4E4NA

Jak1 kinase (jh1 domain) in complex with compound 49
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
302
structure length
291
Chain Sequence
GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPHIADLKKEIEILRNLYHENIVKYKGICTEGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK1
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 291
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e4nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e4nA01
4P90A 2IVSA 3C0HA 1O6KA 4G16A 5JFWA 3L8PA 4E4LA 2G2HA 3PZEA 4U0IA 4USFA 4RX8A 3IONA 4OT5A 3IDCA 1J7UA 2WIPA 3NUXA 5KBQA 3LM0A 3GVUA 4RC4A 3OBJA 5DOSA 3U6HA 5JN2A 5CF6A 4QP7A 3OTUA 2QNJA 3VUKA 5FXRA 5F94A 4GKHA 4O21A 1XH5A 4FTUA 4MXCA 3PPKA 4TTHB 2CMWA 1PF8A 3FLZA 4GFGA 5LVLA 4XG7A 4M68A 3DLZA 3QLGA 3BRBA 4WKQA 3UOKA 5A14A 5B2MA 5EI8A 4CD0A 3ZM4A 5TT7A 1IASA 2UZUE 3NUYA 2C3KA 3D7TA 5L8KA 2XNBA 3TKHA 2HY0A 3QX4A 4AZFA 1WBNA 3LJ0A 2UZNA 1PXIA 2J9MA 5HTCA 2J0IA 5BMSA 4E73A 3M2WA 2QU5A 3VNTA 3HV6A 1ATPE 4R7BA 5HD4A 2HY81 1M7QA 3ERKA 4R3CA 4FMQA 4D2PA 4HVIA 3UQCA 2AUHA 2VWVA 2W9ZB 4HNIA 3PP0A 4PWNA 1Q97A 2R0UA 4XRLA 5FG8A 4P2KA 2C0IA 3VUMA 2EB3A 1R1WA 2RG5A 3NW5A 1H07A 3MH0A 4G5JA 4J98A 4ACMA 3H9RA 4FSUA 2QO9A 5HTIA 4YZ9A 2VWIA 3PA3A 2OWBA 3BE9A 4ZZOA 4PPBA 2EWAA 3E8EA 5ANDA 3UG1A 4CFFA 4TYHB 2FSLX 2X6EA 4RLKA 5FXSA 3U8WA 3QTRA 2OGVA 2NP8A 1XR1A 4QP3A 3GQIA 4KS8A 4WD5A 5E8WA 3B2TA 5KE0A 3ZU7A 3DB6A 3VHKA 1QMZA 2X7OA 4GSBA 3EL7A 4FKLA 3ROYA 3REPA 3KEXA 5BQ0A 2OFVA 5M53A 4O81A 2Y4PA 3PE2A 4R3RA 2IG7A 3LCSA 5HVJA 3ZH8A 4LFIA 5EM5A 1XQZA 3OF0A 3SD0A 3NR9A 2W0JA 4YHJA 4OBQA 5LJJA 2A4LA 3VIDA 1ZLTA 3D94A 2PHKA 2LGCA 4S34A 5JZNA 5AP4A 4BI0A 5FTGA 5LVOA 3RPRA 3FSKA 4TZRA 2I0HA 2VD5A 1FQ1B 3LFEA 4XG9A 3U51A 4O2ZA 3FQSA 4IJPA 5DT4A 3CKWA 4ERWA 4FK6A 4R1YA 4R7HA 4EC9A 4FTQA 4Y46A 4C2WA 4ERKA 3KCKA 2W5BA 2BFXA 2HWOA 5CSPA 4HGEA 4XRJA 4ZY5A 2P55A 4CFXA 3EYGA 4PPAA 3PTGA 4UN0C 1YXUA 4FKPA 3FQEA 3IK3A 3FZTA 2UW8A 3O7LD 4UALA 2QONA 1XBCA 5AUZA 3ACKA 4PMPA 1U54B 2W1GA 2UZOA 3FZSA 5L8LA 1BX6A 4QYFA 3TXOA 4GT3A 3V3VA 4AOTA 4ACCA 2V7AA 5I3RA 3DZOA 3BKBA 4FV3A 3H3CA 3VBTA 1IAJA 4F6UA 4NYEA 2XNPA 4QP1A 5BVEA 4QTEA 1PW2A 1GZ8A 5J7BA 4J52A 2HWPA 2BALA 4ZAUA 1TVOA 4UXQA 3KULA 3ZEPA 4BCJA 4CLIA 4DYMA 2NPQA 5ANOA 4MF1A 1WVWA 3FDNA 4JJRA 3E88A 3FUPA 4S30A 5AR8A 3VS1A 3F69A 4D5KA 2UW9A 4RWIA 5FEEA 4XEYA 3O8TA 4ITIA 2YWVA 2IO6A 3DKGA 3NDMA 4PL4A 3IW7A 5DEYA 1OPLA 1GY3A 5HE3A 4D4YA 4QMLA 4QQCA 4PTEA 5AIRA 2OF2A 3QBNA 3ORXA 2JFLA 5CF4A 3EIDA 4U5JA 4IB3A 4TWNA 4DG2E 5AUWA 5CTPA 4YURA 1KE6A 1A9UA 1H24A 1PY5A 4G3EA 4IVDA 3EMGA 4JIAA 4QMWA 3VUIA 4CMTA 3DAEA 4JQ7A 4O2PA 3V5JA 4H3BA 2PYWA 4RMZA 5H3QA 2H8HA 2A27A 5EOLA 2UZEA 3GCPA 3GU4A 4D1ZA 1JKSA 2ZB1A 4UB7A 4ZSJA 2VTPA 4LMUA 4RRVA 5M56A 4ZMFA 1UNGA 2Y4IC 1Y91A 1NVQA 2X1NA 3A4PA 4BWKA 3GC0A 3GFEA 1OIRA 3NW6A 4PTGA 2UZTA 4U43A 1TKIA 4NWMA 2J0KA 2W4JA 4FKUA 5AR3A 2R7IA 5D41A 4QP8A 2PU8A 5CWZA 5E8TA 4PDSA 3R22A 4BKJA 1E1XA 3O7LB 2PWLA 3FV8A 3R9OA 2VTTA 3MA6A 4E4NA 4FV9A 5HQ0A 5KX8A 5TKDA 2VWXA 5JSMA 2QOFA 4QYGA 5A9UA 4DEHA 4DT9A 3CGOA 2IZTA 5DR9A 2C6LA 3Q96A 5M4CA 4NJ3A 1CDKA 4FZDB 2KULA 5ANIA 4FKQA 1SVGA 4I6QA 3MFRA 2UW4A 1FBNA 5C01A 3NZ0A 1ZARA 1ZWSA 3OP5A 4FIHA 1L8TA 4I20A 5ICPA 4ZP5A 3S4QA 3HRBA 3TIYA 4F65A 5IA3A 3ZO3A 4NEUA 4FE2A 3F88A 4TPTA 4YJUA 2GQRA 3MS9A 3DBEA 4FIJA 4ZK5A 3QUDA 3EKKA 4Z55A 2XJ1A 3D5XA 4XG3A 3A4OX 4HZRA 2ITWA 2C5YA 2JKOA 2IZUA 4ACGA 4I6FA 4GH2A 4BCMA 4J95A 3VBXA 4O1PA 4F99A 5CANA 3AG9A 2CSNA 2XZSA 2Y6OA 3DBQA 4FKWA 5AM7A 4UMRA 1FGIA 2OBJA 2QQ7A 2XCKA 2ZMDA 4IAZA 3QYZA 3BYVA 4B0GA 4E1ZA 2I40A 2X9FA 4JT3A 2QHNA 2JAMA 1JBPE 4WSYA 1OIUA 3R8UA 5FP6A 4NZWB 4AN3A 2PMLX 4KIQA 4R7IA 4CQGA 4CSVA 2ZM4A 5J95A 5AV1A 3QZGA 4RSSA 4DG0E 3VBWA 4H39A 2OZAB 3RJCA 5C4LA 5AAEA 2JIUA 4J96A 2E9UA 1OKYA 3A8XA 3Q9XA 5E8YA 4KBCA 4FT9A 2F7XE 4Y5QA 2W1FA 5KUPA 3QKLA 4XBRA 2RFNA 5IKWA 3DKFA 3JPVA 3CGFA 3IGOA 2BZIB 2W1HA 2W5AA 3R1NA 3UE4A 3HMPA 4FSWA 3LVPA 2W1EA 4Y73A 5JFVA 3HRCA 4WT6A 3RM7A 1CKIA 4IB0A 4I21A 2ZVAA 3TN8A 5KKRC 3DFCB 3KCFA 2Y6MA 3RNIA 2W1IA 3A7HA 4X3FA 5HBJA 2ZM3A 4DH8A 4BN1A 1KE9A 2O63A 1H26A 2ZB0A 4QQ5A 4JBQA 3FXXA 4XOZA 2R4BA 4HPTE 3GC7A 2X8IA 3GP0A 3LM5A 1JVPP 3P7BA 2J51A 4H58A 4H3QA 1ZY4A 3F5GA 1YHWA 4AQCA 3HDNA 4WUAA 2VTLA 3FMKA 2WU6A 3LMIA 4E6DA 4YO4A 1OUYA 4JXFA 3IO7A 3NAXA 4BIEA 2ERKA 3QGYA 5EFQA 4FV7A 4EJ7A 3NUUA 1UA2A 3MVHA 4O7NA 4G17A 4K0YA 4FTRA 4BTFA 2C6TA 4FF8A 2GCDA 3F5PA 5FTQA 4I92A 3FLQA 4A06A 1JOWB 2C3LA 2UZBA 2A0CX 3Q60A 3GBZA 3O96A 4XLVA 3ZRLA 3MESA 3UIMA 5FRIA 3G0EA 3KREA 1CKJA 2W1CA 5J1WA 1PMVA 4MD9E 2P33A 3LQ8A 4BDDA 5G6VA 4O0WA 4IAFA 3ENHA 3FI4A 5GJDA 2B55A 2XUUA 4RBLA 3PXFA 4EZ7A 3KRJA 5M51A 4ZIMA 4USDA 4HNFA 5C1QB 2VTHA 3OEZA 3F2RA 1UV5A 2XIZA 2YZAA 4IB5A 4W8EA 3QCQA 1DAYA 3DV3A 4I23A 4TYHA 2VV9A 3UNZA 2VWYA 1IA9A 2OU7A 2JKQA 2FSMX 3E3BX 2F4JA 3GB2A 3TKIA 4V0GB 4EOLA 4IX6A 3L9PA 4FTMA 4LRKA 4O22A 4QMUA 4RIXB 4GK3A 4C4JA 1BKXA 3MTFA 4TNBA 4E5AX 4EH8A 3RNYA 4CVAA 2RFSA 2OSCA 4RJ8A 5FBNC 4R5YA 4YJSA 2F2UA 3QGWA 5E91A 5BVOA 