3HDMA

Crystal structure of serum and glucocorticoid-regulated kinase 1 in complex with compound 1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
298
structure length
285
Chain Sequence
QQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Sgk1
publication title Design and synthesis of orally bioavailable serum and glucocorticoid-regulated kinase 1 (SGK1) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 285
sequence length 298
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hdmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hdmA01
1H1WA 2O64A 4H36A 4I1ZA 4PQNA 4O0UA 4QTBA 5DVRA 3QQFA 1QPCA 5LWNA 2W06A 2IWIA 3DBDA 4XRLA 4E5BA 4FYNA 5JGAA 2C6KA 1PXNA 5FM2A 4EOQA 2XK9A 4H1MA 4MH7A 2OIBA 4CD0A 1FBNA 4HYUA 4NTTA 2HWPA 4YJOA 4IX5A 1J91A 1YXUA 4S33A 4O82A 3FAAA 3ZRMA 4GG7A 5CTPA 2BHEA 5E8VA 4YTFA 4GT4A 5I4NA 1MQBA 5AUWA 5HTBA 2UW5A 3BLRA 5GJFA 3T9IA 2JDVA 4FTJA 4TYHA 3DDQA 1JVPP 1LEWA 3FYKX 5KKRB 3G15A 4K11A 2QU6A 4XV1A 3FEGA 3OCBA 5CNOA 3GC7A 2ITOA 1KOBA 2C6LA 1OI9A 5HG5A 4WRSA 1JKTA 2PUIA 1ERKA 2JDOA 1UVRA 2HZ0A 3OW4A 2RL5A 2XYNA 1LPUA 4XLVA 4C35A 3ZO4A 5ANGA 5FRIA 2PY3A 4X3JA 1WBWA 2XBAA 4BICA 4FNZA 4LMNA 4H3BA 2ITYA 4XBRA 5GZ9A 4AFEA 4BHZA 3PYYA 4DGOA 5CAPA 3PJ8A 5KBRA 4M14A 2YIRA 5A14A 3FXZA 5BPYA 5IDPA 1UV5A 5KX8A 4FSYA 4E26A 4XP2A 3UIUA 4BF2A 2ZOQA 2QG7A 4NIFA 4EYJA 1OL1A 3RI1A 4IH8A 4GL9A 4WIHA 3UIMA 3V6RA 4BTMA 5A4EA 5JRQA 4O21A 3DFAA 1YQJA 4TKSA 2FB8A 2QOQA 3OF0A 4FTAA 4B99A 3BQRA 4D9UA 2YA9A 4AGCA 4B0GA 5K5NA 1JPAA 5F20A 3MSSA 2CLQA 4HYSA 3RK9A 5KCVA 3LJ0A 2J0JA 3EQIA 2JEDA 2VTLA 2OBJA 5CVHA 3OD6X 3DAKA 3Q9XA 3VF8A 1ZAOA 5IZFA 4EL9A 4JAIA 4LOQA 3I79A 4O0XA 2CSNA 3SGCA 3LFDA 4FTOA 4R7IA 3H10A 4YO4A 3SW4A 3VQUA 4O7RA 4AOTA 1GZNA 4GCJA 4DITA 3PP1A 5ETFA 3OROA 3PVUA 3Q96A 1DAYA 3KKVA 4WRGA 2W1IA 4X2JA 2PVMA 4OTHA 3CY2A 4J96A 1ZZ2A 3MH0A 4NUSA 2VX1A 4DHFA 3N51A 4YJVA 4BCQA 3E8EA 3EQGA 3P9JA 3R8PA 2Z02A 2XIZA 3FL5A 1KE9A 4W9XA 3RPSA 4HJOA 4ZOGA 4DFYA 5LMAA 3LXNA 4TNBA 5EHYA 4UXQA 2CKEA 1EH4A 1JSUA 3G6HA 3HKOA 3UVPA 5AA9A 5M4FA 1G8SA 3S00A 5M4UA 4O1OA 3FMJA 4GK4A 4F0GA 2W1CA 4AGWA 5CU0A 1BI8A 3H30A 4BRXA 1MRYA 4IB3A 4CRSA 2IJMA 1ZYCA 3KGAA 4C3PA 3EMGA 3O7LB 3ZS5A 5I3OA 2OWBA 4FV0A 4RX7A 3HP5A 3G90X 3ZM9A 4IC8A 3GNIB 1OZ1A 3FV8A 1L8TA 3BRBA 3KN6A 3DK7A 5LVPA 2BAKA 4ZTNA 5HO6A 2BRHA 4BZOA 2GTMA 3HUCA 5EYKA 3WI6A 3IDCA 4S30A 2YABA 3EQRA 3F3ZA 4P90A 4X2NA 4DBNA 3EFLA 4LUDA 1V0BA 2WQNA 3DCVA 2WTWA 3E5AA 4M66A 4NJ3A 3VC4A 4BVUA 5CT7A 5FXSA 3VBXA 4D1ZA 4EH2A 1OM1A 1I09A 2KULA 4RQKA 3BV3A 4BYJA 2UZTA 3NYNA 3OXZA 3DB6A 4FT3A 3FMEA 3QLGA 4O22A 5ETAA 5M55A 3M11A 1CKIA 3AT4A 2YERA 4EWHA 5HBEA 3DBFA 4NM5A 4FEWA 4BDFA 3PIZA 2B53A 1T46A 5L2QA 1JLUE 2JKKA 4CQGA 3JXWA 1SNUA 3EZRA 4DGGA 3LFNA 4KIQA 4H39A 2BRBA 4YPDA 5EYCA 1E1XA 1OIUA 1DI9A 2CDZA 4Z55A 3W2OA 3DT1A 4A7CA 5CZIA 3PXKA 4ASZA 4BDAA 1RQQA 2XJ2A 4I41A 1KE8A 3I4BA 1TVOA 4QMTA 4DFUA 3CQEA 4GV1A 4QMZA 3UP2A 3R02A 4J97A 4D4YA 3JUHA 4DH1A 4K1BA 4LYNA 1KV1A 4FTMA 4HZSA 3D7ZA 4X6RA 4NW6A 3GB2A 3BYMA 5JFVA 3LAUA 3VUKA 2XP2A 2AYPA 1H0VA 3GU6A 3COMA 3TNHA 3LIJA 1HCLA 2RF9A 2R64A 4K33A 4Z3VA 2W9ZB 4JDIA 3OY3A 3I5NA 3P4KA 4FYOA 4CFFA 4U42A 4J52A 4QNAA 4RX8A 4DYMA 3EWHA 4MAOA 4X3FA 4FOBA 4HNIA 3QTWA 4IDVA 4O6EA 4R1YA 3AC5A 1ZOEA 5EI2A 5FM3A 4F1OA 3B2WA 4QMOA 4XG9A 1PW2A 4JBPA 3FZSA 3QWJA 4L52A 1W0XC 2V55A 4FVRA 4OBQA 4BCKA 5FTGA 3BWFA 3BGPA 2YIWA 3R9DA 1FGIA 3E63A 2WOTA 3D5WA 4AW2A 2DWBA 5AR5A 3WARA 4D4RA 3ORKA 4TT7A 4H1JA 5IA0A 4MHAA 4EJNA 5FGKA 4HGEA 2G9XA 1XWSA 4RMZA 2W4KA 1O6KA 2QO7A 2YAKA 2JKMA 3E62A 3UODA 3UVQA 2W1FA 3NNWA 2HZ4A 2OG8A 4R3CA 5IKWA 4AZEA 3CTHA 4YC8A 4GYIA 3UO4A 3ORTA 4AZFA 2BTRA 1H28A 3C4CA 4RG0A 4BKYA 4ANOA 1VEBA 2EB3A 4PP9A 3OFMA 2QC6A 2QLUA 3VUIA 4BWKA 3MESA 3F82A 4UXLA 2O5KA 2PVYA 4M8TA 2CMWA 3B2TA 4IQ6A 3B8RA 5D1JA 4AW5A 1ZARA 3Q3BA 4DGMA 3GCVA 1Q97A 3TZ9A 2UZEA 5L6PA 5M4IA 4QMQA 4EK5A 3CTQA 2UVZA 5FDPA 3PFQA 2QVSE 4O0YA 5DRBA 4C02A 4P4CA 4EK8A 1O6LA 3DLZA 3LLAA 2UZNA 2PULA 3MW1A 3UGCA 4FZ7A 5AX3A 1Q8YA 3CKWA 3RP9A 4YZ9A 4EWQA 3F7WA 4E3CA 4O7SA 2FSMX 3HMMA 5CU2A 2PMLX 2P2HA 3KVWA 4RIOA 4HVHA 3DGKA 3P23A 3DKCA 4O0WA 4CFUA 3HA6A 3BYOA 3FZ1A 3QQJA 3QQUA 4S34A 5EK7A 3EL8A 1V0OA 5AAFA 3WIKA 3K54A 3VO3A 3ZZEA 2ITZA 5TO8A 5L4QA 4RZVA 4BI0A 4GT5A 3RWPA 4UYAA 4J8NA 3QTIA 3VRZA 2XK4A 4EI4A 2ITWA 5IQEA 3CY3A 5CS6A 5CF6A 1QL6A 3UZPA 3Q4UA 3LMIA 2X8DA 1U46A 4E4NA 4PV0A 1DM2A 4MBIA 1RDQE 3LFAA 5CAUA 3IPHA 3GU7A 2CKQA 3PXYA 4QMYA 2VTHA 1S9JA 3IDPA 2XNGA 2BKZA 4K8AA 2OZOA 2VTNA 3E7OA 3MVLA 3PZHA 4EC9A 5DEYA 2WMUA 5FEEA 4CT2A 3F6XA 4AOIA 4J98A 5LMBA 2WEIA 3KULA 3QTZA 1QPEA 4MBLA 4KIKA 2W7XA 3UC3A 4NCTA 4NM7A 3SX9A 5L2WA 4FX3A 2CN8A 3D7TB 1YWNA 3LQ5A 1PYEA 5JFSA 5BUJA 5DN3A 2HY81 2H34A 5EDPA 3BLHA 3D5XA 3EQBA 1W98A 5E9EA 5JQ5A 4ITIA 2E9VA 3NW6A 4QD6A 3VUHA 4U43A 3KK8A 3A7HA 4HPTE 4XV2A 3GQLA 4QMLA 4FTLA 1UNLA 1H01A 4X3FC 4B8MA 4DN5A 4BFMA 5I9VA 3HMOA 5A54A 2YZAA 4KB8A 3FHRA 4UMPA 2PVRA 3AD4A 3EFWA 3PSBA 3EN6A 5HVJA 3UP7A 4CMUA 4MK0A 2QHNA 2Z60A 3E8CA 3OCGA 2YM3A 3QLFA 4BB4A 