4XX9A

Crystal structure of pdk1 in complex with atp and the pif-pocket ligand rf4
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
289
structure length
288
Chain Sequence
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Small-Molecule Allosteric Modulators of the Protein Kinase PDK1 from Structure-Based Docking.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xx9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xx9A01
4PTEA 4I0TA 1ZYCA 3DKCA 3M1SA 4FODA 4UB7A 3WE4A 5IUGA 2FO0A 5EK7A 4CG8A 4ZZNA 4YJNA 3KREA 2WMTA 5HVYA 1M17A 4FT7A 3PVUA 4K9YA 2A0CX 2VTIA 4FZ7A 4S2ZA 3BKBA 4ORKA 2XNOA 1XH4A 3OZ6A 2YAAA 4L8MA 1YXXA 5I0BA 1PYXA 5BVEA 4EKLA 4AFEA 3OBJA 4L6QA 5AAEA 4JG8A 3DK6A 1OGUA 5M09A 3QD0A 4K6ZA 3JYAA 3JVSA 3G0FA 4KKGA 3BYSA 4QT1A 1FQ1B 4RLLA 1PXMA 5L6WL 3WARA 4AZSA 3MTFA 5JFVA 4EQUA 4AAAA 5BUEA 3WOWA 1JKLA 2R0UA 2Y7JA 3UO6A 2BHHA 4FT9A 2ZM1A 4I6HA 5E8SA 4DINA 4L53A 1Q3WA 2ETRA 3NAYA 4OTQA 4AFJA 5DYJA 2PHKA 4TTHB 3ZUVA 2OXYA 4YJQA 4ASDA 3S2PA 3DXPA 3D0EA 4XP2A 2O65A 5ANJA 5LMKC 3RAKA 3HMPA 4TYEA 3L9NA 1O6KA 5FBOA 3ZDUA 5EDRA 4ACCA 5JT2A 5IEYA 3WZKA 3HZTA 5LCKA 4DH5A 3KRWA 4BHZA 4U45A 3D2KA 4GT4A 4V0GB 3UP7A 4ZK5A 4EK8A 4BYIA 4ZEGA 1ZMUA 4BB4A 1UKIA 5JK3A 5FEEA 4GK4A 5TKDA 5KMLA 1LUFA 2UVZA 4AS0A 1UWHA 3COHA 1REJA 3QWKA 2HZNA 2GHGA 3MDYA 5A4EA 2X8EA 4BFMA 3PSDA 1NW1A 2XNEA 5EHOA 5IPJA 1ZXEA 3A4PA 3GP0A 4AZEA 4JDIA 4IDTA 4BN1A 2VWXA 4YGAA 2RFDA 2Z7QA 3EOCA 4AA5A 4CFNA 4FSYA 3AT2A 3L9PA 4IC8A 5JRSA 3F2RA 3AD4A 3KXZA 3WE8A 4G3CA 1YHWA 2YACA 4TNDA 4ALWA 5HTIA 2OIBA 3I7CA 3PPKA 3UQGA 3SKCA 4AU8A 4O7WA 4M68A 4MBIA 4IZYA 4RC3A 3ETAA 3DKGA 3MFUA 3QUPA 4WKQA 3E64A 2X81A 3S4QA 2A4LA 3CS9A 4II5A 4FT3A 4GT5A 2HY81 4D2TA 3FE3A 4FK3A 2OF4A 4S32A 5J5SA 4ZTHA 4OGRA 4FTJA 3V01A 2ZOQA 4R5SA 2WOUA 4TRLA 3QTIA 3AC3A 4O2ZA 5EHYA 2QOBA 4DTBA 5FEQA 5K0XA 3ZONA 2J9MA 3MJ1A 4YSJA 3WBLA 5CI7A 1A06A 3HX4A 4O0UA 3EMGA 3GU6A 3Q9WA 3LLAA 4EK4A 3R02A 3PIXA 1G5SA 2WMAA 1WBWA 4CZTA 1U46A 2CGXA 4IZAA 3IGOA 3PLAE 4H1MA 3P23A 4RJ6A 4PL3A 2IJMA 1FGIA 3OROA 4QP1A 5HG9A 5M4IA 3FMNA 2JDSA 2PVJA 2ITZA 2WMVA 4PP9A 3UIBA 1WVYA 3TV7A 4H3QA 5LOHA 3QCYA 3A8XA 1BX6A 1FMOE 1ERKA 3P78A 4KAOA 4M69B 4RZVA 3TCPA 4BKZA 4NYEA 5TE0A 4O0XA 3RZBA 3R71A 4WBOA 3ZSHA 3DU8A 5FM3A 2UZUE 5DE2A 4C4GA 5IDNA 4DFBA 4EONA 4EUTA 2WTIA 2XJ2A 4HGTA 2X6DA 2V62A 4MTAA 3IG7A 4WD5A 3FI8A 1BKXA 2QC6A 3SC1A 4JT3A 3QAME 3HMOA 4FEWA 1CSNA 3D4QA 4X6RA 1JSUA 3EIDA 1YOMA 2QONA 2UW8A 4CT1A 1YXTA 3THBA 3TIYA 4HVIA 5DI1A 3IW5A 5KMMA 4ZZOA 3LMHA 3MESA 3FQHA 5AEPA 2C4GA 2C6TA 4G2FA 3Q4UA 3DAEA 4RPVA 2R3OA 2EXEA 4D55A 5EOBA 3C51A 4U6RA 2WTWA 3RJCA 4RJ4A 2W06A 1WFCA 4LGHA 1H1QA 2DQ7X 4XNEA 3PPZA 3PXYA 4TNBA 3C5UA 1G3NA 5HNIX 5HU3A 2OICA 4QTEA 4X3FB 3NNXA 3PSBA 4I3ZA 2XEZA 3JXWA 5I3RA 4BTFA 1Q5KA 2EB2A 4FTKA 3E5AA 1W8CA 5EHLA 4CZYB 3B8QA 3KCFA 1DS5A 3ZRMA 1Q61A 4DE4A 4L00A 2VX0A 4O7NA 2YM8A 2XK7A 3DDQA 4BDFA 2ONLC 3AXWA 3V3VA 3R9NA 4A9TA 5DBXA 3R9DA 5CU3A 2BRHA 5FUTA 4U79A 2WMUA 1E9HA 2JFMA 4I5HA 1ZLTA 3DB8A 2Z7LA 4OTFA 4GRBA 4EL9A 1YDSE 1KUTA 3LMIA 4NM3A 4MVFA 4IM0A 2QG7A 2YM4A 3TV4A 2CNUA 4FV5A 4C59A 4DCEA 3CJGA 4E6DA 2CDZA 3RNIA 3VUIA 1I09A 2ZMDA 4EK5A 3LCTA 4IVDA 2EVAA 5CLPA 4R78A 4EK3A 3BQRA 4TWPA 1M14A 4FIJA 3DJ7A 2UZVA 2CGWA 4MX9A 3RK9A 2XCHA 3U8WA 5I5ZA 5AP5A 2BKKA 5HX8A 2ETKA 5F4NA 3MB6A 3UVRA 4F7SA 2OW3A 3BHVA 3NRMA 4BDHA 3Q04A 3FEGA 3NUXA 4EH7A 3NLBA 3U6JA 1MQBA 1YI4A 1AGWA 3OP5A 5TOZA 1R39A 4F0GA 4W4WA 3VUDA 3VVHA 3BYOA 2RFNA 4CKRA 2CKOA 3MH0A 3W8QA 1P2AA 4O7YA 3O96A 3OFMA 4LL0A 2RG6A 4UWCA 3FMJA 4DITA 4ANMA 4B8MA 2WTCA 3DV3A 3GCVA 2J0MB 3O71A 4M0ZA 2XNGA 3KXHA 1URCA 3R28A 4FSRA 2JDTA 3OC1A 3MJ2A 1RE8A 4HNIA 2YJRA 4BKJA 4FSNA 4M67A 3PE1A 3AD5A 3U9CA 1Q8YA 2QOKA 3LCDA 3PA5A 4BGHA 1H1RA 1KE5A 4OW8A 2YZAA 4W4YA 1LR4A 3EHAA 5DFPA 4U3YA 2PL0A 3VQUA 4AW2A 3L8VA 3RPVA 4I21A 4DEDA 3NW5A 5CZHA 2F7XE 2O0UA 2FB8A 4BF2A 3DXNA 4TWOA 4RX5A 4BTJA 3IDPA 1KE7A 1H00A 5DA3A 1H28A 4KINA 2IO6A 4B99A 4YHJA 2ZV7A 2OKRA 3H0ZA 4FEXA 3C4EA 5BVDA 3TM0A 3TZ8A 