3BBTB 4D1XA 5HOAA 4TYJA 1WVYA 4UMUA 4F08A 3VC4A 5HE1A 3ZCLA 2JKKA 4UEUA 2QCSA 4BFMA 2J4ZA 4E3CA 3HRFA 5EI2A 4M97A 1Z57A 4P5QA 5M4UA 4ASEA 4B7TA 3OOGA 2VO3A 3ZUVA 3F3VA 3OWJA 4NK9A 5H8BA 2C1BA 4KBKA 2IWIA 4FNZA 4LGHA 4O38A 2XNOA 4U9AA 4BDCA 3EFJA 3EN5A 4XH6A 4EHZA 3DXQA 3FQHA 4M13A 3PYYA 4OTIA 2B7AA 3MIYA 3CXWA 2EXCX 4YZMA 5D10A 3TIZA 3HNGA 2XJ2A 4AAAA 2YIWA 4CFVA 2QOIA 3CLYA 3C0IA 3HECA 2BZHB 2WMRA 4ZOGA 4B4LA 2IPXA 4UWYA 5ETFA 3R7EA 5BYLA 2J7TA 4OGRA 2HXLA 4FSZA 4G2FA 3RINA 5BYZA 3BU5A 3MYGA 4FV0A 5FDXA 4AOIA 1OM1A 3A7FA 4KRDA 3D5WA 5AMNA 2X2MA 4XG4A 2OIBA 5KCVA 5K3YA 2BAQA 4YSMA 4W8DA 4I5HA 1U54A 3BBWA 2WMAA 2VRXA 2HYYA 3FMHA 4KWPA 4DBXA 1H8FA 4IHPA 2UVZA 4UZDA 3EWHA 5HCYA 2QO7A 4F7LA 1Q3DA 1MQBA 4JI9A 4K6ZA 4O6EA 3R7IA 4Z7HA 4H36A 4Q5EA 4RVKA 3VULA 4F7JA 3UIXA 3UO4A 3QWKA 3MWUA 5JGDA 4FR4A 3BWFA 4F4PA 4R77A 3ELJA 4Y85A 4EZ3A 4YBKA 4RZVA 2UZLA 3A60A 3DB8A 2QHMA 4BCIA 2YEXA 4F6SA 2G2IA 2R3HA 4P7EA 1V0BA 3WZKA 2HCKA 3II5A 4YJRA 4I6HA 1Y8YA 3KF4A 3F82A 3QYWA 3GI3A 4KNBA 4FA2A 1M17A 4MAOA 4IZ7A 2XRUA 3HGKA 4D4SA 4X2NA 2JDRA 4GVAA 2ITNA 2R3GA 2WTCA 2NO3A 3H10A 2PTKA 4DN5A 5C03A 4Z9LA 4DINA 3PXKA 3UQFA 3CR0A 3MW1A 4AN9A 4ORKA 3EYHA 4FIFA 2B9HA 5IQCA 3QQHA 3P9JA 1DAWA 1R0PA 1OKVA 5IA0A 5H8GA 2I0YA 2B4SB 4NM5A 4XHKB 4IVAA 3ZZWA 1EH4A 2C68A 3PLSA 4FIGA 4GU6A 2RSVA 5F4NA 3OXTA 5ACBC 4EHGA 5AM6A 1P4OA 2WNTA 4GT4A 4PP7A 5L2WA 2B0QA 2VX3A 4MEDA 3LW0A 3FBVA 1URCA 4V05A 3VS6A 5C9CA 2V55A 1LR4A 4RJ3A 3UOJA 3QALE 4BI1A 5CU0A 4AE6A 5JZJA 1QL6A 4A9TA 3VVHA 5A46A 1REKA 3NYVA 5B2KA 4IX5A 4EOOA 1JLUE 1H25A 1UNLA 3NUAA 2KTYA 2J90A 4JNWA 4FX3A 3BI6A 1PXNA 2R3IA 2C6DA 4MF0A 1Y8GA 4YTIA 3SHEA 4ZTMA 5AUUA 1UNHA 5IA2A 2O2UA 4YJVA 4FKOA 3ALOA 2W05A 1GZKA 3CEKA 3R1QA 5JK3A 4I5PA 2FSTX 3PSCA 4JG6A 5DR6A 4YC3A 4BYJA 3R9DA 2GQSA 3AD6A 3QRTA 4CCUA 3C13A 4CZUA 4FYOA 4GU9A 4FG8A 2XNEA 4F0IA 2YJSA 4OR5A 5IISA 1Q5KA 4E20A 5HO7A 3SDJA 4EH2A 4N6ZA 2WQOA 3VBVA 5DYJA 5LWNA 3TCPA 2WQEA 3WE8A 3GT8A 3S00A 5EKNA 4RX9A 2PE0A 3SXRA 3R30A 5G1XA 3L8XA 4UMPA 2GHMA 1Q61A 2PVKA 3VUTA 3KRXA 3I81A 3ZZEA 3BLQA 2ZJWA 3EFWA 3QQKA 4NH1A 4EI4A 1CMKE 3DK6A 4IWOA 3FWQA 4O0VA 2JIIA 2PZ5A 4RIOA 3OG7A 4DFLA 4AZEA 4RWLA 5IQAA 3OCBA 1FVTA 4MXOA 4Q5HA 3KQ7A 3C5UA 3V5WA 4UMQA 1B38A 2PVHA 3FSFA 2OZAA 4WHZA 3BIZA 1SYKA 2F2CB 3L9NA 3NNXA 2ITUA 4K2RA 4EZ5A 3NW7A 3QTUA 4ZTNA 1W84A 4FTOA 2JEDA 5DT0A 3CQWA 2C0OA 1QPCA 4RC2A 2EUFB 2XCHA 5LQFA 5EYMA 4CXAA 2DS1A 3HEGA 3V8SA 5AR7A 5CASA 3BV2A 4C62A 4I5MA 2XNNA 5CALA 3UJGA 3IGGA 4OBOA 3ORMA 4G3GA 1PXOA 3FPMA 4F1TA 5BPYA 3EQBA 4LV8A 2IVVA 4EH9A 3ALNA 3VAPA 3K3JA 3G51A 4Z16A 3OW4A 4WNPA 4NL0A 3FMJA 5IQFA 2O3PA 3BLHA 3P5KA 1ZY5A 3SQQA 3MSSA 4CFWA 1F0QA 3R8ZA 4XNEA 3ZXTA 2GHLA 1PKGA 2C0TA 4YSJA 3ZUTA 4JX3A 2IJMA 1BMKA 1UWHA 3DT1A 5GINE 3LXPA 3C4CA 3W2QA 4FGRA 4FT7A 1H1WA 1W83A 4ITJA 4M14A 1W0XC 5D12A 5FGKA 2XK4A 2CCHA 2ETMA 2QC6A 1FMKA 4FG9A 4GK4A 4JVGA 3BCEA 1P2AA 1PYXA 3ZSIA 1LEWA 2DWBA 4X7QA 4KBAA 5DT3A 2IVTA 3BHYA 4BKZA 2C6MA 5L2SA 4UYNA 5FUTA 2E9VA 4LQMA 5HE0A 1Q99A 3CCNA 4OUCA 5EM6A 5HG9A 3K54A 3UP7A 1K2PA 4AG8A 4QQTA 4ZLYA 4FKGA 1GZNA 1CTPE 2W96B 1OUKA 4II5A 4DFYA 2GNHA 4AGDA 1DS5A 2BRHA 3A61A 5JFSA 2WTWA 5AUYA 1GIIA 4O7RA 3RTPA 3W2CA 5E7RA 3FPQA 3IW8A 2BAJA 5AUVA 4ZTLA 1BI7A 2YCSA 5DEWA 4P5ZA 3Q5IA 5AP1A 4M7IA 4F9WA 4RX5A 3ZHPC 3R2BA 4EQCA 3F2NA 4O0XA 3DQWA 5EW9A 5GJGA 4ZXTA 4S32A 3RPSA 4BBEA 2CGWA 3KKVA 2ITQA 1IAHA 3EB0A 2PUIA 1OL7A 2XBJA 4ENYA 5E8ZA 5I4NA 2VTJA 3SGCA 1T46A 5GIOE 2DQ7X 1H1RA 1OECA 5EK7A 1ZOGA 2WOUA 3C50A 5AAGA 3DZQA 3VRZA 2OLCA 3Q2MA 5LMAA 3KXGA 3KK9A 4KIPA 3NSZA 4R5SA 3QRJA 5DG5A 4IAYA 5CAVA 2J0JA 3PA4A 3P7AA 3PG1A 3SVVA 3HV3A 3MTLA 4FKVA 4UWBA 4B99A 3BHVA 4V0GA 5HIBA 3EQGA 1M52A 3D9VA 4U45A 3W2OA 5AA9A 3NNVA 3BYMA 4RIXA 3E5AA 5IA1A 4ASXA 2ETRA 3ZLWA 3MIAA 3LE6A 4NKSA 5D1JA 3TNQB 3DK3A 3UZTA 2HOGA 4RGJA 1YHVA 3QRIA 3QHRA 2VGOA 3G6GA 2WMBA 4GG5A 4XG2A 4RQKA 5I9UA 5A3XA 4ZY4A 4FZ7A 4NCTA 2EB2A 5CNOA 1XH9A 2XK8A 3D83A 4GFMA 3QX2A 4PF4A 3DXPA 3DS6A 1XH6A 4FL2A 3EQIA 4EK6A 2GHGA 1FPUA 3O23A 4YJOA 4D9TA 2E2BA 3W2PA 3I79A 4GUBA 4BYIA 4CTBA 2XEZA 3P1AA 5D7VA 5TE0A 2HIWA 1XH4A 3FC1X 4IM2A 3H9FA 5B0XA 4YR8A 5KMNA 2Z7LA 2VTAA 3OC1A 4QPSA 3DBDA 4PP9A 3KMUA 5TOZA 4C4EA 4ALUA 1E9HA 4EQUA 3Q52A 3WF7A 3BU3A 4K1BA 4EL9A 2I7QA 1P14A 3BQRA 4WRSA 4U8ZA 4C61A 4EOKA 5EDQA 5ETCA 3FZPA 5IZFA 3OY1A 2XVDA 4O0RA 4X3FB 1PXKA 2ZDUA 5CAUA 4HGSA 2WTVA 4C35A 3QC4A 5L8JA 4EH6A 4FSYA 4KKGA 5J1VA 2UUEA 4AGCA 3VRYA 3FKNA 3QZIA 4RLLA 3GQLA 4E7WA 2QOCA 3N4VA 4D2RA 4BDKA 3ZLSA 1WBWA 5FM3A 5L6WL 3MVLA 2QR7A 4CMUA 2OH0E 4C38A 2VUWA 3RWQA 3U9CA 5KHXA 1W8CA 2CDZA 1ZXEA 2R64A 5DH3A 3TNPC 5EG3A 2WTDA 3MVJA 4V04A 2B9FA 4GT5A 5CI6A 4GYIA 4AX8A 4QYEA 3V6SA 3E8NA 4TN6A 2ONLA 2JD5A 2X7GA 3TZ9A 3VUGA 5T3QA 3ZBFA 3HV4A 4PMMA 1YRPA 2PSQA 4A4XA 3LLAA 4IE9A 4EH3A 4U81A 3PXRA 2CKOA 5AV4A 2RL5A 3BGPA 4BDFA 2F49A 4FG7A 4C8BA 2XK9A 3O50A 5IQHA 4IEBA 4KSQA 4ZLOA 3AC2A 5DNRA 1E1VA 3ORNA 4KINA 5K4JA 2ITVA 5HHWA 3RCDA 4PL3A 4O7YA 5KMLA 4MNEB 4WO5A 4DT8A 3QZHA 1XWSA 5CU6A 1M2QA 3QTZA 5C8MA 