4X3JA

Selection of fragments for kinase inhibitor design: decoration is key
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
280
structure length
234
Chain Sequence
VLKARMDAAIKELEVLCKLGHHPNIINLLLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRNLAARNILVGENYVAKIADFGLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
publication title Selection of fragments for kinase inhibitor design: decoration is key.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 234
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4x3jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4x3jA01
4FKUA 3EN4A 5LXMA 1YXVA 2H8HA 3PXFA 2QOOA 1BI8A 5EYDA 4BI1A 4XRLA 1YXSA 4F64A 1Q8WA 2QG5A 3BEGA 4FYNA 4JDJA 5AAEA 3ENHA 4BZDA 2YERA 1PMUA 3KC3A 4X2GA 4EK4A 3NNWA 2R3JA 3S1HA 4FNYA 5CAVA 2R5TA 5I9UA 2R3HA 4FTAA 2CSNA 3F5GA 4G3GA 4NZWB 4BC6A 1H1QA 4D4YA 3PIZA 1MRUA 1XO2B 3GQIA 4DG2E 2OJGA 4MYGA 3L8VA 3UMWA 2NP8A 4QTDA 2A2AA 4TNDA 2QC6A 4FV8A 3UNJA 2OH4A 5M44A 1G8SA 3F9NA 5J9YA 1SZMA 3DGKA 5DT3A 5AV3A 3UC4A 3QZGA 4LYNA 3NR9A 1WFCA 1ZYCA 2XK3A 5DT0A 3TNHA 3KQ7A 2XNPA 3F5XA 4LFIA 1S9JA 3UPXA 1ZYSA 4BDJA 4DT8A 2XYNA 3U4UA 4RA5A 2C3JA 4M67A 1WVYA 3LKMA 4C3FA 4YZMA 3S00A 1OITA 3H0ZA 5AUVA 4C4IA 2Z2WA 3LFQA 3P9JA 4UY9A 4TTHB 4AGWA 2JKMA 3WYYA 3LQ3A 2O2UA 3SXRA 3LMHA 3HECA 5A4LA 3ZUVA 4B9DA 1PKGA 5ITAA 4FC0A 5HG8A 5JRQA 4NU1A 3ZXZA 3JVRA 2X8DA 2QOIA 4FV7A 2R2PA 1URCA 3C0GA 4F6UA 5CVHA 3NNXA 3LVPA 5E1SA 3ZC5A 2UZBA 4WHZA 3DBEA 4KKGA 5KX8A 5M51A 2ZDUA 2VU3A 2UUEA 3RGFA 3TV4A 3NUUA 4BIEA 3I6WA 4FV5A 4QRCA 4A9YA 3FLSA 2HAKA 3LHJA 3NCGA 4FBXA 4RIOA 3GOKA 2QI8A 3BYVA 2BZJA 4RIXA 3RNYA 5A46A 4HGLA 4DEAA 4UMPA 4FV0A 3MN3A 4ZTNA 4QMVA 4AOTA 2CLXA 3R73A 2YWPA 2C5XA 2W9ZB 2X0GA 4U97A 4KBKA 5IMEA 3JY9A 4RJ4A 3NAXA 4UXLA 4EYMA 1IA9A 1H25A 4EBWA 4CRLA 4GS6A 5EI2A 2B0QA 3QTRA 4K33A 2GNJA 2PPQA 1WZYA 2P3GX 4I41A 3R9NA 3GU5A 2DWBA 5D9HA 4EORA 4HZRA 2JD5A 4G9RA 5DVRA 5DMZA 4A06A 3FSFA 1T46A 2XIRA 3VHEA 3FLZA 3QCXA 4CTBA 2JGZA 2R3GA 3VJNA 5CSVA 3ATTA 2PSQA 2VWZA 5FP5A 3ULZA 5I3RA 3PE1A 3H4JA 4O7VA 4ORKA 2J5FA 2PZ5A 2YDIA 5IU2A 1UKHA 3GFWA 4NW6A 4DEHA 4EJ7A 5M4UA 3F7WA 2ZV2A 3Q53A 2SRCA 3WF6A 1Q8UA 5CEQA 3DAJA 1QCFA 4K18A 4EH6A 2CKQA 3LCOA 3LW0A 3V04A 3EYHA 4N4SA 3BYMA 5AJQA 5EYMA 2I0HA 5HLPA 3WI6A 3TKUA 2VWWA 3DV3A 4XV1A 3LQ8A 2XS0A 4OTDA 4UWYA 3S3IA 4FTJA 4GKIA 3NYNA 3W2SA 1OVEA 3DTWA 3VBVA 2X39A 4FEQA 3UYTA 2B53A 2PY3A 3EQBA 5HLNA 5JGAA 2VGPA 5GJGA 2OI4X 2XF0A 3OY1A 1WBSA 4QYEA 3R7YA 4FEUA 3GU7A 5KMMA 2QOCA 4HCVA 2VTNA 1YXUA 2P33A 4NFNA 4XCUA 5DNRA 1YI4A 4U7ZA 3MESA 3PRIA 1ZY5A 4BWXA 4EQUA 2Y6MA 5EK7A 4RIWA 4RIXB 2C47A 4OTFA 5EKOA 4F7JA 4JG7A 3ZO2A 4AW1A 3FAAA 4ZJVA 3C50A 5H8EA 2JIIA 3ZS5A 1UNLA 3N4TA 1R39A 4EKKA 1FMKA 5DN3A 3GU8A 3HV3A 3QQKA 3V3VA 4IVAA 4E20A 2YCRA 4L45A 3FKOA 2XKDA 4FTTA 2ETKA 3D5XA 4FMQA 4YHJA 3C13A 5ACBC 5JQ5A 3D7ZA 4AQCA 2Z02A 3R2BA 2QKWB 2XIZA 4O86A 3F82A 2OBJA 3KN6A 4EH5A 3R8ZA 5DEYA 4PF4A 3SV0A 4BHNA 1P4FA 3A7IA 4F7NA 4M13A 4EOIA 4QD6A 4ZS4A 2VTLA 2VO3A 3BZ3A 5A4EA 4YTCA 5CAPA 4XEYA 3UZRA 4L3PA 4TT7A 4V0GA 4Z9LA 3VC4A 3KKVA 3MIYA 4QTAA 3GC9A 3PIXA 4HOKA 3JS2A 2WMQA 4F9YA 5BVOA 4ZS0A 4XG8A 1M17A 3OWPA 4CXAA 4FKPA 3E64A 1OM1A 4JQ7A 5CY3A 3UE4A 3TKHA 4MXZA 4DGMA 5E9EA 4C2VA 4LMNA 2CCIA 3Q5ZA 3UVQA 5IUHA 1ZYDA 3F3TA 4XG2A 4D58A 2YM7A 3NMUF 3QXPA 1GOLA 4QYGA 2VWIA 2E9UA 2W1DA 1OKWA 2REIA 4W4XA 5FM2A 4KRDA 2PULA 2IN6A 2WPAA 2YA9A 4FTIA 2F9GA 1WVWA 4RC3A 4E6CA 4EL9A 4M8TA 4ID7A 4RQVA 5AR8A 1P4OA 4IWPA 4RLLA 3OCSA 3Q4CA 2VTHA 4DFXE 2HK5A 4BCGA 2BZHB 4EONA 3KVXA 3G9LX 3OOMA 3Q04A 3Q4ZA 4RWIA 3FLYA 4FV4A 4GUEA 2OF2A 4RIWB 3CSVA 1L3RE 4LL0A 3R02A 5HHWA 3RAKA 2C1AA 2C5OA 4Z7GA 2UZUE 3F3UA 1W8CA 3HX4A 3KL8A 2HELA 4FG8A 3ELJA 2GQSA 2ZB1A 4FIEA 3QTQA 5HCXA 3Q2JA 3KN5A 4U43A 3LFEA 4NM5A 3D5UA 5DWRA 4MD9E 2GS6A 2I1MA 2WEIA 4W8EA 4B99A 5HLWA 4QMTA 4DEDA 4X0MA 4FT9A 2HZ4A 3F2AA 5FM3A 3L8SA 3WF8A 1PJKA 4D4VA 4YZ9A 1V0BA 2J9MA 1H1RA 4WNOA 4CFWA 3UGCA 3GP0A 4QQ5A 3VULA 5E1EA 3TL8A 5IDPA 4AT5A 5KE0A 2XB7A 3PPZA 3UBDA 5AUTA 2F7EE 1E1VA 2J90A 5HO6A 2CNUA 4V0GB 2W1GA 3GU4A 4Y8DA 3EIDA 1U46A 3DBDA 4UBAA 3UVPA 2P2HA 4F63A 2YIXA 3F7ZA 4KINA 3PSBA 4C36A 4PMTA 4G9CA 1OPLA 2B4SB 4EZ7A 3RK9A 4QMZA 2ACXA 2FSTX 4CZTA 3VBYA 3WYXA 5GIOE 5C27A 3E3BX 4NKAA 3LFCA 3EHAA 4EOLA 5M57A 4JXFA 4X2FA 3KRLA 5AIKA 1ZYLA 5CZIA 4B0GA 5FG8A 4F4PA 5L2SA 4QP8A 4FGRA 1ZY4A 2YEXA 5GZ9A 4TL0A 3RWPA 2C30A 2BRMA 5HO8A 2FSOX 4EOKA 1IAHA 4O84A 5M07A 4QMQA 2BDWA 4HZSA 3E8DA 2XKCA 2VRXA 2VO6A 3GBZA 5IPJA 5K4JA 4NEUA 4AUAA 4F6WA 1PYEA 3HA6A 4ANQA 2Z7LA 5TKDA 4B8MA 3G0FA 2RG5A 4QMXA 2GSFA 3IKAA 4GJ2A 4RFYA 3LPBA 4LV8A 3TIYA 4H05A 2Y4IB 4DC2A 1BX6A 5FP6A 3WZUA 4EOMA 4IX5A 4NT4A 4F65A 2Q0BA 5CALA 2ETRA 3D15A 3F5UA 3KF7A 3MBLA 3O7LD 4FOBA 3ITZA 5AIRA 3RMFA 3ZSIA 5CF5A 3QTIA 4CKRA 2X6DA 4YNOA 5CS6A 1Q3DA 3OC1A 4II5A 2BR1A 4DEGA 4EYJA 2J50A 1EH4A 2W05A 2WMAA 3IG7A 4L52A 3BGZA 2WHBA 2PE1A 3R8LA 4RZWA 3FLWA 4KIQA 3RK5A 2C4GA 3R1NA 4I5CA 2RKUA 2UW5A 4I1ZA 1Q8YA 4BKZA 4TWCA 3ZCLA 1K2PA 3PWYA 2C6OA 3GNIB 2YWVA 3MIAA 1DAWA 2F2CB 4TPTA 