3HDMA

Crystal structure of serum and glucocorticoid-regulated kinase 1 in complex with compound 1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
298
structure length
285
Chain Sequence
QQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Sgk1
publication title Design and synthesis of orally bioavailable serum and glucocorticoid-regulated kinase 1 (SGK1) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 285
sequence length 298
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hdmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hdmA01
3DS6A 2WQMA 3B8QA 1E9HA 1OECA 4S30A 4O6LA 4JDKA 1LEWA 4NM3A 3F7ZA 4YPDA 5EOBA 4C7TA 2CNUA 5DN3A 4ZK5A 5K0KA 3MH0A 2ZB1A 4BCOA 2ONLC 4J52A 3ZH8A 3GCVA 3MIYA 3NNXA 3Q4TA 3BYMA 2YERA 4YZ9A 5F1ZA 3WARA 5LVNA 5CEPA 3TKHA 3G2FA 3ZEWA 4FEQA 3ZO2A 2OJ9A 2BFYA 1KV2A 2O8YA 2BVAA 2GNGA 2VWBA 3CPCA 4GS6A 4O81A 5CT7A 2VWWA 3VW8A 1NXKA 3E5AA 4F65A 3FQHA 5LMKA 3TKIA 3OCGA 2XKFA 5HBHA 1WMKA 1OL1A 4QMSA 3Q3BA 3GQIA 1Q3DA 3BCEA 3NW6A 3F6XA 4KBAA 2J5FA 3FY0A 2GNLA 2VAGA 3R00A 1DI8A 4GW8A 1OUYA 2QOOA 3ZRKA 4L00A 2C0OA 3MVLA 4X2KA 3FXWA 4FTAA 3ZBFA 4DFXE 4ZTMA 2VGPA 3FZ1A 3VS3A 3UG2A 5LQFA 4YLKA 4YJSA 5GZ8A 3SW7A 4Y72A 2OFVA 1H1RA 3R6XA 5DEYA 3UVRA 1JKLA 4G6LA 4F0GA 3WZUA 5A4QA 4FSUA 4H3BA 4MYGA 2NPQA 3SD0A 3PPKA 5HBJA 4UXQA 4FIGA 5HZNA 2CGUA 2XEZA 3BHVA 2WIPA 2FSTX 5JGAA 3FL5A 3KRLA 3DJ6A 3JYAA 4IAKA 4IAIA 4J95A 4JBVA 3UBDA 3RZBA 3B2WA 3FJQE 3UIMA 4RWJA 4EH4A 4B99A 3F88A 2WMTA 3NWWA 3W2QA 4ZLZA 5LVOA 3QD0A 4QYFA 4M97A 4A9RA 3EB0A 4KB8A 3W2SA 5E92A 1YRPA 3DKOA 3FL4A 5KMKA 2BIYA 4MVFA 3HV6A 5AFVA 4USFA 3FMEA 4B4LA 4EOLA 1RJBA 2JLDA 3EN4A 1ZWSA 4RG0A 3RPSA 3OUKA 4E4MA 3BLHA 5CU6A 2QNJA 3OY1A 2PVFA 4R77A 3AD6A 4ZSGA 5DIAA 3RK9A 4QP8A 3JUHA 1H1QA 3NUPA 4JRNA 4BY9E 2VX0A 3UQFA 2XNBA 3KXHA 3MWUA 4XH6A 2OZOA 5IA3A 2QLUA 2OBJA 4PMMA 4RQVA 5FWKK 2GFSA 5TO8A 5AIRA 2O3PA 4S33A 5IISA 1A9UA 5LVMA 4M84A 3GQLA 2F9GA 1JSVA 4LRMA 4MCVA 4YZCA 5M4FA 3Q9YA 5AX9A 1S9JA 3GC7A 4D2VA 3LFFA 3FLWA 4U5JA 2GHLA 3LXKA 1AQ1A 4Y8DA 1ZOHA 5AUZA 3C13A 5FG8A 4BTFA 2OI4X 1J91A 5E8TA 4AOIA 4K11A 4AX8A 4RIYA 2C0TA 3G90X 4OBOA 1X8BA 5CU0A 2YM5A 2FGIA 1LEZA 5E8SA 2JD5A 4F9WA 2W7XA 2PVKA 2QG5A 3ORLA 3DT1A 1R1WA 4FT3A 4U3ZA 3V5TA 5K5NA 4DEDA 4MTAA 3E8EA 4QPMA 5ANEA 5IU2A 4BHNA 5EHOA 2O64A 3O51A 2B9JA 3GGFA 4OTWA 3W55A 2JKOA 4ASXA 5FDXA 4GIIA 4Y83A 2Y4IC 5A6OA 4I5HA 2IPXA 3G51A 4DGOA 4H3PA 2O0UA 4ZJVA 4MAOA 5ETAA 5DA3A 2IZTA 1P4FA 3NNWA 4EUTA 2CNVA 4HNIA 3L8XA 4M3QA 3OOGA 5AUWA 4BKJA 3VS6A 3Q9XA 2WQEA 4PMTA 1ZYLA 2ERKA 2F7EE 2YCFA 3VHKA 5CASA 3QL8A 4Q9SA 3ZDIA 1VEBA 4TWCA 3RWPA 4YGAA 3OT3A 5FQDC 3OWPA 4F70A 4L01A 4LOOA 4YHTA 3NSZA 2QG7A 2Y9QA 4NW6A 3KRXA 3SAYA 3PXQA 2VN9A 3C4CA 3QLFA 3FC1X 3UIXA 5CSVA 2JDOA 3DAEA 5CQUA 3VS2A 4FNZA 5BVWA 5DT4A 1H1SA 4GL9A 3UP7A 1Q97A 5J79A 4WBOA 5CEIA 5C26A 2OO8X 4OW8A 4MQ2A 3V6SA 5LVPA 5CF6A 4XOZA 2VGOA 3KCKA 3FZPA 3CTHA 3OXZA 4CZTA 4QP4A 2IG7A 3ZTXA 4O2ZA 3KXMA 5JRQA 3V5JA 5HIDA 2BAJA 1FINA 2PU8A 4QMWA 2WMAA 4DH3A 3VNTA 2PE1A 3QZHA 2VZ6A 2ZV8A 4CFUA 2JIVA 4FT0A 4H1MA 5JN2A 4ASDA 2W17A 3Q04A 4F99A 4XG4A 5EI8A 2VTLA 3R7GA 5ITAA 3DBFA 4OUCA 4EQCA 4ZZOA 1V1KA 2C4GA 4QPSA 4U80A 5HG9A 5IUHA 4R1YA 2X2LA 3MY1A 4N57A 4X7QA 2ZYBA 3KXXA 4JDJA 1TVOA 4RVKA 2X9EA 1CMKE 3ZZWA 5GINE 2OICA 2UZDA 3U6JA 2CKOA 3JVRA 4ANMA 2IVVA 3PXYA 3LFNA 4FTCA 3SRVB 4ENXA 5CALA 2GNIA 4BCPA 4OTIA 2G2IA 1ZY4A 3K3JA 3LFEA 1B39A 1NVQA 3NRMA 4NM5A 4JAIA 5IH5A 3RNYA 1KE8A 1FGIA 3A99A 3OF0A 5JFSA 2BRHA 3EQPA 3ATTA 4RGJA 4FNXA 4JG8A 1KUTA 5AV2A 3Q53A 2GTMA 3FMHA 3K5UA 2ZM4A 3HDMA 4EQUA 2BDFA 2BRGA 4IZ5A 4WRGA 4CNHA 4I0RA 3ET7A 4F9YA 3S4QA 4FC0A 4QPAA 4JR3A 3K3IA 4WKQA 3POOA 5ETFA 2HWPA 4ALVA 3ZM4A 5A4TA 2G15A 2QO7A 2R3MA 4J8MA 2XNEA 4YC6A 4ACCA 3FQSA 3EJ1A 4LOQA 3RMFA 4EJNA 4FL3A 3HMIA 1JKKA 5E7RA 1QMZA 4DG0E 4BDFA 2UZUE 4LRKA 3ZS5A 4N0SA 5BUIA 3DXQA 3PA3A 5CEKA 3VF8A 1BUHA 4JXFA 2P0CA 5F9EA 3F3ZA 3DDPA 5AJQA 3C0IA 1WBNA 4GU6A 4X2GA 1BYGA 3QU0A 4BDGA 2GQGA 3D5VA 4W4WA 4CSVA 3SXFA 2SRCA 5AUXA 3V5PA 1KSWA 3DBEA 3BGQA 2XJ2A 4FTTA 2I0EA 2QKRA 1XJDA 4BBEA 2HZ0A 5TT7A 3L9LA 4PDSA 5L8LA 3SG9A 2UZVA 5AP2A 3ZDUA 5IF1A 1Y57A 3SOAA 3Q52A 3UOKA 2OWBA 4GT4A 5FXSA 3AG9A 4AW1A 4QMYA 4E6AA 4BI0A 4OTDA 3RAIA 4HVHA 2VRXA 3BU6A 1RE8A 1JNKA 2JBOA 2QURA 3R8PA 4DH1A 3FLQA 4EK4A 2HELA 5C01A 2UW5A 5J5TA 2DUVA 1PXLA 3CTQA 4BIBA 2C5YA 4DT9A 4DEGA 4YUQA 4O7TA 5D10A 4FTKA 3WIKA 4MBIA 3PJ1A 3EQFA 3O8UA 3ZLSA 4E20A 3LVPA 1QPDA 3ORKA 4BYIA 2BZJA 4HZRA 4L8MA 4PWNA 2WZJA 3TUCA 3S95A 3HLLA 4ONAA 4FUYA 2OH0E 2BFXA 2XNNA 2W9ZB 3SXRA 1OUKA 4FSQA 3U87A 4NTSA 2WHBA 1KE5A 4D5HA 3ZLXA 4BF2A 3P4KA 4EHZA 3NVMB 2VTTA 2HYYA 5EH0A 3R8MA 3PXZA 4USEA 4DGMA 5CENA 4I23A 2G9XA 3GFWA 2FO0A 1ZRZA 3SOCA 4JI9A 4ZMEA 1H27A 2WXVA 1KOAA 1OKWA 3AGLA 2O63A 2Z7LA 3H30A 4U42A 4X0MA 4FSTA 4PY1A 5DT3A 3UC4A 4EHVA 5EYCA 3DOGA 3NEWA 3MA3A 4TZRA 1S9IA 4EZ5A 4C4EA 4RWIA 2FSLX 4ZAUA 4KS7A 2ZDTA 2AUHA 3KA0A 3UQGA 3FI8A 1NT2A 3WOWA 3GBZA 4APCA 2F7XE 3QC9A 4BCQA 3LM5A 3OBGA 2LAVA 2WMWA 3PJCA 2BUJA 3FAAA 4IM3A 1NY3A 4G3FA 