GA 2IZTA 4BICA 5GJGA 3C0GA 5HE2A 1JBPE 4RVMA 2PZYA 4XCUA 1GIJA 4Q5HA 5J5SA 1J91A 1H8FA 4Y5HA 3RKBA 2ITPA 3NUSA 2QD9A 2PMNX 4ALUA 1WZYA 2HXLA 4PDSA 4UBAA 4BGGA 4NTSA 3UP2A 4BCQA 5B7VA 3QF9A 4QP2A 5JMSA 4YJPA 3AC1A 4IX5A 4RQKA 4EZ5A 2YZAA 5L8LA 4MWIA 5CWZA 4USFA 3HRBA 3QRIA 1REJA 3MIAA 3FUPA 4O22A 3IW7A 1XH9A 4PTGA 1JAMA 1VYZA 2H34A 4A4OA 4XV1A 1YDRE 4JBPA 3WZDA 3FQSA 1ZY4A 4AU8A 5HD4A 3AD6A 4PF4A 5IEXA 3PRFA 4HCUA 4X6RA 5IF1A 3KN6A 1GNGA 5E8TA 4HVSA 2WMQA 4E4XA 3MPMA 2WZJA 2XKDA 4KRCA 2OIBA 3KF4A 3QZIA 4JQ8A 4X2KA 1LUFA 2JAMA 4F0IA 2C6IA 3UBDA 3VBVA 1IA9A 4A9SA 3OTVA 2F4JA 2ZB1A 3FI4A 3ZM9A 4KA3A 2UV2A 4FUYA 4QT1A 2C0OA 3SOCA 3ORZA 3RAKA 4FT5A 1FPUA 4QMPA 3TZ7A 3LVPA 4JVGA 4S33A 3FMEA 3E3BX 3IKAA 4GV1A 3THBA 4A9UA 3LOKA 2QI8A 2BZIB 1YI6A 3I1AA 1J7LA 3R73A 2JIIA 3EFKA 5BUEA 2JC6A 3FSFA 2P3GX 2G9XA 2WEVA 5HLNA 2WTWA 3ROYA 4IMYA 4TT7A 4FT9A 2WU7A 3HX4A 4BTFA 3DXQA 4WSQA 1PYXA 3FQHA 4F9AA 3G51A 2VUWA 4XG9A 2XKEA 3CD3A 3F2NA 1BX6A 3IOPA 3E5AA 5ETCA 3TG1A 5K4IA 4CEGA 3IGGA 2BKKA 4FTRA 3QTIA 4XV2A 4C57A 4TWCA 3QGWA 4K11A 4RWLA 4FV9A 4RC2A 2VRXA 1Q8TA 3VS7A 4F08A 2QODA 3BLHA 3HZTA 3R63A 4L68A 1M7QA 2WB8A 2R0UA 3FPMA 4J95A 4MF1A 1SMHA 3E7VA 1NY3A 2FB8A 4PV0A 4ZTQA 4CLIA 4WG4A 4DF3A 4AACA 5AADA 3CGFA 3DKFA 4ZTNA 3KB7A 3UQCA 4FSNA 4M0ZA 4O7YA 5BX0A 3DJ6A 1JSVA 2WNTA 3LIJA 3UIUA 1L3RE 1OMWA 3F7WA 1YDSE 3KK9A 5DN3A 4OTHA 4YJQA 3RCJA 3EOCA 3JPVA 3JS2A 5HICA 2J0KA 4EH4A 2YWVA 4M69B 2VTHA 4ANMA 2C6DA 5AV2A 5EDPA 3MYGA 3GCUA 1IAHA 3Q4TA 4R78A 4B6LA 3ZO2A 4UX9A 4BC6A 1MUOA 3I7CA 3ZUUA 5K0XA 5GINE 3DT1A 3PVWA 3HUCA 3NW6A 4S34A 4YTIA 5L2SA 5C1QB 5LMKA 4TYHB 3I0OA 5H9BA 3DA6A 4JX7A 4R3RA 4XS2A 4CYIA 4DEAA 5C27A 5KHXA 4RZVA 4O7ZA 2UW6A 2V55A 5A3XA 4YBJA 2VO6A 1OL6A 3F5UA 3R0TA 3ZUVA 3DK3A 2W96B 2Y4IB 4HPTE 4DCEA 2UW5A 4GSBA 5J5TA 3COHA 4V04A 4CT2A 3D5WA 5EW9A 1XH8A 4NK9A 4G9CA 4B7TA 2DS1A 3JVRA 3Q9XA 3TACA 3W33A 1IAJA 2QHMA 3GU5A 3KMMA 4XP2A 5I9VA 3TDWA 3WARA 2VTIA 2P2IA 2OJGA 4C37A 5IUGA 5BVNA 2IPXA 4U80A 3ORTA 2NRYA 3EQCA 3R30A 3E8DA 4GYGA 5IUIA 2CNUA 4G16A 1I44A 1ZYCA 5D10A 3NW7A 3R1NA 3AQVA 5HG5A 3V04A 