2DS1A 3DDQA 2VTQA 5B0XA 1SVGA 4BKYA 2WIPA 4RSSA 2VO7A 3G51A 4U44A 4F08A 1BKXA 2DQ7X 2WQNA 2W7XA 3BE2A 5EHYA 3A99A 3Q6WA 4YHFA 2BZIB 3UMXA 1NT2A 4YJSA 4M7IA 1DI8A 2FSMX 2UV2A 5EHLA 3ZRMA 3VF8A 4DN5A 3LCTA 4F1OA 5C4LA 1QPDA 2RFNA 4CFUA 4LOOA 2WXVA 2NRUA 5IA0A 4QP9A 5IQHA 3DBFA 1JKKA 4ARKA 4CCUA 2DUVA 2VTIA 4J1RA 1WBNA 4PPAA 2VNYA 1FVTA 1YQJA 4K9YA 4HVIA 3JY0A 5CSWA 3DFAA 3EQHA 1TQIA 1YVJA 3DOGA 4E7WA 5AUUA 5BVDA 4WO5A 1V1KA 4JQEA 4O2ZA 4AW5A 2XZSA 4JQ8A 4WT6A 4IB3A 4FYOA 3UTOA 2X9EA 2O0UA 3AC5A 3U87A 3I79A 5GINE 1CMKE 3R7EA 4EHVA 4BICA 3NW5A 3F6XA 4FZFB 1OPKA 3ACJA 1PKDA 4XP3A 1ZXEA 3QRUA 3RI1A 1OKVA 4I6BA 1FVVA 3RNIA 4D5KA 4RX8A 4AX8A 3UOKA 4IANA 1Q61A 4QTCA 3PG3A 4Z7HA 3E87A 2XEZA 2QCSA 4G5JA 4Z3VA 2OO8X 1Q8ZA 2QNJA 5L6OA 5B2MA 4K8AA 1JSUA 3SLSA 2ZOQA 3EJ1A 3ZXTA 2UW8A 2WTCA 3D83A 2B9HA 5IQAA 5D41A 2C6EA 4ALWA 3NCZA 4S30A 4O0UA 4EC8A 3LQ5A 1IRKA 3UQFA 3EFWA 4ZJJA 3W10A 5ICPA 1CKJA 4TKSA 4CFXA 1IG1A 3DT1A 4KA3A 1XH4A 4IX6A 4C7TA 5JKGA 2QHMA 3I5NA 2QR8A 5BYLA 4BTKA 4JRNA 2JC6A 3GXLA 4MEDA 4Y73A 4XG3A 5AP3A 4M14A 5IA4A 3PXZA 4ZSJA 2OKRA 3CPCA 4R5SA 1JSVA 1R0EA 4BTJA 1R78A 4CLIA 4G31A 1GZKA 2HWPA 4E6AA 3V6RA 2BDFA 3DXNA 3LMGA 4OGRA 3R8VA 3VS2A 5KMLA 3C4ZA 2R3KA 4BCQA 1ZMWA 3IO7A 3KFAA 4QNAA 2BFYA 3ORTA 3QUDA 4O82A 4QMNA 4WSQA 4ACCA 4HVSA 2AUHA 3P7AA 1TKIA 5I4NA 4KKEA 4OT6A 3FXZA 2R3FA 1YXTA 3OW3A 4TYHA 4ALVA 3P7BA 1XH6A 2R3MA 4LOQA 5HNGA 4GIIA 1OB3A 2W1FA 3VO3A 5JK3A 4KAOA 5IQBA 4EZ3A 1OZ1A 4C02A 3GCSA 5AADA 2CLQA 4YSJA 3OXZA 4YJPA 5KZIA 3SHEA 3QCSA 3F3VA 3QTXA 2OXXA 2Y4PA 5GHVA 4AA0A 5JEBA 2ZV9A 5JSMA 3PJ1A 5KMNA 3LXLA 3UP7A 5EOLA 4W4YA 4KUJA 3FL4A 2CGWA 1QPEA 4F0FA 4FVRA 2BRGA 2C5YA 2QO2A 5AX9A 4HGTA 4ONAA 4ERKA 3JYAA 5FRIA 3VRZA 3SKCA 2GFSA 5JH6A 1YDTE 5CASA 3VVHA 2DYLA 2ITOA 3HMMA 1FQ1B 3HVCA 2E2BA 2BIKB 2C6KA 3PXQA 2FO0A 4FNXA 4C0TA 4BDCA 3B8QA 5A3XA 4JJRA 3VUKA 3JXWA 2YM3A 4EK5A 4ZSLA 1G8AA 2R3RA 5KO1A 5AWMA 4CMOA 4DITA 5EG3A 4L67A 4IZ5A 5LVPA 2BCJA 5KZ0A 4M97A 3ORNA 4WBBB 4PTGA 2VTSA 4FUYA 2UZDA 3ZTXA 4X3JA 3FXWA 1PXNA 4UWBA 3AXWA 4WG3A 3F3WA 2FVDA 3LLTA 3Q96A 2OIQA 3RHXA 2RG6A 3I6UA 3QHWA 4B6LA 4J71A 3EFLA 4BCOA 2XK6A 2WTVA 5DHJA 3OVVA 4G3EA 3TEIA 2GS7A 4EJNA 5JFVA 2B54A 3C51A 3BBTB 3FI3A 4A9UA 4DF3A 1K3AA 4I5PA 1A06A 1NVQA 3F69A 5BPYA 5EKNA 1CSNA 3SG8A 2E9OA 1M2PA 1LUFA 4O0XA 2F7XE 3UOJA 1L8TA 3O8PA 1XJDA 2YIQA 3W8LA 4BDAA 4BCIA 4UYAA 4HYHA 1XH8A 4TYHB 1UU7A 4F7LA 4JS8A 4X3FC 4FIGA 4IVBA 4D1SA 4Z55A 3FQHA 3MA6A 3ZEWA 3R01A 5K5XA 4EOPA 4CYIA 3BIZA 3NRMA 2YITA 4CSVA 2QOBA 3QZFA 3VNTA 3D2KA 3QQGA 3KU2A 3U9NA 2C68A 4JLCA 2IZUA 4O0WA 5DR2A 4DFNA 5LMKC 3CCNA 2IPXA 2CKOA 1XH9A 4QMUA 4FSTA 4I23A 3KK8A 2BFXA 2WTKC 4KSPA 4KKHA 5FGKA 5CYIA 3VS7A 2AC3A 1PXOA 4QPAA 5T6KA 3MJ2A 2PUNA 3VS0A 1U5RA 3C1XA 2ONLC 3V6SA 4AU8A 1CKIA 4ZEGA 2YM6A 4KIOA 4ITJA 4O0RA 5HNIX 5ETFA 3IW8A 3PWDA 2R3OA 5D11A 4ACGA 3BHHA 4I0SA 5ETAA 3VW8A 4C62A 3R9HA 1F0QA 1RQQA 2BIYA 4DG0E 2VTMA 1QL6A 4IADA 5HTIA 5AUZA 3A8WA 5BYZA 3DZOA 4DBNA 4UMRA 4CV9A 4ZY4A 2YACA 3BU6A 4ZP5A 3D5VA 5HTCA 4FV6A 1KV1A 3GOPA 2VWYA 3AGLA 4Q5HA 2EUFB 3HA8A 3TZ8A 4F09A 1KE6A 1SYKA 4D2TA 2OU7A 3P78A 4XG9A 5CQWA 3R0TA 4BGGA 3BCEA 3R1YA 2VX0A 2E9VA 3HEGA 4RZVA 4BF2A 4Y46A 3I4BA 3GQLA 5LWMA 5F94A 3TNPC 3I81A 3QCYA 3NUSA 1YXXA 4WUNA 3F61A 4WRSA 4XUFA 2BRHA 3MB7A 2ITTA 4YSMA 5FBOA 1XWSA 4P90A 5HU3A 4GUBA 3ZO4A 4D4RA 2QOLA 3A61A 4ASEA 3TNQB 4RX7A 4BWKA 2VGOA 5C03A 3DLZA 4FKQA 3DXPA 5T3QA 3VBTA 4M84A 4L43A 4U6RA 3FYJX 2JBOA 2OJIA 3IW5A 4IACA 4KWPA 4DINA 5LVOA 1UNGA 3HP2A 4M0YA 3RPYA 4JR3A 4BI0A 4DT9A 3OBGA 3AT2A 4P5ZA 4YO6A 5L2QA 3MGYA 5CSXA 1Q4LA 2C3LA 3QQFA 3OFMA 3R21A 3IDCA 5EQEA 3CKXA 4F70A 3VWAA 4NSTA 3KK9A 2NNWB 1O6LA 2ZV8A 2XNMA 4CFMA 4L53A 4JDKA 2PTKA 4USDA 4GYIA 2ZM1A 3EQPA 5C1QB 2UW0A 3BHUA 3MB6A 4JL9A 5AR5A 1SM2A 2JFLA 3M42A 5HEZA 3RVGA 1LP4A 3QX4A 5CEIA 3RCDA 3WZEA 2VZ6A 3BPRA 3VBWA 3CGOA 3ZRKA 5HE3A 1H27A 3DAEA 2ITVA 1O6YA 5JT2A 4J8MA 5AUXA 5KKRB 5KBQA 3PRFA 1J91A 5KHXA 1GJOA 1RE8A 5AAFA 4IZ7A 5HZNA 3FI8A 2BHEA 4P2KA 1U54A 5HIBA 5DRDA 4TWOA 5H8GA 4DGLC 2XNBA 3NIZA 3TNIA 4ZY6A 3IGGA 5F1ZA 1RJBA 4PRJA 3NUAA 3FPMA 5E7RA 4BDFA 4I93A 2WAJA 3PXYA 5FTQA 1YOMA 2V7OA 3KB7A 3HRBA 4H1JA 3KRJA 4LGDA 4QQTA 4YLKA 3PVGA 4EBVA 4OTWA 4BDIA 4AA4A 5A4QA 2C5NA 3QBNA 4J53A 3RPSA 3FHIA 4O38A 4EK6A 5I9VA 1BLXA 4D2VA 4XJ0A 3KRWA 5HOAA 1REJA 5FDPA 3HMOA 5C4KA 4ZTHA 2WQOA 4FZ7A 4ZLOA 3TACA 5GZ8A 3NPCA 3T3VA 2IWIA 1H24A 2PHKA 3QC9A 3R71A 1A9UA 2YHVA 4V05A 3AC1A 4H3BA 4MTAA 1YHSA 4EOQA 5J9LA 1NVSA 4R3PA 2BROA 1PMVA 4RWJA 3U8WA 2W17A 2ZB0A 4OW8A 4PNKA 3QWJA 3QAME 3CGFA 2F7ZE 3ATSA 2O3PA 4TRLA 3PLAE 2YCQA 5FEDA 2J0LA 3ERKA 4IWQA 3C4EA 2I7QA 2BRBA 3QQHA 3LFSA 1Q41A 1XH5A 3NS9A 3C4WA 2ZDTA 4JG6A 2HZNA 4NCTA 3ZM9A 3CLYA 3OCBA 5E8ZA 4QNYA 2EXCX 4PDSA 3RM6A 4JI9A 3EN6A 2O63A 2YIYA 4I0TA 3ZFXA 2R3NA 2GNHA 4C4EA 1UWJA 1GZNA 5E90A 3WIGA 3HNGA 4MXOA 1F3MC 2EU9A 4FKJA 4S31A 3TV7A 2OXDA 3ZM4A 2G2FA 1OL2A 2OIBA 2P0CA 3SW4A 2EWAA 3EQIA 5HO7A 4M12A 3ZFMA 1Z57A 4G3DA 4GT3A 4FKTA 2VX3A 4PP7A 4YJQA 5JZJA 1FINA 1U54B 2W1EA 3LXNA 4EEVA 5GJDA 3AMAA 3KEXA 