2ZAZA 3A7HA 2W05A 4K11A 4KBAA 4JDHA 4JQ7A 4FG7A 2ITTA 3DY7A 4FK6A 4LV8A 4Y72A 5FBNC 4M12A 2X1NA 1NXKA 3GOKA 4AT3A 2XNNA 1ND4A 3NW7A 4TT7A 4PL4A 5DN3A 4KB8A 3UOJA 2R3LA 1CM8A 3LQ3A 4FTIA 1PW2A 2GPHA 4O82A 3NX8A 2IPXA 3JUHA 4IWDA 3VUKA 3FLQA 2UW5A 4J52A 4MQ2A 4DG3E 4AZFA 2HAKA 1JLUE 2UVXA 4GUEA 2VTTA 4YHFA 4BCIA 5JFWA 3RPYA 3PWYA 4M3QA 3ROYA 5HBEA 2PPQA 5C1QB 2XS0A 2ZYBA 3BELA 4GU9A 4CQEA 5HG5A 4U43A 5DT3A 4ZSJA 4O0RA 3EN6A 4BCKA 3LM5A 3NZ0A 3QFVA 3ZRLA 5BYYA 3NVMB 5L3AA 4JJRA 4ACDA 4MD7E 4TWCA 3TZ7A 4CRSA 3DB6A 2DUVA 3KKVA 4FSWA 2PMIA 2VWYA 4RFMA 4F7LA 3R8ZA 3BBTB 2PMLX 4C57A 5GIOE 4ZS4A 4IWOA 3PWDA 4ASXA 3EYGA 3D5UA 3IO7A 4GVAA 4MD8E 5FLFA 4E3CA 4TL0A 4L7SA 2CMWA 3OUKA 4H3BA 4M0YA 4KBKA 3ZTXA 5LVPA 4G1WA 1VR2A 3JY0A 5DEWA 2V0DA 1LPUA 4K8AA 3EFWA 3I0OA 3OEZA 3W2OA 4BWPA 4BDBA 3OOGA 4MEDA 4HGSA 3MV5A 4LOQA 3SRVB 3WIKA 5JSMA 4AZVA 5ANEA 2R4BA 4QPAA 4JBQA 4Q5HA 4B0GA 4FIIA 3NIEA 2W1ZA 5AM6A 4F09A 4OAUC 5I4NA 3VUTA 3LIJA 2BDWA 5LWMA 2YWPA 4DEAA 4PDOA 5ANOA 3A99A 2YM6A 4EOOA 3CBLA 3BHHA 2X2LA 3PY0A 5EW3A 1BMKA 1U4DA 3OCBA 5IA0A 2AC3A 4AACA 2Y4IB 4EHGA 1TQPA 2BDFA 3P0MA 3P7BA 2JC6A 4HGEA 4XMOA 4CMOA 2J5FA 3LPBA 4FX3A 5AX9A 5J8IA 5LVLA 4EH8A 1P14A 2HCKA 5IKWA 4XG3A 2P4IA 3FKLA 2PVFA 4M66A 1WVWA 1X8BA 3QGYA 3VBWA 3LW0A 4XG9A 4QNYA 3PXRA 2UZWE 5BMSA 4FYOA 4PTCA 5LWNA 1J7IA 5JEBA 3ORNA 2GNFA 2O3PA 3F69A 3WIGA 4GG7A 2VU3A 1FGKA 2YLFA 2YISA 1PXNA 3BWJA 3VJNA 3UZPA 3QRJA 1WVXA 1XH5A 4I4FA 4YHTA 2X2KA 3SG9A 4FUXA 3LFAA 4RIYA 4BTKA 5HKMA 4QNAA 2W1GA 3WZJA 5I9UA 3ZXTA 3TTIA 2VRXA 2LAVA 3OY3A 3I4BA 4DG0E 1FINA 5H9BA 2PU8A 5TR6A 4B8LA 3LMGA 2G2IA 2BMCA 2XK8A 3BE9A 2QKWB 3R8MA 2XCKA 3MSSA 2QOIA 4DGMA 5L2IA 2CCIA 3HMNA 2YDIA 2W5BA 2R64A 4BCGA 4FSTA 4WG5A 1Y57A 3ZO1A 2BFYA 4N0SA 3Q5ZA 3RINA 4QP3A 2YHVA 2GMXA 4FT0A 4V0GA 3QQLA 1H07A 4MXZA 4W9WA 5BVWA 5A4TA 2ITWA 5EI8A 4ZTMA 2OH0E 2CKQA 2B54A 1Q3DA 2XM8A 3DTWA 3P86A 1Q97A 3FPMA 4MQ1A 2PZYA 3UP2A 4L45A 3R7OA 4EH4A 4E6QA 4QQCA 3VRZA 4LYNA 2UZNA 5A6NA 4OBQA 5JFXA 2W4KA 5ETFA 4F1TA 5A6OA 3NGAA 4FSQA 4GK3A 2GQGA 3FV8A 5JGBA 3AGMA 4FV2A 4JQEA 4U5JA 2WMWA 4RQKA 3I60A 3SLSA 1YHVA 2XM9A 4RA4A 4RWIA 4AT5A 4ZLYA 4USEA 1PMUA 5H8GA 4CNHA 5HQ0A 4ASEA 4GJ2A 3VHKA 5HOAA 1KE6A 3FXWA 4IXPA 4IBMA 3QRUA 3JVRA 4I6FA 4R1YA 2QG5A 2PE0A 1LEWA 3CPBA 3CQWA 3RALA 2WMBA 3LLTA 1A9UA 1Y8GA 2X0GA 1P4FA 3PJCA 4PPBA 5DT4A 5LARA 5AUTA 4I41A 4ANSA 4F63A 1FVTA 3I1AA 4WT6A 5M57A 4GJ3A 1XQZA 5AR3A 3V8TA 2IWIA 3BZ3A 4K1BA 4CEGA 3QKLA 4L52A 2I0HA 1VJYA 4NEUA 3B2TA 4FL1A 3FKNA 4QQ5A 3I6UA 2XJ0A 3F3WA 3GXLA 4S30A 2GS2A 3AD6A 2X6EA 3R7GA 2QLUA 5KMOA 1JWHA 1R0EA 2J90A 2WD1A 5A3XA 1WBOA 4FI1A 4DEBA 4FTMA 4E6AA 3LAUA 4YNEA 2R3IA 3E62A 3A2CA 3F9NA 5DG5A 2WZJA 3FSKA 1H27A 1Z9XA 2C69A 3KN5A 2R3NA 2YJSA 3KK8A 3PUPA 4FKLA 4FV6A 5LVOA 3DKOA 3HA6A 5HIDA 3SXRA 4TZRA 3EJ1A 3QHRA 4FIEA 5ANKA 4XH6A 3MH1A 5KZIA 3C5IA 4GMYA 3QTRA 1XBCA 1H4LA 2ITQA 2ZB1A 3COKA 3MY5A 4B7TA 2C6EA 3MTLA 2Q83A 1H24A 2WB8A 5AP3A 5HTBA 4M69A 4HPTE 4UYAA 4KSQA 5C4LA 4G6LA 1ZY4A 3C9WA 1REKA 3R83A 4BR3A 2OJFE 3SD0A 1QMZA 2W1CA 4F7NA 1Q62A 3DNEA 4E5WA 2B0QA 2PTKA 4BBEA 2KTYA 1UA2A 5E8UA 5E1SA 2C1AA 4IQ6A 1RW8A 4L7FA 1URWA 4F6WA 2XK3A 3GC0A 4DEGA 3GFWA 1BL6A 4F7JA 3FQEA 5C8NA 4RZWA 2FSOX 1TKIA 3MB7A 4IANA 2R3JA 1FVRA 4AA0A 4C4IA 3LHJA 4HPUE 4QP7A 2R9SA 4CLIA 4PMSA 3OMVA 1J3HA 1Z5MA 3U9NA 5F94A 4QOXA 3PP1A 2WEIA 1TQMA 4CGAA 5AA9A 1J7LA 4DBXA 5AA8A 5GHVA 4C4FA 1ZOEA 3U4UA 3BYVA 3SQQA 4X2GA 3BHTA 3UOKA 1HCKA 4EOKA 4PNKA 3B2WA 3ZO4A 5HZNA 4O7RA 4MK0A 3Q2MA 4D9UA 4Z16A 2I6LA 4FVQA 3GCSA 4EQMA 2A1AB 4O96A 5KHWA 4O0TA 4RWLA 1R1WA 3OUNB 2YAKA 1WMKA 1M2PA 2WPAA 4DH3A 2CPKE 5LVNA 4IX6A 5CVFA 4FTAA 1RQQA 4KNBA 4P5QA 1OL1A 4TWNA 3GCPA 3ORPA 1P4OA 2HK5A 3SOCA 3AMYA 2OLCA 4O6EA 3FMHA 4CFMA 3RP9A 2VO7A 3SG8A 2OIQA 4KS8A 2BUJA 3H10A 2GCDA 4FG8A 3BGPA 4NKAA 4QMLA 4YZNA 4LG4A 4XV9A 2QQ7A 4APCA 4BVUA 3W2QA 5CQUA 5E90A 1UU3A 3VS1A 5CWZA 3S95A 4IW0A 4RJ8A 4AW0A 5AR5A 4HZSA 3T3UA 2CGUA 3E93A 3SVVA 3ORLA 1DI9A 3KEXA 4FKOA 5DRDA 4TYHA 4BIDA 4C02A 1OBGA 