1PXIA 3VVHA 4EORA 4Z7GA 2VTAA 4JIKA 3D7ZA 4G31A 2W1IA 5IUHA 3JUHA 4KINA 2O3PA 2CNVA 4LMNA 5JQ5A 3KY2A 3AMAA 3FKNA 4FNZA 5HNGA 1TQIA 3MVLA 4I0SA 3Q5ZA 5AP5A 3LM0A 3R7EA 4EHGA 2YACA 4P90A 3VF8A 2R2PA 3FSKA 3K3IA 3ENMA 2VO7A 3L9LA 4ANBA 4DEIA 4ZY4A 5CF4A 4DT8A 1RW8A 2WGJA 3VBQA 4BZNA 1XH5A 5C8KA 1Y6AA 5C4KA 4IJ9A 4RLLA 5TO8A 2V0DA 1JSUA 4FC0A 4RFZA 4MH7A 1OM1A 4YZDA 3OT8A 4QYFA 5CQUA 3ZH8A 4U8ZA 4S30A 4FKJA 4MNEA 1UWHA 5AR7A 3MY1A 3W10A 4H39A 4WIHA 4CMTA 5AUWA 3UIXA 2YA9A 4W4XA 1YRPA 1T46A 3POOA 5GZ8A 3HV7A 3ZM4A 3SD0A 3NDMA 4OTGA 3WILA 1VYWA 4GG5A 4RWIA 5AR3A 4USEA 3GC7A 3O2MA 3ZUTA 3GCVA 4FIFA 4MBJA 1U46A 1VR2A 3RALA 2QR7A 3ZLSA 5FRIA 2VX3A 4IH8A 4WG3A 4HCVA 4W4WA 4IANA 4JBVA 3ORXA 3KRXA 5DE2A 2CMWA 1OL7A 4DITA 4I22A 1JPAA 4S32A 2J90A 3R01A 3POZA 4G17A 5FUTA 5C4LA 3QTQA 5CEOA 1YDTE 2O65A 5HNBA 3AC2A 3QKLA 4M66A 1P2AA 3P5KA 4FIHA 4AN9A 4XV9A 3BV2A 4EHZA 4EH5A 2A0CX 3PJ1A 2QO7A 3NX8A 3LCTA 3FWQA 3QU0A 4ITIA 4FG9A 3H10A 5AP3A 4O0XA 3K5VA 4F9BA 3FXZA 4FKRA 1UV5A 2QOIA 2XMYA 3IW5A 4QP7A 4YR8A 2R0IA 4RX7A 5DGZA 4J53A 3QX2A
chains in the Genus database with same CATH superfamily
1ZRZA 3QD4A 2ITYA 3L8SA 2YABA 3P7BA 4DEGA 3O5AA 3Q04A 4FT3A 3QL8A 2H6DA 2BRHA 3QALE 3PXYA 4JQ7A 4OTIA 2ESMA 4EUUA 4UN0C 4L42A 3C7QA 1BUHA 3HV4A 2JIUA 3BYOA 3F2AA 1KV1A 1R39A 4CG8A 2O0UA 4U7ZA 3DCVA 4GJ2A 5HVYA 4TYGA 3T9IA 4ENXA 5JFSA 4FNWA 3JY0A 3LJ2A 3QRUA 4FKLA 2QOHA 2X7OA 4BDEA 4R6VA 5C03A 4J96A 1BYGA 4IM0A 4IM2A 3PXZA 4IWOA 4ZOGA 2XS0A 4GFMA 1NT2A 2XIZA 2VNWA 3PIYA 4E5WA 5KO1A 4ZZNA 5IA1A 5ITAA 3OXTA 5CSXA 3UGCA 4OT5A 3UODA 1M17A 3UOHA 1TKIA 3VWAA 4KS8A 4PDYA 4N6ZA 1YHSA 2P33A 4FV4A 2QCSA 4U41A 4A4XA 3LMGA 3WF5A 5IQIA 3I0QA 2C6OA 2YJSA 2Y9QA 3OG7A 3CBLA 3UO4A 3MH0A 3Q2MA 1H08A 3NLBA 1M7NA 4FK3A 5EKOA 4AA4A 3BELA 4F9WA 4CYJA 1W2DA 2JBOA 3PVBA 2XF0A 2R3PA 4D4SA 3NNVA 4MQ2A 5BMSA 3VNTA 5EHYA 4K18A 1S9IA 2WMBA 4AAAA 4AT3A 4OR5A 5E8VA 5F4NA 3FDNA 4BGHA 1MRYA 1R1WA 3PA4A 3RI1A 2XB7A 3Q32A 3S95A 2JKOA 3W0RA 3CC6A 4BL1A 3II5A 1PYEA 5AUYA 3R00A 4BB4A 3QAME 4EZ7A 2CKOA 2YJRA 2C6LA 3VUTA 5HLWA 3A7GA 4JDKA 1FINA 3TNPC 2VO3A 