4KSQA 3M11A 4ZP5A 5EW3A 2XA4A 5FD2A 2WQBA 4AW0A 4MK0A 2QO2A 4KKGA 5HD4A 2X4FA 3LXNA 1M2RA 4FKVA 3BELA 4AOTA 1URCA 2HOGA 3GU7A 4TW9A 5E8ZA 3ORMA 3CS9A 3MVMA 4AAAA 1U46A 4PNKA 4FE2A 2W06A 2X7GA 2XMYA 5M4IA 4U43A 4EOMA 5E8VA 3O96A 2WGJA 3FYJX 5G6VA 2IW9A 4ERWA 4UMRA 3A8XA 3BYUA 5JKGA 1H4LA 3V04A 5DMZA 3U6HA 3KKVA 2A19B 2ERZE 5AR7A 4DA5A 4L45A 3LFBA 3PSCA 4QP2A 4V0GB 3I6UA 2C6IA 2EXEA 2GNHA 2VX3A 3AC5A 1SVEA 4QMPA 4MD8E 4U79A 4C3RA 4C57A 3DA6A 3Q2MA 3F3VA 1OL7A 2BMCA 3HDNA 4C33A 2WIHA 3PTGA 4G9RA 2HW6A 2ZMCA 1JAMA 2ETRA 4X6QC 5C03A 4Z7GA 3O17A 3F3WA 4A06A 1F5QA 3HA8A 3QZGA 4R78A 2R3IA 3IGGA 4O7ZA 3QCXA 3IONA 2QD9A 4DHFA 4FA2A 4RSSA 3HRBA 1IAJA 2C68A 4QTDA 3ENHA 4KD1A 5EYKA 5HHWA 3WBLA 2PZIA 4HYUA 4KS8A 3HP5A 3P86A 4KABA 4GEOA 4O0SA 2XP2A 3W16A 4LG4A 4AT4A 4D55A 3VO3A 2YIXA 4JBPA 2IJMA 5CU2A 3ZSIA 2PVLA 4A07A 2WB8A 3E8NA 3D5WA 2XIZA 4UWCA 3ULZA 3KQ7A 2E9NA 3UYTA 3DCVA 3NUNA 1ZYJA 1YOJA 1P5EA 1ERKA 1MQ4A 2YN8A 1XBAA 3QHRA 2GS2A 4KRCA 5EM7A 5JT2A 5I3RA 2XIRA 5JFXA 5AM7A 4BDDA 2OFUA 3EFLA 3L8SA 2ITUA 2PVMA 3QTIA 3ALNA 3HMOA 4FIJA 5TE0A 4BIDA 4E1ZA 2B55A 2VO3A 3IOPA 3Q4CA 3MFRA 5JSMA 4CG9A 4K33A 4IWDA 1UWJA 3Q4ZA 3KVXA 4YMJA 2GNJA 4DN5A 2DS1A 3K5VA 2X6DA 1MRYA 3LIJA 4L7FA 2OXYA 4E73A 1KOBA 2P2HA 4F6UA 2JFLA 5AWMA 2J0JA 4FKSA 5IDNA 4GK2A 4IACA 4P5QA 2YAKA 3PP1A 4II5A 4Y5HA 2JAVA 3GI3A 3TIYA 4KRDA 4MXXA 3R7IA 5CAUA 5AP1A 4N6YA 3VUHA 2YCRA 3UGCA 2C6LA 2WMXA 4O84A 1IR3A 4RC2A 4O21A 2C6MA 2XRUA 3TXOA 4WNPA 4LOPA 4IEBA 2Z7SA 4OR5A 4CMOA 4DINA 5GZ9A 1QPCA 3E64A 2ITVA 4IX3A 2JGZA 3SKCA 3C4WA 3EMGA 3QX4A 3AT3A 4FKGA 5EM8A 3TT0A 4MH7A 1G3NA 5ACBC 4KIQA 3OBJA 4QMQA 4M68A 1WBVA 3VUKA 4PTEA 3LMGA 2I1MA 3FI3A 2Y4IB 5GJGA 3SRVA 4C4HA 4EC9A 2VWXA 4WG4A 5AUTA 5CTPA 4GSBA 2W0JA 3FKLA 1RDQE 4ZY4A 4A9UA 3CKWA 4YJTA 1PKGA 3A2CA 2VNWA 2VO7A 3AMAA 4IDVA 3NDMA 3HEGA 4OTPA 3EFKA 2VTHA 4E6DA 5GIPE 2YWVA 5AMNA 4PP7A 4FG7A 3ZUVA 4DFZE 4I94A 5HU9A 3KULB 3DXPA 4NFNA 5FM2A 2HENA 4OTRA 3TNPC 5HG7A 3PSBA 4FOBA 4IM0A 3GENA 3O71A 2J51A 2IVUA 3IG7A 4AE9A 1JVPP 3SGCA 5DT0A 2H6DA 3PG3A 4L6QA 3AOXA 2QOLA 4IX4A 4F4PA 4PX6A 2UW9A 4FZAB 4TYHB 2W9FB 1UVRA 4FTMA 5M57A 4O0TA 3W2RA 4LV8A 3VQHA 4BCIA 4GJ3A 4EOPA 3BPRA 4F7JA 2X7FA 3KK9A 3JVSA 3D2KA 3NW7A 5E8UA 3ACJA 1TQIA 5BNJA 4O7SA 2R3JA 1VR2A 4WHZA 4L53A 5JQ8A 3NUSA 4IB1A 4C02A 3QA0A 3EWHA 5IPJA 3N9XA 3CD3A 5J9YA 1YXVA 1M2QA 4EHEA 3WF6A 3PXFA 5IA0A 3P0MA 2XS0A 3LJ2A 4EKLA 4G16A 4E4XA 3LAUA 4AE6A 4NCTA 5FDPA 4GKHA 2XVDA 1WBWA 2JKKA 4QP7A 4LV5A 3HA6A 4FKJA 4BGQA 4FGRA 3G9LX 4JDHA 3QKMA 1H24A 3UPZA 2YIWA 2CCIA 2YDJA 2YM7A 4CRLA 4O7NA 2Y8OA 3HECA 2VTOA 2KTYA 3FMKA 3D4QA 2W4OA 3ZFXA 4RWLA 4DFBA 3E7VA 4O38A 2PUUA 2IWIA 3QC4A 2GS6A 2WO6A 3OC1A 3QA8A 5DI1A 3EQDA 4H3QA 1DI9A 4IAYA 4GJ2A 3VUGA 4UMUA 4QMLA 5DWRA 1YW2A 4CFXA 3ZZEA 1YXUA 4DEBA 2BRBA 2QHMA 4K2RA 2JIUA 4RA5A 3RPVA 3TACA 4WRSA 2UZTA 3OMVA 1XWSA 3IW4A 5FEDA 4EHGA 3U9CA 5IQCA 5E8YA 2WMUA 3KXZA 4N6ZA 4I20A 4RBLA 3VS4A 5DG5A 4XRJA 2UZBA 3F2NA 3EZVA 1UWHA 3CR0A 5CS6A 4QQJA 4IBMA 3W2CA 2HK5A 4QYYA 5IG1A 3TUBA 1UU8A 1OBGA 4CKRA 2GHGA 4V01A 3C5IA 4RRVA 3TUDA 3FZRA 3MH2A 4FVRA 2PK9A 5JMSA 2Y6MA 3FUPA 3S3IA 3V5QA 4G9CA 3C4EA 1Q3WA 3PVWA 2REIA 2C3KA 1SYKA 3LCSA 4X2NA 4PPAA 4AN3A 1YXTA 1SZMA 2EB2A 3MGYA 4FV8A 4NJ3A 5BMMA 4AZTA 3UNKA 2BTRA 2ZV7A 2ONLA 1EH4A 2OU7A 3UPXA 2UVZA 5BQ0A 1PXJA 1YDRE 3Q32A 2FSOX 3LJ1A 3R8ZA 2I40A 3N51A 5DR6A 3D5XA 4DGNA 2YIRA 3QGWA 3KC3A 5G1XA 3DPKA 4KBCA 4AZFA 5HLPA 1XR1A 2OSCA 4G6NA 3SA0A 1Y8GA 1WBTA 3NNVA 4MXZA 4EH6A 3IW6A 3V8TA 2PE2A 2XKEA 1YI6A 3QUEA 4WBBB 5IQEA 4QP3A 4EYJA 1PW2A 2QHNA 3TV4A 4JIKA 3OW4A 4Z16A 4G3GA 4HYIA 3CQWA 4DYMA 4BKYA 2OJJA 4NT4A 4WSYA 3RI1A 4C35A 2ZM3A 3VUDA 1NVRA 3QRUA 4GUBA 3PXRA 3R1QA 1CKIA 3O8PA 3R1YA 2G2FA 4IWPA 3TZ9A 3QUDA 2FVDA 4V0GA 4DITA 3GVUA 3R9DA 3TZMA 3QAME 1P2AA 3ZUTA 4CCBA 3HZTA 4XP2A 4C4FA 4YBKA 2DQ7X 1I09A 3TCPA 4BDHA 1OIQA 1GIHA 3II5A 5HX8A 3IW5A 2PZ5A 3U4WA 3O2MA 2C6KA 3QTWA 3AC3A 4CFWA 4EH5A 4PNIA 4QYHA 5C8KA 4ZTLA 5EHLA 3MH3A 4W4YA 4F6SA 4GVAA 4FOCA 3BKBA 2X8IA 3HKOA 5CSXA 3F66A 3PYYA 5ETIA 4FSWA 5I9YA 3EKKA 3G0FA 2PMIA 4CV9A 4N4SA 5AR4A 4QNYA 4AN9A 3CJFA 3IECA 5C4KA 3FHIA 4TXCA 1Q62A 4D0XA 3C51A 4OT6A 4TYGA 3H9FA 3KXNA 5EHYA 1KE7A 4DGLC 4PTCA 5HLWA 3F2RA 3QZFA 3I79A 4RFYA 3UC3A 4NKSA 3ZCLA 4O86A 3HAMA 4ITIA 2UW8A 3OXIA 4RC3A 4AZVA 4XP3A 2CJMA 4E5AX 3LMIA 1JKTA 3PIXA 2VNYA 4R3RA 5AIKA 2JEDA 2BKKA 1OPJA 5EQYA 4UB7A 5TKDA 4AN2A 1G5SA 5E1EA 4BGGA 3CJGA 2VTAA 2UVXA 1F3MC 1YDTE 2W5AA 4I6HA 4M12A 4HW7A 3MN3A 5A4EA 5JFVA 5FBOA 3ZC5A 2PL0A 3UP2A 2UVYA 2XJ1A 2OJIA 3FLNC 3AMYA 1GNGA 4I6QA 4YNEA 5HNGA 3NAYA 4FF8A 3ZLYA 4BZDA 3M2WA 3BHTA 4QTEA 5IEYA 5BYLA 1JLUE 2Z8CA 4FV1A 2QO9A 3FXZA 4EWHA 1NA7A 2BZIB 3U8WA 3T9TA 4ZLYA 4TYIA 1J7UA 1PXIA 3CPBA 3HGKA 4EYMA 4O7VA 4IJPA 1Q4LA 3R71A 1XH4A 2CN8A 3KMUA 2R5TA 1P14A 2WKMA 4J71A 2BRMA 5KMLA 2PMOX 1YHSA 3RAHA 5D11A 4QTAA 4KAOA 3HRCA 3QQFA 5DRDA 5C8MA 2C1AA 4EL9A 1IG1A 2YABA 3JR1A 1M7NA 4X2JA 3MJ2A 2WU7A 4FSMA 4BC6A 4W9XA 4RX9A 3L9MA 4EOSA 5HICA 2GSFA 3IW7A 4IQ6A 4QMTA 4DGGA 1W8CA 4CG8A 