3QFVA 4PDYA 3DBCA 4RJ5A 3W55A 5LMKA 5FWKK 4BR3A 2UVYA 3I5ZA 5CF5A 4AS0A 4CLJA 4FIIA 4ZMEA 4ZZMA 4B8MA 3EL8A 3LKMA 4BCKA 1H28A 4K9YA 3W2SA 3MGYA 4CRSA 2YITA 2W4KA 2XEYA 2CLXA 3BYSA 4ZSGA 4ANMA 5E4HA 3Q4TA 3T9TA 2ITOA 5H2UA 1IG1A 3QLFA 2WU7A 4YTHA 1CKPA 2XIYA 1XO2B 4BCGA 3OT3A 4YUQA 4FK3A 1T45A 3U6IA 3CTHA 5IQDA 3UNKA 4ANSA 2X0GA 1W7HA 3HUCA 3OY3A 4D0XA 3P7CA 4BIDA 3TZ8A 5HNIX 4I93A 3M1SA 4E6QA 3K2LA 4FTTA 2Y8OA 2DYLA 4LGGA 3S0OA 3PJ1A 1H1QA 2ITYA 4AW2A 5AAFA 3HMNA 4MX9A 3Q4CA 4AACA 4DFZE 2XM9A 4FOCA 3ZTXA 3ZO4A 4YLLA 3DKOA 2EU9A 3OEFX 2QG5A 4PX6A 2BAKA 4FGBA 3LCDA 4QMXA 5CAPA 3A7GA 4RJ7A 4EH4A 4GJ3A 5BUEA 3QCSA 2BDFA 4FV1A 3TTIA 4FKSA 2ZYBA 4RJ4A 1PHKA 5FTOA 3DPKA 4DAWA 3RK9A 4X2KA 4FZFB 4L7SA 2V5QA 3QD2B 3ZDIA 5CY3A 3UZPA 4DGOA 5EM8A 3QUEA 1G8SA 4XLIA 4BY9E 1Z9XA 1MUOA 1CSNA 2O65A 2UW0A 3FKLA 3RCJA 2BTRA 4DFXE 4EOSA 4HYSA 3IW6A 3DDPA 4WUNA 1OKWA 2YZLA 4CKIA 3CIKA 1PMUA 3HMOA 5LVPA 4HYUA 5CSXA 4GV1A 5BX0A 3PVBA 4V01A 1KE7A 5AP7A 3RWPA 2V7OA 4I94A 5M07A 2GS7A 4U79A 5HCZA 2WIHA 1VR2A 2WKMA 3LCKA 4L3LA 4O86A 1JSTA 4QMNA 2O5KA 4GRBA 5LCKA 1MP8A 4FL3A 3POZA 4DITA 4PNIA 2X6DA 1YDSE 1URWA 4J99A 5HG8A 4DH5A 2WMSA 3MH3A 4JS8A 2G01A 4NW5A 2GFSA 4MXAA 5HVYA 4GEOA 4NM3A 5HBHA 5IUGA 3BGZA 4BHNA 3C4XA 3O51A 5HO6A 4CMOA 1OL5A 3R63A 5BVNA 4FV8A 1YVJA 2W1DA 5EHOA 4XX9A 1J7IA 3CQEA 3Q6WA 2W1ZA 3QWJA 4DTBA 2R9SA 4EWQA 4N57A 1GJOA 5GZ9A 4HCVA 2J5EA 2WHBA 4O1OA 5GHVA 3ZLXA 2BRNA 2HAKA 1GIHA 3GCUA 4DEEA 3OWLA 4WSQA 4FTAA 5KMKA 3SW4A 2R3RA 2OI4X 1U5QA 5A6NA 5CXZA 4WRGA 3BGQA 3PJ3A 1OIQA 4IM0A 4YGAA 3ETAA 1H0VA 4IVBA 3OD6X 5CU2A 3UMWA 4M12A 3QTXA 3KFAA 1IA8A 4IXPA 4H1JA 4FV5A 4FI1A 4CG8A 3AD4A 4ACHA 4IFCA 3L8SA 1VYWA 4X0MA 3R7OA 4HVDA 2YWPA 4WA9A 1WBOA 5BUJA 4USEA 4O7ZA 4EYJA 3UODA 4QMOA 2QURA 1ZRZA 4EHVA 1AGWA 1ZOHA 2XIXA 4NU1A 2VNYA 4K11A 4FIEA 4O91A 4ONAA 5E1SA 5EI6A 4BBMA 1DI9A 2CKQA 3TV6A 3UG2A 3AT3A 1UU3A 4RJ6A 5IQGA 2JLDA 3CS9A 4QT1A 4S31A 2YM8A 2R3KA 4DFBA 3GEQA 3FC2A 1FVVA 4MBIA 3S95A 2Y9QA 4KRCA 1H08A 1Q24A 2RKUA 4O0SA 3RAIA 4X2GA 2YERA 3TWJA 4F7NA 5ITAA 4F1MA 1P4FA 3CD3A 3OS3A 4GL9A 4BDBA 2R0IA 2EXEA 2YJRA 4RA5A 4F6WA 4MHAA 4HW7A 5IMEA 3UO5A 3R01A 3FI8A 1H00A 3ZBXA 2VX1A 3MJ1A 1RDQE 1YI4A 3MY5A 1PMNA 3GU7A 3PZHA 2I1MA 4JG8A 1V1KA 3Q4ZA 5KHWA 3C5IA 5IQIA 1KSWA 2YAAA 2YABA 3LXLA 4EOQA 4I5CA 4I6BA 3OHTA 4YZBA 4UYAA 5J7HA 1U4DA 4CG9A 3EFKA 4GCJA 5DFPA 5E8UA 3O2MA 5CS6A 4CKRA 1WZYA 2BHHA 4NFNA 3RPOA 4EKKA 2JDVA 3CBLA 3KMWA 3R7VA 1OBDA 4MH7A 4E6CA 2CN5A 3CPBA 2IVUA 4FT0A 4AWIA 4EONA 1J91A 3DJ7A 5C4KA 1WBSA 4S2ZA 5JKGA 4F7SA 3P0MA 4WNMA 4YU2A 5GZAA 4DGGA 1UKIA 3KXHA 4JR3A 3MFUA 5HZNA 3TM0A 1MRVA 3EFLA 3HA8A 5AR5A 3G9LX 3V5QA 4RQVA 4CKJA 5KMJA 1Q8WA 3ENMA 3PWYA 4FKRA 4UV0A 4YJNA 4Q2AA 4DEDA 3GCQA 5K0XA 1DM2A 3ATTA 3RI1A 1MRYA 3MFSA 3OROA 2J50A 2QD9A 5H8EA 4A9YA 4C36A 3M11A 4ZJIA 5L3AA 2IZRA 3Q9YA 4G9RA 4K8AA 5KO1A 2RFEA 2WAJA 1WBVA 3C7QA 5L2IA 1P5EA 2IW8A 1ZYCA 3ORZA 5DVRA 4YMJA 5M44A 3HL7A 4WBBB 2FUMA 3F9NA 5KMOA 3KXXA 1YXTA 3ULIA 4BZOA 1H27A 3KA0A 4F0GA 5KBRA 5AP6A 1XBAA 1IRKA 1XH8A 3LQ5A 2JC6A 4D2TA 1OPKA 2WXVA 4U3ZA 3WILA 2QVSE 4ZTSA 4QTBA 4D0WA 2XK3A 4QYHA 5CVGA 4IACA 4CEGA 3KVXA 3TKUA 1M2PA 3UC3A 2QKWB 5FDPA 5DA3A 4QPAA 2QLQA 3KRWA 1LPUA 3ULZA 3WF9A 3RHKA 2Y7JA 3ZRKA 1OL2A 4L53A 4OLIA 3RK7A 3UVPA 2YM7A 4DC2A 5E8SA 2PK9A 4RWKA 4BCHA 1B6CB 3KMMA 3DY7A 4MNEA 5EDRA 2F7EE 3N9XA 1V0PA 3BLRA 4FSTA 1VYZA 5DRBA 2QG7A 2WEIA 5BVFA 3EJ1A 3G9NA 1OBGA 2V0DA 2WMQA 3ROCA 3R9NA 3MI9A 3MV5A 3FMDA 4X2JA 2BFYA 3ID6C 4G3DA 4BDIA 2VTNA 3OMVA 3BHTA 3QAME 4AT3A 5HX6A 2YLEA 4K77A 4Y95A 4AE9A 1YHSA 2WTKC 3LOKA 2UW3A 3PIXA 5HEZA 3HA6A 4W4VA 3IW5A 1YDTE 3THBA 3VF9A 2BMCA 5CT7A 3GCSA 2X39A 4D28A 5IU2A 4U3YA 1ZZ2A 3R7GA 4X6QC 3VHEA 3NX8A 3CJFA 4RWJA 2C5OA 3NYNA 3DTWA 4O7TA 3QZFA 2XMYA 3GU8A 5D7AA 2J5FA 2W17A 1OB3A 3T9IA 3ZOSA 4MTAA 3UDBA 4FSRA 3NYOA 4F9CA 1JAMA 2UZVA 3P23A 4IZ5A 4Y72A 4EC8A 2YDKA 4PMTA 4WNKA 4O7VA 2PMIA 2VTSA 4FYNA 3PIYA 5IQEA 3AQVA 2OIDA 4L67A 1LUFA 2YHVA 5M57A 4ZJVA 2ETKA 4WIHA 4D4RA 4K33A 4JDIA 3RAWA 2JIVA 2VO7A 1O6YA 3EN9A 2YA9A 5C26A 4CTCA 4EWHA 4O0YA 1A06A 3ZC5A 1UU9A 3PRFA 3QKMA 2C69A 1WAKA 3ATSA 3WF5A 1ZMUA 4CRLA 5J5TA 5JGAA 4GMYA 3DDQA 3V01A 4FUYA 5HTBA 1R39A 3O8PA 3O17A 3QQFA 4F9AA 2B53A 5HNBA 2GNLA 5DHJA 5HESA 3AD5A 3DCVA 2JBPA 3LJ1A 3S2PA 3VS7A 2XKDA 4FODA 3Q53A 4U80A 3A7JA 3N51A 4KD1A 1ZMWA 4FKTA 2I0EA 1FGKA 3PY3A 3UQGA 4DGMA 2J0LA 5IEXA 3MVMA 5AP5A 5BNJA 1KWPA 4JL9A 5FM2A 2QOOA 3R7UA 5IUHA 4E4XA 4GG7A 2ZOQA 2GNFA 4FV4A 4RVTA 3GOKA 3ORIA 2YIYA 3FLWA 5JFXA 4X3FC 1U5RA 4CCBA 4YTCA 3QA0A 2W4OA 3EOCA 5T6KA 4W4YA 2B52A 2Z8CA 3PWDA 4UZHA 2BROA 4YO6A 5E8XA 1KE8A 2AYPA 3KVWA 4GW8A 4DLJA 3JY0A 4OAVB 4R1VA 3GNIB 3PJ8A 5CENA 3NMUF 4O0TA 5BMMA 3RAHA 2ESMA 2PUNA 4BWXA 2XF0A 4QQJA 2G2FA 4IFGA 3D4QA 3KL8A 2HK5A 4GK2A 1TQPA 3R0TA 3D15A 3B8QA 2HZIA 3I7CA 3DQXA 3I0OA 3FMEA 3H0ZA 2Y4IB 4QNAA 1XJDA 3A7IA 2BDWA 1OITA 3I60A 3NS9A 3W2RA 3FY2A 3RHXA 4D58A 3EQDA 5AV2A 4BGHA 4E93A 3R21A 4M66A 3C4FA 3QQGA 4CFMA 1OL6A 4J8NA 5A4TA 3P86A 5HVKA 1YI3A 2XP2A 2EVAA 2J2IB 2IW9A 