3S1HA 4U5JA 3HMNA 3N4UA 4YJQA 3WZDA 3KXXA 5FBOA 2YIXA 4GEOA 4F63A 2OXDA 4QYHA 4C34A 4BDCA 2X9FA 3BU3A 4YZMA 1J7LA 3O50A 4IC7A 1YXTA 2UZOA 4YNOA 3VS4A 3HA8A 2C47A 2XIYA 1YOJA 4V05A 4G3EA 3SA0A 2OU7A 3DKFA 4PDOA 4RJ4A 5AUVA 4M7IA 3CD3A 4U3YA 2VTSA 3JY0A 5E91A 4EOOA 4B7TA 4DTBA 2J51A 3HRBA 1ZY5A 4USFA 4IJ9A 2CGWA 4C4EA 5AUYA 4YMJA 5JRSA 2VTOA 1JQHA 4WKQA 4IVBA 4XX9A 4CXAA 4ZJVA 1OGUA 4LM5A 3RAKA 3W2SA 1PMVA 3QCQA 5ANJA 4KIPA 5AWMA 3ZBFA 3II5A 4U80A 5TKDA 4QMVA 4ACHA 4C4FA 3ZFMA 3R7VA 4M69B 1FINA 4AA0A 2XRUA 5I0BA 1BMKA 3NIZA 5EM6A 5F94A 3ZHPC 5C8KA 1MUOA 4QP1A 3O0GA 4EOJA 4I22A 2PUUA 3KXHA 2YWPA 3MGYA 3MYGA 2OZAB 4I24A 2QOLA 2VU3A 2XEYA 1PXMA 5JH6A 5BYZA 2P33A 3SKCA 2OJIA 4J7BA 3NIEA 5D11A 3AD5A 1OUYA 2WMSA 2BAQA 4ASXA 4MNEB 2YLEA 3L8VA 4PY1A 3MA6A 2UZWE 4ALVA 3ZC6A 4G31A 3DAJA 4YZCA 1Q8TA 2FSTX 3FMDA 4L42A 3SV0A 4AA4A 3KCFA 4OR5A 2XEZA 4FSUA 4P5ZA 4FNYA 1E9HA 4MQ2A 2BDFA 4D1SA 3POZA 4I6QA 3NAXA 4YSMA 2BMCA 4F7LA 4ZAUA 3MVJA 4U79A 4EH6A 4M0YA 4D4SA 2YIYA 2ZDUA 5JGBA 4FGBA 4F9AA 2AC5A 4BDHA 2JDRA 1CMKE 2PZYA 4HZRA 3W1FA 4UYNA 2V5QA 5AUZA 1BYGA 1PHKA 3N9XA 5C8NA 2GMXA 5A46A 5DBXA 3DZOA 4IZYA 4QYEA 5EHOA 5B2LA 2J9MA 1L3RE 3LCTA 1XBCA 4LQMA 5AR7A 4ORKA 5H3QA 4BCMA 4E6DA 1H1SA 4YJTA 2YM8A 4C33A 5KO1A 3CQWA 2YITA 2X0GA 3L8SA 2W1ZA 4I0TA 3PA4A 3ALNA 3PG3A 3RINA 2EB2A 4YBKA 4F9CA 2XCKA 5HX6A 4ZSJA 4CVAA 3OVVA 3RHKA 3TIZA 2NPQA 3O51A 3RNIA 3SRVA 3HV6A 3G0FA 5D12A 4M15A 4I21A 4PTEA 3UNJA 4UZHA 4ANMA 3DK3A 1H0WA 1SM2A 4PMSA 1JOWB 2CHLA 4HW7A 3SC1A 2UV2A 3FY2A 4X2FA 4Z7GA 4YP8A 5IQIA 2QLQA 4NCTC 3C7QA 3R7UA 4ZJIA 3WF5A 3NAYA 2EWAA 4DH5A 1OL2A 3RVGA 1YWRA 3VBVA 5CF8A 1V1KA 2R3RA 3EN4A 5F1ZA 1WVWA 1YVJA 3TCPA 4N57A 2YIQA 3IOPA 4D1XA 5EW8A 5E8XA 4EH4A 2YM4A 4CKRA 1GAGA 3EZVA 3G2FA 3TXOA 4Z7HA 3U4WA 1YW2A 4EK3A 1YDSE 3OWLA 4JX7A 5ANDA 4AN2A 4PRJA 1Z57A 4AGDA 2JC6A 4QQJA 3ZCLA 4NH1A 4QYFA 2ZDTA 3TV6A 4R1VA 4C59A 4C58A 3WYYA 4DA5A 2XIRA 3FL4A 4XOYA 3DS6A 3QD0A 3FLSA 4BC6A 3OS3A 1J3HA 3C0HA 3W10A 4KAOA 1U5RA 1BUHA 3ZO3A 2PMNX 3V5JA 3COHA 4JRNA 4C2WA 4YTCA 4FSQA 2CLXA 4G16A 2IW8A 2GFSA 4TW9A 5EOLA 3SVVA 4GFOA 4BCGA 2ZM1A 4AGUA 2ERKA 2J0KA 5K9IA 4JI9A 2BZKB 3GGFA 3ODZX 4U7ZA 3ZLSA 1WCCA 5HBHA 2X7GA 3IW4A 3AG9A 4GT3A 2C5YA 4QYGA 5DOSA 2XH5A 3UYSA 2WTKC 5BVDA 1Q8UA 4AN3A 4JR7A 4QTAA 1RW8A 1YOLA 4LGGA 4ACDA 4O2ZA 2Y6OA 5E8ZA 2OO8X 2YM7A 3MIYA 2WQOA 2C5XA 4IACA 4XP0A 4AX8A 4EUTA 3QRUA 2ZAZA 2CGUA 2X7FA 5DYJA 2B55A 5HVKA 1ZXEA 3FZTA 5DHJA 4O7LA 2JBOA 3EQFA 3QYWA 4HNFA 4LFIA 3RKBA 3VVHA 5JZJA 5EYDA 4IXPA 5A6OA 2C6TA 4MYGA 3ZM4A 4E20A 1YKRA 4FK3A 3RBWA 3IKAA 1OKZA 3VRYA 3G51A 4WT6A 4ID7A 2OIDA 5JFXA 2OW3A 4RLLA 1JWHA 2IN6A 3R71A 3HP2A 4GG5A 4TXCA 4R5YA 1URCA 4QP2A 5HG7A 3S3IA 3V5QA 4EQCA 1K2PA 3HLLA 3P08A 3L9MA 5CALA 4CZUA 4LOOA 4JIAA 5FTOA 4ALUA 1GZOA 4ERKA 4L9IA 1WBPA 2IZUA 1UNGA 3GFEA 3KN5A 2ZM3A 4O7TA 5IU2A 3FQSA 4WG4A 2VTPA 4TYGA 3UZRA 4BHNA 4F6UA 4BCHA 4IB1A 2PPQA 3NPCA 1PMNA 4HYHA 4RIWA 1KWPA 1WBOA 2X6EA 3F5GA 2VWVA 3BU5A 5EM7A 3QQHA 3QTQA 4FT9A 4XG6A 4FZ6A 4WSQA 4CGAA 2Z7SA 4AUAA 2R7BA 2WMWA 3W18A 4AU8A 3KRRA 4BTJA 2X4FA 3D4QA 5CEIA 2NRYA 4ZTMA 4I94A 2HZIA 4IM2A 4Y5HA 2R3FA 2Y4IB 4MXYA 3IDBA 1G3NA 1ZYSA 3R8MA 5D10A 5JQ8A 4BDDA 5FLFA 4ANQA 3BCEA 4AOJA 4AT5A 4AA5A 1M7QA 3QBNA 4O2PA 4RJ7A 3OEFX 4MXAA 2B52A 5LARA 2IG7A 4HPUE 2PU8A 2RIOA 3C5IA 4XBUA 3F5PA 1H24A 3E8NA 4C7TA 3RNYA 3BLQA 4E6CA 5M07A 5KHWA 3SQQA 3LFBA 3IECA 3VW6A 4CLJA 4MXZA 2CJMA 2I1MA 3QZGA 5DT4A 4AP7A 2Y9QA 2IVSA 4FSMA 4CTBA 5HNIX 5J9YA 4D2TA 1NVRA 4DGLC 3G6GA 3C0GA 3MFSA 2HOGA 3K2LA 4MVFA 3V5TA 5ITAA 4H3QA 3V51A 1U54B 2W96B 3ROCA 5I3RA 1W84A 3KC3A 1GZKA 3LCDA 4KBAA 5DLSA 1FOTA 5AR4A 3ZH8A 3U55A 4RFMA 1ZWSA 5FXQA 4WSYA 5IQDA 4V01A 3BHUA 5JSMA 3IO7A 2OKRA 2WOUA 4GK2A 4FKTA 3HGKA 3C5UA 3UJGA 1P5EA 2XJ0A 3BGQA 3DBCA 4F6WA 3ZBXA 4R7BA 4HOKA 5AFVA 5CQWA 3UG1A 4W4XA 5DA3A 4C8BA 2PUNA 2HAKA 5CSXA 2ZMCA 4IMYA 2E9NA 4NU1A 5EDRA 4Y73A 2FA2A 3HEGA 3D5UA 4M97A 2IZRA 1YXVA 1WZYA 3U8WA 1P2AA 4QP7A 3MIAA 3R8VA 4FSNA 4QYYA 3A62A 5AP2A 2IVTA 4BIEA 4YZDA 2R3JA 2XNPA 3QUPA 4IFGA 2XBJA 5ETIA 1OVEA 2C3IB 2XK6A 2GQGA 3OY1A 2Q0NA 4C4JA 5J1VA 2REIA 3L8PA 2FSLX 2ITUA 3OT3A 3POOA 4PWNA 5A3XA 2ZB0A 4D58A 5CSPA 1K9AA 3CXWA 1B39A 5DRDA 4S2ZA 3DK6A 4I6HA 3FPQA 2EXCX 3TTJA 3R9NA 4EYMA 2PZPA 3KCKA 4PUZA 4Q9SA 4FTIA 2OXYA 5IA1A 3D15A 4ZMEA 3HRFA 4I3ZA 2VWXA 3W55A 4FV6A 3ZONA 3IW7A 3F9NA 1W83A 4FKWA 4XG4A 4ZTRA 1QCFA 2XMYA 2VGPA 1KOAA 2JLDA 3KF4A 5KMOA 3R7OA 4JQ7A 4JBVA 3KRJA 4RSSA 3TI1A 4BGHA 2RFSA 5HBJA 3OZ6A 4FUXA 4D0XA 1NVSA 1TQPA 4JS8A 3TKIA 2W1EA 2JIUA 2ETRA 3PRIA 3MH2A 5ANOA 4BIBA 4FICA 4DGNA 3FWQA 5AMNA 4K6ZA 2GNJA 5KHXA 5EI6A 4I93A 4JL9A 1MQ4A 2EXEA 2C0TA 4N6ZA 2XB7A 4FTQA 5GJDA 5IPJA 3DJ6A 2ZB1A 2YISA 4HCVA 4RWJA 1Y8YA 2VTIA 2WEVA 4FKOA 1O6YA 2CNQA 2HW7A 4PL4A 2JFMA 3KU2A 3LZBA 3ULIA 2XA4A 2JIVA 5HD7A 4FSRA 1OL6A 4WG3A 1IG1A 4YZBA 4O86A 2GHMA 2YM6A 4FL3A 4IADA 4CT1A 3D2KA 4YJPA 4EH8A 2OICA 4C3FA 4D2SA 4FC0A 1OBGA 2GQSA 3I6WA 4M3QA 5AJQA 5ACKA 4GIIA 3AC1A 4GFGA 2F2CB 5A4LA 4GMYA 3LHJA 3TNPC 4DEDA 5HCZA 2C6EA 