5LMKA 2P55A 4BICA 3DAJA 4R3CA 4ANBA 4UALA 4CYIA 2I0EA 3AQVA 5ETIA 4O0WA 5FXRA 4ZZMA 3H3CA 4G6OA 2XKFA 4DGGA 4GCJA 4ZMEA 4NM5A 5AP1A 2QR7A 4FV3A 3KVWA 4PUZA 2HWPA 2ITXA 4O1OA 4RC4A 5HG8A 5KUPA 2YZLA 4TY1A 3MVHA 4DBNA 4RX9A 3UVPA 3LE6A 3FWQA 4JLCA 2YCFA 5L4QA 4M7IA 5M44A 1UNHA 3CP9A 1W7HA 1Y6BA 2JDRA 5FTOA 1XBBA 4AGWA 3FMDA 4KIKB 2VTPA 4L42A 3LJ2A 3ZFXA 2C6KA 4ZOGA 3D7TA 2IZSA 3GBZA 4BY9E 1AD5A 3ODYX 4Z55A 3GCUA 2NPQA 3KF7A 4PDSA 1MRUA 3UGCA 5L6OA 2J4ZA 5HHWA 2VGOA 2JKKA 4OTIA 1CKJA 4HVSA 2X8IA 4TYGA 4AZTA 2WFYA 3QTWA 5HLNA 3FXXA 5J9LA 4D5HA 2A27A 4G6NA 5IQGA 3PDTA 1KV2A 4IVBA 3T9TA 3FDNA 3E63A 2VGPA 4GH2A 5F20A 4XOZA 2O63A 3NYXA 2OBJA 4OTRA 4X21A 4NH1A 2DS1A 4GUBA 1GZKA 4GIIA 4IZ7A 4X2KA 5BPYA 3W32A 5CQWA 5IA4A 2PUUA 4CQGA 2W9ZB 1PKGA 4XLVA 4DGLC 3LFNA 1JNKA 3AC1A 3Q5IA 4X3FC 4H39A 1V0OA 4Q2AA 5E92A 1VYZA 2G1TA 4R77A 5KMNA 3HUBA 4IIRA 4TXCA 3DZQA 2Y0AA 2J2IB 3DBCA 3NNUA 4BBFA 1M52A 4XJ0A 2JKQA 4K33A 3MIYA 3F82A 3ORTA 4BI0A 4BCOA 3LOKA 4WRSA 3NUYA 4G3FA 3MY0A 5L2QA 1YXUA 3FLSA 3WZDA 3VBQA 4AW1A 4QP9A 2UUEA 2F57A 4C3PA 5CU2A 4IMYA 2J51A 4NJ3A 4BI2A 1GIJA 3GENA 3VS2A 3KRRA 1T46A 3QD2B 3QZFA 3R21A 5M55A 3E92A 2R0IA 1MQ4A 3LXLA 4G9CA 2BIKB 3VWAA 3S1HA 1F5QA 4NCTC 1PHKA 3OWPA 5B0XA 1SVEA 1YWRA 4Y8DA 2RGPA 2XUUA 3ZSIA 3U4WA 3BGZA 4JRNA 2DYLA 2R3QA 4GU6A 4YJRA 2C6DA 3V51A 3TL8A 3SDJA 3UDBA 4YTFA 4DH8A 1YXVA 4I94A 4A07A 4LM5A 4LRJA 3FUPA 1YDRE 1OKZA 3NUNA 3QWJA 4FVPA 5AUUA 4GS6A 3VUGA 2XK4A 4FTLA 3ZO2A 2J0IA 3BIZA 3Q60A 1ZYSA 4EH5A 4G5JA 4U44A 1APME 4W9XA 3V5PA 4EOMA 2W96B 4ACMA 4XX9A 5T68A 3R9HA 2PUPA 4U7ZA 5C4KA 2UZOA 2OJ9A 5C26A 3NPCA 4RG0A 3TNHA 2A2AA 2ESMA 4QYEA 2YDJA 3NUSA 4OBPA 5CI6A 3R6XA 2VO0A 5IA5A 2E9VA 1JKTA 1JVPP 4MXCA 4YJUA 2FUMA 4BDCA 4E4NA 3OWKA 4M8TA 3QRTA 5CEIA 3FLNC 2F2UA 2ONLA 4D9TA 4JIKA 4F9AA 1YVJA 5AUVA 5CU0A 3VS5A 1U54A 2O64A 3DGKA 4D0WA 5KMJA 2B9FA 3UOLA 2AC5A 3WF7A 4BKYA 4NM7A 2WO6A 5HG7A 4PRJA 3FAAA 4FGBA 3LXKA 4IAZA 2X39A 3GFEA 5IQCA 4W8DA 3FY0A 2IZUA 4RIXA 3GCQA 4O0VA 2OXXA 1P5EA 2QVSE 4FKTA 4LOOA 1PKDA 4EJNA 1F3MC 4D1XA 3DFAA 3E7OA 3FQSA 1SZMA 2XP2A 3QC9A 3BX5A 5L2TA 3HRFA 3Q53A 1ZOGA 5IZFA 5M56A 4MHAA 4ALVA 5IH4A 3QBNA 3F5PA 4CXAA 5IQBA 2IZTA 3R1QA 1PXPA 3BLHA 5EG3A 4DGNA 2BIYA 4A7CA 3QUEA 3CTQA 3U54A 4E7WA 4A4XA 2Y8OA 2YERA 1MRYA 5DR9A 3ZM9A 2OIDA 3MA3A 5ACBC 3LFSA 2ERZE 4ALUA 4YO6A 4KIOA 3RVGA 4NIFB 5DRBA 5D12A 3VAPA 4HZRA 1FOTA 1H26A 2B53A 5D7AA 5FD2A 5JKGA 2X9EA 5D10A 1A48A 3DBEA 3R9OA 4KKEA 3RKBA 4DAWA 2Z02A 1YOJA 3HRCA 5AV4A 1KE8A 4NU1A 1XH6A 3ANRA 3PG3A 3DJ5A 3PRIA 2REIA 4PDPA 4DT8A 2PZPA 1YW2A 3F7WA 3K2LA 1Y91A 3D15A 3MGYA 4ZSGA 3CD8A 4CKIA 5DIAA 2V5QA 5AR4A 1KOBA 3BE2A 4ZJIA 5EQYA 2VNWA 1PMNA 4LFIA 5C27A 4S33A 5GZAA 3P79A 3V04A 2VD5A 3NIZA 1Q8TA 5E8XA 3DS6A 3TUDA 1UNLA 4UXLA 2HY0A 2YM5A 4EOLA 4FTUA 3PJ1A 3ZEWA 3FMEA 4U0IA 5JFSA 2R3HA 4FF8A 3HNGA 5I9YA 4FZ6A 3ENHA 3ZZEA 5EKNA 3NS9A 5L8LA 3EKNA 5HO8A 3ID6C 4ENYA 2FYSA 4FV1A 1KOAA 5ACKA 2OFUA 2OK1A 4EJ7A 1W82A 3SHEA 3ATSA 1U5QA 4CYJA 4WUAA 4ZLOA 2BZIB 5DGZA 4BDEA 2CLXA 2WHBA 2Y4IC 3Q3BA 5GIPE 3D7ZA 4JG7A 1OVEA 4QMZA 4XRLA 3IW7A 2PE1A 2WGJA 2JAVA 4X7QA 3BYUA 3PZHA 4F1OA 3MFSA 5CENA 4D28A 2O8YA 3SOAA 2IW6A 3RAIA 5K5NA 4I0RA 3W10A 3DKFA 2OI4X 2OO8X 2VN9A 2ZV8A 3MYGA 4DC2A 2XIKA 3V5LA 3V8WA 3VF8A 5EQPA 3CGFA 2WTDA 4JI9A 4O6LA 2NRYA 5GNKA 2GU8A 4QP8A 3DNDA 3DBQA 3QRIA 3DQXA 2C3KA 2V22A 3VUHA 4F08A 5AV3A 2W5HA 3PTGA 2BFXA 1UU7A 3O2MA 2ITOA 4J98A 4YJSA 5LMAA 4IAFA 5BX0A 4FA2A 2GDOA 4O0SA 4FZAB 2XZSA 4U9AA 5M4FA 1H0WA 3G9NA 5A46A 1JQHA 5EM7A 2WMSA 4YMJA 3CQUA 3OD6X 3C4WA 5HICA 3C0IA 3GOPA 5C8MA 2UV2A 4JBOA 3R9RA 5CEMA 3GUBA 2GNIA 5L2SA 2C3JA 3EQBA 1W98A 4UY9A 4BIBA 4CMUA 3QYWA 5AWMA 1V1KA 3WF9A 2VTQA 2W1DA 1OUKA 3ZLYA 5CF5A 3FYJX 1OIRA 4D1SA 5ANIA 2ITYA 2XRWA 3CY3A 3HUCA 3A4OX 3QTZA 5CYIA 3R04A 5CU6A 5CAUA 3KRXA 4JQ8A 4PMTA 5IISA 3RAHA 2C0IA 3AMBA 4BGQA 1ZAOA 3OW4A 4ZTRA 3OF0A 5DHJA 4R8QA 2OJJA 2RIOA 2F9GA 3KMMA 5JGDA 3DBFA 3R7IA 2HXLA 4EOQA 1UWJA 4I5CA 4OBOA 4AF3A 3C4FA 4UMUA 3F6XA 2PZRA 3FI2A 4ERKA 