3CJFA 4FV9A 4AA5A 4BYJA 1IAJA 4IWDA 2PVHA 2G9XA 2XM8A 3R00A 5DRBA 2YDKA 3IQ7A 4C2WA 4TYGA 1UU3A 3QKMA 1JAMA 3H30A 5EW8A 4BL1A 4JX3A 5CTPA 3WE8A 3VN9A 2ZM3A 4FIFA 3EL8A 3R7UA 2KULA 3OBJA 3Q52A 4YJVA 5HKMA 3TT0A 5HBHA 4XLVA 2PVKA 3NZ0A 2WFYA 1ZMUA 5FXSA 2A4LA 2R9SA 3KCFA 3ZLXA 4A4XA 4RWKA 3OROA 4YZDA 2OZOA 3MS9A 3PVWA 2V62A 4S2ZA 5D12A 3O23A 4ZMFA 4C33A 2IVUA 3KCKA 1IR3A 3IECA 4EOSA 4TNBA 4W4VA 2QU6A 4QYYA 1MQBA 1OKYA 5I9WA 3LM5A 3PSDA 4MNEA 4O7RA 2CN5A 3W16A 3HKOA 5ANIA 2WU7A 4AOIA 3V5PA 1FOTA 3N51A 4JBOA 2XEYA 4QP6A 5EYKA 3HP5A 3QA0A 4H39A 2E9NA 4QO9A 3D4QA 4BHZA 3RM7A 2HOGA 3RBWA 4AE6A 5KMJA 3TDVA 2YIWA 4QQCA 3DKFA 4QTBA 4FG7A 2EVAA 1TQMA 3G9NA 3PVUA 3LFFA 4TXCA 5M55A 3FLQA 3BYSA 3O8UA 3D0EA 4M69A 3RHKA 2PYWA 2V55A 3TG1A 3LOKA 5EDQA 2A27A 2B9JA 5J95A 1R3CA 2GPHA 3LXKA 2CNVA 4IB1A 3F2NA 4AE9A 4RGJA 3A4PA 2V7AA 5CF4A 4L46A 2C1BA 5CAUA 2JKKA 4H3PA 2CKPA 3QYWA 5C8NA 5IQCA 3ULIA 4RVKA 5CT7A 2ZYBA 4JBVA 2EB2A 2ESMA 3BE9A 4XV2A 5LCJA 4TWPA 4OBOA 3OUNB 3PLSA 3HRFA 2X9FA 3Q9XA 3QKKA 5K5NA 3NX8A 5J1VA 4AWIA 4IEBA 4RFZA 5FQDC 2C3IB 4QMOA 5GNKA 3FMMA 3FXXA 3I0OA 3ZBXA 4YZBA 3EL7A 3UQCA 2QOHA 3C5IA 4RG0A 3AT4A 3DFCB 3OMVA 4DTKA 5HESA 4EUTA 3GI3A 2W1CA 5IDNA 4CZUA 4DBXA 3EB0A 4ANBA 2V5QA 5L3AA 5JZNA 3H9OA 3K5UA 5HG7A 2CMWA 5CT0A 3NLBA 3FI4A 4YR8A 3DDPA 4IB5A 4FNWA 3Q5IA 5HG9A 1ZOEA 4U0IA 3CPBA 4MNEB 3TNWA 4OTGA 4O83A 4KBCA 1OIQA 4K0YA 3RZFA 3UDBA 3IGOA 4C4HA 4EHGA 4A4OA 4N6YA 4BKJA 4RVLA 1ZARA 1PXPA 3CJGA 4TYEA 3OZ6A 5J7HA 4RFMA 5FTGA 4O7WA 4O22A 1I09A 3HGKA 3MH2A 4M69B 1ZYJA 5HGIA 5HCZA 1NVRA 4FTRA 5TT7A 4JDHA 3L9MA 5ANDA 2RFDA 4IX4A 5G1XA 1H01A 3S0OA 3EMGA 4HCTA 2C0TA 4U80A 3RAHA 1LR4A 4JR7A 3LFDA 2GFCA 2PL0A 4O96A 2WMSA 4AN9A 4XBRA 4N57A 1SNXA 4D0XA 3QTZA 4DGOA 3SRVA 1OMWA 3DJ5A 5AV0A 3VJOA 2HXQA 5A4TA 2XP2A 4E4MA 5EOBA 5AMNA 5F95A 4EHEA 4M68A 4O91A 1MP8A 3GVUA 3PUPA 3IONA 2NPQA 3E3PA 3QTUA 4HGSA 4UWCA 3RALA 2QQ7A 3M11A 4NW5A 3LMIA 2WMRA 3TJCA 2HIWA 4MX9A 4HVDA 3QRJA 3LFNA 3ZRLA 3UIBA 4IDVA 3ALNA 3MFTA 1YHWA 4YLLA 1YOJA 3DZQA 4D2PA 4IBMA 1GIJA 4OT5A 2OWBA 4J96A 5IA1A 3OW4A 2LGCA 3MTFA 1PRYA 3IW6A 5EW3A 3VS4A 3BX5A 3I1AA 3O96A 1GIIA 3VAPA 5KCVA 2RIOA 4JNWA 3V8SA 2XNEA 5DR6A 5IQIA 3OCGA 4B4LA 2GNIA 4BIDA 5AP7A 3DKOA 2JDOA 3WIKA 4AF3A 3C5UA 5CEOA 4ZSEA 4IJ9A 2XJ0A 4KIPA 4PMPA 4D9TA 4NJ3A 2HWOA 3C0HA 4FKGA 5B7VA 4R77A 4IE9A 2GNLA 2QO9A 3DA6A 4ZAUA 5AFVA 4IXPA 3R8UA 4HYIA 3TUCA 4G3FA 3QFVA 3PP0A 4NTTA 3WZJA 1U59A 4EK3A 3RPRA 3HMPA 5CXZA 4F9AA 3VUDA 3BHYA 3KXXA 4ANMA 1M14A 3FMLA 4WUAA 3TZ9A 4E26A 4D2WA 3S2PA 3QRTA 1H28A 3QUPA 3II5A 5HTBA 3FI2A 3HUBA 5K4IA 2XK4A 1H08A 3BU5A 3FY0A 1O6KA 1XQZA 3PVBA 1RDQE 1Q3WA 3LM0A 4EC9A 2YJSA 3SRVB 4DE4A 4TYJA 1M7NA 3KREA 1I44A 4FL1A 3PY3A 1Y57A 4P5QA 3BV2A 1P5EA 3U54A 3R2YA 4L00A 1PMEA 4S32A 4WBOA 5DT4A 4O0SA 3KVWA 3ALOA 3IDPA 4G6NA 3V01A 3QQLA 4JIKA 4PMSA 2RL5A 2Z7RA 4YBKA 4RBLA 2XM9A 1XBAA 1UWHA 3CS9A 3ODYX 3ZDUA 3GCUA 4QTEA 2R4BA 4I4EA 4C3PA 5IF1A 3SG9A 3PZEA 4Q5EA 2GHGA 4IM0A 3R8PA 3FMHA 1URWA 3AGMA 3HDNA 3FMEA 4OTPA 3UNZA 3DY7A 3ZLYA 3S4QA 3MA3A 2XNGA 2VUWA 4OTRA 4XS2A 4ZY5A 2WGJA 3QALE 4PL3A 4ZK5A 4RJ6A 4N6ZA 3AQVA 4MAOA 1KWPA 2UZVA 3ORXA 5KMIA 3GGFA 4O1OA 4RJ5A 4G1WA 4KS7A 5DEWA 3QWKA 4ANNA 3RPVA 2R3LA 4FTQA 1B6CB 4GV1A 1OI9A 5IEYA 5KMKA 5BMMA 5I0BA 1Y6AA 1PXKA 3BU3A 5JFXA 4FODA 3SW7A 2VV9A 2YABA 3V8WA 2VN9A 4GW8A 3Q4TA 1XH7A 2YM4A 1KOBA 5FD2A 4IVDA 4DH7A 4AG8A 3QD2B 3P86A 4FA2A 2WQEA 4PV0A 2JITA 3CXWA 3PA5A 1BMKA 4RLKA 5IEVA 2OZAA 1H0WA 1XR1A 5L6WL 2UVZA 4ZOGA 3TTJA 4GT5A 4GH2A 3EYGA 3ZYAA 1Z5MA 2PMIA 4PX6A 1OUKA 5K3YA 4AN3A 2VTTA 3KMWA 3ORIA 4QYFA 3UIXA 3NEWA 4R5YA 2H9VA 3QF9A 2JLDA 4O6EA 1OIUA 4C57A 4YUQA 2VTAA 4FG9A 2YCSA 4BCHA 2G01A 3VBQA 4CGAA 1PYXA 2XBJA 5E8SA 4F1MA 5IEXA 3W2CA 3KXGA 3MJ1A 4C4GA 5L6PA 1VYZA 3VQHA 3P23A 2PVMA 3D14A 5BMSA 4EQCA 2OFUA 4FX3A 3TN8A 4USFA 5L8JA 4ANSA 3SAYA 2ITZA 3SOAA 4GVAA 3VUHA 2PK9A 3POZA 4EKLA 2Y4IC 4MD7E 4EQMA 1Y8YA 3FZPA 4IAKA 4BB4A 1Q99A 1JBPE 5K0XA 1V0PA 4I3ZA 3DAKA 5AV2A 3DBCA 2VX1A 1W98A 3OP5A 4RA4A 4E4NA 3TDWA 3CP9A 3I0QA 5CU2A 3BBWA 1H26A 3G6HA 4K77A 2F49A 1PXLA 5AR7A 1H00A 4U41A 4YJNA 4L7FA 3G6GA 3Q60A 3ZFYA 1M52A 3TV6A 3TUBA 4USEA 4FNZA 4QP1A 2WOUA 4I6QA 3UP2A 2VNWA 5LOHA 4F9BA 4H1MA 3RK7A 4FEWA 2RFSA 4GG5A 1VEBA 2O65A 1W82A 2WO6A 3E93A 5G6VA 4W9XA 4FTKA 4YJTA 5EM7A 4B8LA 4D4SA 4DEEA 4GU9A 2W1IA 2CPKE 4XP0A 5H3QA 2OZAB 4CVAA 3EH9A 3PY1A 2UZOA 3F3ZA 2XKFA 3GT8A 1ND4A 4F99A 3DTCA 4AXAA 5L8KA 2QHNA 2X8IA 2XIYA 2ITUA 4ZSAA 1IA8A 3NUXA 2W5BA 4CLJA 2W96B 2J0JA 4MNFA 2PE0A 5HVKA 1NY3A 5J79A 4LRMA 2XK9A 4RPVA 4KRCA 1OBDA 1ZOHA 3TI1A 3LIJA 3R83A 3UO4A 4AAAA 3ZOSA 4ANLA 4BWPA 1H8FA 4IAYA 2PE2A 4BIBA 3NVMB 2WZJA 4IM2A 4F9CA 4NM7A 1G3NA 1PW2A 3NW7A 3IOPA 2PVJA 1FVRA 2BTSA 2CNQA 2BAQA 2OXYA 4AGUA 2PVNA 2GU8A 2J4ZA 2QOKA 4UV0A 4D2RA 4YHTA 4AN2A 1OECA 2OW3A 4CT2A 4HVGA 4RQKA 3UPZA 3ORMA 5CAQA 4L9IA 1BYGA 5CSHA 4EWQA 5E4HA 3R28A 5HORA 3FC2A 5AR4A 4RT7A 3A2CA 4XV9A 2C6MA 4I22A 3DB8A 5AM7A 3PDTA 3KGAA 4IDTA 5CQUA 1E1XA 4ZLZA 3C4CA 3QU0A 3N4UA 2I0YA 2ITYA 2ZM4A 1UKIA 3B2TA 3RZBA 3IW4A 