3PDTA 2DQ7X 2QURA 4X2KA 4BCPA 4PX6A 3CJFA 3ZRLA 5AUTA 4DG3E 3D9VA 3PWDA 4MD9E 2YAAA 4P5QA 4YJRA 5DR9A 2BPMA 1XH9A 4QRCA 4JQ8A 5HORA 2UW8A 4ZK5A 3IGGA 4FKVA 5CEPA 4ZY4A 2PZIA 3WYXA 1OKWA 1GIHA 3C4ZA 1YDTE 4AFJA 3IQ7A 2H6DA 3MVHA 4OT5A 1PXJA 3Q53A 1JKSA 3MVMA 4RPVA 2WIPA 2R3QA 4YC3A 3UNZA 2O0UA 3QX4A 5BVNA 2C6DA 4V0GA 4FKLA 3KFAA 5AP1A 4C4HA 5L2IA 3OTVA 2VWIA 4NKSA 4HVSA 1A9UA 3MPTA 4FV8A 4FODA 2CNUA 2XRWA 2SRCA 4MCVA 3K5VA 1OIRA 3TUCA 5HLNA 2PK9A 2C6MA 4QTEA 3CLYA 3BZ3A 2J0IA 3COKA 4IDTA 3H0ZA 4J95A 2WMVA 4RIYB 4FIFA 4JLCA 1Y57A 3VBWA 4BDKA 4O7WA 3FYJX 4HYIA 1WBNA 3RWQA 4RFZA 3BBTB 5H2UA 5HQ0A 4I92A 3RM7A 5F9EA 3DNDA 1UU8A 2OJGA 3FZOA 4APCA 5DGZA 3CJGA 2C4GA 2YM5A 5EH0A 3CE3A 4YPSA 4IBMA 2YN8A 3R1QA 3A60A 4J99A 3EQPA 3PY1A 3R2YA 1FVVA 4FIGA 3BWJA 2PVFA 4WNKA 4DH8A 3RZFA 5E7RA 5L2TA 3LLTA 4BDBA 3E8DA 4EKKA 2B7AA 3H9FA 5C01A 3UQCA 3NYOA 3JVRA 2RKUA 4WUAA 3AGMA 3FI8A 1UNHA 2C1AA 4PPCA 4ZSGA 5L8LA 2PVHA 3NW5A 3Q5IA 2XKEA 3C4WA 3AOXA 3IG7A 4EQUA 4G6LA 4QP4A 1PXPA 5HE2A 4JBQA 4O81A 2HZNA 3BYVA 5DPVA 4L67A 1SMHA 1J1CA 3WF9A 4KBKA 1JNKA 2WELA 1NT2A 1PYXA 2VWUA 4KD1A 4KRDA 3R7YA 3QF9A 3ZXZA 5KUPA 2WNTA 1PXLA 5AM7A 4AZTA 4CNHA 3PVBA 3PLSA 3TWJA 4O7YA 3BI6A 2OFUA 2RFEA 2C0IA 4FMQA 1FMKA 3GCPA 3NCZA 3ORPA 3FLNC 1UKHA 3LKMA 2QO2A 3F88A 3LM0A 5E8WA 3R9OA 2XM9A 3NVMB 2ESMA 3TACA 3WZEA 4E5AX 2J4ZA 2VZ6A 1ND4A 1H4LA 1P14A 3DOGA 5T6KA 2H8HA 4F7JA 4FTTA 5HG9A 5E8UA 3IW6A 4FKUA 2XK8A 4WO5A 5HG8A 2YDIA 1H1PA 3C4XA 4RC2A 3SOAA 5BYYA 1OIQA 2QOOA 4QP3A 3FXXA 2ETMA 2XKFA 4AWIA 4FV1A 1XH5A 3PPJA 5B2KA 2HW6A 4O0VA 4G6OA 5GHVA 1A48A 1M17A 4D2WA 3HDMA 4DLJA 3EHAA 2VNYA 4YLKA 1I44A 4C57A 3R21A 5JEBA 4L3JA 5K0XA 3TDVA 2W1GA 5CF4A 3EIDA 4N6YA 4PP7A 4YHJA 3ACKA 3FI2A 1ZYJA 2YLFA 3R7IA 3RPYA 2VGOA 1QPDA 3COIA 5FD2A 4AS0A 4F9YA 5GIPE 4TY1A 3ZXTA 3OUNB 4WNOA 4MNFA 5CXZA 2GNGA 5A6NA 2GS2A 5LVNA 3QZFA 4Y83A 1CM8A 3O8UA 2IZSA 4FKSA 4LV5A 4EUUA 2JITA 2GNLA 1HOWA 3GC9A 5HCXA 4CCBA 4ERWA 3VUMA 2X7OA 3LE6A 4RC4A 3DJ5A 5CZHA 2Y6MA 4K77A 4PF4A 5CSVA 2CCHA 3ZO2A 1GY3A 5LJJA 2Z7QA 3AC3A 4GS6A 4RQVA 4RIYA 4KKHA 1H8FA 4KS7A 3UO5A 5HU9A 2WXVA 4IAAA 3GCUA 3SW7A 4F4PA 4N70A 1G5SA 2IPXA 1BL6A 4IZ7A 2J0LA 4BCIA 4S32A 4YURA 5KNJA 3PTGA 3R8LA 3UOHA 4DTKA 2IVVA 4E6AA 3MFUA 4F99A 4I4EA 3KMUA 2XJ1A 2YEXA 3AXWA 3FMLA 4NYEA 3DZQA 4TWNA 2CN5A 4LRMA 2XIKA 4WNPA 1A06A 2J50A 5C9CA 5AADA 2B4SB 4OTPA 3MJ1A 3O17A 3TN8A 1XH8A 3OW3A 4E4MA 4ZLYA 5FEQA 4CEGA 5IA5A 3W2CA 1J1BA 2PVKA 3O71A 4TYEA 3O8TA 3RGFA 3ZLXA 4PMPA 4DEHA 1W82A 3UPZA 4O7VA 2R3IA 5IA2A 4KSPA 4FTCA 3NR9A 1XBBA 3EKNA 4XOZA 4J71A 1LP4A 1DS5A 2JDSA 2PHKA 5HVYA 5IISA 3ETAA 2ZM4A 2OJJA 4UMRA 4A9YA 2PYWA 2W05A 5M56A 2VO6A 3Q32A 4AZSA 2W4JA 5C26A 5HO8A 3W8LA 2VX0A 2ZV7A 4GFMA 4IANA 4IVCA 3RCJA 3TG1A 3UC4A 4OTRA 2H96A 5BVWA 3LJ1A 3TJDA 1GIIA 1ZZLA 4YR8A 2QOHA 3TTIA 4XP3A 2Z2WA 4MD7E 4OW8A 5HE0A 3V5LA 3F3TA 2X81A 2ZV9A 3DDPA 3ODYX 1OKVA 3OCTA 4OBPA 3O23A 5KKRC 4C37A 1IR3A 3EYGA 4O27B 5AV3A 2F49A 2WPAA 4G2FA 2C6IA 4UWYA 3FY0A 3V8WA 3RJCA 3RPVA 3HX4A 2RGPA 3VWAA 3DA6A 3W16A 2ONLA 3HYHA 1M2QA 3M42A 1M2RA 3ZO1A 1XJDA 3BPRA 4BTKA 2R5TA 5HEZA 3UE4A 2BR1A 4QTDA 3FLQA 5EW9A 4UMUA 4CSVA 1XH4A 5IEXA 4LGDA 4BZNA 3GBZA 3TNIA 5IQHA 4OTDA 4RRVA 4ZMFA 2OH4A 4IHPA 4FNXA 4ITHA 4GU9A 2QKWB 4W4VA 5IQCA 4XG7A 4QMNA 3H4JA 1U5QA 2PL0A 3NX8A 4YJSA 3REPA 3NNUA 1YHWA 3GI3A 3ORZA 5L8JA 3SXSA 3U4UA 2O65A 4O0TA 3HNGA 4G9CA 4O38A 4GVAA 3R30A 2W5BA 2BZJA 4KRCA 4IM3A 4DEGA 3ELJA 4ANBA 5AR2A 3DXQA 3UZTA 4DEIA 4BDJA 2O8YA 5BNJA 3KMWA 2VO3A 1H1RA 2EXMA 3LCSA 3Q9ZA 4B8LA 1F0QA 2UW7A 2A27A 4P7EA 2BFXA 4GKHA 2EU9A 3L9NA 3DB8A 1WVYA 2RFNA 4NFMA 4PL3A 3IW8A 3BHVA 1OECA 5K3YA 4ACMA 2WIHA 4FKGA 1Y6BA 4BZDA 2UVYA 2ZJWA 3WF7A 4D9TA 5CAQA 2WMRA 3LW0A 5FDXA 3R9RA 3LQ8A 3TIYA 4EH3A 4L3LA 5DWRA 4G3GA 3L1SA 4TL0A 5BYLA 1JBPE 4A4XA 5DT0A 4EK6A 3L9LA 3NUYA 4R6VA 5E1SA 4DE4A 3EN9A 3NNVA 3Q4CA 2A2AA 2DS1A 1APME 5CLPA 1WBSA 2WTDA 3PPKA 4ZZOA 4ZY5A 5I9WA 3ID6C 1G8AA 4F09A 4KA3A 4K18A 4F9WA 4AT4A 5KMKA 3G33A 2WO6A 1SVEA 4ACCA 3FMKA 5TT7A 2R3LA 3PRFA 4UB7A 5HLPA 4F08A 3OOGA 5BVEA 4PMMA 2RG6A 3EJ1A 3LCKA 4C4IA 3ORLA 4E1ZA 4JOAA 3TJCA 4DC2A 2ITNA 4EHGA 4BWXA 4M84A 3QA8A 5IEYA 1CKJA 3OEZA 1ZRZA 4RVLA 4KABA 3THBA 4OUCA 3F2RA 2WU7A 3JY9A 3BV2A 4ENXA 2XNNA 1UU3A 3NZ0A 3R8UA 3QRJA 2BTSA 3GCQA 3ZSHA 3QX2A 4C3RA 3BEGA 1IRKA 5J5SA 2OGVA 4UY9A 3ITZA 3P78A 3A7JA 4GH2A 4I5PA 5CANA 4NM3A 2VV9A 3V01A 3RHXA 2I7QA 4L01A 3D94A 2QKRA 3R1SA 5KMNA 5E92A 4R78A 2ZV8A 3H0YA 3I1AA 4QMMA 3ZUVA 5CEOA 2J6MA 4IWOA 3MS9A 3HVCA 4RLKA 4U8ZA 5CT0A 5H8EA 5CEQA 4BCFA 4BCJA 4RX5A 3CIKA 2QODA 4CCUA 5EKNA 2VO7A 3SD0A 2UZDA 4YTHA 4MKCA 3VAPA 3U51A 4I0RA 5IF1A 3OWJA 5HO7A 1KE5A 3UOJA 4PTCA 3CEKA 4KS8A 4IEBA 3QALE 3TT0A 5GZ8A 1R39A 1Y6AA 3EQCA 2WKMA 3ORXA 3VUGA 1DAWA 4JRVA 1E1VA 1OPLA 3UOLA 3DQWA 4M13A 2JIIA 2PVLA 4MWIA 4RIXB 4I6BA 4ZS0A 4YHFA 3A7IA 3QTSA 4JDHA 5HKMA 3VS3A 3D7TA 4G17A 4GJ2A 4BBEA 3T3UA 1J7UA 2QG5A 4R5SA 5HESA 2ONLC 3I5ZA 4C36A 4ZZMA 4F9BA 2PVJA 3L9PA 5FP5A 4ACGA 3VJOA 4QMWA 4YJNA 5J9LA 3JVSA 4RVKA 4YO6A 2GHGA 2C68A 3ET7A 