4HYIA 3P7AA 4I93A 1XH9A 2H9VA 3AC2A 1ZMWA 3RI1A 2NO3A 5K9IA 5B2LA 5HIEA 2GNHA 3QA8A 4RA5A 2OXDA 3IPHA 1Z57A 5D1JA 4O84A 4GIHA 4MXXA 4O38A 2WU7A 4E4MA 4F0IA 3UC3A 4IFCA 1OKVA 4CD0A 4RGJA 4O7TA 4WOVA 4C7TA 4QYYA 4EORA 2GTNA 3I5ZA 3MN3A 5T3QA 5IU2A 4B4LA 5JMSA 4FG9A 3GU4A 3R8PA 3HV5A 3O7LD 3U55A 3VNTA 4EZ5A 4EBWA 3VS3A 4ZIMA 4FE2A 4P90A 2OF2A 3MPMA 4NK9A 5CASA 1PXKA 3GU8A 2WTKB 3KA0A 4FSZA 4MXYA 1YHSA 4J99A 2XH5A 4BDAA 3R63A 4ASZA 5ICPA 2X2MA 4E8AA 4A06A 4CFFA 5LXMA 4NL0A 2GQRA 5FTGA 2ZDTA 4BBMA 1K3AA 5M08A 3RK5A 1O6YA 4EHZA 4K77A 2QHMA 2IW8A 4U8ZA 5I9ZA 4QYHA 2RF9A 5JZNA 4ZTQA 5IH6A 3HV6A 3HMMA 3ZZWA 4FOCA 2IW9A 2EWAA 1DAWA 1H0VA 2UZEA 3M2WA 1ZZ2A 2CGVA 2OH4A 3HDNA 4AN2A 2WIPA 3E8NA 2VWIA 3LM0A 1IASA 3ODZX 3IKAA 5IUIA 4E1ZA 3BLRA 5EI2A 2HZIA 4MNFA 3FBVA 4Z7HA 4FSMA 4O7LA 4A4LA 3RBWA 3RHKA 5B2KA 3UODA 2QLQA 5AAFA 4AGDA 1OECA 4C37A 5E91A 3AMAA 4J7BA 4ZY4A 3TWJA 2AUHA 4YSMA 3L8XA 3F5XA 3LZBA 4N70A 1CTPE 4CV8A 1OI9A 2WOTA 4IM2A 1DAYA 3LQ5A 2WMXA 1U5RA 3P1AA 4H1JA 4QRCA 4TW9A 5KMIA 5KKRB 4IVAA 4A9YA 4RIWA 1OIQA 4XV2A 2PMOX 2XNPA 1Q4LA 3BEGA 3GU5A 4DYMA 4PV0A 3JR1A 1PF8A 5IQEA 1OM1A 1O6LA 3UIUA 4MBJA 5CZIA 2CNVA 4YTCA 3GC9A 3OXTA 3R00A 4LGDA 4F4PA 3HYHA 5AR8A 2QOHA 3KRJA 3TG1A 5HTCA 2XVDA 4LL5A 3TDVA 3R1NA 5F95A 2VTRA 2YDKA 3MS9A 3BWFA 3KGAA 3ZUUA 3VUMA 2DWBA 2HENA 4E4XA 4L3PA 2XKCA 3I79A 4QPSA 3OCGA 5IUHA 4ID7A 4AGCA 2OZOA 2J0KA 2VTHA 3N4TA 1ZARA 3ZO3A 1L8TA 2YM3A 4C4HA 2P0CA 4HYUA 3CR0A 3P5KA 5CAPA 2GFSA 3ET7A 3FZSA 3UYSA 4DFUA 3FZPA 4H58A 3IW8A 3O17A 4RFYA 5AIRA 3WZEA 1DM2A 2Z8CA 3IQ7A 2I40A 1MRVA 1OPJA 3OTUA 3UG2A 4BDDA 5CAOA 3EQFA 3R7YA 3O23A 3IONA 1QPJA 3DAKA 5DMZA 4RJ3A 2PMNX 4WSYA 1I44A 3MVLA 3VC4A 2BKZA 4G5PA 3KMWA 1T45A 2BRGA 3OWLA 5HO7A 3HAMA 4I4EA 4IB1A 4OTGA 5AP2A 4GSBA 5CEQA 4KUJA 5IA3A 2WQBA 3NUUA 4IB3A 4HJOA 4FBXA 4PWNA 4YTHA 1JSVA 2W1HA 2GQSA 4YJPA 2BAKA 2ITPA 2VTAA 2IVTA 2CLQA 3E8CA 3M42A 3G51A 4FKVA 4DEEA 4F6UA 3CKXA 5IMXA 5KCVA 3H4JA 2BRNA 3DLSA 5IQIA 5LQFA 4BRXA 4W4VA 3PE2A 3FKOA 1NVRA 3PVWA 3UYTA 5DPVA 3EQCA 5ETCA 2UW0A 2R3GA 4I5MA 4I5PA 4I6QA 3ZHPC 1ZWSA 2W1IA 3WYYA 3IS5A 3MH2A 1G8AA 3FLZA 2E9NA 5BVKA 3M11A 2HZ4A 3F5UA 3ZRKA 3TT0A 1GNGA 1XHAA 1BI8A 5AR7A 3CPCA 3R2YA 4FZDB 4RT7A 2HZ0A 3QX2A 4NSTA 4U81A 3ZS5A 3AC4A 3QALE 2PY3A 2SRCA 2B52A 4J71A 4XRJA 5BVOA 4A4OA 3S3IA 3TKHA 1J1CA 2WQEA 4RVKA 4R6VA 4RX8A 5CSVA 4O0YA 3COIA 5BYLA 1KE9A 3WI6A 5CSWA 2QKRA 1IRKA 3KULB 1ZOHA 4KBCA 3ZC6A 2VNYA 5CVHA 2ACXA 4P4CA 4AOTA 3KXXA 5LJJA 5TT7A 2UW3A 1B39A 4YLLA 4ZJVA 3K3IA 2YFXA 3F2AA 4FL3A 4MH7A 2HWOA 3ELJA 3NVKI 3VIDA 2QURA 1YDTE 2VTJA 4IAYA 4QMUA 4F9CA 3NDMA 1WCCA 3GI3A 3MIAA 4S34A 2VWVA 3KFAA 3R7UA 4BCFA 2ZV2A 2XYNA 3IECA 3II5A 3F66A 4O86A 4NJDA 4G16A 3U87A 2EXMA 1OUYA 3T9IA 2ERKA 5BVFA 5EQEA 3DT1A 2JKOA 4OTWA 4BI1A 4F9YA 3D83A 3POZA 3C7QA 3LKMA 5CSXA 4JOAA 4ZS0A 3G90X 4EZ7A 3FI4A 4CVAA 4ZSAA 2GTMA 4NIFA 5BUJA 1OL5A 4GEOA 3LQ8A 2QOCA 2VZ6A 1FPUA 2BRMA 3UO4A 4GT3A 1Q24A 1PY5A 2PZIA 2YIXA 5A54A 2PULA 1OIYA 4UN0C 3E7VA 2PVNA 3ZSGA 3CJFA 5AADA 4NTTA 4F9BA 3MBLA 4FUYA 2QO7A 4C35A 4YR8A 4CRLA 4AX8A 2GS6A 1ZYLA 4JBVA 1XH8A 2E9PA 4A9RA 3KXGA 1YKRA 4E26A 5HE2A 5CXHA 1Q8WA 2OJIA 3MY1A 4FMQA 4GFMA 3FYKX 4FNWA 1ZRZA 4M97A 1XJDA 4FYNA 2P2IA 3QXPA 3OHTA 4L3JA 1OBDA 3R1SA 2A19B 2JIIA 4KIPA 4MXAA 2ZM4A 5AIKA 2BZHB 4UX9A 2C5XA 4XS2A 4PF4A 4QP4A 3NR9A 3UVQA 4D2SA 1OITA 5AV2A 3E3PA 4J1RA 3FMKA 4U3ZA 3FHIA 4QTCA 4YZ9A 4AXAA 4C34A 3AGLA 1YWNA 3REPA 5KX8A 3PP0A 3LFDA 3DK7A 4MD9E 3VBVA 3GNIB 3DBDA 3DTCA 5A4CA 4KABA 2EB3A 2G15A 5DWRA 1XBAA 5LMBA 4EOPA 4IM3A 3NMUF 3V6RA 3PXFA 3HECA 3E87A 4XBUA 4BCHA 5HVKA 3W2RA 4QMNA 3U6HA 1GAGA 4FKGA 4L3LA 5M53A 4FEVA 3HLLA 2XK9A 4X3FA 5AP6A 3FL4A 5HEZA 3QHWA 5D41A 3TXOA 2IZRA 2F7EE 2J50A 4F70A 4RC2A 4OLIA 2PVMA 3FZ1A 4IHPA 5KE0A 4LRKA 4BC6A 4QTDA 2QU6A 4TKSA 5DT0A 4I23A 5CU4A 3OEFX 3C0GA 3OY1A 4NFMA 3VW6A 4UZDA 5A14A 3WF5A 4BCNA 3BU5A 4KIQA 4QYFA 3TV6A 4ZTSA 4H3PA 4HVGA 5CSPA 4HCUA 5CY3A 3KVXA 5FQDC 3LFFA 4ZJJA 4GV1A 2BPMA 2V55A 4DA5A 2CKPA 1TVOA 2F4JA 3PXKA 