2X4FA 4XUFA 4ZEGA 3WARA 5EQPA 3E62A 2Z7QA 3QXOA 4BC6A 4RIYB 2R3QA 3FE3A 4A9SA 4YC8A 4C34A 4DHFA 5AP2A 3TJCA 3MY1A 5LWMA 4UX9A 4GIHA 3LAUA 1G5SA 4B6LA 4E8AA 2R3PA 4RX7A 2O0UA 2HZ0A 2GNIA 3DBFA 1BLXA 3R00A 3QF9A 3HX4A 4HYHA 4QMYA 4BDEA 4M69B 3BHHA 4QMQA 5I9VA 5JEBA 3PP1A 4AF3A 4JBPA 3TL8A 4RG0A 5LARA 3NVKI 3LFDA 4MCVA 4PTCA 2Q0BA 1SNXA 2QOQA 3ODYX 3L8VA 3SX9A 4ACDA 1K9AA 2PVRA 2P2HA 2P3GX 3TZ7A 2PVNA 3Q9WA 1PXJA 3NNWA 5HIDA 3OTVA 3CQUA 3EN4A 3NEWA 3OUNB 4BDGA 3OT8A 4RZWA 4C58A 4EOMA 2Q83A 2XKCA 4ZSAA 3LXKA 4FVPA 3EQFA 3R9HA 3M42A 4R3PA 4C4GA 3FJQE 4G31A 4XV2A 2ZDTA 3UPZA 3MH2A 1HCKA 1GNGA 5EW3A 4FVQA 2BZJA 4I0SA 4P4CA 2BTSA 4KABA 5CEOA 5L2TA 4IDVA 4OTRA 2QLUA 1Q8TA 2X4ZA 5HNGA 1R0EA 4LOQA 4MWIA 5ANJA 1WBTA 3EZVA 3ORPA 5T68A 3RGFA 1PKDA 4RIWB 4HVHA 2HZNA 5J9YA 4LL5A 4BRXA 1J7LA 2QOHA 1U59A 3U9NA 4ZTQA 5K9IA 4EYMA 4PQNA 1WCCA 2YAKA 3ORKA 4GFOA 3LFFA 4IZAA 5HICA 4ALVA 5IQBA 3MJ2A 2ZMCA 3LMGA 4ANBA 3UBDA 3KXZA 3PRIA 2IN6A 3B8RA 3AC3A 2VN9A 1SVEA 3PUPA 5FD2A 3WIGA 4DEGA 5C8KA 3UIUA 4NTSA 4DEIA 5K5XA 1ZYLA 4FTCA 5KZIA 3Q9ZA 3SW7A 2Z02A 4QMVA 3R8LA 3POOA 5E9EA 4IWQA 2BRBA 1OGUA 4HGTA 3P4KA 3RKBA 1GAGA 1NVRA 5AV3A 5KKRB 2CPKE 1MRUA 1GOLA 2CN8A 4JQ8A 2R3JA 2JBOA 5JMSA 2CNUA 3PPZA 1GIJA 3OCTA 3V04A 3VUHA 1Q41A 3OCGA 2WO6A 4L6QA 4ASZA 3EQRA 3Q04A 1JQHA 4FEWA 3LFCA 4UMTA 3TNIA 3JY9A 1YKRA 3KN5A 3PSBA 4KIOA 4ASDA 4K18A 2BRMA 1M14A 5F20A 2ZV8A 5CU3A 5DR2A 4JDKA 5EYKA 4EEVA 3CJGA 5TF9A 1R3CA 1HOWA 5B7VA 3QRKA 4M0YA 4AZTA 2PL0A 4RT7A 4M67A 1U46A 5CI7A 3FZRA 4UWCA 2BKKA 5A4CA 2VWBA 2FH9A 4QMPA 4O27B 4OTWA 1RE8A 4A07A 2BHEA 5IG1A 2PMOX 5AR2A 3E92A 2YDJA 4NSTA 4BCPA 4CZTA 3FEGA 3VUDA 3G5DA 2JKMA 3HUBA 3D0EA 2Y0AA 4IMYA 1DI8A 2OKRA 3ACJA 3OOMA 5ANEA 4C02A 2PMNX 4EK5A 3QU0A 5EHYA 2XK7A 1OKZA 3PJCA 4J71A 5JT2A 4PV0A 2CCIA 3FZ1A 1Q8YA 4J7BA 5AX9A 4EHEA 3BWJA 3ZS5A 2JITA 2BKZA 4ID7A 4MNFA 2BPMA 3HYHA 3SXFA 4PNKA 3B2WA 4O96A 2BCJA 4QMSA 2PE1A 3TDVA 3W8QA 3R71A 3JVSA 2XKEA 2C3IB 4G6NA 3RP9A 3VQHA 2HW6A 3GGFA 3EN7A 1JKKA 4BICA 4FVRA 4KUJA 3KC3A 2YN8A 3HKOA 4FT3A 2WFYA 4NTTA 1ERKA 1O9UA 1YXSA 2XS0A 4KKEA 2W5HA 3FMLA 4U42A 4AN2A 4MBLA 1OZ1A 3MPMA 4XOYA 3AC4A 2GTNA 2ZAZA 4IVCA 4ANQA 3OUKA 5FEDA 3R8PA 1PXMA 4D55A 3DTCA 4L9IA 4AFEA 4U6RA 3E8DA 3QTWA 4YZNA 4YPSA 2VWZA 5LVMA 2C5XA 2C6OA 2VAGA 4ZTRA 1G8AA 3PXQA 3TUDA 2CKPA 5LMBA 4QP4A 4X2FA 4DEBA 3QKKA 3DJ5A 4AXAA 2YACA 3R28A 3C4EA 4GUEA 3UYTA 3ET7A 4FNWA 4KKHA 3N4UA 2PVYA 4FEQA 5HBEA 4I4FA 3AMBA 2JFMA 2XNGA 4XMOA 5HGIA 3F61A 3TZMA 1OMWA 1L3RE 3FL4A 4JDJA 1OVEA 2H6DA 3UVQA 1XKKA 1PMEA 2XH5A 3IQ7A 5HORA 5IH5A 4CGAA 4RA4A 3VS0A 4XG8A 3BPRA 2GPHA 4BHZA 2NRUA 4LOPA 2BIYA 3SKCA 2CLQA 3ZRMA 4JBOA 4RVMA 3E87A 3GCVA 4YJPA 3WZDA 4N4SA 2GSFA 4UBAA 4KIKB 3W32A 3F6XA 3OXZA 4IDTA 2QODA 3DKCA 2GFCA 4IC8A 1J3HA 2OJFE 2UVXA 1KV1A 4BBFA 4DEAA 4TKSA 2VO6A 3BX5A 5IA4A 2X8EA 3DU8A 3Q3BA 3NYXA 4R8QA 5CNNA 5I0BA 1OPJA 2UZDA 3D7ZA 5M09A 2J0MB 3QA8A 1MQ4A 1OIYA 2C5VA 4MVFA 4JX7A 4ZTHA 2PZYA 4JIKA 3C4WA 5AP3A 4F1OA 4AU8A 5EHLA 3DFAA 4DTAA 4CZYB 4ZY6A 5DRDA 4FSQA 3ZLYA 4A4LA 3LLTA 2H34A 5HG7A 5I9XA 2P0CA 4GIIA 4NW6A 3R7YA 4CT2A 3DJ6A 4XYFA 2PVFA 4BTKA 2YIXA 1W82A 3FL5A 3PE1A 2SRCA 5CVFA 3FXWA 4FEXA 4YJTA 5CLPA 3RAKA 1JNKA 4CFNA 5CSHA 4IX4A 3H9OA 3CY2A 2VU3A 2WMVA 5HU9A 1KE5A 4KB8A 2WMUA 5JQ8A 2R3MA 4FL1A 4G1WA 2VGPA 4RPVA 1JPAA 4NKAA 4YTFA 1JSVA 3AMAA 4FSNA 1S9JA 3SLSA 3MA3A 3UIBA 1V0OA 1YDRE 3QTSA 5EDPA 3T8OA 2IW6A 4J97A 4LUDA 4LUEA 4AT5A 4IM3A 2NRYA 5J8IA 2HXQA 2VWWA 3GENA 3IECA 3R04A 4JOAA 4N6YA 3JXWA 2VX0A 4FTLA 3QD0A 2GNGA 5A54A 4DFNA 4MXYA 4G5PA 2PVLA 3QTIA 4QTAA 5L2QA 3RALA 4E4MA 3Q2JA 4AZSA 4TW9A 3QCYA 4IX3A 3HLLA 4BWPA 3TUBA 3AMYA 3HAVA 3BEAA 3RBWA 2B1PA 2HW7A 1NT2A 4RIYA 5FQDC 5IF1A 4S33A 4HCTA 3W33A 1UWJA 2GTMA 4QNYA 4BZDA 1Z5MA 1RQQA 2R5TA 4PY1A 3S1HA 4FNXA 4NIFA 4TYIA 3MB6A 3Q4UA 4M69A 3ZDUA 4XP2A 5C27A 3Q6UA 3VF8A 4C4HA 2BIKB 3FI3A 3JYAA 2XIRA 3V8WA 2QU6A 3SC1A 4AOJA 2I6LA 2P2IA 4AP7A 5I3OA 2E9NA 5CEPA 4E5WA 5M4IA 3LXNA 2ZV9A 4YBJA 2W06A 2ITXA 3RZFA 3FZOA 3V8TA 2OJIA 2X2KA 4BKYA 2GU8A 4KAOA 4NT4A 3NWWA 2V62A 3KXNA 5GIPE 4FBXA 1Y6BA 3AC8A 3BV3A 3DAJA 3Q32A 3GXLA 3QTQA 4NCTC 4IB1A 2OXYA 3SRVB 5HO8A 3QL8A 4QTDA 4XV9A 5CQUA 5E92A 3DNDA 3U4WA 4MKCA 3F2AA 3ANRA 2B9IA 3MB7A 2OH4A 1H1PA 3BE2A 4FV6A 2BUJA 3LZBA 4FZ6A 3AT4A 5CSVA 4RIWA 3UPXA 3WF8A 3DA6A 3L9LA 4YNEA 1NVSA 5M55A 5DIAA 2WQMA 3TNWA 4W4WA 3KF7A 4HVGA 3FYJX 3LIJA 5AP0A 3FI2A 5DLSA 4A9UA 4G3FA 3E93A 3UTOA 3QQUA 5D11A 3DK7A 3NRMA 5F1ZA 3JR1A 4RFMA 1ZAOA 2VTQA 2FB8A 4TWOA 3TG1A 3OWPA 2QKRA 4H05A 5B2LA 3SOCA 3AGMA 4ALWA 1FOTA 5DPVA 5KNJA 2RF9A 5A4QA 3CE3A 5IA5A 4MK0A 5A4EA 1TQMA 2XBAA 4HVSA 2B54A 2RIOA 1ND4A 5K0KA 2WQNA 5K4IA 4LRJA 1J1BA 1XBBA 4DCAA 2G9XA 2W7XA 3PVWA 1I09A 2ITPA 2F57A 4DLIA 2CHLA 2PVJA 4C59A 3R73A 1PXPA 1YI6A 4IADA 4J1RA 3HP5A 1S9IA 1SMHA 4C33A 3RPVA 3T3VA 4YLJA 4R78A 4AFJA 3R1SA 4X3JA 4A4OA 5I9YA 1R78A 2WGJA 4XJ0A 1YQJA 5HKMA 3SOAA 1M2RA 3WE4A 3VO3A 3CTJA 4A9RA 4BCFA 5M08A 1Y57A 2AC5A 2ONLC 3V5PA 4TXCA 2YM5A 4IQ6A 4BDHA 4DTKA 2W99B 3OWKA 4UY9A 2C5NA 5EW8A 