5F4NA 4D55A 3OTUA 3PIYA 5CI6A 5E8TA 1H26A 3WF8A 3ZLYA 3MPAA 3LVPA 4FIEA 5JMSA 5AX9A 5CQUA 3BYSA 3MB7A 3IW5A 1PRYA 3E3PA 3WZJA 4GRBA 3DLSA 3S4QA 2F7ZE 3KREA 4ENYA 2V22A 3RZBA 2BVAA 2UW9A 2W4OA 3F5XA 4KUJA 3Q04A 1M2PA 3QRKA 1Q8WA 5M53A 4FT7A 4BGQA 3HMPA 2G2FA 4DINA 2JKOA 3VF9A 2HCKA 3KVXA 3MBLA 4TYJA 2R2PA 4EZ7A 1Q3DA 3N4TA 2OJFE 4UMTA 1PXKA 2QOIA 4MX9A 4W4YA 5B0XA 5E8YA 4FBXA 4YNEA 4ANLA 1PXOA 4YSJA 3ULZA 4NSTA 5EFQA 4TWPA 3VS7A 3LJ2A 3HDNA 3FSFA 2ZV2A 4OTGA 5CEMA 4E5WA 3PVWA 4G6NA 2VTQA 3HL7A 3ZYAA 5KMJA 1ATPE 1WBTA 1UA2A 4GU6A 3TKUA 5IUIA 4CLIA 4FNWA 5DT3A 3GCSA 4RVMA 4OBOA 4TWOA 4CFWA 4EOMA 4ZZNA 3BEAA 4FKJA 4M69A 2HXQA 4QPMA 4U81A 3IS5A 4FTNA 4XG3A 3P1AA 4JG8A 3VBQA 3I60A 1OPKA 2PVNA 2P0CA 4NTSA 4PDSA 4ASEA 4ZSLA 5FWKK 3D0EA 3UBDA 4EC8A 5L2SA 4TZRA 3HRCA 3BQCA 4FTKA 3U9NA 3GP0A 2OZAA 4NW5A 3FHIA 3QRIA 5AR8A 1PKGA 1IAJA 2GHLA 3BU6A 3NW7A 4FKPA 4ZY6A 4D2RA 3F2AA 5IMEA 1YWVA 2I0VA 4USDA 4F65A 4MNEA 1VYZA 4EH7A 5M57A 4FUYA 3OC1A 5DI1A 4FEXA 3KRWA 4MTAA 3TEIA 5FXRA 2IW6A 2R3GA 3Q4TA 2QNJA 1YI6A 4P2KA 2BALA 3FBVA 1OITA 3FLWA 2VAGA 3U87A 5AP3A 4L53A 3EN5A 3BHYA 3LFCA 2Y0AA 4XG8A 4LI5A 4CRLA 2X4ZA 5ANEA 2OF4A 3VULA 4FL2A 4X2GA 2ITVA 5CAVA 1OUKA 3DPKA 3LCOA 5IQAA 2R7IA 1GJOA 2A4LA 2AUHA 4FEVA 2J5FA 3QZHA 2YJRA 3HMIA 4BCNA 3AMAA 5IUHA 4QOXA 3ANRA 5L6WL 4IW0A 3TUDA 5BX0A 3E87A 5ANIA 3RALA 2WZJA 2Z8CA 3E3BX 3PP0A 2LAVA 5AP5A 3TZ7A 3Q5ZA 2XIXA 4FL1A 3EYHA 5AP0A 3UQGA 3M1SA 1BKXA 1YHSA 1OPJA 1CKPA 3QTRA 5LWMA 1YI3A 2OIQA 5IUGA 3QCSA 3TDWA 2VWBA 2E9PA 3G0EA 2OJ9A 5GZAA 4UZDA 3TKHA 2BCJA 3A4OX 3CPBA 3ORMA 2GS7A 3E92A 4FKIA 4G3FA 5J95A 2GQRA 1ZOGA 3VQHA 4EBVA 2QR7A 3LMGA 3A8XA 2C0OA 3FDNA 3JS2A 4A9RA 5HIEA 5BMMA 1OL5A 4CFXA 1RE8A 1FGKA 3SOCA 3DXNA 2WQBA 4AQCA 3CSVA 4JG7A 4D4VA 4NZWB 4ZJJA 3OXTA 2WD1A 3CQUA 3HV3A 4W4WA 5DEWA 1SVGA 3SHEA 3EOCA 5LXMA 4YBJA 4AE9A 3I0QA 4FG9A 2NRUA 1AQ1A 5HTCA 2W5AA 2XKDA 4LGHA 3DTWA 2VD5A 5J5TA 2B9FA 2VUWA 1ZMWA 5TF9A 3V8SA 3V8TA 4EOPA 4IB5A 3MWUA 4TYHB 2VX3A 3UDBA 3ORNA 4RA5A 4C0TA 4IE9A 2BDJA 4CG8A 4FK6A 4Z16A 5F95A 4G1WA 2ITXA 2Z7LA 5HIDA 3ZDUA 1WBVA 2X2MA 3DY7A 5EHLA 5BVOA 4U45A 4UBAA 4XCUA 5DG5A 3QUEA 4ALWA 3RPRA 2JAMA 4IAIA 4WNMA 3WE8A 4DEBA 4YLLA 1OKYA 1PXIA 1KE7A 4APPA 3F3UA 5GINE 2QOKA 4JQEA 4Q5EA 3NNXA 2OF2A 3IGOA 1H00A 3QA0A 4FEQA 4AZWA 3FXWA 1CDKA 4QMUA 5TE0A 3KEXA 5AAGA 2WQEA 4NIFB 5TOZA 3LM5A 5J7BA 4GSBA 5CY3A 4YZNA 3CPCA 5DNRA 4J8MA 2V7AA 1IA9A 4TRLA 3PUPA 3P7AA 4IM0A 2R3HA 3PY0A 5C4LA 2BDWA 4I5MA 2PZRA 3ZFYA 4OAUC 3G9NA 3NRMA 5KZIA 2DUVA 3ENMA 1XKKA 3VIDA 4YHTA 1JSTA 5EM8A 5BVFA 4E8AA 1Q8ZA 2J2IB 3KXZA 3VS5A 4ZTQA 2R3PA 4UWCA 3K5UA 1VJYA 1JAMA 3K3JA 2WMTA 3NWWA 3ZUUA 2W5HA 3R2BA 5AV1A 5I5ZA 2F7XE 4DFLA 3SG8A 5JKGA 5AAEA 2CPKE 3A7FA 3P86A 3EFKA 3GT8A 5JK3A 2XS0A 5CU6A 2G01A 1BL7A 5HOAA 4Y46A 2PE1A 4FOCA 4CKIA 3S0OA 2WB8A 4O83A 4KWPA 4OTIA 3KQ7A 2QI8A 2BROA 5FQDC 4FF8A 4BDGA 3AT2A 4Q5HA 3NUPA 4JR3A 3MY0A 3F3WA 3QKKA 5B2MA 5M08A 2HYYA 3QWKA 4U97A 5EW3A 4IZAA 1PKDA 1Q99A 3QC4A 3UIXA 4LRKA 4PNKA 4PNIA 5CI7A 2X8IA 3RM6A 3WZUA 2KTYA 2VO0A 1HCKA 3G9LX 3R01A 4QQCA 4FTUA 4QTCA 4EH9A 3EKKA 1UKIA 3RAIA 4EEVA 2G1TA 4ZXTA 4DAWA 5HE3A 2C3LA 1PMUA 4KKEA 4RJ3A 3ZUTA 1ZYDA 3ZEPA 3BHHA 1YOMA 1V0PA 2CKOA 3Q4ZA 3BE9A 4CV8A 3OUKA 4KINA 3MTLA 4QP8A 4E4LA 2GNIA 4G5JA 3UIBA 4Q2AA 2QQ7A 4FZAB 4E6QA 4BTFA 2Q0BA 4K0YA 4DFXE 2PMOX 4WG5A 4BWPA 3UQFA 4Y95A 4FV4A 4IAKA 3FUPA 3SDJA 3WOWA 3HV5A 2FH9A 3HECA 3QC9A 3C9WA 1R3CA 4I4FA 4R8QA 4D28A 2OFVA 3TZMA 4AXAA 1BI7A 3F7ZA 3F5UA 1AGWA 4AF3A 3JPVA 4EOSA 2F4JA 5KMMA 3CGFA 2HXLA 3MFTA 5HIBA 4CQEA 3LXLA 2HIWA 4A9TA 2W9FB 3GQIA 2R0IA 5CYIA 5K5XA 1U54A 4CYJA 4XJ0A 3JR1A 5D7VA 3SLSA 4EZ3A 4X0MA 3BYUA 2GCDA 3P7BA 4JIKA 1LUFA 4I5HA 2HK5A 2ETKA 2QONA 3GU4A 3MY1A 1IEPA 3PJ2A 2PE0A 5B7VA 4AAAA 3ZEWA 5FUTA 3RK7A 2R3KA 2NP8A 1Q62A 2I0YA 1Y91A 4IAZA 4RJ5A 4WHZA 2NNWB 4O7ZA 2HELA 2CNVA 1P4OA 1YXXA 3GC0A 3NGAA 4IJPA 4KNBA 2BZHB 3EL7A 3EH9A 2G2HA 3KXNA 4AE6A 4EHEA 5LOHA 3IK3A 2QO9A 3PPZA 1ZMVA 3GVUA 4ITJA 4ZSAA 3Q60A 2BIKB 4FV5A 4BBMA 3U6HA 4X3FB 3HV4A 3QGWA 1BX6A 3CTJA 3H3CA 4PDYA 2R9SA 5CENA 4F1MA 1YI4A 3I7CA 4XEYA 3MN3A 1OMWA 4FSWA 5AP6A 2GTNA 3GXLA 2QOBA 4HCTA 4O0RA 1Q24A 5D7AA 3QGYA 5AUUA 2C6OA 4U44A 3NUUA 2GSFA 2UW4A 5IQGA 3GFWA 1O9UA 5H8GA 3VHKA 4C2VA 4C4GA 3NSZA 2OI4X 5A4CA 3FSKA 4CMOA 3ANQA 3MJ2A 3TNWA 5EQYA 5AEPA 3DBQA 3PY3A 3LXPA 5EM5A 2QCSA 3R6XA 5ICPA 2C30A 2WTVA 3WIGA 1NY3A 1WMKA 3FZPA 4GW8A 2BAJA 5CX9A 2YZLA 3NMUF 1FVRA 5C8MA 3CR0A 1Y8GA 2WAJA 4M0ZA 3R00A 1U59A 4IZ5A 2V0DA 4OLIA 5T3QA 3QQKA 4BCOA 5CNNA 5CU3A 2A0CX 3CGOA 4O91A 4A07A 3I7BA 5L6OA 4M67A 4PMTA 2CKPA 3S2PA 4G3DA 5JFWA 4CZYB 3IOKA 3NYVA 4I20A 5EDQA 4HGSA 5C4KA 1NXKA 4RFYA 5J87A 3NVKI 4GUBA 2R0UA 4TPTA 4G9RA 4AACA 4RC3A 4U0IA 5HI2A 4XNEA 1XH7A 1OL7A 4MF0A 4GKIA 2C69A 3QRTA 1FVTA 3NDMA 3VS1A 4XLIA 4UX9A 5M06A 3UG2A 4C38A 3PE2A 2CGVA 3QL8A 4ANSA 3DKGA 5I9XA 3H9OA 3O2MA 2X9EA 2ACXA 3ERKA 3LFEA 4USEA 4LL5A 4LMUA 3PA3A 4MWHA 4BIDA 3NUNA 2IZTA 2VTMA 2ITQA 4JAJA 2UW3A 4XRJA 4DCEA 4FV7A 4DCAA 2VWYA 2YHVA 2IO6A 3S95A 4DF3A 3PA5A 