5J1WA 3NCZA 2VTSA 4CYJA 4XBRA 3PLAE 4O22A 3E93A 3G9NA 4RJ5A 2PWLA 3R9OA 4AS0A 1FVVA 5CSHA 2BILB 4TL0A 5HE2A 4IWOA 5HG5A 4GFGA 2XK4A 4K0YA 4O0VA 5DR2A 2XRWA 5CVHA 5M07A 3JS2A 3RP9A 3ODZX 3BWJA 3KULA 2DWBA 2VWUA 3P7CA 1GJOA 1H0WA 2ITZA 3BBWA 2OKRA 3I0OA 1FOTA 3QXOA 4TYJA 4DFLA 3MB7A 4ALWA 1U59A 1XQZA 3KK8A 4FIFA 5HIBA 4TNBA 4HCTA 3RM6A 2WQOA 1V0PA 2YIYA 5I9ZA 4G3CA 2Z60A 4D4YA 2Y7JA 3KL8A 4FVPA 2YM4A 3BX5A 3ORNA 4QD6A 2XH5A 2EWAA 1ZMUA 4FV4A 4IVDA 4TYHA 2HAKA 3LOKA 4GG5A 4JL9A 1OPLA 4EH2A 3PRFA 5KE0A 1QCFA 4FI1A 1YKRA 2ESMA 3F61A 3ZOSA 2HY0A 2GTNA 3NW5A 3VULA 5HBEA 1L3RE 4V04A 2FB8A 1GIIA 2ITTA 3FZSA 4L68A 5EDPA 4YLLA 4BL1A 2I7QA 1TQMA 4G34A 3QD2B 5K4IA 4DAWA 3NGAA 2R3OA 4WO5A 3D9VA 5KHWA 3CSVA 4CFMA 4EK6A 4NUSA 3I60A 1ZAOA 2XB7A 3ORIA 4EH9A 4D9UA 2UZEA 2V7OA 5HTCA 3CIKA 4FEUA 1MRUA 4PV0A 3WE4A 5EG3A 4D28A 5A54A 4EEVA 2B53A 3ZO4A 3OT8A 4DTBA 2WTJA 3VHEA 5JQ5A 3LZBA 4FMQA 2A4LA 5AR3A 5FBNC 1O6YA 5EI6A 2XM9A 4QMOA 4ANBA 3C4ZA 2ZOQA 4ITHA 1OB3A 1U54B 3MPAA 5HO6A 2ZAZA 5BVNA 2FYSA 1W83A 1FPUA 2WMQA 3C50A 3ANRA 3OW3A 4FSNA 4IH8A 5CU3A 4ZMFA 3R02A 4GK4A 1XBCA 3IO7A 4DBNA 3QQJA 3GP0A 3KGAA 4JLCA 4QMMA 5AAGA 4ZS0A 3TZ8A 3THBA 3AGMA 1BL6A 5A14A 4IZ7A 3MJ1A 4AZWA 1PY5A 3VQUA 1M52A 1Q61A 1ZARA 2Y0AA 2ZV2A 3LCDA 2WU6A 3LFAA 3MFUA 4AW5A 4YTCA 3QTRA 3C4FA 2X2MA 1IAHA 1BLXA 3P1AA 4AU8A 1ZZ2A 3QKLA 3IK3A 3QGYA 3VS7A 5HEZA 2W99B 3ZSGA 3G5DA 4NSTA 4YC8A 5JRSA 2F7ZE 3RK7A 2OIDA 3VS5A 1Y91A 5J95A 3QCQA 1CKPA 3GCUA 3KN6A 5DE2A 3SG8A 3BQRA 4FSYA 1OPKA 2WOTA 4U9AA 4KIPA 4X21A 2GQRA 3HAVA 2H9VA 4JNWA 4KNBA 1ND4A 4FG9A 5AP3A 5BUEA 1ZYSA 4ZTSA 5IQGA 3BE2A 3ERKA 3GU6A 4OTQA 4OLIA 3EHAA 4IE9A 3KB7A 2VTRA 4NH1A 3V8SA 4ZSAA 3NUXA 4L3PA 1V0BA 4O0UA 4NYEA 4JX7A 4X3JA 2CDZA 3DLZA 1YI4A 4HPTE 3OWJA 4BBFA 4QYEA 1R0PA 4NTTA 3D7TA 4UWYA 1ZYDA 3F7WA 3E7OA 3R9RA 3UE4A 4UZDA 3TV7A 5DYJA 2W1ZA 4HVGA 5E4HA 3E92A 2QQ7A 4O83A 4LI5A 3WZDA 3VAPA 4FEXA 2RGPA 2PZPA 4FYOA 3PIYA 4DH5A 1JSTA 2YLEA 2P55A 3R8UA 4B8MA 4R7BA 3JXWA 4IZAA 5FEQA 5HD7A 5AV4A 2F2CB 2A0CX 3F5PA 3GU5A 3Q6WA 3TDVA 4YJPA 5H8EA 5J5SA 5CSWA 1STCE 4OTFA 3AC2A 4D5KA 4UV0A 5KMOA 4F7SA 4XLIA 4HVDA 2I6LA 4KSPA 5CLPA 2V0DA 5C4LA 4GVJA 2C5XA 5HCXA 1WBSA 2GMXA 2P4IA 3F69A 4GYIA 3C7QA 4PPBA 4ZZNA 3DQWA 1H0VA 1XH8A 2OZAB 2OJFE 2QR7A 3VWAA 3GEQA 3NPCA 5A9UA 3OZ6A 2G2HA 2HCKA 3SX9A 1LR4A 4AG8A 3LFSA 3W2PA 4E4NA 4F6WA 5AAEA 5I4NA 1WZYA 4ZSLA 2FA2A 3MY0A 4L44A 3NYOA 4WUAA 3P78A 3GU8A 4ZXTA 1V0OA 3UG1A 2X8DA 4R3CA 4F7LA 4DTKA 4ACDA 3NYVA 1AD5A 1SVGA 3DBDA 4RVLA 1H26A 4UX9A 4FSRA 5HX6A 1U5QA 2C3JA 3ETAA 4TY1A 4JG6A 2YLFA 3HMPA 5HG8A 4CXAA 1O9UA 3A8WA 5ETCA 3DTCA 3F5XA 4M0YA 2H34A 5AADA 1QPEA 3CEKA 5LCKA 3I7CA 2X4ZA 3TNIA 2V7AA 1XH5A 2ZJWA 5D7AA 3HYHA 1XHAA 2I0YA 2OG8A 4JBOA 2XKCA 3R1SA 5IQHA 4C4GA 4FTJA 1UA2A 2OXDA 2PPQA 4FTOA 5L6OA 3DJ7A 4HCVA 4M14A 4L3LA 4YJRA 1WBPA 4GK3A 3VBQA 4C61A 4Q5HA 3RINA 4MNEB 5J87A 2C3IB 4ERKA 1R39A 3EQCA 3WF7A 3PY0A 3FKOA 4G6OA 4C36A 2BAKA 3WF8A 2UW4A 2ZM1A 3CD8A 2PZYA 4RX7A 5AR2A 2E9PA 1QPJA 2GHMA 3F2AA 2YIQA 4ZTQA 5LWMA 1LUFA 2UW6A 1FVRA 2W4JA 2QCSA 3V51A 4K6ZA 4QMVA 3DDQA 4R3PA 3UMXA 2YZLA 4TPTA 3PY1A 4EOJA 4EUUA 4EOIA 4CLIA 5LMAA 1W98A 5CZHA 2FH9A 3OHTA 4ACGA 1G8AA 3QRKA 1ZY5A 4A4LA 2KULA 4DG2E 1ZMWA 2V5QA 5JZJA 2YFXA 3HP2A 2AC3A 2OIBA 5CAPA 3LM0A 3VS0A 2BRNA 4IX5A 3C5UA 5L2TA 2QLQA 3L9NA 2J4ZA 4D1SA 2UZLA 1JKSA 4W9WA 4C3FA 4WT6A 4YJUA 3NIEA 3OY3A 4C58A 4TRLA 1RW8A 3UTOA 3LXLA 3KVWA 3QQGA 4TWNA 2R3LA 1OKVA 4RFMA 3BGZA 4RIOA 4YR8A 1J3HA 3QXPA 4L43A 2XIXA 5IQFA 5E8WA 2J9MA 5GIOE 2YISA 2WPAA 3OG7A 2EVAA 5I9VA 4IAAA 3NR9A 4BVUA 3OWLA 4R6VA 1HCKA 4BZOA 4D2TA 5EDQA 3QQLA 3VJOA 4L67A 2BKZA 4XG9A 4YSMA 3RM7A 4JQ8A 3NVKI 1OL6A 1H28A 2R3RA 3AT4A 4QQ5A 3QCYA 4I6FA 1XH7A 3QD3A 4MWHA 3RHKA 3U54A 4A4OA 4FIEA 3W1FA 2CKEA 2PY3A 4A7CA 2ZB0A 4U7ZA 4BTKA 4M69B 3QD4A 4FTNA 4XHKB 3TM0A 4BIEA 3O8TA 5AP0A 4LQMA 4K9YA 4LL5A 2R3GA 5LXMA 4ZTHA 4FV7A 3OD6X 4K8AA 5TR6A 1IEPA 4I5PA 4O27B 3EN5A 3OEZA 4HYHA 4Q2AA 4L52A 4OTHA 2RG6A 2PVNA 2C30A 3QQKA 2OK1A 4MWIA 4PDOA 5K3YA 5CF4A 4UY9A 4RLKA 3UVPA 1PXMA 4CZUA 2J2IB 4G5PA 4ZS4A 2WAJA 3BE9A 3BU3A 3UQCA 4RJ7A 2B0QA 4I41A 4NK9A 5KHXA 3U9NA 3NUUA 3UODA 1PMUA 3B8RA 1OKZA 2YDKA 4ZSJA 4AACA 3DZQA 4YTHA 1U5RA 2UV2A 3I7BA 3PWYA 4P5ZA 5A4LA 4NFMA 3T9IA 4MHAA 3VBYA 3BHUA 2PULA 3PJ2A 3MB6A 3PLSA 4PRJA 4I21A 4JS8A 3GNIB 5KBRA 4LGDA 5KMMA 1YXXA 2PVJA 4FKIA 4QP9A 4PTGA 5BYYA 1YOMA 4X3FC 2B4SB 4B7TA 3FLSA 4EORA 3GOPA 3OTVA 3UO6A 3SQQA 1URWA 1MP8A 4PUZA 5K5XA 5FTQA 4CD0A 5M06A 1CSNA 4XG8A 1WCCA 4AT3A 2Y4PA 3CY2A 4JJRA 1U54A 2X7OA 4QMUA 3S00A 2NNWB 4AGCA 4C4JA 3DTWA 4FODA 4A9SA 3HMNA 3R2YA 4IFCA 4RVTA 5FLFA 4FIIA 3UYSA 4EH7A 4BCMA 4E5BA 2R3FA 4TKSA 4JQ7A 5HVJA 2BCJA 5DLSA 5A3XA 3IDCA 4O82A 3QALE 2YCSA 3HL7A 3UOHA 4P7EA 1GAGA 4L42A 2RSVA 2W96B 1F0QA 4UEUA 4XG6A 3DNEA 2CMWA 2WTDA 3KMWA 5LCJA 2ZMDA 1FGKA 2CHLA 2W1IA 1Q41A 3RTPA 2PVHA 4LUDA 3LFDA 3UNZA 4CFFA 4DFNA 2XIKA 2AYPA 3HNGA 3OTUA 4FTLA 4BTMA 3SC1A 4YU2A 3KF7A 3WZJA 5L3AA 1Q99A 4EJ7A 5DOSA 5EQEA 3FPQA 3W10A 3PPZA 2R7BA 3DZOA 3DNDA 5D9HA 3N4VA 