3BGPA 3G15A 4TN6A 1JOWB 3QCQA 4MD8E 4RIYA 1YWRA 2E9PA 4NYEA 1JKLA 5JRSA 4YZCA 3RP9A 3HV7A 1YI3A 4BY9E 4OTIA 3IOKA 4QP4A 4YC6A 4O0VA 5HIDA 4AT3A 4F0GA 4QMSA 4D55A 5CNNA 4H3QA 3HL7A 1F5QA 3OT8A 5H9BA 4LQMA 3CTJA 4ZTLA 3BI6A 4JIAA 4FV2A 4LG4A 4WNKA 5EW9A 4FSUA 3R30A 5IA5A 3ZONA 4UN0C 3SA0A 2QLQA 2V22A 3BELA 3P08A 4C58A 2YIRA 4ACHA 4I94A 4DFLA 5L2IA 4WG5A 2J6MA 2UW4A 3CY3A 3E62A 2O64A 4D28A 2VWBA 5M4FA 3BLHA 3WZKA 4LUDA 4GIHA 2B9FA 4CFVA 2GHMA 3FDNA 3L9NA 3W18A 2BAKA 5DGZA 5CNOA 5TO8A 1XBBA 4OAVB 2UZEA 1OL1A 2V0DA 5IQGA 1G5SA 3QD0A 3RCJA 3HLLA 2WTJA 3SD0A 3WBLA 4BCKA 4CZYB 5C8KA 2H34A 2Q0NA 1DI9A 3AG9A 3EZRA 4IMYA 1JVPP 5F9EA 2F4JA 3AC4A 4UZDA 3SXFA 4AACA 4N0SA 4C37A 4ZLYA 4I92A 5DE2A 4ZSGA 2LAVA 3PTGA 4WOVA 4FSNA 1J1BA 2PWLA 3OUKA 2QVSE 3V5QA 4PNIA 5AP4A 2QKRA 3FZSA 3ZO1A 4UB7A 2Q83A 3UQGA 3MH0A 1WBPA 3EZVA 4HVHA 4UALA 5IMXA 4FIJA 1FGIA 4PTCA 3NUYA 4XH6A 4FK3A 3MY5A 4HPUE 4RIYB 3FYKX 3IK3A 4MWIA 2HW7A 3QZHA 3OWLA 5HVYA 4GVJA 3CIKA 1DS5A 2WMXA 3GUBA 1YDRE 3FQEA 4GFMA 3V5LA 4AT4A 4YU2A 2CCHA 3MV5A 4FKSA 1OGUA 4I6FA 2VO0A 3BKBA 2IVVA 4KSQA 4C34A 3MYGA 3U55A 4W4WA 5ANGA 3RPOA 2JEDA 3A7HA 3FC1X 3R1QA 4QT1A 4DLJA 2PZIA 5EDRA 5E8TA 2W06A 4YP8A 3QLFA 4A9TA 3COHA 5C26A 4F9WA 3PJCA 4Y95A 5FDXA 5FWKK 4JVGA 1PXIA 3UOHA 2ITQA 1M7QA 3GFEA 5BNJA 5M53A 4P4CA 2X8EA 2OJ9A 2XCHA 2QOQA 3BGQA 3H9RA 3IW7A 3M2WA 3PP1A 4PTEA 4D2SA 4EK8A 1U5QA 3N4VA 3GC7A 1OIYA 5EM8A 5BUJA 4R7BA 3NNVA 5D10A 3NDMA 5HE1A 3I60A 2CN8A 3HYHA 4JRVA 4I6HA 3ZUUA 4FZAB 2JDRA 2WTWA 3PZHA 3CQEA 3B8RA 4R1YA 3MTLA 2GNFA 4XYFA 2VD5A 2WQBA 1MRVA 2JDVA 4X2NA 2ZMDA 4FKVA 2HW6A 2JAVA 5JQ8A 3V5TA 2UZLA 2QLUA 4APPA 4K11A 4YPDA 4BDDA 5KBRA 3U6HA 4CD0A 4YMJA 4FI1A 3BHTA 4G3CA 4YPSA 3W2OA 4QP3A 5TE0A 1KV2A 4DLIA 3TM0A 3H9FA 3R04A 4FKLA 5E8XA 3CR0A 1AGWA 4RC4A 3IPHA 1P14A 5FTOA 3V51A 3DK3A 2EXMA 3I7BA 4EI4A 3DKCA 3QX2A 3UO5A 3QUEA 4EH2A 3E8CA 3UIUA 1WBWA 4TYIA 5DIAA 4FEXA 3NAYA 2R64A 2OG8A 3H10A 3ORZA 2OSCA 4FR4A 3TKIA 3I7CA 4G16A 2C69A 2CGUA 2PMLX 2WMUA 4R8QA 4E5BA 2BKZA 4M15A 4IB0A 4RVMA 4CTCA 4DGNA 5IG1A 1OL7A 1VZOA 2PVYA 1YDSE 3ORLA 5HNBA 5CEMA 5KUPA 3MPAA 3O8TA 5AP5A 3OD6X 4PWNA 3Q9ZA 4YBJA 3E92A 3UOLA 3TWJA 4U8ZA 3FMNA 4WG4A 2CJMA 4AZFA 5A54A 2Z7SA 5E8VA 4BBEA 3CBLA 3ZDIA 2I0EA 4FV3A 2WB8A 3EN7A 3FMKA 2WNTA 4MQ1A 1J3HA 4AZTA 3KF4A 2KTYA 4AS0A 3FY2A 5TR6A 2C6IA 2XIXA 4FIIA 4IW0A 4FKOA 3HMIA 3NWWA 1HOWA 3WOWA 4U79A 4NL0A 1BI7A 3U6IA 5AM6A 2UVYA 4GL9A 4IFGA 3TTIA 3K2LA 3PA3A 4FTNA 4PP9A 1J7IA 3ZEPA 5CZHA 4YJUA 3A7GA 3MPTA 3RKBA 3PE2A 5KMOA 4AFEA 4FT0A 4FSYA 2C6DA 4FT7A 4L6QA 2XNOA 3W33A 3A7JA 4C8BA 4ZZNA 4OAUC 3P0MA 5DPVA 4KS8A 3BEAA 4ENXA 4GKHA 5IH6A 4KABA 4LOPA 2XK7A 3Q6UA 4L8MA 1E9HA 2B55A 5LCKA 4ZXTA 5IA2A 3QD3A 3TZMA 2XJ2A 3A60A 1BUHA 3UG1A 4RRVA 3GCPA 4YNEA 5BUEA 4XX9A 2XVDA 4RMZA 2IVSA 3FL5A 4KNBA 4BDBA 4TW9A 4ERWA 4K2RA 4O1PA 2AC5A 2UVXA 4WNPA 5BVKA 3KMUA 4MH7A 3OEFX 2BTRA 2CHLA 3NIEA 3PFQA 4WRGA 4DTBA 5LJJA 1LEZA 5JGDA 4ASDA 2ERZE 2AYPA 4ANOA 1KE9A 1CKPA 2JFMA 5DYJA 3LAUA 4A4LA 2GQGA 1H1SA 3DPKA 4EOOA 5CEPA 3KXNA 3FV8A 4X21A 5H2UA 3U51A 2GS2A 4E1ZA 3O0GA 3UYSA 3VF9A 3AC2A 3ODZX 3SX9A 3UZPA 4EH7A 3AOXA 2X2LA 5KKRC 1ZWSA 3ORPA 4G17A 4W9WA 4LRJA 4XMOA 3UC3A 4NM3A 4ZTMA 1CM8A 3RINA 5M56A 3FSKA 3O50A 4FZDB 3DQWA 4DFUA 4JBPA 3NYVA 4S33A 3ZO3A 4J7BA 3FQSA 1FBNA 2W5HA 3E63A 4BDEA 5L2TA 4QP7A 4YTFA 2RF9A 3W55A 1T45A 3R9OA 4QOXA 3FKLA 5AUYA 2XKEA 5EFQA 4L3JA 1VJYA 4EUUA 1GZOA 4EWHA 5H8BA 3WILA 4DH5A 4U9AA 2WKMA 3QD4A 4F0IA 3FEGA 2WMWA 3N9XA 3R9DA 2W1ZA 2X6EA 5DI1A 5EHOA 3TZ7A 4CFNA 2JDTA 3CE3A 3KULA 2YZLA 1WCCA 3RAWA 3MH3A 4X2JA 3NNUA 5TF9A 3VUMA 3PXRA 3VBXA 4O7YA 1PHKA 5IISA 4DH1A 1S9IA 4R7HA 3VS5A 2XIKA 4ZJIA 1GIHA 4YO4A 1Y6BA 3BV3A 3UG2A 1ZZLA 4IAIA 3R7GA 3W8QA 5A9UA 5EI8A 3SQQA 5EQYA 5ETIA 4DEIA 2OF4A 4YJOA 3EKKA 3FZOA 5E8UA 2P55A 4FV1A 4E5AX 3W2PA 5ANOA 4BCMA 5BVWA 2IZSA 4X6RA 4FSRA 2I6LA 2X81A 3ZC6A 3GC0A 4C59A 2FH9A 3AD6A 1ERKA 4FTUA 3QTWA 4PY1A 5HIEA 5ANEA 1J7UA 3VUIA 4J52A 4K6ZA 4CCBA 4LUEA 3KA0A 3MY0A 4UX9A 5CENA 3W2QA 3M1SA 4DFZE 4LM5A 5AA9A 5FLFA 3VUTA 4IWOA 2VWVA 4DA5A 4Y85A 3VRYA 3OF0A 3DB6A 2YM5A 2XNNA 3CTQA 3QYZA 5AEPA 2OK1A 3VS1A 4BYIA 3QL8A 5GIPE 1Y91A 2BAJA 4PMMA 3OS3A 3OY3A 4OBPA 4EH3A 2GHLA 4MXAA 5L4QA 5CU0A 1JLUE 4I0RA 2ZV7A 2W4OA 4H36A 4GK2A 4O7NA 2WD1A 4FT3A 2OH0E 1O9UA 4TWNA 4MXXA 4HW7A 4AZSA 2IJMA 3F2RA 3NGAA 4Y72A 4QYHA 4ITIA 2J51A 3DNEA 3KULB 5CANA 4CKJA 4GRBA 3BLRA 3POOA 4FKRA 3PJ2A 4C4JA 3WF7A 1OIRA 4KB8A 4Y5HA 4MVFA 4YJRA 3L8XA 1WAKA 5FEEA 2JIUA 3UO6A 3COKA 5KNJA 2J5EA 2PMOX 4FVPA 4FIHA 3KXMA 4LGGA 3JR1A 4FTLA 4U45A 3MWUA 2Y8OA 3CD3A 4NCTC 4Y83A 4BBFA 5IQFA 4YTIA 3C7QA 4ASXA 1SVEA 2RSVA 2R3QA 3OWKA 3ZLSA 1NW1A 5A6OA 1K9AA 4NIFA 1BL7A 2BVAA 4O27B 5HI2A 4I20A 4IAAA 3R1SA 1UA2A 2QU5A 1GZ8A 2W99B 3FMDA 3IDBA 3LFBA 3OXIA 4LGHA 1PXJA 1M2RA 4WA9A 4ZTRA 3WF5A 4D0WA 3LCKA 3FZRA 3LJ0A 4F6SA 2J0MB 4GFGA 3WF9A 4S34A 1YI6A 4N70A 4BTMA 5HD4A 4JG8A 3Q4UA 2YCFA 3R7VA 2NO3A 1CDKA 1H0VA 1QMZA 3O71A 3T8OA 2WTIA 3C4XA 3I5ZA 3HMNA 3G0EA 4H58A 4HNIA 3C0IA 1MRYA 4HGEA 4BI2A 2R7IA 2IO6A 4XLIA 3UZTA 