2HWOA 2Y4IC 4O96A 1CTPE 3RPOA 4ARKA 4C61A 5L8KA 1REKA 4ASDA 5DIAA 3UTOA 2IW9A 5EQPA 3R22A 3W2RA 3KA0A 1UWHA 4DBXA 2BIYA 1KV2A 1MRVA 3PXRA 3WZKA 4R77A 2VN9A 2F57A 5CSHA 1FPUA 5EG3A 2WTIA 3QD3A 4LG4A 2LGCA 5CU4A 3NUSA 3TM0A 2I6LA 2OK1A 4JT3A 3OWPA 4GUEA 3NEWA 3R83A 4BL1A 2YCRA 4EOLA 5LCKA 3KXGA 2GNFA 3OBJA 2R3OA 5KBQA 3F66A 4XS2A 5HE1A 2UW0A 2XNMA 1UWJA 3V5PA 3N4VA 3QQLA 3DXPA 2Y7JA 1NA7A 3C13A 2JGZA 2E9OA 5LQFA 5GIOE 3BGZA 2E2BA 3U9CA 5M44A 2F9GA 4HVGA 2VTAA 1UU9A 1SYKA 2XNOA 3Q6WA 3OHTA 3QTXA 3E7VA 3FJQE 2W0JA 4FV3A 2JDTA 4DH3A 3GEQA 2PE2A 4J53A 4N4SA 1REJA 1NVQA 3KULB 4WBOA 2RG5A 4KIKB 2NO3A 2PTKA 4L7FA 3ACJA 4Y72A 3ATSA 4FZFB 4EQMA 1XH6A 5CSWA 3AQVA 4G3CA 3ROYA 4XV9A 4GYGA 4L7SA 5CAOA 3K3IA 3QHWA 1MP8A 3MFRA 2PSQA 4WOVA 5FEDA 3SAYA 2BHHA 4YJUA 3WF6A 4U41A 4QQTA 2F2UA 5BMSA 1OB3A 3QCXA 4H3PA 5EOBA 1SVHA 1JSVA 1XBAA 2GPHA 2PMIA 5AUXA 4XYFA 5HTIA 3KL8A 5JGDA 5IA3A 4CTCA 4QMSA 3RMFA 4Y8DA 1JKKA 1STCE 5HGIA 4WBBB 3FKLA 4JDKA 2ZVAA 2R3MA 1VYWA 3T8OA 4RT7A 2XNEA 4F7SA 1R0PA 3FC2A 1H25A 2R3NA 4GIHA 2QHMA 3FQHA 4L46A 5J8IA 5A9UA 4QT1A 5AA8A 1M14A 5ETCA 4B9DA 4RJ8A 1F5QA 4HGLA 4NM0A 4OTWA 3FLYA 3KRXA 1ZMUA 3V6SA 2C3KA 3P7CA 3PE1A 2A1AB 4NWMA 1WVXA 1DI8A 2XCHA 4L00A 4X6QC 3V3VA 1F3MC 4PDPA 1Q61A 4RA4A 2WHBA 3QTUA 4A4OA 2WTKB 2RSVA 5JT2A 4RBLA 2XK7A 5FG8A 5KMLA 3OG7A 4W8EA 4CG9A 5KZ0A 1GIJA 2IVUA 3OWKA 4JVGA 4M12A 3BELA 3NS9A 1QPJA 4E73A 3A61A 3P79A 3W33A 2RFDA 5BUEA 5CASA 5HD4A 2ERZE 3O7LD 4FVPA 1K3AA 4L3PA 1Q3WA 1J7IA 4BY9E 3PWYA 3D83A 4JDJA 4LRJA 3FMMA 4ZLOA 3MA3A 3UMXA 2WMAA 4XV3A 4K2RA 4L8MA 4EOIA 4LUEA 4F7NA 2EUFB 2UZBA 5G6VA 2QU5A 1YHVA 4F6SA 4RVTA 5EQEA 1Q41A 3JYAA 3GENA 5IQBA 1IA8A 3BHTA 4OGRA 2ITPA 3H9RA 4HVDA 3LFFA 1B6CB 4FZDB 4S31A 3HAMA 5DR2A 3P0MA 3QQGA 3ZU7A 3VBTA 1B38A 4R7HA 4EONA 4FT0A 3ZSGA 4I5CA 3AGLA 3R0TA 4JX3A 4UMQA 1XO2B 1VZOA 4OAVB 1KSWA 3M2WA 3Q9WA 4IAFA 5HNGA 3R73A 2VWWA 3OOMA 3RCDA 4F70A 2B0QA 3LQ3A 3F3VA 5BUIA 3VNTA 4BBFA 2VNWA 5CWZA 5CF5A 3OXIA 1R1WA 4W9WA 3FI4A 5I9ZA 1GNGA 1TKIA 4D5KA 3T9TA 4DG0E 3UVRA 1OIYA 5I9UA 2C5VA 3PSDA 1AD5A 1MRUA 2BUJA 2XKCA 2UVXA 4FIHA 3FMNA 4ZS4A 3NLBA 4N0SA 3EQHA 4EBWA 3CD8A 3A7GA 3Q6UA 5IMXA 1PMEA 4A06A 2ZMDA 1PY5A 5H9BA 3KF7A 3R8ZA 4O84A 2E9UA 3WBLA 3AT3A 3UYTA 3ZMMA 4HVIA 4NT4A 2WMXA 2QD9A 1OBDA 3VBYA 1PF8A 4L44A 2UZUE 3ZSIA 3BKBA 3ENHA 4BKJA 4TTHB 3SRVB 4G5PA 2B54A 3ORIA 4GVJA 2BFYA 4XH6A 4EJ7A 2WGJA 3R9HA 2C1BA 3HUBA 4V04A 2X6DA 4KIOA 2H9VA 3DNEA 4PL5A 4H05A 4IX3A 5AIKA 5HLWA 4RZWA 5A4TA 4AZVA 3MDYA 4D0WA 4WD5A 3C4EA 3E64A 3MB6A 3O96A 4R3RA 4OTQA 3ALOA 4YTIA 4DFZE 2C3JA 2XNBA 3E93A 4FA2A 2XZSA 3C4FA 3PIXA 3PXZA 3W8QA 1R78A 2ZYBA 4GK3A 4UALA 3I81A 5IH4A 1QMZA 4M68A 2Z7RA 3SXFA 3L8XA 4E4XA 4YLJA 3OMVA 1P4FA 3V04A 2FSOX 4IVDA 3RAHA 4FSTA 5AV4A 2GU8A 2Y4PA 4FEUA 5IH6A 4MEDA 4ZP5A 2QR8A 4FVQA 3Q2MA 4AW0A 5HZNA 4MQ1A 2VTTA 3VHEA 1Z9XA 4KSQA 5A4QA 1R0EA 3CBLA 1Q5KA 2UZLA 2VTRA 2XYUA 3AMYA 1SZMA 3PXFA 4IWQA 2W99B 2A19B 4FIIA 3QYZA 5HICA 4Q9ZA 1IAHA 4BDIA 3I6UA 4RWLA 3ZZWA 4PPAA 4TNDA 3R7GA 3SXRA 4AT3A 2I0EA 4UN0C 1KUTA 3TV7A 3AC2A 4ZLZA 1URWA 2XVDA 4II5A 4D2VA 4FG7A 5E4HA 2FUMA 2XUUA 3U6IA 5M09A 2EVAA 3VJNA 3VUDA 2YCSA 4A4LA 5K4IA 2C5OA 2X39A 2WU6A 4XUFA 5G1XA 3F69A 2CCIA 1TQMA 3QAME 4LL0A 4XHKB 3ZDIA 3R1NA 3LPBA 4IIRA 3R1YA 4Y5QA 3OCSA 1SNXA 2OSCA 2BRNA 2GDOA 1KE6A 1M7NA 2GNHA 2FVDA 2J0MB 4TYIA 5HNBA 4O7NA 2XF0A 4FV2A 1ZLTA 1H1QA 3PVGA 4F1TA 5BVKA 4KBCA 3UOKA 4I6FA 4R3PA 1H08A 4ZIMA 5CVFA 4YUQA 2YDKA 3RAWA 1ZOHA 5IEVA 3QU0A 5CXHA 3VS6A 3DU8A 3ZOSA 5D41A 2FGIA 3DBEA 4BKZA 4YC6A 4LV8A 4DEEA 1XR1A 3C0IA 4D5HA 3ZC5A 3KK9A 4CKJA 3W2PA 3MH1A 3KB7A 4IAYA 4QNYA 3DV3A 3ATTA 2J7TA 3GOKA 3MV5A 4FIJA 1WFCA 4IB0A 3AC8A 3GU8A 4BI2A 4F64A 4DT9A 1M52A 5EI8A 4I0SA 4ZTSA 3PJCA 5C03A 5LVMA 4GJ3A 3LXKA 2G15A 4CZTA 3F2NA 2W17A 4YU2A 1W8CA 3R28A 4BN1A 3QKMA 2WMQA 4CFVA 2YACA 5AV0A 5LVLA 5EKOA 1VR2A 3R63A 5JN2A 2I40A 1T45A 5FTQA 4OTFA 4HCUA 5E1EA 1WAKA 4EOKA 3DTCA 5J79A 4IWDA 4RIWB 5GJGA 3VN9A 2UW6A 4AW1A 5AIRA 4U40A 4A9SA 1UU7A 2B1PA 2HY0A 4G34A 3A2CA 4HGTA 3OBGA 4DTAA 2X8EA 3FQEA 3DKOA 5K0KA 4WA9A 4FG8A 3R04A 5IG1A 4QPAA 4FV9A 3CCNA 1GZ8A 2FYSA 3Q9YA 3FE3A 4U9AA 3PJ1A 3FC1X 3C1XA 5HCYA 5DMZA 5IDNA 3KMMA 2YCFA 2HENA 4O0SA 3I0OA 3WE4A 4FSZA 2UUEA 4EH5A 3UMWA 1ZYLA 4EZ5A 5J1WA 3BE2A 4JNWA 1TQIA 3DQXA 4MBJA 4EK4A 3AC4A 3Q52A 3KY2A 3AD6A 1Z5MA 2YDJA 2WMBA 2JKQA 4NJDA 5M51A 3ZFXA 4ZTLA 2X2LA 3TV4A 1Q4LA 3VUTA 3FLZA 5C27A 2X2KA 3OT8A 4FTRA 3BIZA 4I23A 3W2QA 4BDEA 4DLIA 1XHAA 5KMIA 5LMKA 2AC3A 3CS9A 3QFVA 2WTJA 4QMPA 4DFNA 3D5VA 2WFYA 4Y85A 4IX4A 4UWBA 3TZ8A 4QPSA 2BKKA 4MXXA 3F61A 3IONA 2YJSA 3P5KA 4TWCA 4IX6A 4NEUA 2JAVA 4LOPA 2F7EE 4RX9A 4JG6A 5GNKA 3AMBA 4PPBA 2YFXA 2B9HA 5JZNA 3RTPA 5AP7A 2JD5A 3CC6A 4L45A 2P55A 4F0FA 4W8DA 4C62A 3FKOA 3B8QA 2YWVA 5FP6A 4FKQA 4NL0A 4NFNA 2PUPA 3PG1A 5DR6A 3KXMA 2PZ5A 3FKNA 4RIXA 1U4DA 4U6RA 4ZEGA 4MF1A 3TUBA 4MXOA 4FE2A 1S9IA 2O63A 2WTCA 4DG2E 4DH7A 4UV0A 3EN7A 4RWIA 4IWPA 4E93A 3U6JA 3MI9A 2VTJA 3G5DA 2WQMA 4OT6A 3VS2A 2XK3A 3WILA 4E7WA 4QO9A 3UNKA 4NK9A 3BBWA 3OP5A 3QCYA 