4NFMA 3U6JA 3LMHA 3IDPA 3BELA 2GMXA 4U97A 2WMXA 4I1ZA 5J9LA 5AV0A 2BR1A 2IZSA 3VJNA 3ZEWA 3NIZA 5EH0A 4CYJA 4IAAA 4BL1A 2EXMA 3W16A 2XYUA 3ITZA 4QMZA 4M15A 4EQMA 4AW1A 2PUUA 3T3UA 3ZUUA 5M06A 5J5SA 5A6OA 3HV5A 4XBUA 3UOLA 4B8LA 2R7BA 1APME 5LMKC 3LJ2A 4NM7A 3TT0A 4E6AA 4OTQA 1UU8A 5IH4A 1YXVA 3OFMA 4O6LA 3TV7A 3V5TA 3W10A 3HAMA 5E1EA 3TACA 4DH3A 3CC6A 3OVVA 3DNEA 4DGLC 4G34A 4LM5A 4FUXA 5JRQA 3EQCA 5DN3A 5ACKA 4CYIA 2R3NA 4H3PA 3RPYA 4DH7A 2PUPA 3C51A 1H1SA 1RJBA 2QO2A 3E8CA 5AUXA 1UVRA 2YCRA 5EQEA 4ZJJA 4GYGA 3V51A 3VQUA 2GS2A 4C2VA 2H9VA 2J6MA 2PPQA 3QQLA 4WOVA 5FBOA 3H30A 4ANOA 4W9XA 2GS6A 1G3NA 1PXLA 1YWRA 3I7BA 2OXXA 3JS2A 4HOKA 4CT1A 4C3RA 4MD8E 1OI9A 3NGAA 4QP2A 3VBYA 4IW0A 3QD4A 4NM0A 4BTJA 4CV8A 3D2IA 4QP9A 4FV2A 3GFWA 5CEKA 1W98A 3R1YA 3IG7A 2Z7SA 4GJ2A 4FSMA 3CPCA 4AT4A 4Q9ZA 4LI5A 4KSPA 2ZV7A 4H1MA 4M84A 2FVDA 3A99A 3HZTA 4I4EA 2C3JA 3F7ZA 5CSWA 1VJYA 3AXWA 3LFBA 4OTHA 4L00A 4IAKA 3PA5A 5L6OA 2A1AB 3I1AA 1WVXA 4CV9A 2YIQA 2Z60A 4FTNA 2WTIA 3VS2A 2O64A 3HVCA 3V6RA 4TY1A 3NNUA 3CSVA 5HE2A 4C37A 4KIKA 5GZ8A 2FGIA 3IW4A 5FEQA 3HMIA 3KK8A 4CFUA 1H4LA 2ZM1A 4AZVA 3R6XA 3R83A 2PVMA 3FLYA 4TRLA 2ACXA 2OK1A 1BYGA 1WMKA 4JG7A 3CY3A 3HP2A 4YPDA 3UVRA 3W8LA 4BZNA 3VBQA 3I6WA 4NUSA 3PSDA 4YZDA 4L68A 3NUNA 1Q8ZA 3PXYA 2ZV2A 4PPCA 4EH7A 4JAIA 3F66A 4L3JA 1YOJA 4OW8A 3SV0A 3ORLA 1SZMA 4D9UA 1BL7A 3BYOA 2A2AA 3VWAA 2X8DA 2GNJA 5ANKA 3VS5A 4DFUA 1Q62A 2H96A 4QTCA 3SAYA 1IR3A 1CM8A 3FMMA 2RGPA 4QMTA 4EOJA 1ZYSA 2OG8A 5LOHA 3VJOA 5AFVA 1Q8UA 2WPAA 3CTQA 3WYYA 1IEPA 4B9DA 4OTDA 3CP9A 2QI8A 5AJQA 3O71A 3QRUA 5AWMA 2WOTA 5HD7A 3SA0A 5I9WA 3TEIA 1XHAA 5I5ZA 4TWPA 4FKJA 4O7WA 2RFDA 3NUPA 3UZRA 4F9YA 1UU7A 2PY3A 3AT2A 2R2PA 2OW3A 3C1XA 5CZIA 3G15A 3WI6A 1H01A 1YWNA 5FXQA 2RG6A 3IOKA 5CYIA 4DE4A 3R8VA 2GQGA 2VTMA 4LGDA 3ZXZA 2OXDA 3GU5A 3E63A 2PZRA 4Y5HA 1ZOEA 2CNVA 3FXZA 2W9FB 4LYNA 5BVKA 2F9GA 1FINA 1QCFA 3F3TA 4IWPA 2C47A 4F64A 4L52A 3COHA 1B39A 3EQHA 3WZEA 4EOIA 4AA0A 4IBMA 2WQBA 2YISA 1VEBA 3KRLA 4G3CA 3F7WA 4L7FA 3FHIA 2YCQA 4L46A 4N0SA 4X6RA 3TV4A 3SXSA 1SNUA 3WBLA 3QCXA 1FVRA 2WMTA 4FKIA 3CKXA 3EHAA 3QUPA 4MQ1A 1ZMVA 3NLBA 4JBVA 4DBNA 4N70A 4LOOA 5CT0A 2Z7RA 2ITTA 1O6LA 4LG4A 3MDYA 3UMXA 3OZ6A 3PDTA 3MY0A 3C4ZA 5IH6A 1JKTA 2AC3A 4PDOA 4O7LA 4O82A 5KZ0A 3GC9A 4BCOA 5IEVA 4Y83A 2YIRA 5F95A 3VW8A 4WG4A 3TJDA 4DA5A 2WEVA 3NPCA 3P08A 5ANGA 1QPJA 4QOXA 3PY1A 3BYUA 2JDSA 5CVHA 4BB4A 4C4FA 4FEUA 3FKOA 3R02A 4BTMA 1F3MC 4G6OA 4AGWA 4ITHA 3OCSA 4ANLA 2C6KA 2VTOA 4M3QA 4RC3A 5CEMA 5CF8A 1ZZLA 3K5UA 3K5VA 4GKIA 5CAQA 3U55A 4MWHA 5HLPA 3WIKA 2NNWB 3KU2A 2VZ6A 4JLCA 3SRVA 3BZ3A 1NW1A 2XKFA 4YJQA 2YLFA 3UGCA 4EORA 4PL5A 5IMXA 4LRMA 1BL6A 5F9EA 4FNYA 3TDWA 4QP6A 1LEZA 5J87A 2E9PA 1F5QA 2OJ9A 3DOGA 3LFNA 3OXIA 4FICA 5DE2A 3RVGA 3TTJA 4JRNA 2WTJA 4QPMA 5EQYA 2VNWA 5H9BA 4C3FA 1KOAA 1TQIA 4IC7A 5CX9A 2CGXA 4GVJA 3L9MA 4I24A 5AUTA 3TUCA 3VS3A 3TI1A 1JKLA 3BEGA 4FZAB 5DBXA 5BVWA 3GOPA 1KUTA 3ZM9A 2YFXA 4Z3VA 3ZO2A 1RW8A 5DI1A 2V22A 1WFCA 1K3AA 3QXPA 4PUZA 2C30A 2HELA 5ETAA 4DGNA 2XB7A 4QO9A 5KMMA 4HZSA 2BRGA 4LMNA 5JH6A 3QQJA 4X21A 2OIQA 3I0QA 4FTIA 4ENXA 1Q3WA 5DMZA 5HX8A 2REIA 3IPHA 1REJA 3MPAA 4LV5A 4UXLA 4OTGA 3ZMMA 4EBVA 5A4LA 4CQEA 2HZ4A 2R3OA 2OO8X 4D2WA 4BDJA 3BHUA 3VW6A 2C1AA 3A2CA 4EJNA 4HGLA 2CJMA 3BQCA 1JWHA 4XCUA 5IDPA 2WB8A 3LFAA 4G6LA 2YCFA 1YOMA 4MQ2A 4TL0A 3D7TB 3RK5A 4WG3A 4AUAA 1AD5A 4D2SA 3HV7A 5CU4A 2XK6A 3E7VA 4GS6A 4EK4A 3NVMB 4KA3A 4D5HA 2A19B 1SVHA 3FLNC 2PE2A 4L3PA 4O7SA 2XNMA 3AOXA 4I22A 4ZZNA 5CQWA 4A7CA 1YWVA 3ZFXA 2OZOA 4L44A 4F63A 5AIKA 3I4BA 3PG3A 2BZKB 5CXHA 3ORTA 5HCXA 3KN6A 3W18A 4TYEA 3QD3A 3P78A 4L43A 3L1SA 5J9ZA 4I41A 4HJOA 3ZC6A 1YOLA 4XV3A 4PRJA 4WG5A 4EK3A 3FAAA 4U44A 4IWDA 2FSOX 5L6PA 4L8MA 4NIFB 3UP2A 1XH7A 4ZS0A 1FMOE 2WELA 3PJ2A 2JGZA 3DGKA 5LVNA 3KY2A 4IIRA 3I6UA 4BIBA 4D2VA 2UZWE 1PRYA 1BI8A 2X7FA 3EKNA 2PZPA 3D5VA 3GC8A 1GZOA 4E26A 4XP3A 3PY0A 1YXXA 2XYNA 3DLSA 4BDAA 3UOHA 3P79A 4Y8DA 2C4GA 5EOBA 2QR8A 2BVAA 4C3PA 5BVDA 2XRWA 5ETIA 3MPTA 1PYEA 4J8MA 5J79A 4O83A 4BCNA 3HDMA 5TO8A 5JRSA 2FYSA 4BI2A 4EUUA 2LAVA 2QOKA 5BUIA 3C9WA 5CEIA 4M8TA 5AEPA 4IAIA 4FOBA 3MBLA 4PMSA 4U40A 4FTKA 3G6HA 1ZYDA 4WBOA 3ZFYA 3LPBA 4APCA 3ZO1A 5HLNA 3V5LA 4F09A 4YZCA 1BUHA 1J1CA 1ZYJA 1QPDA 5GNKA 4AA5A 5IDNA 3KXMA 5CEQA 3EQPA 3HMMA 3QHWA 4KS7A 4DCEA 4YNOA 5EYCA 4HYIA 3EN6A 3TNHA 4AW5A 1KOBA 2FO0A 5IEYA 2UW7A 4WNOA 2WD1A 1M7NA 2ITZA 4OTFA 3COIA 5EKOA 3ANQA 3H0YA 3UO6A 4JDHA 2CKEA 2P4IA 3D14A 4YP8A 2YM6A 4ZSLA 4AZWA 4YLKA 2QOBA 2BILB 3F5UA 3UNJA 4HPUE 2X9EA 2BDJA 2G1TA 4G9CA 3R9RA 4MYGA 1NY3A 5L4QA 3ZFMA 4FC0A 5HI2A 4EUTA 4OT6A 3R8MA 5HIEA 1VZOA 5FLFA 4IANA 3MFTA 3GUBA 4J53A 4DH1A 4I0TA 4OTPA 3PLAE 1Y6AA 3IKAA 3KULB 5TR6A 5EYDA 4F70A 3JUHA 1NXKA 4FTJA 3G2FA 4U41A 2X2LA 5E8VA 1WBPA 3AC1A 4MBJA 4F9BA 2VWUA 4EH5A 2XJ0A 5IPJA 3AC5A 3OBGA 3H4JA 5M4FA 4IJ9A 1AQ1A 5LXMA 3DXNA 4I0RA 1OL1A 3NIEA 3LCTA 3F5XA 3PXZA 3NCZA 4L42A 3O8UA 1UKHA 4RFYA 3PFQA 4OBPA 3MH1A 5FP5A 2UW5A 5HG5A 1A48A 3G0FA 3COMA 3IS5A 2UW6A 2DUVA 4EKLA 4F0FA 3PVGA 4RVLA 