3RTPA 5DNRA 3TEIA 2WTVA 2XIXA 5IA1A 3LCOA 4NCTA 3MH3A 5HLPA 5LVMA 1XWSA 4TYJA 3K5VA 2VTLA 5AUZA 3ZLXA 3MVMA 3TN8A 4GW8A 4EEVA 1OKYA 4N6ZA 3OT3A 4FV7A 4ARKA 4BCMA 4G9RA 4JAIA 4EBVA 5CF8A 2UW6A 5IMEA 5HU9A 4RJ7A 4FNXA 4BWXA 3PJ2A 3POOA 4C4EA 3TZMA 5GJDA 4GVJA 3EQIA 3Q4CA 4E4LA 5HE0A 3QTQA 5GZ9A 2JGZA 3C1XA 4PP7A 3CTJA 4YZCA 5L6PA 3VBTA 2Y4PA 2B1PA 4CSVA 2VO3A 2Z7SA 3EQHA 4M84A 4S31A 4WHZA 5D11A 4Y85A 2WEVA 1NT2A 3VHEA 2YCSA 4XP0A 5HCYA 5KBQA 1YQJA 3QF9A 2YITA 4JDKA 5L2WA 4PTGA 2UW7A 3G6GA 4QMTA 3DK3A 4FTCA 4UZHA 4JRVA 3ZUTA 4FICA 1VZOA 4IX3A 4M14A 4CFWA 3RPOA 3R7EA 4UBAA 4XOYA 3W2SA 1W0XC 1XR1A 3CGOA 3ORMA 4GYIA 2XKEA 3R7VA 1XKKA 4MBLA 5EOLA 3V5WA 3ZU7A 3TUCA 3COMA 5FG8A 2Z60A 4JR7A 4DH1A 3PJ3A 4MNEB 5C8KA 3EWHA 4GKHA 2C47A 5M06A 1IG1A 2Y6OA 4UV0A 3WILA 3RK7A 3Q96A 3QZGA 3PA3A 1H1WA 2J6MA 4EC8A 2J5EA 5FM2A 3I7BA 5CAVA 3ZMMA 4IX4A 4FKJA 3IW6A 4FTNA 3HKOA 4QMSA 3WF6A 3PY1A 5KHXA 4D58A 1V0BA 2ZM3A 5JQ5A 4O21A 4LQMA 3UIMA 1ZY5A 2IVSA 4BCJA 1EH4A 3ITZA 4A9UA 4XUFA 1CDKA 1XO2B 5H3QA 5K4IA 3NSZA 1UU9A 3D5XA 5AR2A 4IH8A 3BQCA 2G2FA 4DTAA 4C62A 3OT8A 5E4HA 2LGCA 4WUNA 4L46A 4F65A 4B9DA 4JX7A 1PJKA 1IA8A 4RLKA 3RMFA 2UZBA 4G3GA 2O2UA 4JS8A 3G9LX 5BMMA 3ATTA 2OU7A 5JGAA 3ZXZA 2GFCA 4DEHA 5CF6A 3JPVA 3SX9A 2WAJA 4JR3A 4OUCA 3MW1A 3F2NA 5EI6A 5AUXA 4FC0A 1Q8UA 3BHYA 3O8UA 4I1ZA 3MPTA 4K2RA 4XCUA 5HD4A 4DT9A 1U59A 2V7AA 3PIZA 3LFQA 4FKSA 3UE4A 4FGRA 3SAYA 3ZLSA 4JBPA 4O7ZA 4AT4A 3QYZA 5CEPA 5KBRA 4FIGA 2GS7A 3D9VA 3I5NA 4XV3A 3RHXA 3G6HA 4ZSLA 5J7HA 1WBNA 4Y5QA 3QD3A 5CTPA 5H2UA 1PMEA 5CT7A 5C01A 4BIEA 5EW8A 2W17A 1GZ8A 3CXWA 3ZFMA 4WBBB 3QZIA 2QOLA 5M4CA 4P7EA 1UVRA 4D4SA 2VTMA 3BHUA 5DEYA 4FV9A 1FMKA 4EH9A 4UYNA 1NVSA 3ALOA 4AN9A 3S0OA 3C13A 5HNGA 2EXCX 5HO6A 4Z7GA 4BCQA 1LP4A 1SM2A 3FI3A 3SRVA 4QTAA 2JIUA 3QQUA 4XLIA 5J7BA 2OFVA 4AUAA 3HL7A 3T3VA 2VAGA 4RVLA 4UMPA 2YA9A 3BLQA 4NFNA 2WKMA 3VS6A 5BUIA 3LJ0A 4FL2A 2VTSA 4HYSA 5IQHA 3OVVA 3HGKA 1HCLA 1RJBA 5K0KA 5FEDA 4XEYA 4L01A 4CMTA 1B38A 1KSWA 4OTPA 4F1MA 3OTVA 3NNWA 1Q99A 3PLSA 5GZ8A 2R3MA 2C0OA 3D5VA 3QKMA 3OCTA 2QOFA 1H1SA 4RIYB 3TNIA 3KL8A 3QD4A 3VBYA 4HOKA 1WZYA 2IVVA 4ITIA 4GK2A 5HNBA 2IVUA 4EOSA 1IAJA 3F7ZA 3QXOA 3D2IA 5EM6A 5AJQA 4Y95A 4E5BA 3EFLA 5HBHA 4AE6A 2R5TA 4AA4A 2B55A 3W18A 2YABA 4KRDA 4D4RA 4CT2A 4ZP5A 4YZBA 2XIZA 1KV1A 4FEUA 4G31A 1M2QA 4JAJA 4ZMFA 4P2KA 4IFGA 2IG7A 3CD3A 2OWBA 1QCFA 4DFZE 4X2FA 4YO4A 2XIRA 3VBXA 2JD5A 5L8KA 1H1PA 1MUOA 3A62A 3MVJA 1QPCA 1W83A 3DLZA 2JDOA 2ZVAA 3CY2A 4CG9A 2GHLA 3UNKA 2XRUA 4CFVA 4BL1A 4YJOA 3Q9YA 2QI8A 4IAKA 2C0TA 5KMKA 3DZOA 5FP5A 2I0VA 4BDJA 3RGFA 3EN4A 5IF1A 4WRGA 3OCSA 4EHEA 3EQRA 5FWKK 5LCJA 2C3IB 5E8YA 1B6CB 2UZDA 4RX7A 3TNQB 2WTKC 3HV7A 4UWYA 3F88A 3L9LA 1WBVA 4XG2A 3UBDA 4NT4A 3VW8A 1OKWA 2PVHA 2J0LA 2WELA 3B8RA 3BU3A 1V0PA 2PUNA 3DXQA 5ETAA 5EYMA 3R0TA 5D7VA 3QRKA 3QZHA 2CN8A 3QA0A 4IC7A 4CFXA 4R7IA 4QYGA 2CKEA 2IN6A 4JXFA 3E8EA 1ZZLA 4XBRA 4O91A 2WIHA 3L8PA 2YIRA 4MKCA 3AC8A 4WNMA 4Z9LA 2C5VA 1M7NA 5J9YA 5JZJA 3TJDA 4MWHA 2VUWA 4QMOA 5G1XA 2VTOA 4QO9A 4QD6A 4DFLA 3O0GA 3EL7A 4AOIA 4C2VA 4OT5A 5IH5A 3FSFA 4FTQA 3ZLWA 5I9VA 3A7FA 3G33A 2E2BA 2XBJA 1ZYJA 3FL5A 3OOMA 2BDJA 5AP0A 5M51A 3KULA 3AT3A 3IDCA 4D2RA 4E20A 4QMXA 4BHNA 3GQLA 5DLSA 3O7LB 3OS3A 4ZXTA 3QCXA 4ZY6A 5EM5A 1YRPA 5A9UA 1J1BA 1M7QA 2PVKA 3FMLA 3N51A 5FDXA 3UTOA 1JAMA 3PFQA 2XNBA 1UKHA 4C2WA 4NTSA 2XBAA 5J5TA 1DI8A 2QO2A 2WXVA 3NYOA 4G3DA 3FZTA 5FP6A 4PDYA 4ITJA 4OR5A 4IDVA 4DTKA 1NY3A 4IZ5A 3PVGA 4RFZA 3RNYA 5KKRC 3TNWA 2WNTA 5IEVA 2CNQA 4CTBA 5IEXA 2ZMCA 1Q8ZA 4JL9A 3EKKA 4EH6A 5A4LA 5J1WA 3EQDA 5CVGA 3TTJA 2W7XA 1SVGA 3NEWA 1BUHA 4GYGA 3ZFYA 3Q6UA 3V8SA 3Q52A 2YWVA 1H25A 3LXPA 4XG6A 3V5QA 4FIHA 1R0PA 5T6KA 4HW7A 1PXLA 3SXFA 2WMRA 4GG5A 4O2PA 4U41A 4BGGA 4NWMA 4HVDA 2I1MA 4PQNA 1CMKE 4QMMA 3EFJA 2R7IA 4EH3A 2Y9QA 4MCVA 2W4JA 4OAVB 4PY1A 2BTRA 3N9XA 3WYXA 5HVJA 2ZDUA 3HV4A 4KWPA 2FGIA 5J79A 5KNJA 3ZCLA 1E1XA 4D5KA 3BRBA 3KC3A 1UU8A 4TN6A 2XJ1A 4BDGA 4QQJA 4L43A 5EYKA 4C8BA 3FJQE 3QKKA 2RFEA 5CS6A 4BDKA 4QMWA 2FSTX 