3LOKA 5CVGA 1LR4A 2BILB 3Q2JA 4UEUA 3QXPA 2GFCA 3C51A 4JXFA 3MTFA 2BZIB 4MD8E 4IFCA 4ANNA 2QOCA 3TNQB 2BRMA 3BX5A 3LFSA 4EORA 3GUBA 3MY5A 2UZVA 3CP9A 4QP6A 3SG9A 1BLXA 3E88A 4EKLA 2G2IA 5AP4A 3FMHA 3A8WA 1JKLA 1X8BA 3D14A 3FZRA 4D2PA 1FQ1B 4FI1A 4ZSEA 2PWLA 3PJ3A 4CFNA 3GOPA 4ONAA 2OLCA 3PZEA 4K9YA 4YGAA 2JFLA 1ZY4A 5ANKA 3W32A 3QZIA 4MXCA 3ZRKA 2P3GX 2YCQA 3MPMA 5J7HA 4BR3A 2FO0A 4DT8A 4CMTA 5KE0A 3DJ7A 5AV2A 2J90A 1RJBA 1YXSA 2O3PA 2CGXA 2ITTA 5E90A 4L6QA 4RWKA 4DEAA 4B4LA 3PLAE 3EFJA 4XMOA 3GC8A 5EYMA 3LFQA 3O8PA 5DH3A 3QD2B 3HZTA 3UPXA 4FR4A 5DE2A 5FBNC 5HX8A 4WUNA 2P2IA 1CSNA 3NCGA 2QOFA 3FI3A 3FPMA 1H07A 3QHRA 4NKAA 4AG8A 3U54A 5E8SA 3PXQA 4L68A 5L3AA 2DYLA 4ZTHA 2OXXA 4IVAA 4EHZA 4FT5A 2C5NA 4PTGA 2P4IA 5M4CA 4JBOA 2GS6A 2I0HA 4CV9A 3QXOA 2BRGA 5ACBC 4BI1A 4DFBA 1W7HA 4L43A 3TL8A 3LMHA 3NUAA 2O2UA 4H58A 5IA4A 3RK5A 5I9YA 3DFCB 3KRLA 3VS0A 3HV7A 4FKRA 3MH3A 5CEKA 3EB0A 4EHVA 3A4PA 2R4BA 2VRXA 1GOLA 5TR6A 4KKGA 5K4JA 4XG2A 5IQFA 4V0GB 3DAEA 2B9JA 3QD4A 2B9IA 3UO6A 3PSCA 2OH0E 5LCJA 3NYXA 5DFPA 4BYIA 1NW1A 4AN9A 5C1QB 4JJRA 4FGRA 4X7QA 3CKXA 2W1HA 3QKLA 5LMKC 2XM8A 5HHWA 3R7EA 1PJKA 2VWZA 4CFMA 3HAVA 3VW8A 4O1PA 1FMOE 4QP9A 4Z9LA 4B6LA 1YRPA 4A9UA 4F0IA 2Y8OA 4U3ZA 1H27A 4X21A 5T68A 3ZLWA 4TN6A 5H8BA 2V7OA 2JBPA 5HU3A 1IASA 5J9ZA 4RGJA 5AM6A 3NUXA 4O6LA 4QMXA 4J1RA 1YDRE 2J5EA 2V62A 3C50A 2W1DA 4QQ5A 3ZTXA 5LVOA 1LEZA 3V5WA 3QUDA 3GU5A 5AR3A 3D2IA 4BGGA 4RJ6A 2X1NA 2Q83A 5BQ0A 5IH5A 3EQDA 5D9HA 3A99A 4CYIA 3T3VA 1XQZA
chains in the Genus database with same CATH superfamily
1H1WA 2O64A 4H36A 4I1ZA 4PQNA 4O0UA 4QTBA 5DVRA 3QQFA 1QPCA 5LWNA 2W06A 2IWIA 3DBDA 4XRLA 4E5BA 4FYNA 5JGAA 2C6KA 1PXNA 5FM2A 4EOQA 2XK9A 4H1MA 4MH7A 2OIBA 4CD0A 1FBNA 4HYUA 4NTTA 2HWPA 4YJOA 4IX5A 1J91A 1YXUA 4S33A 4O82A 3FAAA 3ZRMA 4GG7A 5CTPA 2BHEA 5E8VA 4YTFA 4GT4A 5I4NA 1MQBA 5AUWA 5HTBA 2UW5A 3BLRA 5GJFA 3T9IA 2JDVA 4FTJA 4TYHA 3DDQA 1JVPP 1LEWA 3FYKX 5KKRB 3G15A 4K11A 2QU6A 4XV1A 3FEGA 3OCBA 5CNOA 3GC7A 2ITOA 1KOBA 2C6LA 1OI9A 5HG5A 4WRSA 1JKTA 2PUIA 1ERKA 2JDOA 1UVRA 2HZ0A 3OW4A 2RL5A 2XYNA 1LPUA 4XLVA 4C35A 3ZO4A 5ANGA 5FRIA 2PY3A 4X3JA 1WBWA 2XBAA 4BICA 4FNZA 4LMNA 4H3BA 2ITYA 4XBRA 5GZ9A 4AFEA 4BHZA 3PYYA 4DGOA 5CAPA 3PJ8A 5KBRA 4M14A 2YIRA 5A14A 3FXZA 5BPYA 5IDPA 1UV5A 5KX8A 4FSYA 4E26A 4XP2A 3UIUA 4BF2A 2ZOQA 2QG7A 4NIFA 4EYJA 4O4CA 1OL1A 3RI1A 4IH8A 4GL9A 4WIHA 3UIMA 3V6RA 4BTMA 5A4EA 5JRQA 4O21A 3DFAA 1YQJA 4TKSA 2FB8A 2QOQA 3OF0A 4FTAA 4B99A 3BQRA 4D9UA 2YA9A 4AGCA 4B0GA 5K5NA 1JPAA 5F20A 3MSSA 2CLQA 4HYSA 3AKLA 3RK9A 5KCVA 3LJ0A 2J0JA 3EQIA 2JEDA 2VTLA 2OBJA 5CVHA 3OD6X 3DAKA 3Q9XA 3VF8A 1ZAOA 5IZFA 4EL9A 4JAIA 4LOQA 3I79A 4O0XA 2CSNA 3SGCA 3LFDA 4FTOA 4R7IA 3H10A 4YO4A 3SW4A 3VQUA 4O7RA 4AOTA 1GZNA 4GCJA 4DITA 3PP1A 5ETFA 3OROA 3PVUA 3Q96A 1DAYA 3KKVA 4WRGA 2W1IA 4X2JA 2PVMA 4OTHA 3CY2A 4J96A 1ZZ2A 3MH0A 4NUSA 2VX1A 4DHFA 3N51A 4YJVA 4BCQA 3E8EA 3EQGA 3P9JA 3R8PA 2Z02A 2XIZA 3FL5A 1KE9A 4W9XA 3RPSA 4HJOA 4ZOGA 4DFYA 5LMAA 3LXNA 4TNBA 5EHYA 4UXQA 2CKEA 1EH4A 1JSUA 3G6HA 3HKOA 3UVPA 5AA9A 5M4FA 1G8SA 3S00A 5M4UA 4O1OA 3FMJA 4GK4A 4F0GA 2W1CA 4AGWA 5CU0A 2XAMA 1BI8A 3H30A 4BRXA 1MRYA 4IB3A 4CRSA 2IJMA 1ZYCA 3KGAA 4C3PA 3EMGA 3O7LB 3ZS5A 5I3OA 2OWBA 4FV0A 4RX7A 3HP5A 3G90X 3ZM9A 4IC8A 3GNIB 1OZ1A 4DHZA 3FV8A 1L8TA 3BRBA 3KN6A 3DK7A 5LVPA 2BAKA 4ZTNA 5HO6A 2BRHA 4BZOA 2GTMA 3HUCA 5EYKA 3WI6A 3IDCA 4S30A 2YABA 3EQRA 3F3ZA 4P90A 4X2NA 4DBNA 3EFLA 4LUDA 1V0BA 2WQNA 3DCVA 2WTWA 3E5AA 4M66A 4NJ3A 3VC4A 4BVUA 5CT7A 5FXSA 3VBXA 4D1ZA 4EH2A 1OM1A 1I09A 2KULA 4RQKA 3BV3A 4BYJA 2UZTA 3NYNA 3OXZA 3DB6A 4FT3A 3FMEA 3QLGA 4O22A 5ETAA 5M55A 3M11A 1CKIA 3AT4A 2YERA 4EWHA 5HBEA 3DBFA 4NM5A 4FEWA 4BDFA 3PIZA 2B53A 1T46A 5L2QA 1JLUE 2JKKA 4CQGA 3JXWA 1SNUA 3EZRA 4DGGA 3LFNA 4KIQA 4H39A 2BRBA 4YPDA 5EYCA 1E1XA 1OIUA 1DI9A 2CDZA 4Z55A 3W2OA 3DT1A 4QDVA 4A7CA 5CZIA 3PXKA 4ASZA 4BDAA 1RQQA 2XJ2A 4I41A 1KE8A 3I4BA 1TVOA 4QMTA 4DFUA 3CQEA 4GV1A 4QMZA 3UP2A 3R02A 4J97A 4D4YA 3JUHA 4DH1A 4K1BA 4LYNA 1KV1A 4FTMA 4HZSA 3D7ZA 4X6RA 4NW6A 3GB2A 3BYMA 5JFVA 3LAUA 3VUKA 2XP2A 2AYPA 1H0VA 3GU6A 3COMA 3TNHA 3LIJA 1HCLA 2RF9A 2R64A 4K33A 4Z3VA 2W9ZB 4JDIA 3OY3A 3I5NA 3P4KA 4FYOA 4CFFA 4U42A 4J52A 4QNAA 4RX8A 4DYMA 3EWHA 4MAOA 4X3FA 4FOBA 4HNIA 3QTWA 4IDVA 4O6EA 4R1YA 3AC5A 1ZOEA 5EI2A 5FM3A 4F1OA 3B2WA 4QMOA 4XG9A 1PW2A 4JBPA 3FZSA 3QWJA 4L52A 1W0XC 2V55A 4FVRA 4OBQA 4BCKA 5FTGA 3BWFA 3BGPA 2YIWA 3R9DA 4AQKA 1FGIA 3E63A 2WOTA 3D5WA 4AW2A 2DWBA 5AR5A 3WARA 4D4RA 3ORKA 4TT7A 4H1JA 5IA0A 4MHAA 4EJNA 5FGKA 4HGEA 2G9XA 1XWSA 4RMZA 2W4KA 1O6KA 2QO7A 2YAKA 2JKMA 3E62A 3UODA 3UVQA 2W1FA 3NNWA 2HZ4A 2OG8A 4R3CA 5IKWA 4AZEA 3CTHA 4YC8A 4GYIA 3UO4A 3ORTA 4AZFA 2BTRA 1H28A 3C4CA 4RG0A 4BKYA 4ANOA 1VEBA 2EB3A 4PP9A 3OFMA 2QC6A 2QLUA 3VUIA 4BWKA 3MESA 2AEGA 3F82A 4UXLA 2O5KA 2PVYA 4M8TA 2CMWA 3B2TA 4IQ6A 3B8RA 5D1JA 4AW5A 1ZARA 3Q3BA 4DGMA 3GCVA 1Q97A 3TZ9A 2UZEA 5L6PA 5M4IA 4QMQA 4EK5A 3CTQA 2UVZA 5FDPA 3PFQA 2QVSE 4O0YA 5DRBA 4C02A 4P4CA 4EK8A 1O6LA 3DLZA 3LLAA 2UZNA 2PULA 3MW1A 3UDSA 