4BF2A 2WHBA 3MJ2A 5DH3A 3R6XA 4L6QA 4FKIA 3QLGA 4ZSJA 4J97A 3Q96A 3GUBA 2WTIA 3SGCA 2A98A 5D7VA 3R8ZA 4HNFA 4O4DA 4NIFB 4EKKA 3F2RA 2BFYA 2R7IA 3BZ3A 2B9JA 3CQEA 3F6XA 2XJ2A 1MP8A 3FI3A 3OMVA 4IC8A 5DHJA 5DWRA 1Q41A 4HGLA 4R5SA 5DT3A 2XNPA 3FEGA 3O0GA 3UP7A 2OH0E 5CXZA 2GNFA 2HWOA 4FTNA 1YXTA 2GNIA 3TM0A 4CGAA 2C3KA 2GHMA 3EN4A 4RJ6A 5BVKA 4JBOA 4O81A 4D2TA 4FTOA 2OICA 4J98A 4ASEA 3G0FA 3G6HA 5AP2A 4E20A 2Z02A 4ZZOA 4UALA 4BTMA 1QPJA 4E5BA 4IC7A 2WFYA 4ORKA 2X1NA 1V0OA 3MDYA 4NCTA 2GTNA 4BTJA 5DPVA 1JNKA 5CAPA 4WBOA 1JKKA 4CQGA 1ZAOA 2X6DA 2OIDA 3BU3A 4KIKB 3RK9A 4F1TA 2Z7QA 3IW8A 4F7JA 1OIQA 5CEIA 4CTBA 4BDFA 3C13A 5HI2A 1PJKA 4PL5A 1TFFA 4M0YA 2X4ZA 3RAIA 2ZM1A 1T45A 3Q3BA 2W9ZB 3ZZEA 1W0XC 2J50A 4YC3A 3GQIA 1M14A 3ZXZA 4RLKA 3A8WA 1OGYA 5J1VA 5A4QA 4L3LA 5JRSA 2XYNA 3M11A 5LVOA 4DFZE 2WMWA 2QKWB 1Q61A 3MA6A 1K2PA 2X39A 4RBLA 3W0MA 4LRMA 3KGAA 4J99A 2GHGA 1ZARA 3EYGA 4BIEA 5JZJA 4XJ0A 5FP5A 4Z9LA 1GIHA 5JEBA 2BPMA 2OH4A 4NYEA 4CT1A 5DNRA 3TKUA 3TDVA 2VU3A 4MKCA 5EH0A 4Z55A 4NM3A 4DTKA 3UDSA 1WCCA 2RFEA 1J3HA 4BFMA 5L4QA 3HNGA 4U79A 3VW6A 5D12A 4DTAA 1DM2A 2G2FA 2R4BA 2YM8A 2Y8OA 3LFDA 3KULA 1CDKA 1KE7A 5EQYA 4EBWA 2YDJA 4IDTA 4MAOA 1NVSA 4ERWA 2BR1A 2A1AB 5BPYA 3NUNA 5FDPA 4RJ7A 2W1DA 3CSVA 2WMAA 4YO6A 1OKVA 2XJ0A 1G8AA 4EH3A 3MY0A 4ID7A 2W1EA 3DKCA 1Q3WA 5CYIA 1FMKA 2W05A 3QC4A 1UKHA 3ALNA 3UC4A 4W8EA 4RVKA 1ZYDA 3GU6A 3VHEA 4I5HA 4A9RA 1O6LA 4E6QA 3QD2B 3OY1A 4F7SA 5BV3A 4X7QA 2BRMA 2RIOA 5T68A 3UVQA 2EWAA 2F9GA 3UPZA 3FY0A 3WIGA 3Q4ZA 3TT0A 2EB2A 2VX0A 4CLJA 4BCJA 3NUYA 4NIFA 5EQPA 1ERKA 1QMZA 4MD7E 3PFQA 2EU9A 3ZBXA 2ETRA 5A54A 5KMOA 2ZJWA 3EQHA 5EI8A 5FM3A 4UWBA 1ZLTA 3OEFX 3CP9A 3GCPA 1JWHA 3O50A 4MNEB 3BL9A 5CALA 3QKMA 5AV3A 4IBMA 4IZAA 5C26A 5LJJA 3TL8A 5I9XA 4BBFA 4N57A 4II5A 3VJNA 5CSVA 2YLFA 3DFCB 3EN5A 3EIDA 3W2QA 3TZ9A 1JVPP 3QC9A 3V5TA 5DT4A 4I23A 3VQUA 4FV1A 3V6SA 1XH4A 4WD5A 5FD2A 4FSWA 4BDAA 1E9HA 1UNHA 4P5QA 4O7WA 3DKGA 5EQEA 3C4XA 5H8BA 1WMKA 5AWMA 3EH9A 4DBNA 4E93A 2FO0A 3HAVA 4EBVA 4YSJA 4V0GA 4L3PA 3GXLA 3A60A 3KL8A 4FYNA 4XG3A 5J8IA 3AD4A 3IECA 3KCFA 3MH2A 5JQ8A 