2UZTA 4W4XA 4ENXA 1R78A 5JQ8A 3HA8A 3EQPA 2WTJA 2JBOA 3F5GA 2VO6A 3O8PA 4X2NA 4AOJA 5AV0A 4D1ZA 2BZKB 3R8LA 2H34A 3V5TA 3LJ1A 2E9OA 2P3GX 3QTSA 2X8DA 4P5ZA 4QP6A 2VV9A 4UEUA 3S00A 4YBKA 5IQFA 4QTBA 3IDBA 3Q9XA 4RWKA 4ANLA 1S9IA 1F0QA 3ANQA 3EFKA 4LI5A 3R01A 2G01A 4WNKA 5BVNA 3VS7A 4CCBA 5CSHA 4LRMA 5AUWA 2Q0NA 2C6IA 2BRBA 4I6BA 1NA7A 4ERWA 1Y6AA 3P4KA 3TUBA 4IJPA 3SW4A 2B7AA 2QCSA 4C38A 3A7IA 2B9IA 2BROA 4WG3A 3Q2JA 2H96A 2WMQA 4EOJA 2OG8A 2JFLA 1Q41A 2JEDA 3W1FA 3EZVA 4OT6A 5CNOA 3W55A 2PYWA 3N4UA 2P33A 4XV1A 3FHRA 2P2HA 5I9XA 1J7UA 4AN3A 2RG5A 4LMNA 3MA6A 4YJVA 4IAIA 3RCJA 3KQ7A 3ZOSA 2UZLA 2X4FA 4BZDA 1YI6A 4W8EA 4C33A 4YUQA 1QPEA 2WQMA 3U51A 3SGCA 4KS7A 2YN8A 5J95A 4DHFA 3H0YA 1OL6A 3ORIA 3GC8A 4E73A 1R3CA 4U97A 4L9IA 1OB3A 1UNGA 2X4ZA 4LGGA 5E8VA 3LCSA 4TYHB 1H01A 2UW9A 3EB0A 1JPAA 3PSCA 1PYEA 3Q4TA 5K3YA 4QQTA 3C4ZA 5DVRA 3GT8A 3IK3A 2VX3A 2JDVA 2Z2WA 3OW3A 2JIVA 3ROCA 5B2MA 3ZEPA 1BL7A 2F2CB 3NAXA 4LOPA 5AM7A 3IOKA 5IDPA 3FLYA 1YWVA 2J0JA 2VWWA 3NCGA 4FKUA 2WQNA 4L44A 4UXQA 1S9JA 2VWBA 5M07A 3UJGA 2JBPA 4QP2A 4JX3A 5ANGA 2ITNA 4U42A 3F3UA 3UNZA 4F0FA 5DH3A 3QLGA 4PPCA 5EFQA 5H8BA 4F64A 5CEOA 1JOWB 3CC6A 3HVCA 1M2RA 3I0QA 3QX4A 2UVYA 4L67A 4YC8A 2XMYA 4TPTA 3L1SA 5F1ZA 1JKKA 2XA4A 4AE9A 2HXQA 4WA9A 4I92A 3KXNA 4FEQA 4FSUA 3E3BX 2VWZA 2YIQA 1PXOA 3QQFA 4JG6A 3SA0A 2FSMX 2W1FA 1GZNA 3D7TB 3CLYA 2ZJWA 3Q6WA 3UMXA 1IAHA 5E9EA 3FZOA 3ZM4A 3A7GA 4O7SA 3G0EA 3VS4A 3O8TA 4IB5A 4MAOA 5CANA 4CLJA 5AAGA 5HE1A 3EZRA 4YZMA 3HP2A 4O27B 2QODA 2R7BA 5GINE 2JAMA 4UMQA 5JH6A 4R7HA 3UPXA 5CT0A 4IADA 4CCUA 4I0SA 4DGOA 5HORA 4YBJA 4MWIA 3BGQA 4MNEA 4PMMA 3TZ9A 2BILB 4KIKA 3NCZA 5HIBA 2HW7A 5EKOA 2YM7A 4MXOA 3UO5A 3BV3A 4NM0A 3L9MA 3OBGA 3BEAA 3JS2A 4V04A 4XG4A 1VYWA 1K2PA 4AG8A 2OZAB 3A7JA 2QD9A 3CIKA 4O81A 1VEBA 4WG4A 1MP8A 4FNZA 4O83A 2GHMA 2XB7A 4FKIA 4FKRA 2PUIA 3FLWA 2O5KA 2C5NA 5C9CA 4KRCA 2QNJA 4PMPA 4GFOA 2Z7RA 3RWPA 4DCAA 4D4VA 4ITHA 4M15A 5AP4A 4C61A 4DH7A 3HAVA 4KKHA 2XK6A 3VN9A 4ANQA 5HX6A 5FTQA 3E8DA 4FVRA 3QQGA 2G2HA 2JKMA 4HCVA 3ZC5A 4NW6A 2XNMA 1OPLA 3QCQA 4F9WA 3JY9A 3BCEA 2BZJA 4R3PA 4EUUA 4ZTLA 3D5WA 2QHNA 2UW4A 4E6CA 2QOOA 2HW6A 3QCSA 5HLWA 3W33A 5ITAA 4ZAUA 1IEPA 3W2CA 4D2WA 3OXIA 4NKSA 3VS0A 3KY2A 4B6LA 2H6DA 4PPAA 4ZY5A 2HYYA 2C68A 2YIWA 1STCE 3BBWA 3EL8A 3HEGA 3KF4A 4AZWA 5CAQA 5AP7A 4RSSA 3NYNA 3N4VA 4F99A 4IACA 2YIYA 4GL9A 4K0YA 1JBPE 5HCZA 1GOLA 3BPRA 3ORXA 2BAJA 3UG1A 3H9RA 3VO3A 3PVBA 4HVHA 3TACA 5DR2A 5K4JA 2I0YA 2R3RA 1UV5A 2AYPA 1SVHA 3FPQA 2Q0BA 1OPKA 2W4OA 3EN7A 5K5XA 4D4YA 3U6IA 3CSVA 2VX1A 5AMNA 3HV3A 4YNOA 1L3RE 3I6WA 4FT5A 4J53A 4JVGA 3OXZA 4CKJA 5G6VA 3CTHA 2CN5A 3G2FA 4WO5A 4E93A 3UQCA 3FC2A 3ULIA 3GGFA 4NUSA 3GC7A 2W99B 3DOGA 4QMVA 4EKKA 2YCQA 3H30A 4JNWA 3ACKA 3RWQA 5BNJA 2C1BA 4FNYA 5HD7A 3R1YA 4RQVA 3PIYA 4IB0A 3NNVA 5IA2A 3UZTA 4IAAA 1SNUA 3QL8A 1NVQA 3DFCB 4IWQA 3TI1A 2C5YA 2C30A 1U54B 4FR4A 4EQCA 4YLKA 3KK9A 5EYDA 4Y73A 3RCDA 4J8NA 3O51A 2W5AA 4F6SA 2PSQA 5EM8A 4L68A 3QUDA 4FTRA 4QPMA 4YZDA 2QO9A 4RIXB 4YLJA 1XH7A 1LEZA 1ATPE 4Q9SA 1JSTA 1HOWA 1YOLA 3K5UA 2PVYA 3KRLA 4N57A 3PYYA 4E5AX 5GJGA 3PXQA 1PXIA 5J1VA 2C6OA 5CEKA 2PZ5A 3VJOA 4DFXE 2PVRA 4EOIA 2ZV9A 4Q5EA 2WQOA 4KA3A 3QQHA 4EWQA 5E8TA 2C3LA 3F3ZA 4ANNA 3Q9ZA 3ORZA 5CNNA 3LCKA 5FXSA 4I20A 5EH0A 4GKIA 4WSQA 1GY3A 3MFRA 4D2VA 3EN5A 4FV8A 2PVLA 4PL5A 3VQHA 4I24A 5TF9A 3C50A 4H36A 4R3RA 4XP3A 4BWKA 4DLJA 5AX3A 3LXNA 3LFCA 3A60A 5BYZA 3UPZA 5E7RA 4C3RA 4QMQA 3HMIA 2HIWA 4FIFA 3MI9A 5H8EA 3RM7A 2QU5A 3ENMA 3PPJA 2W9FB 3CEKA 3DJ6A 4YTIA 2XYUA 5HI2A 2XIYA 5D9HA 3KXMA 3DDPA 3QLFA 4QMYA 3QC4A 3WF8A 4EYJA 4H05A 2XF0A 4CV9A 4HGLA 4DF3A 3PJ8A 2NP8A 3UIXA 2WU6A 2G9XA 1GJOA 3ZH8A 2C6LA 5FDPA 2QR8A 1QPDA 4USFA 4IWPA 1H8FA 4X3JA 5HCXA 3K54A 3HDMA 3CKWA 2CHLA 1IA9A 5I3OA 3NUPA 3QU0A 5J87A 2RL5A 3PY3A 4MF0A 4J96A 4XYFA 3OWJA 3QGWA 1OMWA 3EH9A 3GU7A 5ANDA 2VTNA 3SV0A 2R3KA 5TO8A 5E1EA 5HESA 1SNXA 3FY2A 3NYVA 4IJ9A 4YJTA 3W2PA 2J7TA 2ZB0A 1J91A 3F61A 4IX5A 4LMUA 1JKSA 4DG2E 4DLIA 4EHVA 3IOPA 2B4SB 2E9UA 