2XEYA 3DXNA 3FE3A 4CRSA 4PMSA 2EXMA 3MVHA 3FWQA 4IAZA 4CYIA 1BKXA 2NP8A 3AXWA 4Z9LA 5FP5A 3UVQA 2IVSA 2EB3A 3QCSA 4FKUA 2QONA 3D15A 3VF9A 3VS1A 2C5OA 2HZ4A 4FG8A 3LHJA 4GG7A 4QT1A 2XYUA 3UOJA 3ORTA 5EYMA 5BVFA 1CM8A 4GU9A 4YNOA 4F1OA 3R2BA 3KF4A 4RX5A 4FICA 3MPMA 5M55A 4KIKB 4HCUA 3TG1A 5EYDA 3WZKA 1UNHA 2W1DA 3H3CA 3MIAA 4BDIA 4I6BA 1A06A 3T3UA 1U4DA 2E9OA 4O0RA 2W1CA 3CXWA 4XP0A 1YDSE 2B9FA 3Q2JA 3FKNA 4QNAA 4BI2A 2VU3A 2C5VA 2F4JA 3F3TA 4K77A 1YWNA 3W32A 1FQ1B 4M13A 3DK3A 1BI8A 1TKIA 3CC6A 3T8OA 4F9CA 2O5KA 4WNMA 2WMBA 4M0ZA 4APPA 2UZWE 4E6QA 4XBUA 3QTUA 3QFVA 2I0VA 4ZY5A 4U0IA 1IA8A 3EL8A 4FKTA 4U41A 4BZNA 4FKWA 1JBPE 3PE1A 3ODYX 4IB5A 2YAAA 4RJ4A 4UWBA 4BTJA 5HO7A 1PMNA 2RFNA 4RZWA 5DPVA 4XNEA 1Z57A 2UW0A 5J7HA 1SNUA 4OGRA 4FV9A 2BTSA 4J99A 1AGWA 4BDEA 2VTQA 3CY3A 2JBPA 4A4XA 2OZAA 3FV8A 3I5ZA 2W5BA 3UZRA 4RPVA 3ORXA 5I3OA 5FTGA 4R7IA 5B2MA 3R7UA 5BYZA 2W1FA 5BUJA 5CVGA 1UU3A 4IAFA 2IVTA 2PMNX 4GV1A 2HXLA 5FEEA 3GOKA 3D14A 4Y5QA 2WTCA 3CBLA 4DFUA 4O1PA 4KINA 3ZU7A 2QU6A 3PA5A 2ITPA 4G31A 2WEVA 5H3QA 4ARKA 1SM2A 4TN6A 3FMMA 2PYWA 4MQ1A 5CZIA 2QI8A 1PYXA 4MD7E 4XV2A 3ZEPA 4DH7A 1VYZA 2J90A 4EZ7A 2PTKA 4ZTNA 2JITA 2YEXA 2OH4A 3QKKA 2WTIA 3HUBA 3GT8A 4JX3A 5JZNA 3V3VA 4DH8A 3EH9A 2E9VA 3VIDA 3RK5A 3R7VA 3EYHA 4FZDB 4NIFB 4AF3A 4RVMA 2XNPA 4FK3A 3R22A 2B52A 4BRXA 3VBWA 4FL2A 3ZFYA 5AA9A 3G6HA 3GC9A 4GMYA 4RJ6A 3HVCA 3ELJA 3BLQA 1GOLA 4MNEA 4DE4A 4RIWB 3ZSHA 4HVIA 4HGLA 3CCNA 5DBXA 1OL5A 3RALA 4IJ9A 2JC6A 2VD5A 2QOHA 4AWIA 3RAKA 3E87A 3PY3A 3R0TA 2J5EA 5L8JA 3BYSA 1OGUA 2F57A 1YQJA 5FGKA 1ZXEA 2JKMA 5AP4A 1H1PA 4HGTA 2QC6A 4C38A 5AEPA 4U97A 1B38A 4BDJA 2J0LA 3PSDA 5I0BA 2CN5A 4I93A 4RLLA 4DEEA 5FM3A 5HORA 5KO1A 3ZC6A 5KUPA 4W4VA 3E62A 3L9PA 4RT7A 2CKQA 3BU5A 4CMUA 2F2UA 4B0GA 1I44A 3P7BA 1XO2B 5H8GA 2QOKA 1PF8A 2G1TA 2BROA 1ZZLA 4CQGA 2QODA 3MW1A 1OITA 1IA9A 3KCFA 4X6RA 2XNGA 3VBVA 1J1BA 4GH2A 4M7IA 4AUAA 4JR7A 4L9IA 4V05A 5B0XA 4IC8A 4AZSA 3FI4A 2BIKB 4DTAA 5EM5A 5IA2A 4BCHA 2HY81 4O2PA 4W4XA 5BMSA 3Q5ZA 4U6RA 5KZ0A 3BEAA 3QF9A 2VTIA 4N70A 4EK8A 1Q8UA 5M4UA 4GT5A 2HIWA 4GUEA 4I24A 3RPRA 5K4JA 5J9LA 2HW7A 2PE0A 2X39A 1FBNA 2VX1A 3TIZA 3I5NA 5KBQA 4F1TA 4UBAA 5BVOA 3NCGA 4YC3A 5FXQA 1DS5A 3E8DA 1YOLA 4G17A 4IW0A 5AR5A 4FT5A 5AX3A 2PHKA 4E5WA 2HZIA 1BI7A 3QTSA 2XK9A 4NWMA 2ETMA 3KMMA 3QZIA 2C69A 3W18A 3O50A 4ACMA 2BHEA 3UJGA 4DBXA 4DEIA 5M53A 3EOCA 4M69A 5CWZA 4YLJA 5JFWA 2QOFA 3ZO3A 4KA3A 2B54A 2GU8A 2YCQA 4Y95A 5IEXA 2WTKC 3OFMA 1NVSA 4HYSA 5AV0A 3LE6A 5TOZA 5AP5A 4O91A 2JDRA 3Q4UA 5M09A 3IDPA 1YXSA 2XKDA 2C6TA 3FY2A 3S2PA 2R3NA 4D1XA 5D41A 5ANOA 2WEIA 5DNRA 5L4QA 5HNIX 5EK7A 3HUCA 3UNJA 3VRYA 2YDIA 1VZOA 4M66A 3I1AA 3PE2A 4PDYA 4K18A 5IA1A 4YJQA 4J1RA 1YWVA 2W1EA 3DV3A 4RMZA 3VBXA 4Z3VA 3PVUA 3DLSA 4XV1A 3DQXA 4C62A 5IA4A 1XBBA 3KY2A 2PUIA 4BFMA 4GYGA 3MPTA 4XX9A 4G3DA 2BR1A 3F9NA 4F63A 2VTMA 2XNOA 5I9WA 2ITNA 5CAQA 4R5SA 4XG7A 3WI6A 4EH8A 1ZOGA 3PG1A 4S32A 3GFEA 2OW3A 3UIBA 5ICPA 2C47A 3CQEA 4GIHA 3W2OA 1E1VA 4F9AA 4XG3A 3C0GA 4CVAA 5DR9A 4ZSEA 1Q8WA 3ORPA 5FTOA 3W8QA 3DFCB 2XUUA 5CXZA 5LWNA 4OAVB 3WF5A 3FMNA 3OCTA 4O0XA 4UMQA 4FNWA 3PUPA 4A9TA 5KKRC 4C3PA 3NAXA 4H39A 5E8XA 2GNFA 3DB8A 4LRJA 3QRJA 4DC2A 4GKIA 1O6LA 3Q9WA 5LMBA 2VWYA 4CV8A 2BAQA 2JDVA 5ANKA 2E9UA 5AP6A 5IQAA 3TZ7A 5LARA 1Z9XA 2EUFB 2I0HA 2Z7QA 5BPYA 2R4BA 4QMNA 2YJSA 4UZHA 4O7LA 5HCZA 5C9CA 3BBTB 5F20A 3TJCA 2ZDUA 4JDIA 4U40A 1TQPA 4I92A 4MXOA 3R8LA 4YJOA 3MYGA 4D1ZA 4E8AA 4AT5A 1Q24A 4LUEA 3TNWA 3PVBA 5HKMA 2C0IA 4FTIA 3KRJA 4RJ3A 1Y6AA 1YHWA 3IDBA 5JGBA 3ZUUA 1APME 2XBAA 4FEVA 3SVVA 4I1ZA 3KEXA 3HV5A 3TWJA 5KMIA 4LL0A 1PJKA 3PPJA 4R1VA 2R7IA 4B8LA 4D2RA 2ZV9A 1GZ8A 4KIKA 2QU5A 3F5UA 3OP5A 1T45A 4Z7HA 4BKZA 3AC8A 5HTBA 4FEWA 3MSSA 3OUNB 4CZYB 1REJA 4MX9A 3ID6C 2CGVA 2X2KA 5CT0A 3BYOA 4J97A 4MEDA 3UDBA 4E6CA 4X3FB 3BV3A 4J7BA 4F08A 4CGAA 3QX2A 3U55A 2C5NA 5IQIA 3DGKA 2VO6A 4S2ZA 2W1HA 4AFJA 3LQ8A 4ALUA 4NJDA 5A46A 4BWPA 4H05A 5DGZA 2ITXA 2P33A 4YZBA 3ROYA 4EQMA 3QTZA 3O7LD 3QHWA 4S34A 5HVYA 4F0IA 4QQTA 5LMKC 2JAMA 4OBQA 5E9EA 5GHVA 4MF0A 5HLNA 4GFMA 2OIQA 1OKYA 2ZVAA 3LCOA 4XMOA 3R7YA 4FV5A 5M4CA 3A7IA 1J1CA 1XKKA 4KKHA 5AAFA 1MUOA 4YZNA 5KZIA 4BCGA 4HVSA 3O23A 2C6OA 2YM8A 4PPCA 4CMTA 3VUMA 3FZTA 3R04A 4I5CA 3R83A 1RQQA 3CTJA 5IUIA 4JT3A 5J9ZA 4BDCA 3Q96A 2RFEA 3UZPA 2YM3A 4GFOA 2WD1A 4D2SA 4IMYA 4Q9ZA 2X8EA 4I0TA 3GXLA 1JWHA 2YZAA 4F64A 1GZKA 2YITA 2GS7A 4FX3A 3HV4A 3COKA 4IIRA 4EK5A 3EZRA 3C4XA 4U45A 1CDKA 3QQHA 3WYYA 1GY3A 5IKWA 1O6KA 3P23A 4M8TA 1PXKA 4NM0A 2X0GA 4AQCA 4YPSA 1OIUA 4XLVA 3QRTA 4MBJA 5CSPA 5A6NA 3REPA 3M42A 5T6KA 2QOIA 3A61A 4D2PA 1W7HA 3PIZA 5IH4A 3TTIA 3RPYA 2H8HA 5CF5A 3RGFA 4YZMA 4EK3A 5KMNA 3TNHA 4NIFA 3ZFMA 4IWQA 1PXOA 5DRBA 4H58A 4P4CA 5HESA 3HRFA 3BWFA 3VC4A 5HQ0A 2WELA 1YWRA 2UW7A 2ETKA 4FZ7A 5GJDA 4I4EA 3EQBA 4MXAA 3CGFA 2JKQA 5L2WA 2G01A 1K3AA 3MFTA 3R1NA 3TKUA 4RIWA 3ZRMA 4B6LA 1J7IA 4O7RA 3RBWA 2HWOA 4PQNA 2DYLA 4PF4A 4MNFA 5IMXA 4FSZA 1KE9A 2YACA 4F0FA 1M14A 2W5HA 3BV2A 2JFMA 5HE1A 1YHVA 4Z55A 2J0KA 4E4LA 1H00A 3PDTA 4O7YA 