4LV5A 2X9FA 3NS9A 5M09A 2V7AA 4FL1A 2BZKB 3ZLYA 2VWYA 4BDHA 2WIHA 4E26A 5IPJA 3KIOC 2C5XA 4LQMA 5HO6A 2QONA 2R3OA 2XK3A 3HUBA 4GJ3A 3F3WA 5GNKA 2WMXA 3D5UA 4IQ6A 3NIZA 4PDOA 4YHTA 2DYLA 5AUXA 3LKMA 4PP7A 5TR6A 3QQFA 3MVMA 3RVGA 2ITTA 1IG1A 3UNKA 3CS9A 1Q4LA 5FGKA 4E3CA 3CTJA 4ITHA 4QP4A 2YIYA 1SNUA 3OWKA 4AXFA 2G2IA 3O8TA 2QU5A 3EJ1A 3KRJA 4H1JA 4DG3E 2OZAA 3FJQE 4S31A 1H01A 1UU7A 2XKFA 3C5UA 1F5QA 3HV5A 1X8BA 3LCSA 3NCZA 3VUDA 1UU8A 3IW6A 4S2ZA 2PVFA 4XP3A 3ZDUA 2Z8CA 5T3QA 3WYYA 5AAGA 3S00A 4FBXA 2E9OA 3F3TA 1H25A 1F0QA 4XG2A 2YIQA 4RC4A 2W1FA 1H0WA 4F6WA 3TUCA 3ANQA 4PQNA 3LCDA 4KS7A 4LYNA 3QTRA 5M53A 3QZHA 3QFVA 5L6WL 2OFUA 3F5PA 4HGTA 4M69A 4RC3A 3W32A 4P4CA 4ANOA 2I7QA 3HP5A 3LFQA 4GVAA 2H96A 4F7NA 2QOKA 5IA3A 4AOIA 4FK6A 4IVAA 3D14A 2WTKC 4C2WA 4O21A 4MF0A 3S1HA 4U44A 4RIOA 3GT8A 3QD3A 4TPTA 3GENA 3NNXA 3CPCA 4IAAA 2WXVA 3QUDA 4DLIA 4PPBA 4EC8A 4RQVA 1Y8YA 2ITVA 2UW9A 3KXGA 3UQGA 5LCKA 3HEGA 3LXLA 5AP6A 3T9TA 4AN3A 3IG7A 2R3KA 4LRJA 4AE9A 4AT4A 4FL3A 5EOBA 5HESA 3VO3A 3H3CA 3LMIA 5AM7A 2PE0A 4YO4A 2BUJA 3C4ZA 2B53A 4RVLA 1M52A 2YCQA 3COMA 4KKEA 2B0QA 5CU3A 3V3VA 2IW8A 5FXRA 3IO7A 3VIDA 4E8AA 3ZCLA 1IRKA 3VUMA 4MXXA 5J9ZA 3GQLA 3RWQA 5CF8A 2X0GA 3SOAA 3ZONA 1Z9XA 3O51A 4UYAA 1GJOA 2CN5A 2DQ7X 2X0OA 2B1PA 3L1SA 4EJNA 4FEUA 3R8VA 3PPZA 4R5YA 4FKOA 1XQZA 1OB3A 5I9UA 3QA8A 5EYCA 3RWPA 3BHYA 2J0JA 5M51A 3TUBA 3NVKI 4NU1A 2PSQA 3CIKA 1HCKA 2PUNA 3TYKA 3BWJA 3E7OA 3NRMA 5ANEA 3W2CA 2I0YA 3QYZA 3U54A 3D0EA 4CSVA 1XH6A 3E8NA 2QVSE 2R3RA 3P79A 3QQHA 4P2KA 3W2OA 4AF3A 4ERKA 4UMPA 5I9ZA 3IDBA 1ATPE 2OBJA 1FOTA 2ITXA 2WOTA 4LL5A 1GIIA 3BBWA 1WBPA 3E3PA 3QRTA 3GU8A 1U5QA 3VS3A 2VD5A 1PXMA 1WBVA 3PPKA 1U54A 3OWLA 3PY3A 5JSMA 1LEWA 4ACCA 3VULA 5E92A 4EKLA 3GCQA 3QZGA 4XMOA 5E4HA 1JKSA 2BZJA 4TNDA 4EHVA 3FHIA 2GU8A 4IWPA 4AN2A 3DKOA 4GIHA 5IQEA 1ZMWA 4ACGA 4DHJA 2BROA 4OGRA 4K33A 5LMKC 4H3QA 4RWKA 3W0PA 4NM0A 4KIOA 3VC4A 4APPA 5HZNA 5IU2A 1UU3A 1ZY5A 2IWIA 3HGKA 3KF7A 4MXZA 4KUJA 3WZUA 5J79A 4FKWA 2PHKA 4QPMA 3DGKA 4C4EA 1Y8GA 3QUPA 5B0XA 4M15A 1B39A 5CF5A 5JN2A 4RFYA 5EYKA 3F82A 2BCJA 4BDJA 