2VTJA 4AW2A 1XKKA 2UZTA 3VUGA 3BLQA 4RWLA 1M2QA 1OL6A 3BWFA 2IZTA 3BRBA 4U42A 5J8IA 3HRCA 4BGQA 4X7QA 5IH4A 1KUTA 2WMTA 2OFVA 4IH8A 3DNDA 4PDOA 4BCJA 1IASA 1JQHA 3CTHA 3NSZA 2X4FA 3ZLWA 4BCPA 2YLFA 4PL4A 2BILB 3OTVA 2X7FA 3WARA 1LPUA 2PVFA 3RJCA 2A19B 3PA4A 3QGWA 4O7ZA 1PY5A 4FL2A 5ETCA 3L1SA 4C3RA 4M0ZA 5J1WA 1UNHA 2GTNA 3D5WA 5E92A 3TXOA 3CEKA 4IHPA 4OBQA 5I9ZA 1JWHA 3ANQA 2WIHA 4BBMA 1YW2A 3L9LA 4E93A 3DXQA 5CF6A 2X7GA 3K54A 4NJDA 2QG7A 4YC8A 3JPVA 4JBQA 2YAKA 4XNEA 3OWJA 4J99A 4XBUA 1ZRZA 5TOZA 3OT3A 2ITPA 3FE3A 3OCTA 4NIFB 3CQWA 2X1NA 4NK9A 4X6QC 4ZTSA 5FXRA 2QD9A 5ANJA 4ENYA 3EFJA 3P1AA 3TJDA 4GEOA 2HZIA 2XJ1A 5I9XA 3A4OX 4CG8A 1DAYA 4K1BA 3F88A 3D2IA 3FLNC 3QQJA 4I5HA 5CU4A 5M08A 3PG1A 3DJ6A 3HV6A 4UEUA 4XG4A 4O81A 2FB8A 3QTSA 1GY3A 5B2LA 2YFXA 3NUPA 3GB2A 5IZFA 3FWQA 3D7TA 5AUWA 4R1VA 1FPUA 4LMUA 1B39A 5LMAA 3G2FA 4O0TA 4ACDA 3ENMA 2HY81 5IA3A 2UW9A 3VQUA 1JKSA 2WOTA 5HE0A 5J5SA 4FTCA 3S95A 1OUYA 1P2AA 3H3CA 3QRKA 5E8WA 2GCDA 1ZLTA 1LEWA 3COMA 4J8NA 1APME 2JKOA 2VWXA 4CQGA 5CEKA 1JSTA 3R8MA 1H07A 4NTSA 3ZBFA 4DH3A 1WMKA 4BR3A 4Q9SA 3R9RA 2VTRA 5K9IA 2Y6OA 4MBJA 1W7HA 3T9IA 5AR3A 4UMQA 3SXSA 3W32A 4ZIMA 4EH4A 1Q97A 5GJFA 3W2RA 2J0IA 1VR2A 2A1AB 3QC4A 4L42A 4WKQA 4RJ7A 4R6VA 5F20A 3FMJA 4BTFA 3Q32A 5LVNA 1JKTA 5DOSA 4L44A 2B7AA 4ZMEA 3NW6A 2BKKA 2CGVA 4IZYA 4DAWA 4U3ZA 1Y8GA 3ORKA 2C0IA 2W4JA 3LZBA 3KXZA 2UW3A 4IVCA 5ANKA 2FA2A 1PMNA 2XRUA 4BCFA 3ZMMA 4AGCA 3PJ3A 5IQDA 4KBAA 4BDHA 4GK3A 3D9VA 2XCKA 3BYUA 2FGIA 1YHVA 3O17A 3PSCA 4GYGA 3DBQA 4AP7A 1AQ1A 5E91A 3Q9YA 4IC8A 2XYUA 1JPAA 4L7SA 4EH8A 5J5TA 3W1FA 3WE4A 4MQ2A 2F57A 2RGPA 1Z9XA 3MVJA 5HCYA 3EFKA 3K5VA 1NA7A 3EQFA 3FHRA 1WBOA 3D7TB 4D1XA 4YTHA 2YM8A 2IVTA 4FKWA 4IFCA 2ZVAA 3BYOA 1QPCA 3QXOA 2IG7A 4GU6A 5AP2A 3V5JA 5CSPA 3SOCA 4CKIA 4O7LA 5BQ0A 3E88A 3R63A 1NXKA 3OHTA 4XG7A 4E8AA 4QMPA 4QP2A 1MUOA 3PJ8A 3EQCA 1XHAA 4U81A 1UU9A 5DA3A 5CAOA 4QPMA 4XHKB 5AAGA 3R6XA 2BMCA 5JFWA 3LJ1A 3QA8A 4GMYA 5CXHA 4Z16A 4IC7A 5AR2A 4C4FA 4HYUA 3MFSA 5IH5A 1REKA 4UMTA 3R7IA 4BFMA 3KRXA 2BDJA 2ERKA 2C0OA 4NM0A 3QLGA 1WVXA 2ITNA 2JAMA 4QQJA 4XRJA 5JN2A 2OIDA 3WZDA 4PDYA 1HCLA 4FUXA 1FGKA 2YN8A 3DS6A 3R7OA 4R78A 3VS6A 3B2WA 4U5JA 5CI6A 5A4CA 4Y5QA 3ROYA 4RC2A 5IUIA 5LVMA 1SVHA 2HY0A 4BDGA 1OPJA 4IJPA 3THBA 4E3CA 4FSMA 3CKWA 2C6LA 3LE6A 3EOCA 4X2KA 3RWQA 5BVNA 4BRXA 4AZWA 2G1TA 5CF8A 3ZZEA 2IW9A 1CTPE 3UODA 4ACMA 3LCDA 4OLIA 5M4CA 2PVRA 2HZ0A 1RW8A 3CY2A 3PYYA 3VW6A 4FZ6A 4AZEA 4GSBA 4A9SA 2XK8A 4FL3A 3FUPA 4FSQA 2YISA 3U9CA 2X7OA 3G33A 3MPMA 5CLPA 5DH3A 4CQEA 2FYSA 4C35A 4DGGA 3EN5A 3FKNA 5L2WA 3MW1A 4FSWA 3TCPA 5EM5A 3DJ7A 3FBVA 4ZZMA 5M06A 3OXTA 4M66A 4EOJA 4MHAA 3G90X 3HV4A 3Q2MA 4O21A 2VTOA 3A7FA 3SC1A 2I0VA 1UV5A 1OL5A 2YDJA 3GU6A 3DLSA 3Q3BA 3T9TA 5AA8A 1OBGA 1JNKA 2C3KA 4PQNA 3MVMA 4TY1A 4BZOA 4X3FA 4FOCA 4CV8A 2BZKB 4ZZOA 2EB3A 3EQGA 4WSYA 4JT3A 4G6OA 4FICA 3OOGA 4FGBA 4GT4A 2X4ZA 4UMUA 4IAFA 4ITHA 1H4LA 3HV5A 5J9ZA 2PUPA 5JGBA 5M09A 2BPMA 4AW0A 4O7TA 1KOAA 3DU8A 5LMKA 1Q5KA 2WEVA 1Q8TA 2ZJWA 2YLEA 2UW6A 5EI6A 3CQUA 5JMSA 5FUTA 4RVTA 3ZZWA 1U4DA 3DQXA 3PPKA 5CWZA 2UW7A 2ONLA 5FEQA 1KSWA 4R3RA 2OJFE 4XOZA 1SMHA 3EKNA 4G34A 4A9RA 3O7LB 4A7CA 3SGCA 3EQDA 5EQPA 2C6TA 4D1ZA 5C9CA 2QURA 4E73A 4BDKA 3V8TA 4DFYA 4ZTQA 2R0UA 4CT1A 4GJ3A 4O0YA 4E4LA 4R3CA 1MQ4A 4QMLA 3HUCA 1UU8A 2Y9QA 1PXMA 2VTPA 1WBTA 3DK6A 4V04A 4BVUA 3QKLA 5AP1A 2WTDA 4PPCA 3F66A 3O2MA 5IKWA 2GNGA 5EM6A 5AV4A 1H1PA 3HZTA 3HAVA 2QONA 2W4KA 4FSZA 2W9FB 2C5VA 2WMVA 2ETMA 5D1JA 3EQRA 1WBVA 2RFEA 1J1CA 2UZNA 3AT3A 4I24A 2GQRA 2G15A 2H96A 4CG9A 4FE2A 3UNKA 3FZ1A 1TVOA 4HPTE 4NH1A 3PY0A 4YC3A 2VAGA 1STCE 2J2IB 3E8NA 4U3YA 2WU6A 4E6DA 3DCVA 3JUHA 4XP2A 2UZWE 4DCEA 2Y7JA 3ZHPC 4GCJA 2YJRA 5AP6A 2PUUA 3EWHA 4X3FB 1W0XC 4LI5A 4OTQA 3AMYA 4MKCA 1VYWA 4LV5A 3ID6C 3QQUA 2WELA 2OGVA 4AZVA 2YAAA 1YOLA 4PL5A 5K0KA 2HXLA 3AD5A 3COIA 4JOAA 2BUJA 3NYOA 5DG5A 1J7LA 5FBNC 2A0CX 3GEQA 5IQEA 2J7TA 2XH5A 3U6JA 1XBCA 2PU8A 1DM2A 2R3PA 4UYNA 2PVLA 1SNUA 3KRRA 4IM3A 2WTKB 2IW6A 3GENA 2X2MA 4J98A 4NUSA 4UZHA 2IW8A 4RJ8A 3E5AA 4G2FA 3PIYA 2VWUA 3UIMA 4KIKA 3P5KA 1GNGA 3FPQA 4HJOA 4P7EA 5HE2A 4AGDA 3AC8A 4AOJA 2R3IA 5KHWA 2ZMCA 2QO7A 1KE5A 2P2IA 3P7CA 4PPBA 4QMMA 2X2KA 3OEZA 5I3OA 4LL5A 5BYYA 5F4NA 5J7BA 2XBAA 5LWNA 4OR5A 3AC3A 2PZPA 3H0YA 1OKZA 1R0PA 2JIVA 4YLJA 1AD5A 5ACKA 3GCVA 4G5PA 4EH9A 5EDPA 4MXCA 2NRYA 4QPSA 3A8XA 3REPA 3HDMA 1BL6A 3MFUA 4BGHA 2P4IA 4IIRA 1IEPA 5IUGA 2PZYA 5EH0A 4R7IA 3VS3A 3U4WA 2ZAZA 5DFPA 4BCNA 3BQRA 4O2PA 5DBXA 4G6LA 4Q9ZA 3LLAA 1KE7A 4WIHA 2JBPA 3E7VA 4JDIA 3L8PA 4APCA 3D94A 3DK7A 2QOFA 2ITXA 5M4IA 2HENA 1YKRA 4QMYA 4KD1A 4IX3A 5CI7A 1PF8A 5CU3A 5A6NA 5HBJA 3LXPA 1UVRA 2WQMA 4NKSA 5CVGA 2F2UA 3V5WA 1ZAOA 2QR7A 4FT5A 4OUCA 4E4XA 2XRWA 4V01A 1W84A 4FK6A 5LVLA 3GC8A 4CRSA 4EHZA 3UVRA 1Q24A 3ETAA 3P79A 4Q2AA 4DFBA 4E5WA 4UXQA 4CMUA 2EXEA 1B38A 3FJQE 4GK4A 3RAIA 2PMNX 5I9YA 5HU9A 1Q62A 2W5AA 4ASZA 2OLCA 4CNHA 4DEBA 3NVKI 1ATPE 2XA4A 1YWNA 2W1HA 4JAJA 3MI9A 4RX9A 2OICA 5EYCA 5D7AA 2R0IA 2Z8CA 5DR9A 3LCSA 4WD5A 4LRKA 5HVJA 5HX8A 3SVVA 4KIKB 4D9UA 