5T3QA 2RG5A 4BYJA 2WTWA 4IC7A 3VRZA 3I0QA 3BHYA 4QTBA 3WILA 5GZAA 1LPUA 3E3PA 3WYXA 3FMLA 4I3ZA 4CCUA 5CAVA 4BBMA 3ZRLA 4FL1A 4ANNA 3ANQA 1Q8YA 5EI2A 3R28A 4OT5A 3B2TA 3DU8A 4KIOA 4TWPA 1T46A 4ZJJA 3IOKA 2UZNA 3TI1A 5IDPA 4ZTRA 2B1PA 2ITOA 1P4OA 1Y8YA 3DBQA 2OF2A 5ACKA 2GQSA 5DEWA 3D2IA 2B9HA 2Z02A 1H08A 3FDNA 3KREA 4IADA 3AD5A 3R9NA 4NZWB 3Q9ZA 4E26A 5B2LA 2BPMA 4F7NA 3G0EA 3KU2A 4WUNA 5KNJA 5CYIA 4JVGA 5I9UA 2P3GX 3VUIA 2GDOA 5AA8A 5IEVA 3DKFA 4TTHB 1Q8ZA 3NUYA 3R73A 2PUPA 1QL6A 3P9JA 4G3EA 3VJNA 3CGOA 3ZBXA 3DFAA 2XM8A 4IFGA 2R3HA 1Q8TA 4FVQA 4XG2A 1R0EA 4LM5A 1PMVA 3POZA 5E1SA 3EFWA 5HCYA 2EU9A 2VTJA 1HCLA 3DK6A 2CLQA 4D4RA 2WOUA 5IZFA 3EQRA 2WTVA 4TYEA 3OWKA 2WQNA 4IANA 4IVAA 3SLSA 5H2UA 3F5GA 5IH6A 3RZFA 2J6MA 4BDAA 1R3CA 2OGVA 4CFVA 2QR8A 4D2WA 3FQEA 3H4JA 2QKWB 3NYXA 5IUGA 3A62A 3DKGA 1W0XC 3M1SA 3MDYA 3F3UA 4G5JA 4C0TA 4YURA 4KKEA 5M51A 4ACHA 4F1MA 2A27A 4IXPA 4YJVA 4ENYA 1K2PA 5GNKA 3A7GA 5KMJA 1ATPE 2VTNA 4HPUE 2UW3A 2J7TA 1Q5KA 4BDBA 2CPKE 3H10A 2X9FA 4XEYA 1UNLA 4B9DA 4BHZA 2R64A 4FIHA 2XF0A 3LMHA 1IASA 5K0XA 5EW8A 3G33A 3TL8A 4ITJA 3U6IA 5FUTA 2RF9A 2WNTA 3QYZA 2ITQA 3LKMA 4FTUA 2XNMA 4U8ZA 1VJYA 5CEMA 3N4UA 2BZKB 1E1XA 3E63A 3GCQA 3P08A 4RX8A 4ANSA 1A48A 2Q0NA 2W05A 2BHHA 5JEBA 3AC4A 3LCTA 2CNQA 3I81A 4ZEGA 2XK3A 4D0WA 3RCJA 3A7FA 3MS9A 5CVFA 3NNUA 3PFQA 5FRIA 3CE3A 4AA5A 3OS3A 4OAUC 3RWQA 3CP9A 4O0YA 4CQEA 4FV2A 3TTJA 5ANDA 5L2QA 1PXNA 4YO4A 2R3KA 3CKXA 3FSKA 2OJGA 4YJNA 2GFCA 4IM2A 4EI4A 3QWKA 4RFZA 4EONA 2XK8A 3L8PA 5DFPA 5AR8A 2C1BA 1PXPA 3OEFX 4YHJA 3CLYA 1ZMVA 1PKDA 4LGHA 1KWPA 3FLZA 4FKRA 4NEUA 2QVSE 4QTCA 1UKIA 4C2WA 4E93A 2C6EA 4CKJA 5L8KA 3O0GA 3WF9A 2C6DA 2VWZA 4EH3A 3QTXA 3R01A 2GPHA 3Q6UA 3EKNA 4MXYA 1H1WA 2WTKB 4PL3A 4BWXA 4EOOA 4O0WA 5EKNA 4Y85A 2ITYA 4NU1A 3ZONA 5AUYA 4IX6A 4YTFA 4ANOA 3S0OA 4A9YA 5C27A 3RAWA 4MF1A 4DFYA 1UU7A 4LFIA 2HZNA 4OBPA 3LQ5A 3ZXZA 3PXKA 4L7SA 5L6WL 4Q5EA 1OM1A 3FPMA 3A4OX 1SVHA 3ENMA 3L8VA 3T3VA 1WVYA 3TNQB 4CKIA 1R78A 4UXLA 2A1AB 1XH9A 4CT2A 5BVEA 1M17A 2GCDA 4DEHA 2R3QA 5EKOA 5HTIA 4JQEA 3PJ3A 4D9TA 4L46A 4FT9A 3DKCA 1DAWA 3BQCA 3IKAA 4M15A 3NZ0A 4X3FA 3AD4A 3TEIA 1M7QA 4JOAA 5HU3A 3C1XA 5HOAA 3LLAA 3DBCA 3FBVA 1CTPE 3MVJA 2FSMX 3SV0A 2PUNA 4JG7A 3ROCA 3ACKA 4TT7A 1G8SA 2PVRA 1ZLTA 4FT7A 4ID7A 4FK6A 2XZSA 5ANJA 5CI7A 4CTBA 4DLIA 3JY0A 3BRBA 4U44A 2PMLX 2Y6OA 5DVRA 4RIXB 4BN1A 5M56A 4J53A 2B9IA 3AT2A 5GJFA 3PP0A 4FYNA 1FVTA 4EKKA 3UO5A 3LQ3A 4P2KA 4USDA 4XV3A 1DM2A 4UYNA 5BVDA 5I9XA 1IRKA 2XCHA 1HOWA 1PHKA 3K54A 1DAYA 2VV9A 3IQ7A 3WE8A 5KKRB 3C0HA 4C59A 1J7LA 4QMXA 4EBWA 3EYGA 2CCHA 4FUXA 5BVKA 4GRBA 2VWIA 2ITWA 4PP9A 4EOQA 3FMDA 5KCVA 4FV0A 2IO6A 3OVVA 4MD9E 4EOKA 3O7LB 3FEGA 4RA4A 2J0IA 1OIRA 3DAKA 4WSQA 4XCUA 2J50A 4WNKA 5C8NA 3AMBA 4ANLA 1OBDA 3ULIA 4MXCA 3V5WA 4QP1A 4LMNA 3ZM9A 3GCSA 4JAJA 1WAKA 3LCKA 3QRIA 4U81A 4DCEA 4BR3A 2IZUA 2PZRA 3EQHA 4AFEA 4QYGA 3RVGA 1L8TA 5J8IA 4BCJA 3LJ0A 2VO0A 2CGXA 4CT1A 3ZLWA 4DG3E 5EDRA 3SXSA 3VUTA 2XK7A 4QO9A 4TWOA 5D12A 4F9BA 4FTQA 5M08A 1FMKA 2E2BA 5CEQA 4O1OA 4ZIMA 3QUPA 5I5ZA 5HE0A 5HI2A 1PRYA 3LXPA 2RFSA 3RHXA 2BDWA 5CNOA 3BYVA 2Q0BA 4AOJA 3GU4A 4UALA 3CQUA 4J96A 3HMMA 3EIDA 4AA4A 3RPOA 3R7EA 2PVYA 2NRUA 3NMUF 3DJ5A 4FKPA 2V62A 5HGIA 4DCAA 4O7WA 3P7AA 2LGCA 2OF4A 3VBTA 4CFNA 5FXRA 5IA5A 1UV5A 4IB3A 2YHVA 2YA9A 3D5UA 1JSUA 3FYKX 5K9IA 2IW6A 3SW4A 2VUWA 4QMZA 4LMUA 1WVXA 4W8EA 5D1JA 3KRRA 3LFQA 4BCKA 3EL7A 5DHJA 4YZDA 4CLJA 1UKHA 1BL7A 4NW5A 5J7BA 1ZOEA 4IZYA 3HV7A 1OVEA 4AA0A 3NUAA 1PYEA 4G1WA 4J8NA 1JPAA 4E7WA 3PA4A 1BX6A 2IW8A 3COIA 4IDTA 3VVHA 5DH3A 3FXXA 2YM6A 5HIEA 1CKJA 5E91A 4DF3A 3WIGA 3BLRA 2O65A 3IGOA 1B6CB 2PSQA 3DY7A 5ANGA 3ALOA 4LGGA 4XRLA 5A4CA 5CEOA 3DAJA 3D7ZA 2WMVA 2Z2WA 4AGWA 4BICA 3U4UA 3A7HA 4FR4A 5ANIA 4PDPA 4D4SA 4I5MA 2JDSA 1XH6A 2WFYA 5CAOA 3UZTA 3MH1A 3TDWA 2A2AA 3GCPA 3LW0A 4X2FA 4ZJIA 3QYWA 2HXQA 5CY3A 5JH6A 2XBJA 4BGHA 2YJRA 3QQUA 4IVCA 3R21A 5AUVA 4YSJA 3TV6A 2R0UA 4MBLA 3V01A 3U51A 4ANQA 3GB2A 1VYWA 2XJ0A 5FP6A 4BI1A 5L2IA 4HGEA 4BCFA 4I0SA 4O6EA 3MY5A 5IQBA 5AV1A 4HOKA 2C3LA 2JDTA 2VWVA 3MBLA 4AZEA 1OL2A 5L6PA 5CXHA 4U3YA 2IN6A 5HO8A 4G2FA 4NL0A 5CX9A 3SDJA 4AXAA 4C34A 1ZYCA 4C37A 3NS9A 1WBOA 4RWKA 3DK7A 4H36A 4ORKA 1H01A 3LFCA 4CTCA 2CLXA 1Z5MA 3EQIA 3RCDA 3GC0A 3TN8A 3AQVA 3ZO1A 4YTIA 2Q83A 3D94A 2NO3A 4C2VA 3MV5A 5H8BA 3A60A 2XIYA 3BGPA 2CGWA 3RNIA 4D58A 3DB6A 3QWJA 1OI9A 2WMSA 3OOMA 3VN9A 2AC5A 4H1JA 4C4IA 5H9BA 3PRIA 5CU4A 5C1QB 5HNBA 4QQCA 1WFCA 3NX8A 1JOWB 3KFAA 4RJ8A 2JIIA 4I22A 2R3PA 4W8DA 5E90A 3VW6A 4FKLA 3G15A 3COMA 2UZOA 3E3BX 4EWQA 4FKOA 2BALA 3OROA 3GC8A 3W33A 4HJOA 3QBNA 2R2PA 4FGBA 5AUUA 4RIYB 2XK6A 3I6WA 3UIUA 5HVKA 4FZFB 3LPBA 5EQPA 5HE3A 3EN9A 3MTLA 4UMPA 3H0ZA 2J0MB 5LVLA 4AP7A 5CI6A 3FHRA 4E3CA 4R5YA 3HX4A 5CQWA 2BDJA 4UMTA 4IHPA 2O2UA 5EFQA 4EC8A 2CSNA 4FZ6A 3R8VA 4BCNA 3A4PA 3FZOA 3NIZA 3JPVA 4FKQA 1H8FA 3HV3A 5B2KA 1LP4A 1W82A 2V55A 5JK3A 1H07A 4OTGA 4ZY6A 4HGSA 4WG5A 1K9AA 2WMRA 3RKBA 4FV6A 4Y73A 1NW1A 4K1BA 4S31A 4WD5A 1OMWA 3IS5A 3MI9A 1H25A 2X81A 2RKUA 3FI2A 4QOXA 4J98A 