1O9UA 5KZ0A 3KMUA 3RAWA 3CE3A 5IG1A 3PG1A 2OJGA 5CF4A 4D0XA 4NZWB 2ITUA 2PK9A 4J8MA 2W1EA 5CX9A 3UOHA 3GEQA 2C6MA 3C0HA 3VRYA 5I9WA 4EK6A 4Y5HA 3HRBA 3MWUA 4AWIA 3T8OA 4AQCA 4C0TA 3UZRA 1YXSA 4GFGA 2BAQA 5M4UA 3F3VA 4C58A 1OIUA 1WBPA 2F49A 2Y6MA 3F3TA 5E8WA 2OGVA 4N4SA 3ZYAA 1TQIA 4CTCA 4D2PA 2BVAA 1ZMVA 2VWUA 4R5YA 3SXSA 1FVVA 3P08A 4EC9A 4ACGA 2BCJA 4WIHA 4FV0A 1PRYA 4X0MA 3UQFA 2NNWB 4UMRA 1OL7A 2R3FA 3R22A 4HCTA 1QL6A 4AW5A 3QQKA 2C5OA 1Y8YA 3RM6A 4FV4A 3AG9A 4O7VA 3UMWA 2R3PA 4APPA 3A61A 3ERKA 3P9JA 3DQWA 4FTTA 5F9EA 4EWHA 4FKWA 3KN6A 4A9SA 1FBNA 1BYGA 2B9HA 1YI3A 2FSLX 2GSFA 2RKUA 3MFTA 4OTDA 2PE2A 3IGGA 3R8VA 4BZOA 3UC4A 2B9JA 2EU9A 4MF1A 3ALNA 3MPAA 2CSNA 3TDWA 3NW6A 2OSCA 4DEIA 4RVTA 2XKDA 4R7BA 4ZSEA 4I22A 4FOBA 3QQJA 3ULZA 2ETMA 5DR6A 5DOSA 3BU6A 5IQAA 3I81A 3V6SA 3ZBXA 5HBJA 5A4QA 3TJCA 1OZ1A 1H08A 1WAKA 3GB2A 4WNPA 4AP7A 3PA4A 5EDQA 3P7CA 2GNGA 3E88A 4LUDA 1GZOA 1SYKA 2X7FA 4XG8A 2KULA 2CJMA 3CQEA 5E8ZA 4OTHA 2F7ZE 3AC5A 3H9FA 4IE9A 5EDPA 4ACHA 4RJ5A 2HELA 3DA6A 3ORKA 3QTXA 3R30A 3R73A 4UWBA 5FGKA 3TKUA 3VULA 4C36A 4EI4A 2EUFB 3DCVA 5AFVA 3PXZA 4G17A 2X7OA 1KWPA 2BR1A 4Z3VA 4C4JA 1W84A 3G5DA 4KSPA 1CKPA 5J9ZA 1PMVA 4O1PA 3D14A 3LVPA 2R2PA 4PNIA 3TIZA 5HGIA 1GIIA 1OL2A 4NW5A 5JN2A 3K3JA 2FA2A 2XEYA 3HP5A 3EN9A 5FXQA 2HOGA 4X2JA 3QTUA 3C4XA 4JIAA 4FKPA 3TNPC 3KCKA 3R2BA 2PWLA 4RRVA 3EYHA 5BQ0A 3H9OA 4RVMA 4Y46A 3RZFA 3TKIA 2YLEA 2JITA 3L8SA 3KB7A 3OG7A 4Y83A 4ONAA 3Q32A 2GNJA 3R8UA 4WNOA 5GJFA 4LUEA 1SMHA 5AV1A 4PX6A 3W8LA 4RBLA 4QMPA 2GNLA 1AQ1A 4RIOA 4YC6A 4G3EA 1PXJA 4BDIA 4YC3A 3VF9A 4N6YA 4ANOA 1GIHA 3LFBA 1BLXA 3V5JA 3WZUA 2X7GA 4ZLZA 5AUYA 5IQDA 2NRUA 3EQGA 4U40A 4U80A 3ZDIA 3GVUA 2H8HA 4YU2A 3ACJA 3PZEA 4IEBA 3ZBFA 4BCPA 4USDA 3NUAA 2RSVA 1K9AA 4XHKB 5EW9A 4FTOA 3BI6A 5EYCA 4JDJA 3GQIA 3FMMA 1IR3A 3O50A 4FKQA 4IVCA 4J97A 4K18A 3KU2A 2BALA 4J95A 2JLDA 5L8JA 2FH9A 3FZRA 4FZFB 4O22A 5FRIA 4AGUA 1WBTA 4TYIA 4C3FA 3NWWA 2I7QA 3CCNA 3UNJA 4EZ3A 4BTMA 4R1VA 4HYHA 1WBSA 5C03A 5B7VA 2CCHA 2BTSA 5KO1A 1G8SA 1CKIA 4MYGA 1BI7A 5CXZA 1ZYDA 4DFYA 3A8WA 4UMTA 3C4CA 4YURA 3IW4A 4RIWB 4ZTNA 3AOXA 5CALA 3Q4ZA 4HNFA 3FC1X 1E1VA 2OZAA 2X9FA 3BYMA 3FXZA 4V05A 3LFEA 4BZNA 5HE3A 2V7OA 2BHEA 2W0JA 4M13A 2YCRA 4RWJA 4XG7A 4EYMA 3SW7A 3G15A 2FVDA 4G34A 4KD1A 4DN5A 3W16A 3BV2A 4YPDA 4EH2A 4Q9ZA 3DPKA 2ITVA 5JRQA 4X6QC 2QOQA 3AT4A 4CFUA 4YP8A 4V01A 4BYJA 4YPSA 2RFSA 3RPSA 4LV5A 4DFNA 4RMZA 3PRFA 3RPRA 1RDQE 2YEXA 4CZUA 3D94A
chains in the Genus database with same CATH superfamily
4PTEA 4I0TA 1ZYCA 3DKCA 3M1SA 4FODA 4UB7A 3WE4A 5IUGA 5BV3A 2FO0A 5EK7A 4CG8A 4ZZNA 4YJNA 3KREA 2WMTA 5HVYA 3W0MA 1M17A 4FT7A 3PVUA 4K9YA 2A0CX 2VTIA 4FZ7A 4S2ZA 3BKBA 4ORKA 2XNOA 1XH4A 3OZ6A 2YAAA 4L8MA 1YXXA 5I0BA 1PYXA 5BVEA 4EKLA 4AFEA 3OBJA 4L6QA 5AAEA 4JG8A 3DK6A 1OGUA 5M09A 3QD0A 4K6ZA 3JYAA 1W2CA 3G0FA 3JVSA 4KKGA 3BYSA 4QT1A 1FQ1B 4RLLA 1PXMA 5L6WL 3WARA 4AZSA 3MTFA 5JFVA 4EQUA 4AAAA 5BUEA 3WOWA 1JKLA 2R0UA 2Y7JA 3UO6A 2BHHA 4FT9A 2ZM1A 4I6HA 5E8SA 4DINA 4L53A 1Q3WA 2ETRA 3NAYA 4OTQA 4AFJA 5DYJA 2PHKA 4TTHB 3ZUVA 2OXYA 4YJQA 4ASDA 3S2PA 3DXPA 3D0EA 4XP2A 2O65A 5ANJA 5LMKC 3RAKA 3HMPA 4TYEA 3L9NA 1O6KA 5FBOA 3ZDUA 5EDRA 4ACCA 5JT2A 5IEYA 3WZKA 3HZTA 5LCKA 4DH5A 3KRWA 4BHZA 4U45A 3D2KA 4GT4A 4V0GB 3UP7A 4ZK5A 4EK8A 4BYIA 4ZEGA 1ZMUA 4BB4A 1UKIA 5JK3A 5FEEA 4GK4A 5TKDA 5KMLA 1LUFA 2UVZA 4AS0A 1UWHA 3COHA 1REJA 3QWKA 2HZNA 2GHGA 3MDYA 5A4EA 2X8EA 4BFMA 3PSDA 1NW1A 2XNEA 5EHOA 5IPJA 1ZXEA 3A4PA 3GP0A 4AZEA 4JDIA 4IDTA 4BN1A 2VWXA 4YGAA 2RFDA 2Z7QA 3EOCA 4AA5A 4CFNA 4FSYA 3AT2A 3L9PA 4IC8A 5JRSA 3F2RA 3AD4A 3KXZA 3WE8A 4G3CA 1YHWA 2YACA 4TNDA 4ALWA 5HTIA 2OIBA 3I7CA 3PPKA 3UQGA 3SKCA 4AU8A 4O7WA 4M68A 4MBIA 4IZYA 4RC3A 3ETAA 3DKGA 3MFUA 3QUPA 4WKQA 3E64A 4BJJA 2X81A 3S4QA 2A4LA 3CS9A 4DHJA 4II5A 4FT3A 4GT5A 2HY81 4D2TA 3FE3A 4FK3A 2OF4A 4S32A 5J5SA 4ZTHA 4OGRA 4FTJA 3V01A 3W0RA 2ZOQA 4R5SA 2WOUA 4TRLA 3QTIA 3AC3A 4O2ZA 5EHYA 2QOBA 4DTBA 5FEQA 5K0XA 3ZONA 2J9MA 3MJ1A 4YSJA 3WBLA 5CI7A 1A06A 3HX4A 4O0UA 