3ACKA 3KMMA 4YZNA 3E8EA 2JKQA 2BALA 2G2HA 4DH8A 2GMXA 3K3IA 3PPJA 3DKGA 3ZSHA 4J95A 2B9IA 2ITWA 3QHRA 2FSLX 3MVHA 3P4KA 4GFOA 4DTAA 3RTPA 1HCKA 3FZTA 2FUMA 4I4FA 2I40A 4DHFA 4TZRA 3QRIA 3E7OA 2H6DA 4FEVA 1ZZ2A 2BRNA 4M3QA 3AD4A 3ZUTA 3OG7A 3MH1A 4O6LA 4OTHA 5BUIA 3C9WA 3NYXA 2OJJA 4L68A 3KXHA 4HCUA 3EN9A 1ZOGA 2PUIA 3ANRA 3TIZA 5C01A 4PUZA 1H1WA 5FXQA 4MXYA 4U40A 4JX7A 2PZRA 5HICA 2O5KA 4W8DA 5L8LA 4BZNA 5I5ZA 1FMOE 3F5PA 4MCVA 4NFMA 3AMBA 3UJGA 4EZ5A 2HYYA 5GZAA 4QMWA 3ET7A 3HAMA 3MSSA 3A62A 4DG3E 5A14A 3VIDA 1KE8A 2W0JA 3IS5A 5HBEA 3GCQA 4RX5A 3KY2A 3VHKA 4IAZA 4I5MA 4AFJA 4ALUA 4GG7A 5T68A 2IZRA 3O51A 3G5DA 3QGYA 2CDZA 5AP0A 2O8YA 4L3LA 3JVSA 4CMTA 5LQFA 3PXKA 2CKEA 3OTUA 3T3UA 2XMYA 1ZMVA 2XUUA 3CC6A 2GTMA 5E8YA 4XG6A 3NUNA 2Y0AA 2QODA 5HG5A 4DCAA 5BX0A 4BN1A 3QZIA 3TUDA 3ZH8A 3ZSGA 3Q9WA 4J97A 5HD7A 5B2KA 2WMBA 2YZAA 4FTMA 5CX9A 4F1TA 4YURA 5JFSA 2JDSA 3MDYA 3LJ2A 4MK0A 3MVLA 5CU6A 5AV1A 5C8MA 4IQ6A 5CVFA 3ROCA 3ZU7A 2GDOA 4E6QA 1A48A 3L9PA 5BVFA 3C4FA 1YRPA 3BWJA 3K3JA 2R7BA 4FVQA 3R22A 4WNMA 1TQPA 2B52A 4FKIA 4C61A 5AX3A 3CD8A 5HX6A 1V0OA 4O7SA 4MBIA 4D5HA 2HCKA 5DLSA 2J0KA 4MF0A 4NWMA 5LARA 4PDPA 1R1WA 3BQCA 4HNFA 5LMBA 2BHHA 4L01A 4RJ3A 5J87A 4CFFA 4DYMA 1X8BA 3MY1A 4MBLA 4XV3A 4YGAA 3SDJA 5HQ0A 3MFRA 4MWHA 2B1PA 5BVEA 1GAGA 4CYJA 4FTOA 4HYSA 4CEGA 4F7SA 5D7VA 4A07A 1W83A 4FF8A 2G2IA 3LFAA 2CGXA 2Z7QA 4XOYA 4C38A 4B7TA 4I21A 4IZAA 1QPJA 1YWVA 4JAIA 2Z60A 3BHVA 4MF1A
chains in the Genus database with same CATH superfamily
4FKUA 3EN4A 5LXMA 1YXVA 2H8HA 3PXFA 2QOOA 1BI8A 5EYDA 4BI1A 4XRLA 1YXSA 4F64A 1Q8WA 2QG5A 3BEGA 4FYNA 4JDJA 5AAEA 3ENHA 4BZDA 2YERA 1PMUA 3KC3A 4X2GA 4EK4A 3NNWA 2R3JA 3S1HA 4FNYA 5CAVA 2R5TA 5I9UA 2R3HA 4FTAA 3W0SA 2CSNA 3F5GA 4G3GA 4NZWB 4BC6A 1H1QA 4D4YA 3PIZA 1MRUA 1XO2B 3GQIA 4DG2E 2OJGA 4MYGA 3L8VA 3UMWA 2NP8A 4QTDA 2A2AA 4TNDA 2QC6A 4FV8A 3UNJA 2OH4A 5M44A 1G8SA 3F9NA 5J9YA 1SZMA 3DGKA 5DT3A 4O4EA 5AV3A 3UC4A 3QZGA 4LYNA 3NR9A 1WFCA 1ZYCA 2XK3A 5DT0A 3TNHA 3KQ7A 2XNPA 3F5XA 4LFIA 1S9JA 3UPXA 1ZYSA 4BDJA 4DT8A 2XYNA 3U4UA 4RA5A 2C3JA 4M67A 1WVYA 3LKMA 4C3FA 4YZMA 3S00A 1OITA 3H0ZA 5AUVA 4C4IA 2Z2WA 3LFQA 3P9JA 4UY9A 4TTHB 4AGWA 2JKMA 3WYYA 3LQ3A 2O2UA 3SXRA 3LMHA 3HECA 5A4LA 3ZUVA 4B9DA 1PKGA 5ITAA 4FC0A 5HG8A 5JRQA 4NU1A 3ZXZA 3JVRA 2X8DA 2QOIA 4FV7A 2R2PA 1URCA 3C0GA 4F6UA 5CVHA 3NNXA 3LVPA 5E1SA 3ZC5A 2UZBA 4WHZA 3DBEA 4KKGA 5KX8A 5M51A 2ZDUA 2VU3A 2UUEA 3RGFA 3TV4A 3NUUA 4BIEA 3I6WA 4FV5A 4QRCA 4A9YA 3FLSA 2HAKA 3LHJA 3NCGA 4FBXA 4RIOA 3GOKA 2QI8A 3BYVA 2BZJA 4RIXA 3RNYA 5A46A 4HGLA 4DEAA 4UMPA 4FV0A 3MN3A 4ZTNA 4QMVA 4AOTA 2CLXA 3R73A 2YWPA 2C5XA 2W9ZB 2X0GA 4U97A 4KBKA 5IMEA 3JY9A 4RJ4A 3NAXA 4UXLA 4EYMA 1IA9A 1H25A 4EBWA 4CRLA 4GS6A 5EI2A 2B0QA 3QTRA 4K33A 2GNJA 2PPQA 1WZYA 2P3GX 4I41A 3W0QA 3R9NA 3GU5A 2DWBA 5D9HA 4EORA 4HZRA 2JD5A 4G9RA 5DVRA 5DMZA 4A06A 3FSFA 1T46A 2XIRA 3VHEA 3FLZA 3QCXA 4CTBA 2JGZA 2R3GA 3VJNA 5CSVA 3ATTA 2PSQA 2VWZA 5FP5A 3ULZA 5I3RA 3PE1A 4DHIB 3H4JA 4O7VA 4ORKA 2J5FA 2PZ5A 2YDIA 5IU2A 1UKHA 3GFWA 4NW6A 4DEHA 4EJ7A 5M4UA 3F7WA 2ZV2A 3Q53A 2SRCA 3WF6A 1Q8UA 5CEQA 3DAJA 1QCFA 4K18A 4EH6A 2CKQA 4AQKA 3LCOA 3LW0A 3V04A 3EYHA 4N4SA 3BYMA 5AJQA 5EYMA 2I0HA 5HLPA 3WI6A 3TKUA 2VWWA 3DV3A 4XV1A 3LQ8A 2XS0A 4OTDA 4UWYA 3S3IA 4FTJA 4GKIA 3NYNA 3W2SA 1OVEA 3DTWA 3VBVA 2X39A 4FEQA 3UYTA 2B53A 2PY3A 3EQBA 5HLNA 5JGAA 2VGPA 5GJGA 2OI4X 2XF0A 3OY1A 1WBSA 4QYEA 3R7YA 4FEUA 3GU7A 5KMMA 2QOCA 4HCVA 2VTNA 2XAMA 1YXUA 2P33A 4NFNA 4XCUA 5DNRA 1YI4A 4U7ZA 3MESA 3PRIA 1ZY5A 4BWXA 4EQUA 2Y6MA 5EK7A 4RIWA 4RIXB 2C47A 4OTFA 5EKOA 4F7JA 4JG7A 3ZO2A 4AW1A 3FAAA 4AXCA 4ZJVA 3C50A 5H8EA 2JIIA 3ZS5A 1UNLA 3AKKA 1R39A 4EKKA 3N4TA 1FMKA 5DN3A 3GU8A 3HV3A 3QQKA 3V3VA 4IVAA 4E20A 2YCRA 4L45A 3FKOA 2XKDA 4FTTA 2ETKA 3D5XA 4FMQA 4YHJA 3C13A 5ACBC 5JQ5A 3D7ZA 4AQCA 2Z02A 3R2BA 2QKWB 2XIZA 4O86A 3F82A 2OBJA 3KN6A 4EH5A 3W0MA 3R8ZA 5DEYA 4PF4A 3SV0A 4BHNA 1P4FA 3A7IA 4F7NA 4M13A 4EOIA 4QD6A 4ZS4A 2VTLA 2VO3A 3BZ3A 5A4EA 4YTCA 5CAPA 4XEYA 3UZRA 4L3PA 4TT7A 4V0GA 4Z9LA 3VC4A 3KKVA 3MIYA 4QTAA 3GC9A 3PIXA 4HOKA 3JS2A 2WMQA 4F9YA 5BVOA 4ZS0A 4XG8A 1M17A 3OWPA 4CXAA 4FKPA 3E64A 1OM1A 4JQ7A 5CY3A 3UE4A 3TKHA 4MXZA 4DGMA 5E9EA 4C2VA 2A98A 4LMNA 2CCIA 3Q5ZA 3UVQA 5IUHA 1ZYDA 3F3TA 4XG2A 4D58A 2YM7A 3NMUF 3QXPA 1GOLA 4QYGA 2VWIA 2E9UA 2W1DA 1OKWA 2REIA 4W4XA 5FM2A 4KRDA 2PULA 2IN6A 2WPAA 2YA9A 4FTIA 2F9GA 1WVWA 4RC3A 4E6CA 4EL9A 4M8TA 4ID7A 4RQVA 5AR8A 1P4OA 4IWPA 4RLLA 3OCSA 3Q4CA 2VTHA 4DFXE 2HK5A 4BCGA 2BZHB 4EONA 3KVXA 3G9LX 3OOMA 3Q04A 3Q4ZA 4RWIA 3FLYA 4FV4A 4GUEA 2OF2A 4RIWB 3CSVA 1L3RE 4LL0A 3R02A 5HHWA 3RAKA 2C1AA 2C5OA 4Z7GA 2UZUE 3F3UA 1W8CA 3HX4A 3KL8A 2HELA 4FG8A 3ELJA 2GQSA 2ZB1A 4FIEA 3QTQA 5HCXA 3Q2JA 3KN5A 4U43A 3LFEA 4NM5A 3D5UA 5DWRA 4MD9E 2GS6A 2I1MA 2WEIA 4W8EA 4B99A 5HLWA 4QMTA 4DEDA 4X0MA 4FT9A 2HZ4A 3F2AA 5FM3A 3L8SA 3WF8A 1PJKA 4D4VA 4YZ9A 1V0BA 2J9MA 1H1RA 4WNOA 4CFWA 3UGCA 3GP0A 4QQ5A 3VULA 5E1EA 3TL8A 5IDPA 4AT5A 5KE0A 2XB7A 3PPZA 3UBDA 5AUTA 2F7EE 1E1VA 2J90A 5HO6A 2CNUA 4V0GB 2W1GA 3GU4A 4Y8DA 3EIDA 