1YVJA 4NM7A 3Q5IA 3PJ8A 2RFDA 4DEAA 4HZSA 3BZ3A 3L1SA 4PL5A 4YP8A 1GIJA 1JQHA 3ORZA 4KUJA 4XYFA 5B7VA 3S1HA 3D83A 3ATSA 2NRYA 4KBKA 2Z7RA 4KWPA 5AV3A 2XCKA 5EW9A 3PZEA 4TNDA 3BI6A 4JBQA 3UOLA 5J1VA 2QOCA 5F94A 3MTFA 2X6EA 3D0EA 5IQDA 1WVWA 2IZRA 2UUEA 2XYNA 4MKCA 5CF8A 5D7VA 4EBVA 2RL5A 4CEGA 3EQGA 3K2LA 4LYNA 4YHFA 5EM6A 3PWDA 1MQBA 3R9HA 4UYAA 2CKPA 4AW2A 3OCBA 3FC2A 4QRCA 3C9WA 4HNFA 4GT3A 4XJ0A 4XOYA 1KE6A 5KX8A 3OXTA 3N4TA 3R7OA 4WOVA 4BWKA 3V5LA 1UU9A 3P5KA 2X1NA 3PVGA 2VTPA 3OCSA 2QOQA 2OXXA 5BX0A 4PMPA 4I4FA 3KXGA 1SNXA 4RQKA 4R8QA 4DLJA 3GUBA 4FV3A 3MESA 4FTRA 3ZYAA 1MRVA 2W4KA 3LLTA 3V6RA 4ZZMA 3H9OA 3F82A 2RIOA 3H0YA 3NLBA 3FMJA 4WIHA 1KV1A 2F49A 3QLGA 4GCJA 1Y6BA 4JRVA 3BIZA 3MFSA 4D4VA 4Y46A 1M2PA 4BDKA 4NKAA 2FUMA 3SHEA 3WZEA 4IVBA 2R0IA 4FBXA 5EOLA 3V8WA 2W1GA 1REKA 1W84A 3IW8A 3EN6A 4R7HA 4NCTC 5AP7A 2P2IA 3ZXTA 3EN7A 3UMWA 4WNOA 3ITZA 4F09A 3ZHPC 3MA6A 4EZ3A 3RJCA 4RIXA 2R9SA 4RZVA 4YO6A 1FMOE 3D7TB 4P90A 2IZSA 4XUFA 3E8CA 5CANA 2B7AA 3QTQA 3FLYA 4DT8A 3ZMMA 3R63A 4WA9A 3KRWA 4XS2A 1GZOA 3H9RA 4QP6A 4XV9A 5LJJA 5F4NA 3Q60A 3PZHA 2V22A 3EFJA 4PL4A 3G6GA 5T68A 5TF9A 1GZNA 3COHA 3TJDA 5M44A 5F95A 3BEGA 4AGUA 2ACXA 1YI3A 3BHHA 2H96A 2QOBA 4C8BA 5LOHA 3E88A 3R30A 4WG3A 5AM6A 4L3JA 3P79A 4JIAA 3W8LA 2YWPA 4IB0A 3KN5A 5CNNA 4RC4A 4ASEA 1OIYA 4ZLOA 1BMKA 2BZHB 4ZOGA 4ASZA 4BB4A 4AGDA 4O96A 5IMEA 2EXCX 5JGDA 1SMHA 3NYNA 3JY9A 5L2SA 4FNYA 3A7JA 3UO4A 1OZ1A 4M67A 2OLCA 3AC1A 4YBJA 3IPHA 1UNGA 3FSFA 4UN0C 3I4BA 1PMEA
chains in the Genus database with same CATH superfamily
3DS6A 2WQMA 3B8QA 1E9HA 1OECA 4S30A 4O6LA 4JDKA 1LEWA 4NM3A 3F7ZA 4YPDA 5EOBA 4C7TA 2CNUA 5DN3A 4ZK5A 3W0SA 5K0KA 3MH0A 2ZB1A 4BCOA 2ONLC 4J52A 3ZH8A 3GCVA 3MIYA 3P5JC 3W0QA 3NNXA 3Q4TA 3BYMA 2YERA 4YZ9A 5F1ZA 3WARA 3W0MA 5LVNA 5CEPA 3TKHA 3G2FA 3ZEWA 4FEQA 3ZO2A 2OJ9A 2BFYA 1KV2A 2O8YA 2BVAA 2GNGA 2VWBA 3CPCA 4GS6A 4O81A 5CT7A 2VWWA 3VW8A 1NXKA 3E5AA 4F65A 3FQHA 5LMKA 3TKIA 3OCGA 2XKFA 5HBHA 1WMKA 1OL1A 4QMSA 3Q3BA 3GQIA 1Q3DA 3BCEA 3NW6A 3F6XA 4KBAA 2J5FA 3FY0A 2GNLA 2VAGA 3R00A 1DI8A 4GW8A 1OUYA 2QOOA 3ZRKA 4L00A 2C0OA 3MVLA 4X2KA 3FXWA 4FTAA 3ZBFA 4DFXE 4ZTMA 2VGPA 3FZ1A 3VS3A 3UG2A 5LQFA 4YLKA 4YJSA 5GZ8A 3SW7A 4Y72A 2OFVA 1H1RA 3R6XA 5DEYA 3UVRA 1JKLA 4G6LA 4F0GA 3WZUA 5A4QA 4FSUA 4H3BA 4MYGA 2NPQA 3SD0A 3PPKA 5HBJA 4UXQA 4FIGA 5HZNA 2CGUA 2XEZA 3BHVA 2WIPA 2FSTX 5JGAA 3FL5A 3KRLA 3DJ6A 3JYAA 4IAKA 4IAIA 4J95A 4JBVA 3UBDA 3RZBA 3B2WA 3FJQE 3UIMA 4RWJA 4EH4A 4B99A 3F88A 2WMTA 3NWWA 3W2QA 4ZLZA 5LVOA 3QD0A 4QYFA 4M97A 4A9RA 3EB0A 4KB8A 3W2SA 5E92A 1YRPA 3DKOA 3FL4A 5KMKA 2BIYA 4MVFA 3HV6A 5AFVA 4USFA 3FMEA 4B4LA 4EOLA 1RJBA 2JLDA 3EN4A 1ZWSA 4RG0A 3RPSA 3OUKA 4E4MA 3BLHA 5CU6A 2QNJA 3OY1A 2PVFA 4R77A 3AD6A 4ZSGA 5DIAA 3RK9A 4QP8A 3JUHA 1H1QA 3NUPA 4JRNA 4BY9E 2VX0A 3UQFA 2XNBA 3KXHA 3MWUA 4XH6A 2OZOA 5IA3A 2QLUA 2OBJA 4PMMA 4RQVA 5FWKK 2GFSA 5TO8A 5AIRA 2O3PA 4S33A 5IISA 1A9UA 5LVMA 4M84A 3GQLA 2F9GA 1JSVA 4LRMA 4MCVA 4YZCA 5M4FA 3Q9YA 5AX9A 1S9JA 3GC7A 4D2VA 3LFFA 3FLWA 4U5JA 2GHLA 3LXKA 1AQ1A 4Y8DA 1ZOHA 2IEWA 3C13A 5AUZA 5FG8A 4BTFA 2OI4X 1J91A 5E8TA 4AOIA 4K11A 4AX8A 4RIYA 2C0TA 3G90X 4OBOA 1X8BA 5CU0A 2YM5A 2FGIA 1LEZA 5E8SA 2JD5A 4F9WA 2W7XA 2PVKA 2QG5A 3ORLA 3DT1A 1R1WA 4FT3A 4U3ZA 3V5TA 5K5NA 4DEDA 4MTAA 3E8EA 4QPMA 5ANEA 5IU2A 4BHNA 5EHOA 2O64A 3O51A 2B9JA 3GGFA 4OTWA 3W55A 2JKOA 4ASXA 5FDXA 4GIIA 4Y83A 2Y4IC 5A6OA 4I5HA 2IPXA 3G51A 4DGOA 4H3PA 2O0UA 4ZJVA 4MAOA 5ETAA 5DA3A 2IZTA 1P4FA 3NNWA 4EUTA 2CNVA 4HNIA 3L8XA 4M3QA 3OOGA 5AUWA 4BKJA 3VS6A 3Q9XA 2WQEA 4PMTA 1ZYLA 2ERKA 2F7EE 2YCFA 3VHKA 5CASA 3QL8A 4Q9SA 3ZDIA 1VEBA 4TWCA 3RWPA 4YGAA 3OT3A 5FQDC 3OWPA 4F70A 4L01A 4LOOA 4YHTA 3NSZA 2QG7A 2Y9QA 4NW6A 3KRXA 3SAYA 3PXQA 2VN9A 3C4CA 3QLFA 3FC1X 3UIXA 5CSVA 2JDOA 3DAEA 5CQUA 3VS2A 4FNZA 5BVWA 5DT4A 1H1SA 4GL9A 3UP7A 1Q97A 5J79A 3AKKA 4WBOA 5CEIA 5C26A 2OO8X 4OW8A 4MQ2A 3V6SA 5LVPA 5CF6A 4XOZA 2VGOA 3KCKA 3FZPA 3CTHA 3OXZA 4CZTA 4QP4A 2IG7A 5BV3A 3ZTXA 4O2ZA 3KXMA 5JRQA 3V5JA 5HIDA 2BAJA 1FINA 2PU8A 4QMWA 2WMAA 4DH3A 3VNTA 2PE1A 3QZHA 2VZ6A 2ZV8A 4CFUA 2JIVA 4FT0A 4H1MA 5JN2A 4ASDA 2W17A 3Q04A 4F99A 4XG4A 5EI8A 2VTLA 3R7GA 5ITAA 3DBFA 4OUCA 4EQCA 4ZZOA 1V1KA 2C4GA 4QPSA 4U80A 5HG9A 5IUHA 4R1YA 2X2LA 3MY1A 4N57A 4X7QA 2ZYBA 3KXXA 4JDJA 1TVOA 4RVKA 2X9EA 1CMKE 3ZZWA 5GINE 2OICA 2UZDA 3U6JA 2CKOA 3JVRA 4ANMA 2IVVA 3PXYA 3LFNA 4FTCA 3SRVB 4ENXA 5CALA 2GNIA 4BCPA 4OTIA 2G2IA 1ZY4A 3K3JA 3LFEA 1B39A 1NVQA 3NRMA 4NM5A 4JAIA 5IH5A 3RNYA 1KE8A 1FGIA 3A99A 3OF0A 5JFSA 2BRHA 3EQPA 4O4FA 3ATTA 4RGJA 4FNXA 4JG8A 1KUTA 5AV2A 3Q53A 2GTMA 3FMHA 3K5UA 2ZM4A 3HDMA 4EQUA 2BDFA 2BRGA 4IZ5A 4WRGA 4CNHA 4I0RA 3ET7A 4F9YA 3S4QA 4FC0A 4QPAA 4JR3A 3K3IA 4WKQA 3POOA 5ETFA 2HWPA 4ALVA 3ZM4A 5A4TA 2G15A 2QO7A 2R3MA 4J8MA 2XNEA 4YC6A 4ACCA 3FQSA 3EJ1A 4LOQA 3RMFA 4EJNA 4FL3A 3HMIA 4I6LA 1JKKA 5E7RA 1QMZA 4DG0E 4BDFA 2UZUE 4LRKA 3ZS5A 4N0SA 5BUIA 3DXQA 3PA3A 5CEKA 3VF8A 1BUHA 4JXFA 2P0CA 5F9EA 3F3ZA 3DDPA 5AJQA 3C0IA 1WBNA 4GU6A 4X2GA 1BYGA 3QU0A 4BDGA 2GQGA 3D5VA 4W4WA 