1YOLA 3NYNA 3MS9A 2PE2A 2QG7A 3C4WA 2BDFA 2UUEA 4DN5A 2HAKA 3I79A 2NYAA 3LFFA 4AZEA 4O0UA 4DCAA 5JFXA 1H07A 4AP7A 5JH6A 1VZOA 2BILB 1OUYA 4IAYA 5TKDA 3BLQA 3O8UA 5DI1A 2PUIA 2JITA 1FVTA 3G90X 1IR3A 5DLSA 3SXSA 2OJJA 3ZYAA 4CKIA 3N4TA 4ZSEA 4C7TA 3H4JA 3FZOA 3F3UA 1KOBA 4O2PA 1URCA 4DTBA 4BCFA 4XUFA 5AX9A 1GOLA 4L45A 1MRUA 4IWQA 4APCA 4QTEA 3RP9A 5LMBA 3R2YA 4WNPA 3QQGA 4CFNA 1ZZLA 2RKUA 4BYJA 2JAVA 3CKXA 1XHAA 4O83A 2VWBA 4DH8A 1RJBA 4BWKA 2EVAA 4F4PA 5FEEA 4X3FB 4K0YA 2Q0BA 3KQ7A 3UG1A 3PG3A 3TZ8A 3EQDA 4YPDA 4CCBA 4EOKA 3U6JA 1PXKA 3PA5A 2NP8A 3R8LA 4MX9A 3WE8A 3FXWA 4NKSA 4M84A 4A9YA 4O4CA 2J0IA 5IQBA 5G1XA 5EG3A 1M2QA 1GZ8A 2UZLA 2XM8A 5FWKK 2F57A 3SG9A 1R78A 4QRCA 4I92A 5CZIA 5AUUA 4FSQA 2ERKA 4OTDA 5HTBA 2XBJA 3A7JA 4LGDA 2OXYA 4I5PA 1ST0A 2A4LA 2CKEA 4C4HA 3DV3A 4BDKA 5E8WA 4GH2A 3E88A 4E6DA 4O7RA 2J51A 1FMOE 5CS6A 3DK6A 2YAAA 4OTPA 5HU3A 2QHNA 3FMJA 5CI7A 2XANA 4IAKA 2XIXA 3S4QA 5ANDA 3LQ3A 2GTMA 2R3GA 2CNQA 3U87A 1I09A 2P2HA 3I6UA 4L00A 1KUTA 3FZSA 4RG0A 1OVEA 3L9MA 2Y4PA 4A7CA 5KX8A 1FBNA 5HE1A 3FPQA 1G8JA 3FE3A 4ZK5A 5DBXA 3K54A 1E1XA 2WMRA 4FGBA 5CAUA 3HDMA 3DB8A 4ONAA 3HV6A 3MTLA 3F3VA 3R02A 2BRNA 3Q6WA 4K9YA 1KE8A 4CV9A 4ZTMA 5GIOE 2NPQA 4YJVA 4XBUA 4TN6A 3RINA 2Y7JA 2ZB0A 4FKPA 2C3JA 4YUQA 4BI1A 4BWXA 3TTIA 3UZRA 3TV6A 4QTAA 2YERA 3D9VA 1J1CA 3E92A 5CLPA 3R71A 4M8TA 5ANKA 2Z7RA 3ZO1A 3P0MA 3NEWA 4BCKA 3S0OA 4ACHA 4FMQA 4JL9A 3LM5A 4I21A 5AAFA 3A7IA 4Q9SA 3DBCA 4FTMA 4JXFA 4NM7A 4TWPA 1DS5A 3BBTB 4YJOA 1MQ4A 4CFFA 5LVMA 2RL5A 4DAWA 4FSMA 4QMXA 3MW1A 4QNYA 2JGZA 2YM6A 3GGFA 3OCSA 4FODA 4YJTA 2PVLA 1R0PA 2JKMA 4PL3A 1FVRA 3HYHA 3KK8A 1R0EA 5BVWA 5I0BA 4EYMA 5LQFA 4RX9A 4P5ZA 2WMSA 4JX3A 3P78A 4EWQA 1URWA 3KXXA 3WF9A 2DWBA 2R64A 1KWPA 2VTLA 2EXCX 2ZV2A 2C5YA 4ZSGA 4IVBA 4PP9A 5A14A 4HYUA 3RZFA 3HMMA 4L01A 4RA5A 5BMMA 3EZVA 5L2TA 3UNJA 1FQ1B 4XG4A 2WIPA 5AR8A 4BHNA 5M06A 4H1MA 1Q5KA 4FTLA 5E8UA 3ZZWA 4D28A 4AA0A 1H28A 4AW0A 3Q52A 2UVXA 2BMCA 4D55A 1HCLA 3SQQA 3SXRA 5AR5A 4BVUA 4QTBA 2B4SB 2ZVAA 4EOIA 4WRSA 1W8CA 3NNWA 3EKKA 4DEBA 2HZNA 4AGWA 4BKZA 3FMNA 2JLDA 3NNUA 1A48A 