3UGCA 4FZ7A 5AX3A 1Q8YA 3CKWA 3RP9A 4YZ9A 4EWQA 3F7WA 4E3CA 4O7SA 2FSMX 3HMMA 5CU2A 2PMLX 2P2HA 3KVWA 4RIOA 3AKKA 4HVHA 3DGKA 3P23A 3DKCA 4O0WA 4CFUA 3HA6A 3BYOA 3FZ1A 3QQJA 3QQUA 4S34A 5EK7A 3EL8A 1V0OA 5AAFA 3WIKA 3K54A 3VO3A 3ZZEA 2ITZA 5TO8A 5L4QA 4RZVA 4BI0A 4GT5A 3RWPA 4UYAA 4J8NA 3QTIA 3VRZA 2XK4A 4EI4A 2ITWA 5IQEA 3CY3A 5CS6A 5CF6A 1QL6A 3UZPA 3Q4UA 3LMIA 2X8DA 1U46A 4E4NA 4PV0A 1DM2A 4MBIA 1RDQE 3LFAA 5CAUA 3IPHA 3GU7A 2CKQA 3PXYA 4QMYA 2VTHA 1S9JA 3IDPA 2XNGA 2BKZA 4K8AA 2OZOA 2VTNA 3E7OA 3MVLA 3PZHA 4EC9A 5DEYA 2WMUA 5FEEA 4CT2A 3F6XA 4AOIA 4J98A 5LMBA 2WEIA 3KULA 3QTZA 1QPEA 4MBLA 4KIKA 2W7XA 3UC3A 4NCTA 4NM7A 3SX9A 5L2WA 4FX3A 2CN8A 3D7TB 1YWNA 3LQ5A 1PYEA 5JFSA 5BUJA 5DN3A 2HY81 2H34A 4DHJA 5EDPA 3BLHA 3D5XA 3EQBA 1W98A 5E9EA 5JQ5A 4ITIA 2E9VA 3NW6A 4QD6A 3VUHA 4U43A 3KK8A 3A7HA 4HPTE 4XV2A 3GQLA 4QMLA 4FTLA 1UNLA 1H01A 4X3FC 4B8MA 4DN5A 4BFMA 5I9VA 3HMOA 5A54A 2YZAA 4KB8A 3FHRA 4UMPA 2PVRA 3AD4A 3EFWA 3PSBA 3EN6A 5HVJA 3UP7A 4CMUA 4MK0A 2QHNA 2Z60A 3E8CA 3OCGA 2YM3A 3QLFA 4BB4A 3S1HA 4U5JA 3HMNA 3N4UA 4YJQA 3WZDA 3KXXA 5FBOA 2YIXA 4GEOA 4F63A 2OXDA 4QYHA 4C34A 4BDCA 2X9FA 3BU3A 4YZMA 1J7LA 3O50A 4IC7A 1YXTA 2UZOA 4YNOA 3VS4A 3HA8A 2C47A 2XIYA 1YOJA 4V05A 4G3EA 3SA0A 2OU7A 3DKFA 4PDOA 4RJ4A 5AUVA 4M7IA 3CD3A 4U3YA 2VTSA 3JY0A 5E91A 4EOOA 4B7TA 4DTBA 2J51A 3HRBA 1ZY5A 4USFA 4IJ9A 2CGWA 4C4EA 5AUYA 4YMJA 5JRSA 2VTOA 1JQHA 4WKQA 4IVBA 4XX9A 4CXAA 4ZJVA 1OGUA 4LM5A 3RAKA 3W2SA 1PMVA 3QCQA 5ANJA 4KIPA 5AWMA 3ZBFA 3II5A 4U80A 5TKDA 4QMVA 4ACHA 4C4FA 3ZFMA 3R7VA 4M69B 3BLAA 1FINA 4AA0A 2XRUA 5I0BA 1BMKA 3NIZA 5EM6A 5F94A 3ZHPC 5C8KA 1MUOA 4QP1A 4F0IA 3O0GA 4EOJA 4I22A 2PUUA 3KXHA 2YWPA 3MGYA 3MYGA 2OZAB 4I24A 2QOLA 2VU3A 2XEYA 4AXEA 1PXMA 5JH6A 5BYZA 2P33A 3SKCA 2OJIA 4J7BA 3NIEA 5D11A 3AD5A 1OUYA 2WMSA 2BAQA 4ASXA 4MNEB 2YLEA 3L8VA 4PY1A 3MA6A 2UZWE 4ALVA 3ZC6A 4G31A 3DAJA 4YZCA 1Q8TA 2FSTX 3FMDA 4L42A 3SV0A 4AA4A 3KCFA 4OR5A 2XEZA 4FSUA 4P5ZA 4FNYA 1E9HA 4MQ2A 2BDFA 4D1SA 3POZA 4I6QA 3NAXA 4YSMA 2BMCA 4F7LA 4ZAUA 3MVJA 4U79A 4EH6A 4M0YA 4D4SA 2YIYA 2ZDUA 5JGBA 4FGBA 4F9AA 2AC5A 4BDHA 2JDRA 1CMKE 2PZYA 4HZRA 3W1FA 4UYNA 2V5QA 5AUZA 1BYGA 1PHKA 3N9XA 5C8NA 2GMXA 5A46A 5DBXA 3DZOA 4IZYA 4QYEA 5EHOA 5B2LA 2J9MA 1L3RE 3LCTA 1XBCA 4LQMA 5AR7A 4ORKA 5H3QA 4BCMA 4E6DA 1H1SA 4YJTA 2YM8A 4C33A 5KO1A 3CQWA 2YITA 2X0GA 3L8SA 2W1ZA 4I0TA 3PA4A 3ALNA 3PG3A 3RINA 2EB2A 4YBKA 4F9CA 2XCKA 5HX6A 4ZSJA 1W2CA 3OVVA 3RHKA 4CVAA 3TIZA 2NPQA 3O51A 3RNIA 3SRVA 3HV6A 3G0FA 5D12A 4M15A 4I21A 4PTEA 3UNJA 4UZHA 4ANMA 3DK3A 1H0WA 1SM2A 4PMSA 1JOWB 2CHLA 4HW7A 3SC1A 2UV2A 3FY2A 4X2FA 4Z7GA 4YP8A 5IQIA 2QLQA 4NCTC 3C7QA 3R7UA 4ZJIA 3WF5A 3NAYA 2EWAA 4DH5A 1OL2A 3RVGA 1YWRA 3VBVA 5CF8A 1V1KA 2R3RA 3EN4A 5F1ZA 1WVWA 1YVJA 3TCPA 4N57A 2YIQA 3IOPA 4D1XA 5EW8A 5E8XA 4EH4A 2YM4A 4CKRA 1GAGA 3EZVA 3G2FA 3TXOA 4Z7HA 3U4WA 1YW2A 4EK3A 1YDSE 3OWLA 4JX7A 5ANDA 4AN2A 4PRJA 1Z57A 4AGDA 3BL9A 2JC6A 4QQJA 3ZCLA 4NH1A 4QYFA 2ZDTA 3TV6A 4R1VA 4C59A 1XMLA 4C58A 3WYYA 4DA5A 2XIRA 3FL4A 4XOYA 3DS6A 3QD0A 3FLSA 4BC6A 3OS3A 1J3HA 3C0HA 3W10A 4KAOA 1U5RA 1BUHA 3ZO3A 2PMNX 3V5JA 3COHA 4JRNA 4C2WA 4YTCA 4FSQA 2CLXA 4G16A 2IW8A 2GFSA 4TW9A 5EOLA 3SVVA 4DDIA 4GFOA 4BCGA 2ZM1A 4AGUA 2ERKA 2J0KA 5K9IA 4JI9A 2BZKB 3GGFA 3ODZX 4U7ZA 3ZLSA 1WCCA 5HBHA 2X7GA 3IW4A 3AG9A 4GT3A 2C5YA 4QYGA 5DOSA 2XH5A 3UYSA 2WTKC 5BVDA 1Q8UA 4AN3A 4JR7A 4QTAA 1RW8A 1YOLA 4LGGA 4ACDA 4O2ZA 2Y6OA 5E8ZA 2OO8X 2YM7A 3MIYA 2WQOA 2C5XA 4IACA 4XP0A 4AX8A 4EUTA 3QRUA 2ZAZA 2CGUA 2X7FA 5DYJA 2B55A 5HVKA 1ZXEA 3FZTA 5DHJA 4O7LA 2JBOA 3EQFA 3QYWA 4HNFA 4LFIA 3RKBA 3VVHA 5JZJA 5EYDA 4IXPA 5A6OA 2C6TA 4MYGA 3ZM4A 4E20A 1YKRA 4FK3A 3RBWA 3IKAA 1OKZA 3VRYA 3G51A 4WT6A 4ID7A 2OIDA 5JFXA 2OW3A 4RLLA 1JWHA 2IN6A 3R71A 3HP2A 4GG5A 4TXCA 4R5YA 1URCA 4QP2A 5HG7A 3S3IA 3V5QA 4EQCA 1K2PA 3HLLA 3P08A 3L9MA 5CALA 4CZUA 4LOOA 4JIAA 5FTOA 4ALUA 1GZOA 4ERKA 4L9IA 1WBPA 2IZUA 1UNGA 4AXCA 3GFEA 3KN5A 2ZM3A 4O7TA 5IU2A 3FQSA 4WG4A 2VTPA 4TYGA 3UZRA 4BHNA 4F6UA 4BCHA 4IB1A 2PPQA 3NPCA 1PMNA 4HYHA 3W0RA 4RIWA 1KWPA 1WBOA 2X6EA 3F5GA 2VWVA 3BU5A 5EM7A 3QQHA 3QTQA 4FT9A 4XG6A 4FZ6A 4WSQA 4CGAA 2Z7SA 4AUAA 2R7BA 2WMWA 3NFGB 3W18A 4AU8A 3KRRA 4BTJA 2X4FA 3D4QA 5CEIA 2NRYA 4ZTMA 4I94A 3KIOC 2HZIA 4IM2A 4Y5HA 2R3FA 2Y4IB 4MXYA 3IDBA 1G3NA 1ZYSA 3R8MA 5D10A 5JQ8A 4BDDA 5FLFA 4ANQA 3BCEA 4AOJA 4AT5A 4AA5A 1M7QA 3QBNA 4O2PA 4RJ7A 3OEFX 4MXAA 2B52A 5LARA 2IG7A 4HPUE 2PU8A 2RIOA 3C5IA 4XBUA 3F5PA 1H24A 3E8NA 4C7TA 3RNYA 3BLQA 4E6CA 5M07A 5KHWA 3SQQA 3LFBA 3IECA 3VW6A 4CLJA 4MXZA 2CJMA 2I1MA 3QZGA 5DT4A 4AP7A 2Y9QA 2IVSA 4FSMA 4CTBA 5HNIX 5J9YA 4D2TA 1NVRA 4DGLC 3G6GA 3C0GA 3MFSA 2HOGA 3K2LA 4MVFA 3V5TA 5ITAA 4H3QA 4LV7A 3V51A 1U54B 2W96B 3ROCA 5I3RA 1W84A 3KC3A 1GZKA 3LCDA 4KBAA 5DLSA 1FOTA 5AR4A 3ZH8A 3U55A 4RFMA 1ZWSA 5FXQA 4WSYA 5IQDA 4V01A 3BHUA 5JSMA 3IO7A 2OKRA 2WOUA 4GK2A 4FKTA 3HGKA 3C5UA 3UJGA 1P5EA 2XJ0A 3BGQA 3DBCA 4F6WA 3ZBXA 4R7BA 4HOKA 5AFVA 5CQWA 3UG1A 4W4XA 5DA3A 4C8BA 2PUNA 2HAKA 5CSXA 2ZMCA 4IMYA 2E9NA 4JMQA 4NU1A 5EDRA 