5DGZA 4EBWA 3OW3A 3QC9A 3AGLA 3LCOA 2WMWA 4O0UA 4PDPA 5D9HA 3VN9A 4BVUA 3O0GA 4TYGA 3ZONA 3U4UA 1YW2A 4FEVA 3LFQA 2WZJA 2JDOA 3KGAA 2UV2A 2PZIA 4Z7GA 2JAVA 1JSUA 3FHRA 3KB7A 4DF3A 3U87A 1SM2A 4RFZA 2G15A 4AA4A 4IZYA 2FA2A 3RM6A 4C4IA 3LQ3A 2JDTA 3F3ZA 5CZHA 1I44A 3UC4A 3ZYAA 3CD8A 2C6IA 2F7ZE 4FT5A 2I0VA 5GJFA 2Q0NA 3G33A 1HCLA 3R2YA 2VTIA 2OJJA 5KMIA 4M0ZA 3WYXA 4ZS4A 4W9WA 4YC6A 3FYKX 4BF2A 4JAJA 3NCGA 3S3IA 2B9JA 2VO0A 3IDBA 3WZJA 3WF6A 4E5BA 3BU6A 3F3UA 4ZSEA 5K5NA 3SG8A 5JGBA 4JR7A 4TWCA 3W1FA 3ZSHA 3ZSGA 3A8WA 3Q5ZA 2WTKB 3PPJA 4MXZA 4YHTA 4QYYA 4ZLZA 3E3PA 3K3IA 5C8NA 4OAUC 4C7TA 2CGUA 3SG9A 4APPA 4D4VA 3E64A 5E90A 4ANNA 4CNHA 4QRCA 1NA7A 1STCE 4TNDA 2Z2WA 3DAKA 5JQ5A 3JVRA 4TT7A 4XV1A 3UYSA 2O8YA 4AGUA 3I5NA 4L45A 2CGVA 4JRVA 2R3FA 4YHFA 2OF4A 3FMNA 5AX3A 3MN3A 2R3LA 2CNQA 1PJKA 4D1SA 4QMMA 1KV2A 1QPEA 2X81A 3G90X 4EOPA 3NAYA 5AA8A 2XM8A 4ARKA 2C6EA 4DG3E 5CAOA 5HLWA 3A62A 1LP4A 3C0GA 3FLSA 2VTRA 3KRRA 4QD6A 4U7ZA 3RMFA 4AW0A 2OJGA 3VS4A 4BGQA 2ERZE 4R6VA 4C57A 4I3ZA 3LFSA 4Q9SA 2YDIA 3PIZA 4BGGA 3D5UA 3FY0A 3NUSA 4HCUA 2OICA 4XS2A 3GU6A 1Q4LA 3RZBA 4BCQA 3F3WA 4XP0A 2YM3A 3EZRA 5DWRA 5HU3A 3N4TA 4O84A 2YM4A 3WOWA 4EK8A 4MXXA 3EH9A 5IUIA 4IH8A 2XA4A 4NJDA 2QOLA 4MD7E 2GDOA 2XIKA 5LCJA 1H0WA 3LHJA 4LL0A 2HENA 4JQEA 5BYYA 2OFUA 2E9OA 3ODZX 5EM7A 5AADA 1X8BA 3E7OA 4W4XA 3IOPA 3WZUA 3PVUA 4L01A 2PULA 4C0TA 4XG6A 3COKA 5AR4A 5I9ZA 3U54A 3D2KA
chains in the Genus database with same CATH superfamily
4P90A 2IVSA 3C0HA 1O6KA 4G16A 5JFWA 3L8PA 4E4LA 2G2HA 3PZEA 4U0IA 4USFA 4RX8A 3IONA 4OT5A 3IDCA 1J7UA 2WIPA 3NUXA 5KBQA 3LM0A 3GVUA 4RC4A 3OBJA 5DOSA 3U6HA 5JN2A 5CF6A 4QP7A 3OTUA 1ST4A 2QNJA 3VUKA 5FXRA 5F94A 4GKHA 4O21A 1XH5A 4FTUA 4MXCA 3PPKA 4TTHB 2CMWA 1PF8A 3FLZA 4GFGA 5LVLA 4XG7A 4M68A 3DLZA 3QLGA 3BRBA 4WKQA 3UOKA 5A14A 5B2MA 5EI8A 4CD0A 3ZM4A 5TT7A 1IASA 2UZUE 3NUYA 2C3KA 3D7TA 5L8KA 2XNBA 3TKHA 2HY0A 3QX4A 4AZFA 1WBNA 3LJ0A 2UZNA 1PXIA 2J9MA 5HTCA 2J0IA 5BMSA 4E73A 3M2WA 2QU5A 3VNTA 3HV6A 1ATPE 4R7BA 5HD4A 2HY81 1M7QA 3ERKA 4R3CA 4FMQA 4D2PA 4HVIA 3UQCA 2AUHA 2VWVA 2W9ZB 4HNIA 3PP0A 4PWNA 3NFFB 1Q97A 2R0UA 4XRLA 5FG8A 4P2KA 2C0IA 3VUMA 2EB3A 1R1WA 2RG5A 3NW5A 1H07A 3MH0A 4G5JA 4J98A 4ACMA 3H9RA 4FSUA 2QO9A 5HTIA 4YZ9A 2VWIA 3PA3A 2OWBA 3BE9A 4ZZOA 4PPBA 2EWAA 3E8EA 5ANDA 3UG1A 4CFFA 4TYHB 2FSLX 2X6EA 4RLKA 5FXSA 3U8WA 3QTRA 2OGVA 2NP8A 1XR1A 4QP3A 3GQIA 4KS8A 4WD5A 5E8WA 3B2TA 5KE0A 3ZU7A 3DB6A 3VHKA 1QMZA 2X7OA 4GSBA 3EL7A 4FKLA 3ROYA 2NYAA 3REPA 3KEXA 5BQ0A 2OFVA 5M53A 4O81A 2Y4PA 3PE2A 4R3RA 2IG7A 3LCSA 5HVJA 3ZH8A 4LFIA 5EM5A 1XQZA 3OF0A 3SD0A 3NR9A 2W0JA 4YHJA 4OBQA 5LJJA 2A4LA 3VIDA 1ZLTA 3D94A 2PHKA 2LGCA 4S34A 5JZNA 5AP4A 4BI0A 5FTGA 5LVOA 3RPRA 3FSKA 4TZRA 2I0HA 2VD5A 1FQ1B 3LFEA 4XG9A 3U51A 4O2ZA 3FQSA 4IJPA 5DT4A 3CKWA 4ERWA 4FK6A 4R1YA 4R7HA 4EC9A 4FTQA 4Y46A 4C2WA 4ERKA 3KCKA 2W5BA 2BFXA 2HWOA 5CSPA 4HGEA 4XRJA 4ZY5A 2P55A 4CFXA 3EYGA 4PPAA 3PTGA 4UN0C 1YXUA 4FKPA 3FQEA 3IK3A 3FZTA 2UW8A 3O7LD 4UALA 4AN2A 2QONA 1XBCA 5AUZA 3ACKA 4PMPA 1U54B 2W1GA 2UZOA 3FZSA 5L8LA 1BX6A 4QYFA 3TXOA 4GT3A 3V3VA 4AOTA 4ACCA 2V7AA 5I3RA 3DZOA 3BKBA 4FV3A 3H3CA 3VBTA 1IAJA 4F6UA 4NYEA 2XNPA 4QP1A 5BVEA 4QTEA 1PW2A 1GZ8A 5J7BA 4J52A 2HWPA 2BALA 4ZAUA 1TVOA 4UXQA 3KULA 3ZEPA 4BCJA 4CLIA 4DYMA 2NPQA 5ANOA 4MF1A 1WVWA 3FDNA 4JJRA 3E88A 3FUPA 4S30A 5AR8A 3VS1A 3F69A 4D5KA 2UW9A 4RWIA 5FEEA 4XEYA 3O8TA 4ITIA 2YWVA 2IO6A 3DKGA 3NDMA 4PL4A 3IW7A 5DEYA 1OPLA 4MUQA 1GY3A 5HE3A 4D4YA 4QMLA 4QQCA 4PTEA 5AIRA 2OF2A 3QBNA 3ORXA 2JFLA 5CF4A 3EIDA 4U5JA 4IB3A 4TWNA 4DG2E 5AUWA 5CTPA 4YURA 1KE6A 1A9UA 1H24A 1PY5A 4G3EA 4IVDA 3EMGA 4JIAA 4QMWA 3VUIA 4CMTA 3DAEA 4JQ7A 4O2PA 3V5JA 4H3BA 2PYWA 4RMZA 5H3QA 2H8HA 2A27A 5EOLA 2UZEA 3GCPA 3GU4A 4D1ZA 1JKSA 2ZB1A 4UB7A 4ZSJA 2VTPA 4LMUA 4RRVA 5M56A 4ZMFA 1UNGA 2Y4IC 1Y91A 1NVQA 2X1NA 3A4PA 4BWKA 3GC0A 3GFEA 1OIRA 3NW6A 4PTGA 2UZTA 4U43A 1TKIA 4NWMA 2J0KA 2W4JA 4FKUA 5AR3A 2R7IA 5D41A 4QP8A 2PU8A 5CWZA 5E8TA 4PDSA 3R22A 4BKJA 1E1XA 3O7LB 2PWLA 3FV8A 3R9OA 2VTTA 3MA6A 4E4NA 4FV9A 5HQ0A 5KX8A 5TKDA 2VWXA 5JSMA 2QOFA 4QYGA 5A9UA 4DEHA 4DT9A 3CGOA 2IZTA 5DR9A 2C6LA 3Q96A 5M4CA 4NJ3A 1CDKA 4FZDB 2KULA 5ANIA 4FKQA 1SVGA 4I6QA 3MFRA 2UW4A 1FBNA 5C01A 3NZ0A 1ZARA 1ZWSA 3OP5A 4FIHA 1L8TA 4I20A 5ICPA 4ZP5A 3S4QA 3HRBA 3TIYA 4F65A 5IA3A 3ZO3A 4NEUA 4FE2A 3F88A 4TPTA 4YJUA 2GQRA 3MS9A 3DBEA 4FIJA 4ZK5A 3QUDA 3EKKA 4Z55A 2XJ1A 3D5XA 4XG3A 3A4OX 4HZRA 2ITWA 2C5YA 2JKOA 2IZUA 4ACGA 4I6FA 4GH2A 4BCMA 4J95A 3VBXA 4O1PA 4F99A 5CANA 3TYKA 3AG9A 2CSNA 2XZSA 2Y6OA 3DBQA 4FKWA 5AM7A 4UMRA 1FGIA 2OBJA 2QQ7A 2XCKA 2ZMDA 4IAZA 3QYZA 3BYVA 4B0GA 4E1ZA 2I40A 2X9FA 4JT3A 1XMMA 2QHNA 2JAMA 1JBPE 4WSYA 1OIUA 3R8UA 5FP6A 4NZWB 4AN3A 2PMLX 4KIQA 4R7IA 4CQGA 4CSVA 2ZM4A 5J95A 5AV1A 3QZGA 4RSSA 4DG0E 3VBWA 4H39A 2OZAB 3RJCA 5C4LA 5AAEA 2JIUA 4AQKA 4J96A 2E9UA 1OKYA 3A8XA 3Q9XA 5E8YA 4KBCA 4FT9A 2F7XE 4Y5QA 2W1FA 5KUPA 3QKLA 4XBRA 2RFNA 5IKWA 3DKFA 3JPVA 3CGFA 3IGOA 2BZIB 2W1HA 2W5AA 3R1NA 3UE4A 3HMPA 4FSWA 3LVPA 2W1EA 4Y73A 5JFVA 3HRCA 