4QYYA 4C4FA 4CFVA 4NL0A 4FTAA 5IH6A 4BY9E 5DR9A 2C4GA 3UMXA 2IJMA 2FA2A 4IZ7A 4KD1A 4F7LA 3KC3A 4DE4A 3VBTA 5CNNA 1QPDA 4E5AX 1ZYJA 5IMXA 3BU5A 3Q4CA 3BYSA 2W9FB 4KKGA 1PY5A 4QD6A 5LXMA 4HCTA 2CGVA 4MXOA 4EOJA 3MH3A 3PPJA 4IAFA 4ANSA 5LVNA 4QTCA 3FYJX 3O7LB 3F66A 3PE1A 2G01A 3I60A 4D1ZA 4GKHA 2CJMA 3OF0A 3UJGA 3OVVA 4ALVA 3LW0A 4FEWA 1O9UA 4IAZA 2XNBA 4AQKA 3DXPA 1GAGA 5CSPA 3VN9A 3TKHA 2XEZA 3FY2A 4M68A 5IISA 3ITZA 3DBDA 4D1SA 2PMOX 3NFFB 4QNAA 4GK2A 3IDCA 3GU7A 5M4UA 2CHLA 3V5LA 4AXAA 3N9XA 3TNQB 4Y85A 3W2PA 1XH7A 3ORIA 3QX4A 4NKAA 4Y8DA 2PTKA 5J9YA 4DLJA 1NVRA 2PYWA 3PXQA 3BHUA 3BHVA 4N0SA 3FLQA 4JR3A 4FIEA 1ST4A 1Q8YA 3JYAA 4AZWA 4BDIA 4C33A 4EH2A 1YXVA 4ZTHA 3A7FA 2LAVA 4A07A 4I41A 1SM2A 5DRBA 2FSLX 4C34A 5B2MA 4C38A 5FLFA 3PZEA 1J7IA 4D0WA 2HYYA 4FZFB 4QMMA 5HBJA 2VTMA 2XVDA 1ZMUA 4FTJA 4UEUA 4AAYA 2GNJA 2YIXA 4QOXA 3W55A 4EK3A 1CM8A 3HLLA 4U9AA 5EM8A 3CY3A 3LXPA 5M08A 1P5EA 2HW7A 1WVWA 2OIQA 3T3UA 4ACMA 4BIDA 2J0MB 3BLAA 3N4VA 1YW2A 2C0IA 4IZYA 4O96A 3KVXA 5CT0A 5CAVA 3O23A 3U9CA 2ETMA 4XG8A 4PTEA 2Y6MA 2V62A 4FSYA 4DINA 3RBWA 3KREA 3NZ0A 1ZOHA 5E8XA 4DEHA 4HVDA 4M97A 4PMPA 4TTHB 1KE5A 3A2CA 5DIAA 5HO8A 2BAQA 3DTWA 2JD5A 2X8IA 4IAIA 2W1ZA 4O27B 4BN1A 2XNOA 2IW6A 4W9XA 2GPHA 2UZOA 4PRJA 3U4UA 4GRBA 3SW7A 1BL6A 4UWYA 2OJIA 4TRLA 3QHRA 3GBZA 5DRDA 4JOAA 4JLCA 4ZLYA 4G2FA 5F9EA 2ONLC 5I5ZA 4UXLA 2YM4A 3R04A 2VAGA 4H58A 4OTQA 3RJCA 3VS5A 3AD5A 5AMNA 3WF6A 1SVGA 2XCHA 2WQNA 4R3CA 5HBEA 2W1GA 4ASZA 3U51A 2NO3A 3ERKA 1H0VA 1G8SA 4EONA 3K5UA 4MD9E 2BHHA 4O2ZA 4C02A 5KBQA 2GS2A 5ANGA 3KMUA 5AIKA 4IB3A 1XWSA 3DLSA 3VUIA 4ZAUA 1KSWA 4QMUA 2X81A 3ZMMA 5E8SA 3LFSA 5IQAA 3H9OA 2OF2A 4IX4A 4C35A 1E1VA 1YOMA 2UW8A 4XHKB 4KIQA 3FLYA 2J4ZA 3MWUA 3P23A 1W98A 2OZAB 3EB0A 3UC3A 3UG2A 3AKKA 3OBGA 4N70A 3HRFA 2F7ZE 3UYSA 2HY81 3UZPA 5I9WA 1YI4A 5D1JA 2WD1A 2SRCA 3DNEA 4KIPA 1OI9A 1ZMVA 1ZOGA 5EFQA 3RAHA 4CZYB 4QYGA 1H27A 3MI9A 3OCBA 3I6WA 3Q6UA 4GFGA 4JBQA 5EM6A 5LWMA 3SVVA 3L9PA 4X3FA 4Y73A 2PPQA 3EQGA 4KABA 1OITA 2WTKB 4O91A 4MWHA 4QP3A 3HMNA 3O96A 3OXZA 2YLEA 3OHTA 5JKGA 4DFUA 2OI4X 4YBKA 4ZS4A 4PTCA 