1U46A 3DBDA 4UBAA 3UVPA 2P2HA 4F63A 2YIXA 3F7ZA 4KINA 3PSBA 4C36A 4PMTA 4G9CA 3NFFB 1OPLA 2B4SB 4EZ7A 3RK9A 4QMZA 2ACXA 2FSTX 4CZTA 3VBYA 3WYXA 3BL7A 5GIOE 5C27A 3E3BX 4NKAA 3LFCA 3EHAA 4EOLA 5M57A 4JXFA 4X2FA 3KRLA 5AIKA 1ZYLA 5CZIA 4B0GA 5FG8A 4F4PA 5L2SA 4QP8A 4FGRA 1ZY4A 2YEXA 5GZ9A 4TL0A 3RWPA 2C30A 2BRMA 5HO8A 2FSOX 4EOKA 1IAHA 4O84A 5M07A 4QMQA 2BDWA 4HZSA 3E8DA 2XKCA 2VRXA 2VO6A 3GBZA 5IPJA 5K4JA 4NEUA 4AUAA 4F6WA 1PYEA 3HA6A 4ANQA 2Z7LA 5TKDA 4B8MA 3UDSA 3G0FA 2RG5A 4QMXA 2GSFA 3IKAA 4GJ2A 4RFYA 3LPBA 4LV8A 3TIYA 4H05A 2Y4IB 4DC2A 1BX6A 5FP6A 3WZUA 4EOMA 4IX5A 4NT4A 4F65A 2Q0BA 5CALA 2ETRA 3D15A 3F5UA 3KF7A 3MBLA 3O7LD 4FOBA 3ITZA 5AIRA 3RMFA 3ZSIA 5CF5A 3QTIA 4CKRA 2X6DA 4YNOA 5CS6A 1Q3DA 3OC1A 4II5A 2BR1A 4DEGA 4EYJA 2J50A 1EH4A 2W05A 2WMAA 3IG7A 4L52A 3BGZA 2WHBA 2PE1A 3R8LA 4RZWA 2X0OA 3FLWA 4KIQA 3RK5A 2C4GA 3R1NA 4I5CA 2RKUA 2UW5A 4I1ZA 1Q8YA 4BKZA 4TWCA 3ZCLA 1K2PA 3PWYA 2C6OA 3GNIB 2YWVA 3MIAA 1DAWA 2F2CB 4TPTA 2DS1A 3DDQA 2VTQA 5B0XA 1SVGA 4BKYA 2WIPA 4RSSA 2VO7A 3G51A 4U44A 4F08A 1BKXA 2DQ7X 2WQNA 2W7XA 3BE2A 2XANA 5EHYA 3A99A 3Q6WA 4YHFA 2BZIB 3UMXA 1NT2A 4YJSA 4M7IA 1DI8A 2FSMX 2UV2A 5EHLA 3ZRMA 3VF8A 4DN5A 3LCTA 4F1OA 5C4LA 1QPDA 2RFNA 4CFUA 4LOOA 2WXVA 2NRUA 5IA0A 4QP9A 5IQHA 3DBFA 1JKKA 4ARKA 4CCUA 2DUVA 2VTIA 4J1RA 1WBNA 4PPAA 2VNYA 1FVTA 1YQJA 4K9YA 4HVIA 3JY0A 5CSWA 3DFAA 3EQHA 1TQIA 1YVJA 3DOGA 4E7WA 5AUUA 5BVDA 4WO5A 3TYKA 1V1KA 4JQEA 4O2ZA 4AW5A 1XMMA 2XZSA 4JQ8A 4WT6A 4IB3A 4FYOA 3UTOA 3W0RA 2X9EA 2O0UA 3AC5A 3U87A 3I79A 5GINE 1CMKE 3R7EA 4EHVA 4BICA 3NW5A 4FJVA 3F6XA 4FZFB 1OPKA 3ACJA 1PKDA 4XP3A 1ZXEA 3QRUA 3RI1A 1OKVA 4I6BA 1FVVA 3RNIA 4D5KA 4RX8A 4AX8A 3UOKA 4IANA 1Q61A 4QTCA 3PG3A 4Z7HA 3E87A 2XEZA 2QCSA 4G5JA 4Z3VA 2OO8X 1Q8ZA 2QNJA 5L6OA 3AKLA 5B2MA 4K8AA 1JSUA 3SLSA 2ZOQA 3EJ1A 3ZXTA 2UW8A 2WTCA 3D83A 2B9HA 4LDTA 5IQAA 5D41A 2C6EA 4ALWA 3NCZA 4S30A 4O0UA 4EC8A 3LQ5A 1IRKA 3UQFA 3EFWA 4ZJJA 3W10A 5ICPA 1CKJA 4TKSA 4CFXA 1IG1A 3DT1A 4KA3A 1XH4A 4IX6A 4C7TA 5JKGA 2QHMA 3I5NA 2QR8A 5BYLA 4BTKA 4JRNA 2JC6A 3GXLA 4MEDA 4Y73A 4FRFA 4XG3A 5AP3A 4M14A 5IA4A 3PXZA 4ZSJA 2OKRA 3CPCA 4R5SA 1JSVA 1R0EA 4BTJA 1R78A 4CLIA 4G31A 1GZKA 2HWPA 4E6AA 3V6RA 2BDFA 3DXNA 3LMGA 4OGRA 3R8VA 3VS2A 5KMLA 3C4ZA 2R3KA 4BCQA 1ZMWA 3IO7A 3KFAA 4QNAA 2BFYA 3ORTA 3QUDA 4O82A 4QMNA 4WSQA 4ACCA 4HVSA 2AUHA 3P7AA 1TKIA 5I4NA 4KKEA 4OT6A 3FXZA 3UDZA 2R3FA 1YXTA 3OW3A 4TYHA 4ALVA 3P7BA 1XH6A 2R3MA 4LOQA 5HNGA 4GIIA 1OB3A 2W1FA 3VO3A 5JK3A 4KAOA 5IQBA 4EZ3A 1OZ1A 4C02A 3GCSA 5AADA 2CLQA 4YSJA 3OXZA 4YJPA 5KZIA 3SHEA 3QCSA 3F3VA 3QTXA 2OXXA 2Y4PA 5GHVA 4AA0A 5JEBA 2ZV9A 5JSMA 3PJ1A 5KMNA 3LXLA 3UP7A 5EOLA 4W4YA 4KUJA 3FL4A 2CGWA 1QPEA 4F0FA 4FVRA 2BRGA 2C5YA 2QO2A 5AX9A 4HGTA 4ONAA 4ERKA 3JYAA 5FRIA 3VRZA 3SKCA 2GFSA 5JH6A 1YDTE 5CASA 3VVHA 2DYLA 2ITOA 3HMMA 1FQ1B 3HVCA 2E2BA 2BIKB 2C6KA 3PXQA 2FO0A 4FNXA 4C0TA 4BDCA 3B8QA 5A3XA 4JJRA 3VUKA 3JXWA 2YM3A 4EK5A 4ZSLA 1G8AA 2R3RA 5KO1A 5AWMA 4CMOA 4DITA 5EG3A 4L67A 4IZ5A 5LVPA 2BCJA 5KZ0A 4M97A 3ORNA 4WBBB 4PTGA 2VTSA 4FUYA 2UZDA 3ZTXA 4X3JA 3FXWA 1PXNA 4UWBA 3AXWA 4WG3A 3VONA 3F3WA 2FVDA 3LLTA 3Q96A 2OIQA 3ML1A 3RHXA 2RG6A 3I6UA 3QHWA 4B6LA 4J71A 3EFLA 4BCOA 2XK6A 2WTVA 5DHJA 3OVVA 4G3EA 3TEIA 2GS7A 4EJNA 5JFVA 2B54A 3C51A 3BBTB 3FI3A 4A9UA 4DF3A 1K3AA 4I5PA 1A06A 1NVQA 3F69A 4O4CA 5BPYA 5EKNA 1CSNA 3SG8A 2E9OA 1M2PA 3TMOA 1LUFA 4O0XA 2F7XE 3UOJA 1L8TA 3O8PA 1XJDA 2YIQA 3W8LA 4BDAA 4BCIA 4UYAA 4HYHA 1XH8A 4TYHB 1UU7A 4F7LA 4JS8A 4X3FC 4FIGA 4IVBA 4D1SA 4Z55A 3FQHA 3MA6A 3ZEWA 3R01A 5K5XA 4EOPA 4CYIA 3BIZA 3NRMA 2YITA 4CSVA 2QOBA 3QZFA 3VNTA 3D2KA 3QQGA 3KU2A 3U9NA 2C68A 4JLCA 2IZUA 4O0WA 5DR2A 4DFNA 5LMKC 3CCNA 2IPXA 2CKOA 1XH9A 4QMUA 4FSTA 4I23A 3KK8A 2BFXA 2WTKC 4KSPA 4KKHA 5FGKA 5CYIA 3VS7A 2AC3A 1PXOA 4QPAA 5T6KA 3MJ2A 2PUNA 3VS0A 1U5RA 3C1XA 2ONLC 3V6SA 4AU8A 1CKIA 4ZEGA 2YM6A 4KIOA 4ITJA 4O0RA 5HNIX 5ETFA 3IW8A 3PWDA 2R3OA 5D11A 4ACGA 3BHHA 4I0SA 5ETAA 3VW8A 4C62A 3R9HA 1F0QA 1RQQA 2BIYA 4DG0E 2VTMA 1QL6A 4IADA 5HTIA 5AUZA 3A8WA 5BYZA 3DZOA 4DBNA 4UMRA 4CV9A 4ZY4A 2YACA 3BU6A 4ZP5A 3D5VA 5HTCA 4FV6A 1KV1A 3GOPA 2VWYA 3AGLA 4Q5HA 2EUFB 3HA8A 3TZ8A 4F09A 1KE6A 1SYKA 4D2TA 2OU7A 3P78A 4XG9A 5CQWA 3R0TA 4BGGA 3BCEA 3R1YA 2VX0A 2E9VA 4QDVA 3HEGA 4RZVA 4BF2A 4Y46A 3I4BA 3GQLA 5LWMA 5F94A 3TNPC 3I81A 3QCYA 3NUSA 1YXXA 4WUNA 3F61A 4WRSA 4XUFA 2BRHA 4DDGA 3MB7A 3NFGB 2ITTA 4YSMA 5FBOA 1XWSA 4P90A 3KIOC 5HU3A 4GUBA 3ZO4A 4D4RA 2QOLA 3A61A 4ASEA 3TNQB 4RX7A 4BWKA 2VGOA 5C03A 3DLZA 4FKQA 3DXPA 5T3QA 3VBTA 4M84A 4L43A 4U6RA 3FYJX 2JBOA 2OJIA 3IW5A 4IACA 4KWPA 4DINA 5LVOA 1UNGA 3HP2A 4M0YA 3RPYA 4JR3A 4BI0A 4DT9A 3OBGA 3AT2A 4P5ZA 4YO6A 5L2QA 3W0PA 3MGYA 5CSXA 1Q4LA 2C3LA 3QQFA 3OFMA 3R21A 3IDCA 5EQEA 3CKXA 4F70A 3VWAA 4NSTA 3KK9A 2NNWB 1O6LA 2ZV8A 2XNMA 4CFMA 4L53A 4JDKA 2PTKA 4USDA 4GYIA 2ZM1A 3EQPA 5C1QB 2UW0A 3BHUA 3MB6A 4JL9A 5AR5A 1SM2A 2JFLA 3M42A 5HEZA 3RVGA 1LP4A 3QX4A 5CEIA 3RCDA 3WZEA 2VZ6A 3BPRA 3VBWA 3CGOA 3ZRKA 5HE3A 1H27A 3DAEA 2ITVA 1O6YA 5JT2A 4J8MA 5AUXA 5KKRB 5KBQA 3PRFA 1J91A 5KHXA 