4CSVA 3SXFA 2SRCA 5AUXA 3V5PA 1KSWA 3DBEA 3BGQA 2XJ2A 4FTTA 2I0EA 2QKRA 1XJDA 4BBEA 2HZ0A 5TT7A 3L9LA 4PDSA 5L8LA 3SG9A 2UZVA 5AP2A 3ZDUA 5IF1A 1Y57A 3SOAA 3Q52A 3UOKA 2OWBA 4GT4A 5FXSA 3AG9A 4AW1A 4QMYA 4E6AA 4BI0A 4OTDA 3RAIA 4HVHA 2VRXA 3BU6A 1RE8A 1JNKA 2JBOA 2QURA 3R8PA 4DH1A 3FLQA 4EK4A 2HELA 5C01A 2UW5A 5J5TA 2DUVA 1PXLA 3CTQA 4BIBA 2C5YA 4DT9A 4DEGA 4YUQA 4O7TA 5D10A 4FTKA 3WIKA 4MBIA 3PJ1A 3EQFA 3O8UA 3ZLSA 4E20A 3LVPA 1QPDA 3ORKA 4BYIA 2BZJA 4HZRA 4L8MA 4PWNA 2WZJA 3TUCA 3S95A 3HLLA 4ONAA 4FUYA 2OH0E 2BFXA 2XNNA 2W9ZB 2X0PA 3SXRA 1OUKA 4FSQA 3U87A 4NTSA 2WHBA 1KE5A 4D5HA 3ZLXA 4BF2A 3P4KA 4EHZA 3NVMB 2VTTA 2HYYA 5EH0A 3R8MA 3PXZA 4USEA 4DGMA 5CENA 4I23A 2G9XA 3GFWA 2FO0A 1ZRZA 3SOCA 4JI9A 4ZMEA 1H27A 2WXVA 1KOAA 1OKWA 3AGLA 2O63A 2Z7LA 3H30A 4U42A 4X0MA 4FSTA 4PY1A 5DT3A 3UC4A 4EHVA 5EYCA 3DOGA 3NEWA 2X0OA 3MA3A 4TZRA 1S9IA 4EZ5A 4C4EA 4RWIA 2FSLX 4QDEA 4ZAUA 4KS7A 2ZDTA 2AUHA 3KA0A 3UQGA 3FI8A 1NT2A 3WOWA 3GBZA 4APCA 2F7XE 3QC9A 4BCQA 3LM5A 3OBGA 2LAVA 2WMWA 3PJCA 4DDIA 2BUJA 3FAAA 4IM3A 1NY3A 4G3FA 4KSQA 3M11A 4ZP5A 5EW3A 2XA4A 5FD2A 3PUFC 2WQBA 4AW0A 4MK0A 2QO2A 4KKGA 5HD4A 2X4FA 3LXNA 1M2RA 4FKVA 3BELA 4AOTA 1URCA 2HOGA 3GU7A 4TW9A 5E8ZA 3ORMA 3CS9A 3MVMA 4AAAA 1U46A 4PNKA 4FE2A 2W06A 2X7GA 2XMYA 5M4IA 4U43A 4EOMA 5E8VA 3O96A 2WGJA 3FYJX 5G6VA 2IW9A 4ERWA 4UMRA 3A8XA 3BYUA 5JKGA 1H4LA 3V04A 5DMZA 3U6HA 3KKVA 2A19B 2ERZE 5AR7A 4DA5A 4L45A 3LFBA 3PSCA 4QP2A 4V0GB 3I6UA 2C6IA 2EXEA 2GNHA 2VX3A 3AC5A 1SVEA 4QMPA 4MD8E 4U79A 4C3RA 4C57A 3DA6A 3Q2MA 3F3VA 1OL7A 2BMCA 3HDNA 4C33A 2WIHA 3PTGA 4G9RA 2HW6A 2ZMCA 1JAMA 2ETRA 4O4BB 4X6QC 5C03A 3O17A 3F3WA 4Z7GA 4A06A 1F5QA 3HA8A 3QZGA 4R78A 2R3IA 3IGGA 4O7ZA 3QCXA 3IONA 2QD9A 4DHFA 4FA2A 4RSSA 3HRBA 1IAJA 2C68A 4QTDA 3ENHA 4KD1A 5EYKA 5HHWA 3WBLA 2NYAA 2PZIA 4HYUA 4KS8A 3HP5A 3P86A 4KABA 4GEOA 4O0SA 2XP2A 3W16A 4LG4A 4AT4A 4D55A 3VO3A 2YIXA 4JBPA 2IJMA 5CU2A 3ZSIA 2ZFYA 2PVLA 4A07A 2WB8A 3E8NA 3D5WA 2XIZA 4UWCA 3ULZA 3KQ7A 2E9NA 3UYTA 3DCVA 3NUNA 4DHZA 1ZYJA 1YOJA 1P5EA 1ERKA 1MQ4A 2YN8A 1XBAA 3QHRA 2GS2A 4KRCA 5EM7A 5JT2A 5I3RA 2XIRA 5JFXA 5AM7A 4BDDA 2OFUA 3EFLA 3L8SA 2ITUA 2PVMA 3QTIA 3ALNA 3HMOA 4FIJA 5TE0A 4BIDA 4E1ZA 2B55A 2VO3A 3IOPA 3Q4CA 3MFRA 5JSMA 4CG9A 4K33A 4IWDA 1UWJA 3Q4ZA 3KVXA 4YMJA 2GNJA 4DN5A 2DS1A 3K5VA 2X6DA 1MRYA 3LIJA 4L7FA 2OXYA 4E73A 1KOBA 2AQXA 2P2HA 4F6UA 2JFLA 5AWMA 2J0JA 4FKSA 5IDNA 4GK2A 4IACA 4P5QA 2YAKA 3PP1A 4II5A 4Y5HA 2JAVA 3GI3A 3TIYA 4KRDA 4MXXA 3R7IA 5CAUA 5AP1A 3BL7A 4N6YA 3VUHA 2YCRA 3UGCA 2C6LA 2WMXA 4O84A 1IR3A 4RC2A 4O21A 2C6MA 2XRUA 3TXOA 4WNPA 4LOPA 4IEBA 2Z7SA 4OR5A 4CMOA 4DINA 5GZ9A 1QPCA 3E64A 2ITVA 4IX3A 2JGZA 3SKCA 3C4WA 3EMGA 3QX4A 3AT3A 4FKGA 5EM8A 3TT0A 4MH7A 1G3NA 5ACBC 4KIQA 3OBJA 4QMQA 4M68A 1WBVA 3VUKA 4PTEA 3LMGA 2I1MA 3FI3A 2Y4IB 5GJGA 3SRVA 4C4HA 4EC9A 2VWXA 4WG4A 5AUTA 5CTPA 4GSBA 2W0JA 3FKLA 1RDQE 4ZY4A 4A9UA 3CKWA 4YJTA 1PKGA 3A2CA 2VNWA 2VO7A 3AMAA 4IDVA 3NDMA 3HEGA 4OTPA 3EFKA 2VTHA 4E6DA 5GIPE 2YWVA 5AMNA 4PP7A 4FG7A 3ZUVA 4DFZE 4I94A 5HU9A 3KULB 3DXPA 4NFNA 5FM2A 2HENA 4OTRA 3TNPC 5HG7A 3PSBA 4FOBA 4IM0A 3GENA 3O71A 2J51A 2IVUA 3IG7A 4AE9A 1JVPP 3SGCA 5DT0A 2H6DA 3PG3A 4L6QA 3AOXA 2QOLA 4IX4A 4F4PA 4PX6A 2UW9A 4FZAB 4TYHB 2W9FB 1UVRA 4FTMA 5M57A 4O4DA 4O0TA 3W2RA 4LV8A 3VQHA 4BCIA 4GJ3A 4EOPA 3BPRA 4F7JA 2X7FA 3KK9A 3JVSA 3D2KA 3NW7A 5E8UA 3ACJA 1TQIA 5BNJA 4O7SA 2R3JA 1VR2A 4WHZA 4L53A 5JQ8A 3NUSA 4IB1A 4C02A 3QA0A 3EWHA 5IPJA 3N9XA 3CD3A 4AXEA 5J9YA 1YXVA 1M2QA 4EHEA 3WF6A 3PXFA 5IA0A 1XMMA 3P0MA 2XS0A 3LJ2A 4EKLA 4FJVA 4G16A 4E4XA 3LAUA 4AE6A 4NCTA 5FDPA 4GKHA 2XVDA 1WBWA 2JKKA 4QP7A 4LV5A 3HA6A 4FKJA 4BGQA 4FGRA 3G9LX 4JDHA 3QKMA 1H24A 3UPZA 2YIWA 2CCIA 2YDJA 2YM7A 4AQKA 4CRLA 4O7NA 2Y8OA 3HECA 2VTOA 2KTYA 3FMKA 3D4QA 2W4OA 3ZFXA 4RWLA 4DFBA 3E7VA 4O38A 2PUUA 2IWIA 3QC4A 2GS6A 2WO6A 3OC1A 3QA8A 5DI1A 3EQDA 4H3QA 1DI9A 4IAYA 4GJ2A 3VUGA 4UMUA 4QMLA 5DWRA 1YW2A 4CFXA 3ZZEA 1YXUA 4DEBA 2BRBA 2QHMA 4K2RA 2JIUA 4RA5A 3RPVA 3TACA 4WRSA 2UZTA 3OMVA 1XWSA 3IW4A 5FEDA 4EHGA 3U9CA 5IQCA 5E8YA 2WMUA 3KXZA 4N6ZA 4I20A 4RBLA 3VS4A 4DHJA 5DG5A 4XRJA 2UZBA 3F2NA 3EZVA 1UWHA 3CR0A 5CS6A 4QQJA 4IBMA 3W2CA 2HK5A 4QYYA 5IG1A 3TUBA 1UU8A 3NFFB 1OBGA 4CKRA 2GHGA 4V01A 3C5IA 4RRVA 3TUDA 3FZRA 3MH2A 4FVRA 2PK9A 5JMSA 2Y6MA 3FUPA 3S3IA 3V5QA 4G9CA 3C4EA 1Q3WA 3PVWA 2REIA 2C3KA 1SYKA 3LCSA 4X2NA 4PPAA 4AN3A 1YXTA 1SZMA 2EB2A 3MGYA 4FV8A 4NJ3A 5BMMA 4AZTA 3UNKA 2BTRA 2ZV7A 2ONLA 1EH4A 2OU7A 3UPXA 4AXFA 2UVZA 5BQ0A 1PXJA 1YDRE 3Q32A 2FSOX 3LJ1A 3R8ZA 2I40A 3N51A 5DR6A 3D5XA 4DGNA 2YIRA 3QGWA 3KC3A 5G1XA 3DPKA 4KBCA 4AZFA 5HLPA 1XR1A 2OSCA 4G6NA 3SA0A 1Y8GA 1WBTA 3NNVA 4MXZA 4EH6A 3IW6A 3V8TA 2PE2A 2XKEA 1YI6A 3QUEA 4WBBB 5IQEA 4QP3A 4EYJA 1PW2A 2QHNA 3TV4A 4JIKA 3OW4A 4Z16A 4G3GA 4HYIA 3CQWA 4DYMA 4BKYA 2OJJA 4NT4A 4WSYA 3RI1A 4C35A 2ZM3A 3VUDA 1NVRA 3QRUA 4GUBA 3PXRA 3R1QA 1CKIA 3O8PA 3R1YA 2G2FA 4IWPA 3TZ9A 3QUDA 2FVDA 4V0GA 4DITA 3GVUA 3R9DA 3TZMA 3QAME 1P2AA 3ZUTA 4CCBA 3HZTA 4XP2A 4C4FA 4YBKA 2DQ7X 1I09A 3TCPA 4BDHA 1OIQA 