4KSPA 3H9RA 3S2PA 2QU6A 2C3IB 3I5ZA 4HZRA 4NT4A 3C4CA 4O0TA 5IA0A 2IW9A 2ZV8A 2HY0A 1ZYSA 4FV7A 4D58A 1YHWA 3R83A 3UMWA 2FH9A 5HCZA 4CRLA 2GNGA 1QCFA 1Z5MA 2IVUA 1PXNA 3AG9A 4NFMA 4NH1A 4WSYA 3P86A 2A2AA 3KXZA 4M12A 3E62A 3B2WA 3GNIB 1XMLA 5IQGA 4OBQA 2ACXA 2JDTA 4F6SA 2QNJA 3VF9A 4LL0A 4RIYB 5DG5A 1K9AA 2ZDTA 3U6IA 3IQ7A 2Z60A 4KNBA 4TKSA 5EM7A 1OBDA 3ZTXA 4NEUA 3G9LX 4WUNA 3PY1A 4K6ZA 2XA4A 2B52A 3N4UA 4JDIA 2UZVA 4A06A 2WMUA 4BKJA 3NSZA 4C59A 4DGNA 4LDTA 4ZTRA 2FSTX 3OUKA 4RVTA 4KWPA 3P1AA 5M4IA 1STCE 1Q24A 2PU8A 1G3NA 5EK7A 3ULZA 3KRWA 3QCSA 4F70A 4DHZA 2QKRA 5HE0A 1H1SA 1Q8WA 4L7FA 1Q8UA 3BRBA 1UKIA 2BZHB 4GW8A 3FMMA 3QTZA 4CNHA 3D83A 4XOYA 4EH9A 3WF8A 3DAKA 4OBPA 2BHEA 1YI3A 2GQGA 2GFCA 3AT4A 4FNYA 2PUUA 1OKWA 4FSUA 4CVAA 5L8JA 3L8XA 4C62A 3B8RA 3HV3A 4GUEA 5DR2A 2C5OA 2Q0NA 2E2BA 3F3ZA 5IH5A 3W0QA 4JAJA 5BYZA 3VBXA 3W0NA 3MB6A 3QCYA 5L6OA 2XAOA 4BCOA 4DYMA 4D1XA 3SRVB 1CMKE 3R7OA 4W4YA 3VRYA 4EJ7A 4PMTA 1PMNA 2XP2A 4ZS0A 5B2LA 4UMQA 4QTDA 2FYSA 4YLLA 4BTKA 2W4JA 2B54A 4K8AA 3S3IA 4C0TA 3MESA 3E8CA 2QOOA 4DC2A 5DT0A 3LFEA 4U0IA 4Q9ZA 4YZCA 3R1YA 4UMRA 1ND4A 4YNEA 4MVFA 4BIBA 5IKWA 1VJYA 3OW4A 5BNJA 3W2SA 5EOLA 3GC8A 2VWUA 5D11A 5C9CA 3KEXA 4DT9A 3NYXA 2R9SA 3LE6A 4IJPA 5F1ZA 3JY9A 5A4EA 1U4DA 4FYOA 2X7GA 3QTSA 4RX5A 3PXFA 3OROA 4JG8A 3FLNC 3Q4UA 4XX9A 4YZBA 3RPSA 3VUHA 2WQEA 2J9MA 4QMLA 3PP0A 5CVFA 3E63A 1NW1A 2P4IA 3V51A 4QEBA 3ZC5A 4JRNA 4Y83A 5KMNA 5J95A 4BI2A 1OL1A 1ZOEA 3TWJA 2ZYBA 4I0RA 5CSWA 4ZP5A 4EQCA 1S9JA 4GYIA 4C36A 2YM3A 3MFTA 5IG1A 3AC4A 4RX8A 1W2FA 3PXKA 3NVMB 3FI2A 4YSMA 2GHLA 4RFMA 5H8GA 4Y46A 3O71A 2JIVA 3OUNB 1WBOA 4O4FA 2XZSA 4W9WA 4AFJA 4MXCA 3FC2A 3KMWA 2I0VA 3W0OA 4RMZA 2PULA 1BMKA 3EN7A 4WUAA 4HGEA 3D5XA 4I1ZA 2OLCA 1TQMA 4E1ZA 4KAOA 3ZFMA 3DAJA 2AUHA 1CTPE 2CGUA 2GMXA 3BX5A 3FHRA 3ZFXA 5AP1A 4OTWA 4NFNA 1YOJA 1XO2B 2HIWA 4R3PA 4ZLOA 3QTXA 2YDIA 1RE8A 4O7NA 1OKYA 4EOOA 3D7TB 3NCGA 3DY7A 1H24A 2IVVA 3HMPA 5ETIA 5CU2A 4D2VA 4CQEA 2WKMA 4DFYA 3TEIA 3DAEA 5E8ZA 4BR3A 2XCKA 2VTPA 4MEDA 1H00A 2OXDA 4LFIA 1UA2A 5DEYA 5IEVA 2KULA 3PUFC 4DBXA 4G6OA 2F7EE 5CZHA 