4WT6A 3RM7A 1CKIA 4IB0A 4I21A 2ZVAA 3TN8A 5KKRC 3DFCB 3KCFA 2Y6MA 3RNIA 2W1IA 3A7HA 4X3FA 5HBJA 2ZM3A 4DH8A 4BN1A 1KE9A 2O63A 1H26A 2ZB0A 4QQ5A 4JBQA 3W0PA 3FXXA 4XOZA 2R4BA 4HPTE 3GC7A 2X8IA 3GP0A 3LM5A 1JVPP 3P7BA 2J51A 4H58A 4H3QA 1ZY4A 3F5GA 1YHWA 4AQCA 3HDNA 4WUAA 2VTLA 3FMKA 2WU6A 3LMIA 4E6DA 4YO4A 1OUYA 4JXFA 3IO7A 3NAXA 4BIEA 2ERKA 3QGYA 5EFQA 4FV7A 4EJ7A 3NUUA 1UA2A 3MVHA 4O7NA 4G17A 4K0YA 4FTRA 4BTFA 2C6TA 4FF8A 2GCDA 3F5PA 5FTQA 4I92A 3FLQA 4A06A 1JOWB 2C3LA 2UZBA 2A0CX 3Q60A 3GBZA 3O96A 4XLVA 3ZRLA 3MESA 3UIMA 5FRIA 3G0EA 3KREA 1CKJA 2W1CA 5J1WA 1PMVA 4MD9E 2P33A 3LQ8A 4BDDA 5G6VA 4O0WA 4IAFA 3ENHA 3FI4A 5GJDA 2B55A 2XUUA 4RBLA 3PXFA 4EZ7A 3KRJA 5M51A 4ZIMA 4USDA 4HNFA 5C1QB 2VTHA 3OEZA 3F2RA 1UV5A 2XIZA 2YZAA 4IB5A 4W8EA 3BL9A 3QCQA 1DAYA 3DV3A 4I23A 4TYHA 2VV9A 3UNZA 2VWYA 1IA9A 2OU7A 2JKQA 1W2DA 2FSMX 3E3BX 2F4JA 3GB2A 3TKIA 4V0GB 4EOLA 4IX6A 3L9PA 4FTMA 4LRKA 4O22A 4QMUA 4RIXB 4GK3A 4C4JA 1BKXA 3MTFA 4TNBA 4E5AX 4EH8A 3RNYA 4CVAA 2RFSA 2OSCA 4RJ8A 5FBNC 4R5YA 4YJSA 2F2UA 3QGWA 5E91A 5BVOA 3BBTB 4D1XA 5HOAA 4TYJA 1WVYA 4UMUA 4F08A 3VC4A 5HE1A 3ZCLA 2JKKA 4UEUA 2QCSA 4BFMA 2J4ZA 4E3CA 3HRFA 5EI2A 4M97A 1Z57A 4P5QA 5M4UA 4ASEA 4B7TA 3OOGA 2VO3A 3ZUVA 3F3VA 3OWJA 4NK9A 5H8BA 2C1BA 2X0OA 2IWIA 4FNZA 4KBKA 4LGHA 2XNOA 4O38A 4U9AA 3EFJA 3EN5A 4XH6A 4EHZA 3DXQA 3FQHA 4M13A 3PYYA 4OTIA 2B7AA 3MIYA 3CXWA 2EXCX 4YZMA 5D10A 3TIZA 3HNGA 2XJ2A 4AAAA 2YIWA 4CFVA 2QOIA 3CLYA 3C0IA 3HECA 2BZHB 2WMRA 4ZOGA 4B4LA 2IPXA 4UWYA 5ETFA 3R7EA 5BYLA 2J7TA 4OGRA 2HXLA 4FSZA 4G2FA 3RINA 5BYZA 3BU5A 3MYGA 4FV0A 5FDXA 4AOIA 1OM1A 3A7FA 4KRDA 3D5WA 5AMNA 2X2MA 4I6LA 4XG4A 2OIBA 5KCVA 5K3YA 2BAQA 4YSMA 4W8DA 4I5HA 1U54A 3BBWA 2WMAA 2VRXA 2HYYA 3FMHA 4KWPA 4DBXA 1H8FA 4IHPA 2UVZA 4UZDA 3EWHA 5HCYA 2QO7A 4F7LA 1Q3DA 1MQBA 4JI9A 4K6ZA 4O6EA 3R7IA 4Z7HA 4H36A 4Q5EA 4RVKA 3VULA 4F7JA 3UIXA 3UO4A 3QWKA 3MWUA 5JGDA 4FR4A 3BWFA 4F4PA 4R77A 3ELJA 4Y85A 4EZ3A 4YBKA 4RZVA 2UZLA 3A60A 3DB8A 2QHMA 4BCIA 2YEXA 4F6SA 2G2IA 2R3HA 4P7EA 1V0BA 3WZKA 2HCKA 3II5A 4YJRA 4I6HA 1Y8YA 3KF4A 3F82A 3QYWA 3GI3A 4KNBA 4FA2A 1M17A 4MAOA 4IZ7A 2XRUA 3HGKA 4D4SA 3W0OA 4X2NA 2JDRA 4GVAA 2ITNA 2R3GA 2WTCA 2NO3A 3H10A 2PTKA 4DN5A 5C03A 4Z9LA 4DINA 3PXKA 3UQFA 3CR0A 3MW1A 4AN9A 4ORKA 3EYHA 4FIFA 2B9HA 5IQCA 3QQHA 3P9JA 1DAWA 1R0PA 1OKVA 5IA0A 5H8GA 2I0YA 2B4SB 4NM5A 4XHKB 4IVAA 3ZZWA 1EH4A 2C68A 3PLSA 4FIGA 4GU6A 2RSVA 5F4NA 3OXTA 5ACBC 4EHGA 5AM6A 1P4OA 2WNTA 4GT4A 4PP7A 5L2WA 2B0QA 2VX3A 4MEDA 3LW0A 3FBVA 1URCA 4V05A 3VS6A 5C9CA 2V55A 1LR4A 4RJ3A 3UOJA 3QALE 4BI1A 5CU0A 4AE6A 5JZJA 1QL6A 4A9TA 3VVHA 5A46A 1REKA 3NYVA 5B2KA 4IX5A 4EOOA 1JLUE 1H25A 1UNLA 3NUAA 2KTYA 2J90A 4JNWA 4FX3A 3BI6A 1PXNA 2R3IA 2C6DA 4MF0A 1Y8GA 4YTIA 3SHEA 4ZTMA 5AUUA 1UNHA 5IA2A 4O4EA 2O2UA 4YJVA 4FKOA 3ALOA 2W05A 1GZKA 3CEKA 3R1QA 5JK3A 4I5PA 2FSTX 3PSCA 4JG6A 5DR6A 4YC3A 4BYJA 3R9DA 2GQSA 3AD6A 3QRTA 4CCUA 3C13A 4CZUA 4FYOA 4GU9A 4FG8A 2XNEA 4F0IA 2YJSA 4OR5A 5IISA 1Q5KA 4E20A 5HO7A 1TFFA 3SDJA 4EH2A 4N6ZA 2WQOA 3VBVA 5DYJA 5LWNA 3TCPA 2WQEA 3WE8A 3GT8A 3S00A 5EKNA 4RX9A 2PE0A 3SXRA 3R30A 3W0RA 3UDTA 5G1XA 3L8XA 4UMPA 2GHMA 1Q61A 2PVKA 3VUTA 3KRXA 3I81A 3ZZEA 3BLQA 2ZJWA 3EFWA 3QQKA 4NH1A 4EI4A 1CMKE 3DK6A 4IWOA 3FWQA 4O0VA 2JIIA 2PZ5A 4RIOA 3OG7A 4DFLA 4AZEA 4RWLA 5IQAA 3OCBA 1FVTA 4MXOA 4Q5HA 3KQ7A 3C5UA 3V5WA 4UMQA 1B38A 2PVHA 3FSFA 2OZAA 4WHZA 3BIZA 1SYKA 2F2CB 3L9NA 3NNXA 2ITUA 4K2RA 4EZ5A 3NW7A 3QTUA 4ZTNA 1W84A 4FTOA 2JEDA 5DT0A 3CQWA 2C0OA 1QPCA 4RC2A 2EUFB 2XCHA 5LQFA 5EYMA 4CXAA 2DS1A 3HEGA 3V8SA 5AR7A 5CASA 3BV2A 4C62A 4I5MA 2XNNA 5CALA 3UJGA 3IGGA 4OBOA 3ORMA 4G3GA 1PXOA 3FPMA 4F1TA 5BPYA 3EQBA 4LV8A 2XAMA 2IVVA 4EH9A 3ALNA 3VAPA 3K3JA 3G51A 4Z16A 3OW4A 4WNPA 4NL0A 3FMJA 5IQFA 2O3PA 3BLHA 3P5KA 1ZY5A 3SQQA 3MSSA 4CFWA 1F0QA 3R8ZA 4XNEA 3ZXTA 2GHLA 1PKGA 2C0TA 3AKJA 4YSJA 3ZUTA 4JX3A 2IJMA 1BMKA 1UWHA 3DT1A 5GINE 3LXPA 3C4CA 3W2QA 4FGRA 4FT7A 1H1WA 1W83A 4ITJA 4M14A 1W0XC 5D12A 5FGKA 2XK4A 2CCHA 2ETMA 2QC6A 1FMKA 4FG9A 4GK4A 4JVGA 3BCEA 1P2AA 1PYXA 3ZSIA 1LEWA 2DWBA 4X7QA 4KBAA 5DT3A 2IVTA 3BHYA 4BKZA 2C6MA 2X0QA 5L2SA 4UYNA 5FUTA 2E9VA 4LQMA 5HE0A 1Q99A 3CCNA 4OUCA 5EM6A 5HG9A 3K54A 3UP7A 1K2PA 4AG8A 4QQTA 4ZLYA 4FKGA 3NFGB 1GZNA 1CTPE 2W96B 1OUKA 4II5A 4DFYA 2GNHA 4AGDA 1DS5A 2BRHA 3A61A 5JFSA 2WTWA 5AUYA 1GIIA 4O7RA 3RTPA 3W2CA 5E7RA 3FPQA 3IW8A 2BAJA 5AUVA 4ZTLA 1BI7A 2YCSA 5DEWA 4P5ZA 3Q5IA 5AP1A 4M7IA 4F9WA 4RX5A 3ZHPC 3R2BA 4EQCA 3F2NA 4O0XA 3DQWA 5EW9A 5GJGA 4ZXTA 4S32A 3RPSA 4BBEA 2CGWA 3KKVA 2ITQA 1IAHA 3EB0A 2PUIA 1OL7A 2XBJA 1OGYA 4ENYA 5E8ZA 5I4NA 2VTJA 3SGCA 1T46A 5GIOE 2DQ7X 1H1RA 1OECA 5EK7A 1ZOGA 2WOUA 3C50A 5AAGA 3DZQA 3VRZA 2OLCA 3Q2MA 5LMAA 3KXGA 3KK9A 4KIPA 3NSZA 4R5SA 3QRJA 5DG5A 4IAYA 5CAVA 2J0JA 3PA4A 3P7AA 3PG1A 3SVVA 3HV3A 3MTLA 4FKVA 4UWBA 4B99A 3BHVA 4V0GA 5HIBA 3EQGA 1M52A 3D9VA 4U45A 3W2OA 5AA9A 3NNVA 3BYMA 4RIXA 3E5AA 5IA1A 4ASXA 2ETRA 3ZLWA 3MIAA 3LE6A 4NKSA 5D1JA 3TNQB 3DK3A 3UZTA 2HOGA 4RGJA 1YHVA 3QRIA 3QHRA 2VGOA 3G6GA 2WMBA 4GG5A 4XG2A 4RQKA 5I9UA 5A3XA 