1GIHA 3II5A 5HX8A 3IW5A 2PZ5A 3U4WA 3O2MA 2C6KA 3QTWA 3AC3A 4CFWA 4EH5A 4PNIA 4QYHA 5C8KA 4ZTLA 5EHLA 3MH3A 4W4YA 4F6SA 1ST4A 4GVAA 2XAMA 4FOCA 3BKBA 2X8IA 3HKOA 5CSXA 3F66A 3PYYA 5ETIA 4FSWA 5I9YA 3EKKA 3G0FA 2PMIA 4CV9A 4N4SA 5AR4A 4QNYA 4AN9A 3CJFA 3IECA 5C4KA 3FHIA 4TXCA 1Q62A 4D0XA 3C51A 4OT6A 4TYGA 3H9FA 3KXNA 5EHYA 1KE7A 4DGLC 4PTCA 5HLWA 3F2RA 4F78A 3QZFA 3I79A 4RFYA 3UC3A 4NKSA 3ZCLA 4O86A 3HAMA 4ITIA 2UW8A 3OXIA 4RC3A 4AZVA 4XP3A 2CJMA 4E5AX 3LMIA 1JKTA 3PIXA 2VNYA 4R3RA 5AIKA 2JEDA 2BKKA 1OPJA 5EQYA 4UB7A 5TKDA 4QDVA 4AN2A 1G5SA 5E1EA 4BGGA 3CJGA 2VTAA 2UVXA 1F3MC 1YDTE 2W5AA 4I6HA 4M12A 4HW7A 3MN3A 5A4EA 5JFVA 5FBOA 3ZC5A 2PL0A 3UP2A 2UVYA 2XJ1A 2OJIA 3FLNC 3AMYA 1GNGA 4I6QA 4YNEA 5HNGA 3NAYA 4FF8A 3ZLYA 4BZDA 3M2WA 3BHTA 4QTEA 5IEYA 5BYLA 1JLUE 2Z8CA 4FV1A 2QO9A 3FXZA 4EWHA 1NA7A 2BZIB 3U8WA 3T9TA 4ZLYA 4TYIA 1J7UA 1PXIA 3CPBA 3HGKA 4EYMA 4O7VA 4IJPA 1Q4LA 1VLRA 3R71A 1XH4A 2CN8A 3KMUA 2R5TA 1P14A 2WKMA 4J71A 2BRMA 5KMLA 2PMOX 1YHSA 3RAHA 5D11A 4LV7A 4QTAA 4DHIB 4KAOA 3HRCA 3QQFA 5DRDA 5C8MA 2C1AA 4EL9A 1IG1A 2YABA 3JR1A 1M7NA 4X2JA 3MJ2A 2WU7A 4FSMA 4BC6A 4W9XA 4RX9A 3L9MA 4EOSA 5HICA 2GSFA 3IW7A 4IQ6A 4QMTA 4DGGA 1W8CA 4CG8A 5J1WA 3NCZA 2VTSA 4CYJA 4XBRA 2XAOA 3PLAE 4O22A 3E93A 3G9NA 4RJ5A 2PWLA 3R9OA 4AS0A 1FVVA 5CSHA 2BILB 4TL0A 5HE2A 4IWOA 5HG5A 4GFGA 2XK4A 4K0YA 4O0VA 5DR2A 1W2DA 2XRWA 5CVHA 3JS2A 5M07A 3RP9A 3ODZX 3BWJA 3KULA 2DWBA 2VWUA 3P7CA 1GJOA 1H0WA 2ITZA 3BBWA 2OKRA 3I0OA 1FOTA 3QXOA 4TYJA 4DFLA 3MB7A 3W0RA 4ALWA 1U59A 1XQZA 3KK8A 4FIFA 5HIBA 4TNBA 4HCTA 3RM6A 2WQOA 1V0PA 2YIYA 5I9ZA 4G3CA 2Z60A 4D4YA 2Y7JA 3KL8A 4FVPA 2YM4A 3BX5A 3ORNA 4QD6A 2XH5A 2EWAA 1ZMUA 4FV4A 4IVDA 4TYHA 2HAKA 3LOKA 4GG5A 4JL9A 1OPLA 4EH2A 3PRFA 5KE0A 1QCFA 4FI1A 1YKRA 2ESMA 3F61A 3ZOSA 2HY0A 2GTNA 3NW5A 3VULA 5HBEA 1L3RE 4V04A 2FB8A 1GIIA 2ITTA 3FZSA 4L68A 5EDPA 4YLLA 4BL1A 2I7QA 1TQMA 4G34A 3QD2B 5K4IA 4DAWA 3NGAA 2R3OA 4WO5A 3D9VA 5KHWA 3CSVA 4CFMA 4EK6A 4NUSA 3I60A 1ZAOA 2XB7A 3ORIA 4EH9A 4D9UA 2UZEA 2V7OA 5HTCA 3CIKA 4FEUA 1MRUA 4PV0A 3WE4A 5EG3A 4D28A 5A54A 4EEVA 2B53A 3ZO4A 3OT8A 4DTBA 2WTJA 3VHEA 5JQ5A 3LZBA 4FMQA 2A4LA 5AR3A 5FBNC 1O6YA 5EI6A 2XM9A 4QMOA 4ANBA 3C4ZA 2ZOQA 4ITHA 1OB3A 1U54B 3MPAA 5HO6A 2ZAZA 5BVNA 2FYSA 1W83A 1FPUA 2WMQA 3C50A 3ANRA 3OW3A 4FSNA 4IH8A 5CU3A 4ZMFA 3R02A 4GK4A 1XBCA 3IO7A 4DBNA 3QQJA 3GP0A 3KGAA 4JLCA 4QMMA 5AAGA 4ZS0A 3TZ8A 3THBA 3AGMA 1BL6A 5A14A 4IZ7A 3MJ1A 4AZWA 1PY5A 3VQUA 1M52A 1Q61A 1ZARA 2Y0AA 2ZV2A 3LCDA 2WU6A 3LFAA 3MFUA 4AW5A 4YTCA 3QTRA 3C4FA 2X2MA 1IAHA 1BLXA 3P1AA 4AU8A 1ZZ2A 3QKLA 3IK3A 3QGYA 3VS7A 5HEZA 2W99B 3ZSGA 3G5DA 4NSTA 4YC8A 5JRSA 2F7ZE 3RK7A 2OIDA 3VS5A 1Y91A 5J95A 3QCQA 1CKPA 3GCUA 3KN6A 5DE2A 3SG8A 3BQRA 4FSYA 1OPKA 2WOTA 4U9AA 4KIPA 4X21A 2GQRA 3HAVA 2H9VA 4JNWA 4KNBA 1ND4A 4FG9A 5AP3A 5BUEA 1ZYSA 4ZTSA 5IQGA 1W2CA 3BE2A 3ERKA 3GU6A 4OTQA 4OLIA 3EHAA 4IE9A 3KB7A 2VTRA 4NH1A 3V8SA 4ZSAA 3NUXA 4L3PA 1V0BA 4O0UA 4NYEA 4JX7A 4X3JA 2CDZA 3DLZA 1YI4A 4HPTE 3OWJA 4BBFA 4QYEA 1R0PA 4NTTA 3D7TA 4UWYA 1ZYDA 3F7WA 3E7OA 3R9RA 3UE4A 4UZDA 3TV7A 5DYJA 2W1ZA 4HVGA 5E4HA 3E92A 2QQ7A 4O83A 4LI5A 3WZDA 3VAPA 4FEXA 2RGPA 2PZPA 4FYOA 3PIYA 4DH5A 1JSTA 2YLEA 2P55A 3R8UA 4B8MA 4R7BA 3JXWA 4IZAA 5FEQA 5HD7A 5AV4A 2F2CB 2A0CX 3F5PA 3GU5A 3Q6WA 3TDVA 4YJPA 5H8EA 5J5SA 5CSWA 1STCE 4OTFA 3AC2A 4D5KA 4UV0A 5KMOA 3AKLA 4F7SA 4XLIA 4HVDA 2I6LA 4KSPA 5CLPA 2V0DA 5C4LA 4GVJA 2C5XA 5HCXA 1WBSA 2GMXA 2P4IA 3F69A 4GYIA 3C7QA 4PPBA 4ZZNA 3DQWA 1H0VA 1XH8A 2OZAB 2OJFE 2QR7A 3VWAA 3GEQA 3NPCA 5A9UA 3OZ6A 2G2HA 2HCKA 3SX9A 1LR4A 4AG8A 3LFSA 3W2PA 4E4NA 4F6WA 5AAEA 5I4NA 1WZYA 4ZSLA 2FA2A 4JMQA 3MY0A 4L44A 3NYOA 4WUAA 3P78A 3GU8A 4ZXTA 4DDGA 1V0OA 3UG1A 2X8DA 4R3CA 4F7LA 4DTKA 4ACDA 3NYVA 1AD5A 1SVGA 3DBDA 4RVLA 3W0PA 1H26A 4UX9A 4FSRA 5HX6A 1U5QA 2C3JA 3ETAA 4TY1A 4JG6A 2YLFA 3HMPA 5HG8A 4CXAA 2X0QA 1O9UA 3A8WA 5ETCA 3DTCA 3F5XA 4M0YA 2H34A 5AADA 1QPEA 3CEKA 5LCKA 3I7CA 2X4ZA 3TNIA 2V7AA 1XH5A 2ZJWA 5D7AA 4FRFA 3HYHA 1XHAA 1ST0A 2I0YA 2OG8A 4JBOA 2XKCA 3R1SA 5IQHA 4C4GA 4FTJA 1UA2A 2OXDA 2PPQA 4FTOA 5L6OA 3DJ7A 4HCVA 4M14A 4L3LA 4YJRA 1WBPA 4GK3A 4O4EA 3VBQA 4C61A 4Q5HA 3RINA 4MNEB 5J87A 2C3IB 4ERKA 1R39A 3EQCA 3BLAA 3WF7A 3PY0A 3FKOA 4G6OA 4C36A 2BAKA 3WF8A 2UW4A 2ZM1A 3CD8A 2PZYA 4RX7A 5AR2A 2E9PA 1QPJA 2GHMA 3F2AA 2YIQA 4ZTQA 5LWMA 1LUFA 2UW6A 1FVRA 2W4JA 2QCSA 3V51A 4K6ZA 4QMVA 3DDQA 4R3PA 3UMXA 2YZLA 4TPTA 3PY1A 4EOJA 4EUUA 4EOIA 4CLIA 5LMAA 1W98A 5CZHA 2FH9A 3OHTA 4ACGA 1G8AA 3QRKA 1ZY5A 4A4LA 2KULA 4DG2E 1ZMWA 2V5QA 5JZJA 2YFXA 3HP2A 2AC3A 2OIBA 5CAPA 3W0OA 3LM0A 3VS0A 2BRNA 4IX5A 3C5UA 5L2TA 2QLQA 3L9NA 2J4ZA 4D1SA 2UZLA 1JKSA 4W9WA 4C3FA 4WT6A 4YJUA 3NIEA 3OY3A 4C58A 4TRLA 1RW8A 3UTOA 3LXLA 3KVWA 3QQGA 4TWNA 2R3LA 1OKVA 4RFMA 3BGZA 4RIOA 4YR8A 1J3HA 3QXPA 4L43A 2XIXA 5IQFA 5E8WA 2J9MA 5GIOE 2YISA 2WPAA 3OG7A 2EVAA 5I9VA 4IAAA 3NR9A 4BVUA 3OWLA 4R6VA 1HCKA 4BZOA 4D2TA 5EDQA 3QQLA 3VJOA 4L67A 2BKZA 4XG9A 4YSMA 3RM7A 4JQ8A 3NVKI 1OL6A 1H28A 2R3RA 3AT4A 4QQ5A 3QCYA 4I6FA 1XH7A 3QD3A 4MWHA 3TYKA