3BHTA 1MRVA 1IEPA 3FKOA 3U9NA 3TIZA 2BFXA 3VBYA 2JKQA 2JDSA 1PXOA 4H36A 2P55A 4EOQA 5E90A 1JQHA 3FZRA 4BGQA 3Q9ZA 2VTRA 1JKLA 4TNBA 3RZBA 2CGXA 1BI7A 2G2HA 4GT5A 3UOLA 4OTFA 4QQ5A 4CD0A 1DAWA 3AXWA 3NAYA 2PVKA 4GKIA 2REIA 3BCEA 1EH4A 3P7CA 4YJUA 3TXOA 3ZOSA 4CRSA 4LOPA 4Q5EA 5BVFA 3R22A 3SG8A 3UDTA 2LGCA 5FG8A 3HL7A 5H8EA 5EDRA 4I6HA 4FEXA 4RT7A 3F88A 1GY3A 5EW8A 2OKRA 4WA9A 4NTTA 3P08A 4B9DA 4EOSA 4IADA 4DHFA 4IM3A 3COKA 2G15A 5EI2A 4OUCA 3Q9YA 5HG7A 4YU2A 1UU9A 2WTDA 4Z7HA 5CEQA 4N4SA 2A27A 4IX3A 3DLZA 2X7FA 1U5RA 3M42A 3OW3A 1FVVA 3D2IA 2VWZA 2V5QA 3H0ZA 4J7BA 2PZRA 3EL7A 4TXCA 5IH4A 1PRYA 2GQRA 2RFSA 2OXXA 4CFWA 4CKJA 4GG7A 4J1RA 3IDPA 3ULIA 4IB1A 1A06A 3EFJA 2XRUA 4FV3A 4D4YA 5AP7A 4WG5A 4F64A 4GMYA 1OZ1A 5K5XA 1YHVA 3AC5A 3E8EA 4TY1A 4F0GA 4JAIA 2C6EA 2OWBA 4ZMFA 5L6PA 4ZY5A 4EHEA 3PXRA 4G3EA 1P4FA 4G5JA 4MD8E 4ZY6A 4I6QA 3V5JA 3CJGA 4JIAA 4AZVA 2OZOA 4AW1A 4DFNA 5FTQA 4EZ3A 4OLIA 2E9PA 2C1BA 4JNWA 5FEDA 3R8PA 3DZOA 5CY3A 4DG2E 3ET7A 4QP8A 3ZRKA 4EC9A 2QOFA 5TOZA 5HIEA 1J7UA 2R7BA 2Z2WA 1OIRA 2WAJA 1DI8A 3EFLA 3TV7A 2HZIA 3D15A 1FGKA 5M4FA 2OG8A 3OCGA 4AFEA 2PY3A 1KE9A 1OPJA 2X9EA 3NGAA 1RQQA 1OIUA 4NM5A 5BUIA 3FL4A 2R3JA 3NW5A 2XH5A 3PG1A 3IOKA 4QYEA 3V8TA 4D5KA 4HVIA 2ITZA 3F5XA 1MQBA 3ZSHA 5KBRA 4FE2A 2QLUA 4P7EA 5FDXA 5K9IA 1XJDA 1OECA 3WZJA 4C58A 3KRRA 2VTQA 1J1BA 2C69A 3OFMA 3I4BA 3VS1A 4G3CA 3R8MA 4R8QA 1BKXA 3QYWA 4RJ8A 3RPRA 4CMUA 4U40A 2PL0A 2XYUA 3PTGA 3RM7A 3MSSA 5CEMA 5ANJA 3B2TA 3LFCA 4F1OA 4U6RA 3ORLA 4YMJA 5HVKA 3JXWA 2XK6A 3PE2A 1UWJA 3GU4A 4L9IA 4G3GA 2JDVA 3RNIA 3DXNA 1QPCA 3Q9WA 5DYJA 3NUUA 3TUDA 3CGOA 3FQEA 5JZNA 5CASA 4EH6A 4FF8A 4QMTA 3OS3A 3I5NA 2ZAZA 5I3OA 4ASXA 3TNHA 2XARA 5J87A 5EHOA 2BTRA 3ALOA 5J7BA 5GIPE 4ASDA 4ZSAA 2FUMA 3UTOA 5DFPA 4GEOA 3OCTA 4CFXA 3LFAA 3QCQA 4LM5A 3L8VA 3VJOA 5KHWA 2PZ5A 1W83A 4MXYA 1P14A 5AJQA 2QO2A 3CPBA 2YWPA 5LOHA 3LJ1A 2ZMDA 4EI4A 5CEPA 4KBKA 4NWMA 5K5NA 3GC9A 3SW4A 5L8KA 5GZ9A 1W82A 5IA2A 3HVCA 2HCKA 2PVJA 4LUDA 2VGPA 4XBRA 4RIXA 3ZO4A 2J2IB 2UW4A 2XUUA 2XK8A 4F63A 3QWKA 4BWPA 4I3ZA 3Q53A 3W16A 5CANA 2C1AA 3FZ1A 3KXNA 4DGLC