1GJOA 1RE8A 5AAFA 1OGYA 4IZ7A 5HZNA 3FI8A 2BHEA 4P2KA 1U54A 5HIBA 5DRDA 4TWOA 5H8GA 4DGLC 2XNBA 3NIZA 3TNIA 4ZY6A 3IGGA 5F1ZA 1RJBA 4PRJA 3NUAA 3FPMA 5E7RA 4BDFA 4I93A 2WAJA 3PXYA 5FTQA 1YOMA 2V7OA 3KB7A 3HRBA 4H1JA 3KRJA 4LGDA 4QQTA 4YLKA 3PVGA 4EBVA 4OTWA 4BDIA 4AA4A 5A4QA 2C5NA 3QBNA 4J53A 3RPSA 3FHIA 4O38A 4EK6A 5I9VA 1BLXA 4D2VA 4XJ0A 3KRWA 5HOAA 1REJA 5FDPA 3HMOA 5C4KA 4ZTHA 2WQOA 4FZ7A 4ZLOA 3TACA 5GZ8A 3NPCA 3T3VA 2IWIA 1H24A 2PHKA 3QC9A 3R71A 1A9UA 2YHVA 4V05A 3AC1A 4H3BA 4MTAA 1YHSA 4EOQA 5J9LA 1NVSA 4R3PA 2BROA 4AXDA 1PMVA 4RWJA 3U8WA 2W17A 2ZB0A 4OW8A 4PNKA 3QWJA 3QAME 3CGFA 2F7ZE 3ATSA 2O3PA 4TRLA 3PLAE 2YCQA 5FEDA 2J0LA 3ERKA 4IWQA 3C4EA 2I7QA 2BRBA 3QQHA 3LFSA 1Q41A 1XH5A 3NS9A 3C4WA 2ZDTA 4JG6A 2HZNA 4NCTA 3ZM9A 3CLYA 3OCBA 5E8ZA 4QNYA 2EXCX 4PDSA 3RM6A 3PUFC 4JI9A 3EN6A 2O63A 2YIYA 4I0TA 3ZFXA 2AQXA 2R3NA 2GNHA 4C4EA 1UWJA 4DHZA 1GZNA 5E90A 3WIGA 3HNGA 4MXOA 1F3MC 2EU9A 4FKJA 4S31A 3TV7A 2OXDA 3ZM4A 2G2FA 1OL2A 2OIBA 2P0CA 3SW4A 2EWAA 3EQIA 5HO7A 4M12A 3ZFMA 1Z57A 4G3DA 4GT3A 4FKTA 2VX3A 4PP7A 4YJQA 5JZJA 1FINA 1U54B 2W1EA 3LXNA 4EEVA 5GJDA 3AMAA 3KEXA 3CJFA 4FV9A 4AA5A 4BYJA 1IAJA 4IWDA 2PVHA 2G9XA 2XM8A 3R00A 5DRBA 2YDKA 3IQ7A 4C2WA 4TYGA 1UU3A 3QKMA 1JAMA 3H30A 5EW8A 4BL1A 4JX3A 5CTPA 3WE8A 3VN9A 2ZM3A 4FIFA 3EL8A 3R7UA 2KULA 3OBJA 3Q52A 4YJVA 5HKMA 3TT0A 5HBHA 4XLVA 2PVKA 3NZ0A 2WFYA 1ZMUA 5FXSA 2A4LA 2R9SA 3KCFA 3ZLXA 4A4XA 4RWKA 3OROA 4YZDA 2OZOA 3MS9A 3PVWA 2V62A 4S2ZA 5D12A 3O23A 3W0NA 4ZMFA 4C33A 2IVUA 3KCKA 1IR3A 3IECA 4EOSA 4TNBA 4W4VA 2QU6A 4QYYA 1MQBA 1OKYA 5I9WA 3LM5A 3PSDA 4MNEA 4O7RA 2CN5A 3W16A 3HKOA 5ANIA 2WU7A 4AOIA 3V5PA 1FOTA 3N51A 4JBOA 2XEYA 4QP6A 5EYKA 3HP5A 3QA0A 4H39A 2E9NA 4QO9A 3D4QA 4BHZA 3RM7A 2HOGA 3RBWA 4AE6A 5KMJA 3TDVA 2YIWA 4QQCA 3DKFA 4QTBA 4I6LA 4FG7A 2EVAA 1TQMA 3G9NA 3PVUA 3LFFA 4TXCA 5M55A 3FLQA 3BYSA 3O8UA 3D0EA 4M69A 3RHKA 2PYWA 2V55A 3TG1A 3LOKA 5EDQA 2A27A 2B9JA 5J95A 1R3CA 2GPHA 3LXKA 2CNVA 4IB1A 3F2NA 4AE9A 4RGJA 3A4PA 2V7AA 5CF4A 4L46A 2C1BA 5CAUA 3W0OA 2JKKA 4H3PA 2CKPA 3QYWA 5C8NA 5IQCA 3ULIA 4RVKA 5CT7A 2ZYBA 4JBVA 2EB2A 2ESMA 3BE9A 4XV2A 5LCJA 4TWPA 4OBOA 3OUNB 3PLSA 3HRFA 2X9FA 3Q9XA 3QKKA 5K5NA 3NX8A 5J1VA 4AWIA 4IEBA 4RFZA 5FQDC 2C3IB 4QMOA 5GNKA 3FMMA 3FXXA 3I0OA 3ZBXA 4YZBA 3EL7A 3UQCA 2QOHA 3C5IA 4RG0A 3AT4A 3DFCB 3OMVA 4DTKA 5HESA 4EUTA 3GI3A 2W1CA 5IDNA 4CZUA 4DBXA 3EB0A 4ANBA 2V5QA 2X0QA 5JZNA 3H9OA 5L3AA 3K5UA 5HG7A 2CMWA 5CT0A 3NLBA 3FI4A 4YR8A 3DDPA 4IB5A 4FNWA 3Q5IA 5HG9A 1ZOEA 4U0IA 2XARA 3CPBA 4MNEB 3TNWA 4OTGA 4O83A 4KBCA 1OIQA 4K0YA 3RZFA 3UDBA 3IGOA 4C4HA 4EHGA 4A4OA 4N6YA 4BKJA 4RVLA 1ZARA 1PXPA 3CJGA 4TYEA 3OZ6A 5J7HA 4RFMA 5FTGA 4O7WA 4O22A 1I09A 3HGKA 3MH2A 4M69B 1ZYJA 5HGIA 5HCZA 1NVRA 4FTRA 5TT7A 4JDHA 3L9MA 5ANDA 2RFDA 4IX4A 5G1XA 1H01A 3S0OA 3EMGA 3P5JC 4HCTA 2C0TA 4U80A 3RAHA 1LR4A 4JR7A 3LFDA 2GFCA 2PL0A 4O96A 2WMSA 4AN9A 4XBRA 4N57A 1SNXA 4D0XA 3QTZA 4DGOA 3SRVA 1OMWA 3DJ5A 5AV0A 3VJOA 2HXQA 5A4TA 2XP2A 4E4MA 5EOBA 5AMNA 5F95A 2IEWA 4EHEA 4M68A 4O91A 1MP8A 3GVUA 3PUPA 3IONA 2NPQA 3E3PA 3QTUA 4HGSA 4UWCA 3RALA 2QQ7A 3M11A 4NW5A 3LMIA 2WMRA 3TJCA 2HIWA 4MX9A 4HVDA 3QRJA 3LFNA 3ZRLA 3UIBA 4IDVA 3ALNA 3MFTA 1YHWA 4YLLA 1YOJA 3DZQA 4D2PA 4IBMA 1GIJA 4OT5A 2OWBA 4J96A 5IA1A 3OW4A 2LGCA 3MTFA 1PRYA 3IW6A 5EW3A 3VS4A 3BX5A 3I1AA 3O96A 1GIIA 3VAPA 5KCVA 2RIOA 4JNWA 3V8SA 2XNEA 5DR6A 2XAOA 5IQIA 3OCGA 4B4LA 2GNIA 4BIDA 5AP7A 3DKOA 2JDOA 3WIKA 4AF3A 3C5UA 5CEOA 4ZSEA 4IJ9A 2XJ0A 4KIPA 4PMPA 4D9TA 4NJ3A 2HWOA 3C0HA 4FKGA 5B7VA 4R77A 4IE9A 2GNLA 2QO9A 3DA6A 4ZAUA 5AFVA 4IXPA 3R8UA 4HYIA 3TUCA 4G3FA 3QFVA 3PP0A 4NTTA 3WZJA 1U59A 4EK3A 3RPRA 3HMPA 5CXZA 4F9AA 3VUDA 3BHYA 3KXXA 4ANMA 1M14A 3FMLA 4WUAA 3TZ9A 4E26A 4D2WA 3S2PA 3QRTA 1TFFA 1H28A 3QUPA 3II5A 5HTBA 3FI2A 3HUBA 5K4IA 2XK4A 1H08A 3BU5A 3FY0A 1O6KA 1XQZA 3PVBA 1RDQE 1Q3WA 3LM0A 4EC9A 2YJSA 3SRVB 4DE4A 4TYJA 1M7NA 3KREA 1I44A 4FL1A 3PY3A 1W2FA 1Y57A 4P5QA 3BV2A 1G8KA 1P5EA 3U54A 3R2YA 4L00A 1PMEA 4S32A 4WBOA 5DT4A 4O0SA 3KVWA 3ALOA 3IDPA 4G6NA 3V01A 3QQLA 4JIKA 4PMSA 2RL5A 2Z7RA 4YBKA 4RBLA 2XM9A 1XBAA 1UWHA 3CS9A 3ODYX 3ZDUA 3GCUA 4QTEA 2R4BA 4I4EA 4C3PA 5IF1A 3SG9A 3O5AA 3PZEA 4Q5EA 2GHGA 4IM0A 3R8PA 3FMHA 1URWA 3AGMA 3HDNA 3FMEA 4OTPA 3UNZA 3DY7A 3ZLYA 3S4QA 3MA3A 2XNGA 2VUWA 4OTRA 4XS2A 4ZY5A 2WGJA 3QALE 4PL3A 4ZK5A 2NYAA 4RJ6A 4N6ZA 3AQVA 4MAOA 1KWPA 2UZVA 3ORXA 5KMIA 4MUQA 3GGFA 4O1OA 4RJ5A 4G1WA 4KS7A 5DEWA 3QWKA 4ANNA 3RPVA 2R3LA 4FTQA 1B6CB 4GV1A 1OI9A 5IEYA 5KMKA 5BMMA 5I0BA 1Y6AA 1PXKA 3BU3A 5JFXA 4FODA 3SW7A 2VV9A 2YABA 3V8WA 2VN9A 4GW8A 3Q4TA 3BL9A 1XH7A 2YM4A 1KOBA 5FD2A 4IVDA 4DH7A 4AG8A 3QD2B 3P86A 4FA2A 2WQEA 4PV0A 2JITA 3CXWA 3PA5A 1BMKA 4RLKA 5IEVA 2OZAA 1H0WA 1XR1A 5L6WL 2UVZA 4ZOGA 3TTJA 4GT5A 4GH2A 3EYGA 3ZYAA 1Z5MA 2PMIA 4PX6A 1OUKA 5K3YA 4AN3A 2VTTA 3KMWA 3ORIA 4QYFA 3UIXA 3NEWA 4R5YA 2H9VA 3QF9A 2JLDA 4O6EA 4AAYA 1OIUA 4C57A 4YUQA 2VTAA 4FG9A 2YCSA 4BCHA 2G01A 3VBQA 4CGAA 1PYXA 2XBJA 5E8SA 4F1MA 5IEXA 4AXFA 3W2CA 3KXGA 3MJ1A 4C4GA 5L6PA 1VYZA 3VQHA 3P23A 2PVMA 3D14A 5BMSA 4EQCA 2OFUA