4ZY4A 4FZ7A 4NCTA 2EB2A 5CNOA 1XH9A 2XK8A 3D83A 4GFMA 3QX2A 4PF4A 3DXPA 3DS6A 1XH6A 4FL2A 3EQIA 4EK6A 2GHGA 1FPUA 3O23A 4YJOA 4D9TA 2E2BA 3W2PA 2AEGA 3I79A 4GUBA 4BYIA 4CTBA 2XEZA 3P1AA 5D7VA 5TE0A 2HIWA 1XH4A 3FC1X 4IM2A 3H9FA 5B0XA 4YR8A 5KMNA 2Z7LA 2VTAA 3OC1A 4QPSA 3DBDA 4PP9A 3KMUA 5TOZA 4C4EA 4ALUA 1E9HA 4EQUA 3Q52A 3WF7A 3BU3A 4K1BA 4EL9A 2I7QA 1P14A 3BQRA 4WRSA 4U8ZA 4C61A 4EOKA 5EDQA 5ETCA 3FZPA 5IZFA 3OY1A 2XVDA 4O0RA 4X3FB 1PXKA 2ZDUA 5CAUA 4HGSA 2WTVA 4C35A 3QC4A 5L8JA 4EH6A 4FSYA 4KKGA 5J1VA 2UUEA 4AGCA 3VRYA 4O4DA 3FKNA 3QZIA 4RLLA 3GQLA 4E7WA 2QOCA 3N4VA 4D2RA 4BDKA 3ZLSA 1WBWA 5FM3A 5L6WL 3MVLA 2QR7A 4CMUA 2OH0E 4C38A 2VUWA 3RWQA 3U9CA 5KHXA 1W8CA 2CDZA 1ZXEA 2R64A 5DH3A 3TNPC 5EG3A 2WTDA 3MVJA 4V04A 2B9FA 4GT5A 5CI6A 4GYIA 4AX8A 4QYEA 3V6SA 3E8NA 4TN6A 2ONLA 2JD5A 2X7GA 3TZ9A 3VUGA 5T3QA 3ZBFA 3HV4A 4PMMA 1YRPA 1VLRA 2PSQA 4A4XA 3LLAA 4IE9A 4EH3A 4U81A 3PXRA 2CKOA 5AV4A 2RL5A 3BGPA 4BDFA 2F49A 4FG7A 4C8BA 2XK9A 3O50A 5IQHA 4IEBA 4KSQA 4ZLOA 3AC2A 5DNRA 1E1VA 3ORNA 4KINA 5K4JA 2ITVA 5HHWA 3RCDA 4PL3A 4O7YA 5KMLA 4MNEB 4WO5A 4DT8A 3QZHA 1XWSA 5CU6A 1M2QA 3QTZA 5C8MA 3QFVA 4PDYA 3DBCA 4RJ5A 3W55A 5LMKA 5FWKK 4BR3A 2UVYA 3I5ZA 5CF5A 4AS0A 4CLJA 4FIIA 4ZMEA 4ZZMA 4B8MA 3EL8A 3LKMA 4BCKA 1H28A 4K9YA 3W2SA 3MGYA 4CRSA 2YITA 2W4KA 2XEYA 2CLXA 3BYSA 4ZSGA 4ANMA 5E4HA 3Q4TA 3T9TA 2ITOA 5H2UA 1IG1A 3QLFA 2WU7A 4YTHA 1CKPA 2XIYA 1XO2B 4BCGA 3OT3A 4YUQA 4FK3A 1T45A 3U6IA 3CTHA 5IQDA 3UNKA 4ANSA 2X0GA 1W7HA 3HUCA 3OY3A 4D0XA 3P7CA 4BIDA 3TZ8A 5HNIX 4I93A 3M1SA 4E6QA 3K2LA 4FTTA 2Y8OA 2DYLA 4LGGA 3S0OA 3PJ1A 1H1QA 2ITYA 4AW2A 5AAFA 3HMNA 4MX9A 3Q4CA 4AACA 4DFZE 2XM9A 4FOCA 3ZTXA 3ZO4A 4YLLA 3DKOA 2EU9A 3OEFX 2QG5A 4PX6A 2BAKA 4F78A 4FGBA 3LCDA 4QMXA 5CAPA 3A7GA 4RJ7A 4EH4A 4GJ3A 5BUEA 3QCSA 2BDFA 4FV1A 3TTIA 4FKSA 2ZYBA 4RJ4A 1PHKA 5FTOA 3DPKA 4DAWA 3RK9A 4X2KA 4FZFB 4L7SA 2V5QA 3QD2B 3ZDIA 5CY3A 3UZPA 4DGOA 5EM8A 3QUEA 1G8SA 2A98A 4XLIA 4BY9E 1Z9XA 1MUOA 1CSNA 2O65A 2UW0A 3FKLA 3RCJA 2BTRA 4DFXE 4EOSA 4HYSA 3IW6A 3DDPA 4WUNA 1OKWA 2YZLA 4CKIA 3CIKA 1PMUA 3HMOA 5LVPA 4HYUA 5CSXA 4GV1A 5BX0A 3PVBA 4V01A 1KE7A 5AP7A 3RWPA 2V7OA 4I94A 5M07A 2GS7A 4U79A 5HCZA 2WIHA 1VR2A 2WKMA 3LCKA 4L3LA 4O86A 1JSTA 4QMNA 2O5KA 4GRBA 5LCKA 1MP8A 4FL3A 3POZA 4DITA 4PNIA 2X6DA 1YDSE 1URWA 4J99A 5HG8A 4DH5A 2WMSA 5BV3A 3MH3A 4JS8A 2G01A 4NW5A 2GFSA 4MXAA 5HVYA 4GEOA 4NM3A 5HBHA 5IUGA 3BGZA 4BHNA 3C4XA 3O51A 5HO6A 4CMOA 1OL5A 3R63A 5BVNA 4FV8A 1YVJA 2W1DA 5EHOA 4XX9A 1J7IA 3TMOA 3CQEA 3Q6WA 2W1ZA 3QWJA 4DTBA 2R9SA 4EWQA 4N57A 1GJOA 5GZ9A 4HCVA 2J5EA 2WHBA 4O1OA 5GHVA 3ZLXA 2BRNA 2HAKA 1GIHA 3GCUA 4DEEA 3OWLA 4WSQA 4FTAA 5KMKA 3SW4A 2R3RA 2OI4X 1U5QA 5A6NA 5CXZA 4WRGA 3BGQA 3PJ3A 1OIQA 4IM0A 4O4FA 4YGAA 3ETAA 1H0VA 4IVBA 3OD6X 5CU2A 2AQXA 3UMWA 4M12A 3QTXA 3KFAA 1IA8A 4IXPA 4H1JA 4FV5A 4FI1A 4CG8A 3AD4A 4ACHA 4IFCA 3L8SA 1VYWA 4X0MA 3R7OA 4HVDA 2YWPA 4WA9A 1WBOA 5BUJA 4USEA 4O7ZA 4EYJA 3UODA 4QMOA 2QURA 1ZRZA 4EHVA 1AGWA 1ZOHA 2XIXA 4NU1A 2VNYA 4K11A 4FIEA 4O91A 4ONAA 5E1SA 5EI6A 4BBMA 1ST0A 1DI9A 2CKQA 3TV6A 3UG2A 3AT3A 1UU3A 4RJ6A 5IQGA 2JLDA 3CS9A 4QT1A 4S31A 2YM8A 2R3KA 4DFBA 3GEQA 3FC2A 1FVVA 4MBIA 3S95A 2Y9QA 4KRCA 1W2FA 1H08A 1Q24A 2RKUA 4O0SA 3RAIA 4X2GA 2YERA 3TWJA 4F7NA 5ITAA 4F1MA 1P4FA 3CD3A 3OS3A 4GL9A 4BDBA 2R0IA 2EXEA 2YJRA 4RA5A 4F6WA 4MHAA 4HW7A 5IMEA 3UO5A 3R01A 3FI8A 1H00A 3ZBXA 2VX1A 3MJ1A 1RDQE 1YI4A 3MY5A 1PMNA 3GU7A 3PZHA 2I1MA 4JG8A 1V1KA 3Q4ZA 5KHWA 3C5IA 5IQIA 1KSWA 2YAAA 2YABA 3LXLA 4EOQA 4I5CA 4I6BA 3OHTA 4YZBA 4UYAA 5J7HA 1U4DA 4CG9A 3EFKA 4GCJA 5DFPA 5E8UA 3O2MA 5CS6A 4CKRA 1WZYA 2BHHA 4NFNA 3RPOA 4EKKA 2ZFYA 2JDVA 3CBLA 3KMWA 3R7VA 1OBDA 4MH7A 4E6CA 2CN5A 3CPBA 2IVUA 4FT0A 4AWIA 4EONA 1J91A 3DJ7A 5C4KA 1WBSA 4S2ZA 5JKGA 4F7SA 3P0MA 4WNMA 4YU2A 5GZAA 4DGGA 1UKIA 3KXHA 4JR3A 3MFUA 5HZNA 3TM0A 1MRVA 3EFLA 3HA8A 5AR5A 3G9LX 3V5QA 4RQVA 4CKJA 5KMJA 1Q8WA 3ENMA 3PWYA 4FKRA 4UV0A 4YJNA 4Q2AA 4DEDA 3GCQA 5K0XA 1DM2A 3ATTA 3RI1A 1MRYA 3MFSA 3OROA 2J50A 2QD9A 5H8EA 4A9YA 4C36A 3M11A 4ZJIA 5L3AA 2IZRA 3Q9YA 4G9RA 4K8AA 5KO1A 2RFEA 2WAJA 1WBVA 3C7QA 5L2IA 1P5EA 2IW8A 1ZYCA 3ORZA 5DVRA 4YMJA 5M44A 4QDEA 3HL7A 4WBBB 2FUMA 3F9NA 5KMOA 3KXXA 1YXTA 3ULIA 4BZOA 1H27A 3KA0A 4F0GA 5KBRA 5AP6A 1XBAA 1IRKA 1XH8A 3LQ5A 3AKLA 2JC6A 4D2TA 1OPKA 2WXVA 4U3ZA 3WILA 2QVSE 4ZTSA 4QTBA 4D0WA 2XK3A 4QYHA 5CVGA 4IACA 4CEGA 3KVXA 3TKUA 1M2PA 3UC3A 2QKWB 5FDPA 5DA3A 4QPAA 2QLQA 3KRWA 1LPUA 3ULZA 3WF9A 3RHKA 2Y7JA 3ZRKA 1OL2A 4L53A 4OLIA 3RK7A 3UVPA 2YM7A 4DC2A 5E8SA 2PK9A 4RWKA 4BCHA 1B6CB 3KMMA 3DY7A 4MNEA 5EDRA 2F7EE 3N9XA 1V0PA 3BLRA 4FSTA 1VYZA 5DRBA 2QG7A 2WEIA 5BVFA 3EJ1A 3G9NA 1OBGA 2V0DA 2WMQA 3ROCA 3R9NA 3MI9A 3MV5A 3FMDA 4X2JA 2BFYA 3ID6C 4G3DA 4BDIA 2VTNA 3OMVA 3BHTA 3QAME 4AT3A 5HX6A 2YLEA 4K77A 1W2CA 4Y95A 1YHSA 2WTKC 4AE9A 3LOKA 2UW3A 3PIXA 5HEZA 3HA6A 4W4VA 3IW5A 1YDTE 3THBA 3VF9A 2BMCA 5CT7A 3GCSA 2X39A 4D28A 5IU2A 4U3YA 1ZZ2A 3R7GA 4X6QC 3VHEA 3NX8A 3CJFA 3P5JC 4RWJA 2C5OA 3NYNA 3DTWA 4O7TA 3QZFA 2XMYA 3GU8A 5D7AA 2J5FA 2W17A 1OB3A