4Y73A 2FA2A 3HEGA 3D5UA 4M97A 2IZRA 1YXVA 1WZYA 4O4FA 3U8WA 1P2AA 4QP7A 3MIAA 3R8VA 4FSNA 4QYYA 3A62A 5AP2A 4AXDA 2IVTA 4BIEA 4YZDA 2R3JA 2XNPA 3QUPA 4IFGA 2XBJA 5ETIA 1OVEA 2C3IB 2XK6A 2GQGA 3OY1A 2Q0NA 4C4JA 5J1VA 2REIA 3L8PA 2FSLX 2ITUA 3OT3A 3POOA 4PWNA 5A3XA 2ZB0A 4D58A 5CSPA 1K9AA 3CXWA 1B39A 5DRDA 4S2ZA 3DK6A 4I6HA 3FPQA 2EXCX 3TTJA 3R9NA 4EYMA 4I6LA 2PZPA 3KCKA 4PUZA 4Q9SA 4FTIA 2OXYA 5IA1A 3D15A 4ZMEA 3BL7A 3HRFA 4I3ZA 2VWXA 3W55A 4FV6A 3ZONA 3IW7A 3F9NA 1W83A 4FKWA 4XG4A 4ZTRA 1QCFA 2XMYA 2VGPA 1KOAA 2JLDA 3KF4A 5KMOA 3R7OA 4JQ7A 4JBVA 3KRJA 4RSSA 3TI1A 4BGHA 2RFSA 5HBJA 3OZ6A 4FUXA 4D0XA 1NVSA 1TQPA 4JS8A 3TKIA 2W1EA 2JIUA 2ETRA 3PRIA 3MH2A 5ANOA 4BIBA 4FICA 4DGNA 3FWQA 5AMNA 4K6ZA 2GNJA 5KHXA 5EI6A 4I93A 4JL9A 1MQ4A 2EXEA 2C0TA 4N6ZA 2XB7A 4FTQA 5GJDA 5IPJA 3DJ6A 2ZB1A 2YISA 4HCVA 4RWJA 1Y8YA 2VTIA 2WEVA 4FKOA 1O6YA 2CNQA 2HW7A 4PL4A 2JFMA 3KU2A 3LZBA 3ULIA 2XA4A 2JIVA 5HD7A 4FSRA 1OL6A 4WG3A 1IG1A 4YZBA 4LDTA 4O86A 2GHMA 2YM6A 4FL3A 4IADA 4CT1A 3D2KA 4YJPA 4EH8A 2OICA 4C3FA 4D2SA 4FC0A 1OBGA 2GQSA 3I6WA 4O4DA 4F78A 4M3QA 5AJQA 5ACKA 4GIIA 3AC1A 4GFGA 2F2CB 5A4LA 4GMYA 3LHJA 3TNPC 4DEDA 5HCZA 2C6EA 3PDTA 2DQ7X 2QURA 4X2KA 4BCPA 4PX6A 3CJFA 3ZRLA 5AUTA 4DG3E 3D9VA 3PWDA 4MD9E 2YAAA 4P5QA 4YJRA 5DR9A 2BPMA 1XH9A 4QRCA 4JQ8A 5HORA 2UW8A 4ZK5A 3IGGA 4FKVA 5CEPA 4ZY4A 2PZIA 3WYXA 1OKWA 1GIHA 3C4ZA 1YDTE 4AFJA 3IQ7A 2H6DA 3MVHA 4OT5A 1PXJA 3Q53A 1JKSA 3MVMA 4RPVA 2WIPA 2R3QA 4YC3A 3UNZA 2O0UA 3QX4A 5BVNA 2C6DA 4V0GA 4FKLA 3KFAA 5AP1A 4C4HA 5L2IA 3OTVA 2VWIA 4NKSA 4HVSA 1A9UA 3MPTA 4FV8A 4FODA 2CNUA 2XRWA 2SRCA 4MCVA 3K5VA 1OIRA 3TUCA 5HLNA 2PK9A 2C6MA 4QTEA 3CLYA 3BZ3A 2J0IA 3COKA 4IDTA 3H0ZA 4J95A 2WMVA 4RIYB 4FIFA 4JLCA 1Y57A 3VBWA 4BDKA 4O7WA 3FYJX 4HYIA 1WBNA 3RWQA 4RFZA 3BBTB 5H2UA 5HQ0A 4I92A 3RM7A 5F9EA 3DNDA 1UU8A 2OJGA 3FZOA 4APCA 5DGZA 3CJGA 2C4GA 2YM5A 5EH0A 3CE3A 4YPSA 4IBMA 2YN8A 3R1QA 3A60A 4J99A 3EQPA 3PY1A 3R2YA 1FVVA 4FIGA 3BWJA 2PVFA 4WNKA 4DH8A 3RZFA 1W2DA 5E7RA 3LLTA 4BDBA 3E8DA 5L2TA 4EKKA 2B7AA 3H9FA 5C01A 3UQCA 3NYOA 3JVRA 2RKUA 4WUAA 3AGMA 3FI8A 1UNHA 2C1AA 4PPCA 4ZSGA 5L8LA 2PVHA 3NW5A 3Q5IA 2XKEA 3C4WA 3AOXA 3IG7A 4EQUA 4G6LA 4QP4A 1PXPA 5HE2A 4JBQA 4O81A 2HZNA 3BYVA 5DPVA 4L67A 1SMHA 1J1CA 3WF9A 4KBKA 1JNKA 2WELA 1NT2A 1PYXA 2VWUA 4KD1A 4KRDA 3R7YA 3QF9A 3ZXZA 5KUPA 2WNTA 1PXLA 5AM7A 4AZTA 4CNHA 3PVBA 3PLSA 3TWJA 4O7YA 3BI6A 2OFUA 2RFEA 2C0IA 4FMQA 1FMKA 3NFFB 3GCPA 3NCZA 3ORPA 3FLNC 1UKHA 3LKMA 2QO2A 3F88A 3LM0A 5E8WA 1TFFA 3R9OA 2XM9A 3NVMB 2ESMA 3TACA 3WZEA 4E5AX 2J4ZA 2VZ6A 1ND4A 1H4LA 1P14A 2X0OA 3DOGA 5T6KA 2H8HA 4F7JA 4FTTA 5HG9A 5E8UA 3IW6A 4FKUA 2XK8A 4WO5A 5HG8A 2YDIA 1H1PA 3C4XA 4RC2A 3SOAA 5BYYA 1OIQA 2QOOA 4QP3A 3FXXA 4O4EA 2ETMA 2XKFA 4AWIA 4FV1A 1XH5A 3PPJA 5B2KA 1G8JA 2HW6A 4O0VA 4G6OA 5GHVA 1A48A 1M17A 4D2WA 3HDMA 4DLJA 3EHAA 2VNYA 4YLKA 1I44A 4C57A 3R21A 5JEBA 4L3JA 5K0XA 3TDVA 2W1GA 5CF4A 3EIDA 4N6YA 4PP7A 4YHJA 3ACKA 3FI2A 1ZYJA 2YLFA 3R7IA 3RPYA 2VGOA 1QPDA 3PFYA 3COIA 5FD2A 4AS0A 4F9YA 5GIPE 4TY1A 3ZXTA 3OUNB 4WNOA 4MNFA 5CXZA 2GNGA 5A6NA 2GS2A 5LVNA 3QZFA 4Y83A 1CM8A 3O8UA 2IZSA 4FKSA 4LV5A 4EUUA 2JITA 2GNLA 1HOWA 3GC9A 5HCXA 4CCBA 4ERWA 3VUMA 2X7OA 3LE6A 4RC4A 3DJ5A 5CZHA 2Y6MA 4K77A 4PF4A 5CSVA 2CCHA 3ZO2A 1GY3A 5LJJA 2Z7QA 3AC3A 4GS6A 4RQVA 4RIYA 4KKHA 1H8FA 4KS7A 3UO5A 5HU9A 2WXVA 4IAAA 3GCUA 3SW7A 4F4PA 4N70A 1G5SA 2IPXA 1BL6A 4IZ7A 2J0LA 4BCIA 4S32A 4QDEA 4YURA 5KNJA 3PTGA 3R8LA 3UOHA 4DTKA 2IVVA 4E6AA 3MFUA 4F99A 4I4EA 3KMUA 2XJ1A 2YEXA 3AXWA 3FMLA 1W2FA 4NYEA 3DZQA 4TWNA 2CN5A 4LRMA 2XIKA 4WNPA 1A06A 2J50A 5C9CA 5AADA 2B4SB 4OTPA 3MJ1A 3O17A 3TN8A 1XH8A 3OW3A 4E4MA 4ZLYA 5FEQA 4CEGA 5IA5A 3W2CA 1J1BA 2PVKA 3O71A 4TYEA 3O8TA 3RGFA 3ZLXA 4PMPA 4DEHA 1W82A 3UPZA 4O7VA 2R3IA 5IA2A 4KSPA 4FTCA 3NR9A 1XBBA 3EKNA 4XOZA 3W0NA 4J71A 1LP4A 1DS5A 2JDSA 2PHKA 5HVYA 5IISA 3ETAA 2ZM4A 2OJJA 4UMRA 4A9YA 2PYWA 2W05A 5M56A 2VO6A 3Q32A 4AZSA 2W4JA 5C26A 5HO8A 3W8LA 2VX0A 2ZV7A 4GFMA 4IANA 4IVCA 3RCJA 3TG1A 3UC4A 4OTRA 2H96A 5BVWA 3LJ1A 3TJDA 1GIIA 1ZZLA 4YR8A 2QOHA 3TTIA 4XP3A 2Z2WA 4MD7E 4OW8A 5HE0A 3V5LA 3F3TA 2X0QA 2X81A 2ZV9A 3DDPA 3ODYX 1OKVA 3OCTA 4OBPA 3O23A 5KKRC 4C37A 1IR3A 3EYGA 4O27B 5AV3A 2F49A 2WPAA 4G2FA 2C6IA 4UWYA 3FY0A 3V8WA 3RJCA 3RPVA 3HX4A 2RGPA 3VWAA 3DA6A 3W16A 2ONLA 3HYHA 1M2QA 3M42A 1M2RA 3ZO1A 1XJDA 3BPRA 4BTKA 2R5TA 5HEZA 3UE4A 2BR1A 4QTDA 3FLQA 5EW9A 4UMUA 4CSVA 1XH4A 5IEXA 4LGDA 4BZNA 3GBZA 3TNIA 5IQHA 4OTDA 4RRVA 4ZMFA 2OH4A 4IHPA 4FNXA 4ITHA 4GU9A 2QKWB 4W4VA 5IQCA 4XG7A 4QMNA 3H4JA 1U5QA 2PL0A 3NX8A 4YJSA 3REPA 3NNUA 1YHWA 3GI3A 3ORZA 5L8JA 3SXSA 3U4UA 2O65A 4O0TA 3HNGA 4G9CA 4O38A 4GVAA 3R30A 2W5BA 2BZJA 4KRCA 4IM3A 4DEGA 3ELJA 4ANBA 4AAYA 5AR2A 3DXQA 3UZTA 4DEIA 4BDJA 2O8YA 5BNJA 3KMWA 2VO3A 1H1RA 2EXMA 3LCSA 3Q9ZA 4B8LA 1F0QA 2UW7A 2A27A 4P7EA 2BFXA 4GKHA 2EU9A 3L9NA 3DB8A 1WVYA 2RFNA 3ML1A 4NFMA 4PL3A 3IW8A 3BHVA 1OECA 5K3YA 4ACMA 2WIHA 4FKGA 1Y6BA 4BZDA 2UVYA 2ZJWA 3WF7A 4D9TA 5CAQA 2WMRA 3LW0A 5FDXA 3R9RA 3LQ8A 3TIYA 4EH3A 4AXFA 4L3LA 5DWRA 4G3GA