3EMGA 3GU6A 3Q9WA 3LLAA 4EK4A 3R02A 3PIXA 1G5SA 2WMAA 1WBWA 4CZTA 1U46A 2CGXA 4IZAA 3IGOA 3PLAE 4H1MA 3P23A 4RJ6A 4PL3A 2IJMA 1FGIA 3OROA 4QP1A 5HG9A 5M4IA 3FMNA 2JDSA 2PVJA 2ITZA 2WMVA 4PP9A 3UIBA 1WVYA 3TV7A 4H3QA 5LOHA 3QCYA 3A8XA 1BX6A 1FMOE 1ERKA 3P78A 4KAOA 4M69B 4RZVA 3TCPA 4BKZA 4NYEA 5TE0A 4O0XA 3RZBA 3R71A 4WBOA 3ZSHA 3DU8A 5FM3A 2UZUE 5DE2A 4C4GA 5IDNA 3AKLA 4EONA 4EUTA 4DFBA 2WTIA 2XJ2A 4HGTA 2X6DA 2V62A 4MTAA 3IG7A 4WD5A 3FI8A 1BKXA 2QC6A 3SC1A 4JT3A 3QAME 3HMOA 4FEWA 1CSNA 3D4QA 4X6RA 1JSUA 3EIDA 1YOMA 2QONA 2UW8A 4CT1A 1YXTA 3THBA 3TIYA 4HVIA 5DI1A 3IW5A 5KMMA 4ZZOA 3LMHA 3MESA 3FQHA 5AEPA 2C4GA 2C6TA 4G2FA 3Q4UA 3DAEA 4RPVA 2R3OA 2EXEA 4D55A 5EOBA 3C51A 4U6RA 2WTWA 3RJCA 4RJ4A 2W06A 1WFCA 4LGHA 1H1QA 2DQ7X 4XNEA 3PPZA 3PXYA 4TNBA 3C5UA 1G3NA 5HNIX 5HU3A 2OICA 4QTEA 4X3FB 3NNXA 3PSBA 4I3ZA 2XEZA 3JXWA 5I3RA 4BTFA 1Q5KA 2EB2A 4FTKA 3E5AA 1W8CA 5EHLA 4CZYB 3B8QA 3KCFA 1DS5A 3ZRMA 1Q61A 4DE4A 4L00A 2VX0A 4O7NA 3VONA 2YM8A 2XK7A 3DDQA 4BDFA 2ONLC 3AXWA 3V3VA 3R9NA 4A9TA 5DBXA 3R9DA 5CU3A 2BRHA 5FUTA 4U79A 2WMUA 1E9HA 2JFMA 4I5HA 1ZLTA 3DB8A 2Z7LA 4OTFA 4GRBA 4EL9A 1YDSE 1KUTA 3LMIA 4NM3A 4MVFA 4IM0A 2QG7A 2YM4A 3TV4A 2CNUA 4FV5A 4C59A 4DCEA 3CJGA 4E6DA 2CDZA 3RNIA 3VUIA 1I09A 2ZMDA 4EK5A 3LCTA 4IVDA 2EVAA 5CLPA 4R78A 4EK3A 3BQRA 4TWPA 1M14A 4FIJA 4QDVA 3DJ7A 2UZVA 2CGWA 4MX9A 3RK9A 2XCHA 3U8WA 5I5ZA 1ST4A 5AP5A 2BKKA 5HX8A 2ETKA 5F4NA 3MB6A 3UVRA 4F7SA 2OW3A 3BHVA 3NRMA 4BDHA 3Q04A 3FEGA 3NUXA 4EH7A 3NLBA 3U6JA 1MQBA 1YI4A 1AGWA 3OP5A 5TOZA 1R39A 4F0GA 4W4WA 3VUDA 3VVHA 3BYOA 2RFNA 4CKRA 2CKOA 3MH0A 3W8QA 1P2AA 4O7YA 3O96A 3OFMA 4LL0A 2RG6A 4UWCA 3FMJA 4DITA 4ANMA 4B8MA 2WTCA 3DV3A 3GCVA 2J0MB 3O71A 4M0ZA 2XNGA 3KXHA 1URCA 3R28A 4FSRA 2JDTA 3OC1A 3MJ2A 1RE8A 4HNIA 2YJRA 4BKJA 4FSNA 4M67A 3PE1A 3AD5A 3U9CA 1Q8YA 2QOKA 3LCDA 3PA5A 4BGHA 1H1RA 1KE5A 4OW8A 2YZAA 4W4YA 1LR4A 3EHAA 5DFPA 4U3YA 2PL0A 3VQUA 4AW2A 3L8VA 3RPVA 4I21A 4DEDA 3NW5A 5CZHA 2F7XE 2O0UA 2FB8A 4O4EA 3DXNA 4TWOA 4BF2A 4BTJA 4RX5A 3IDPA 1KE7A 1H00A 5DA3A 1H28A 4KINA 2IO6A 4B99A 4YHJA 2ZV7A 2OKRA 3H0ZA 4FEXA 3C4EA 5BVDA 3TM0A 3TZ8A 2ZAZA 3A7HA 2W05A 4K11A 4KBAA 4JDHA 4LDTA 4JQ7A 4FG7A 2ITTA 3DY7A 4FK6A 4LV8A 4Y72A 5FBNC 4M12A 2X1NA 1NXKA 3GOKA 4AT3A 2XNNA 1ND4A 3NW7A 4TT7A 4PL4A 5DN3A 4KB8A 2IF8A 3UOJA 2R3LA 1CM8A 3LQ3A 4FTIA 1PW2A 2GPHA 4O82A 3NX8A 2IPXA 3JUHA 4IWDA 3VUKA 3FLQA 2UW5A 4J52A 4MQ2A 4DG3E 4AZFA 2HAKA 1JLUE 2UVXA 4GUEA 2VTTA 4YHFA 4BCIA 5JFWA 3RPYA 3PWYA 2XAOA 4M3QA 3ROYA 5HBEA 2PPQA 5C1QB 2XS0A 2ZYBA 3BELA 4GU9A 4CQEA 5HG5A 4U43A 5DT3A 4ZSJA 4O0RA 3EN6A 4BCKA 3LM5A 3NZ0A 3QFVA 3ZRLA 5BYYA 3NVMB 5L3AA 4JJRA 4ACDA 4MD7E 4TWCA 3TZ7A 4CRSA 3DB6A 2DUVA 3KKVA 4FSWA 2PMIA 2VWYA 4RFMA 4F7LA 3R8ZA 3BBTB 2PMLX 4C57A 4AXFA 4AXDA 5GIOE 4ZS4A 4IWOA 3PWDA 4ASXA 3EYGA 3D5UA 3IO7A 4GVAA 4MD8E 5FLFA 4E3CA 4TL0A 4L7SA 2CMWA 3OUKA 4H3BA 4M0YA 4KBKA 3ZTXA 5LVPA 4G1WA 1VR2A 3JY0A 5DEWA 2V0DA 1LPUA 4K8AA 3EFWA 3I0OA 3OEZA 3W2OA 4BWPA 4BDBA 3OOGA 4MEDA 4HGSA 3MV5A 4LOQA 3SRVB 3WIKA 5JSMA 4AZVA 5ANEA 2R4BA 4QPAA 4JBQA 4Q5HA 4B0GA 4FIIA 3NIEA 3BLAA 2W1ZA 5AM6A 4F09A 4OAUC 5I4NA 3VUTA 3LIJA 2BDWA 5LWMA 2YWPA 4DEAA 4PDOA 5ANOA 3A99A 2YM6A 4EOOA 3CBLA 3BHHA 2X2LA 3PY0A 5EW3A 1BMKA 1U4DA 3OCBA 5IA0A 2AC3A 4AACA 2Y4IB 4EHGA 1TQPA 2BDFA 3P0MA 3P7BA 2JC6A 4HGEA 4XMOA 4CMOA 2J5FA 3LPBA 4FX3A 5AX9A 5J8IA 5LVLA 4EH8A 3W0OA 1P14A 2HCKA 5IKWA 4XG3A 2P4IA 3FKLA 2PVFA 4M66A 1WVWA 1X8BA 3QGYA 3VBWA 3LW0A 4XG9A 4QNYA 3PXRA 2UZWE 5BMSA 4FYOA 4PTCA 5LWNA 1J7IA 5JEBA 3ORNA 4JMQA 2GNFA 2O3PA 3F69A 3WIGA 4GG7A 2VU3A 1FGKA 2YLFA 2YISA 1PXNA 3BWJA 3VJNA 3UZPA 3QRJA 1WVXA 1XH5A 4I4FA 4YHTA 2X2KA 3SG9A 4FUXA 3LFAA 4RIYA 4BTKA 1W2FA 5HKMA 4QNAA 2W1GA 3WZJA 5I9UA 3ZXTA 3TTIA 2VRXA 2LAVA 3OY3A 3I4BA 4DG0E 1FINA 5H9BA 2PU8A 5TR6A 4B8LA 3LMGA 2G2IA 2BMCA 2XK8A 3BE9A 2QKWB 3R8MA 2XCKA 3MSSA 2QOIA 4DGMA 5L2IA 2CCIA 3HMNA 2YDIA 2W5BA 2R64A 4BCGA 4FSTA 4WG5A 1Y57A 3ZO1A 2BFYA 4N0SA 1W2DA 3Q5ZA 3RINA 4QP3A 2YHVA 2GMXA 4FT0A 4V0GA 3QQLA 1H07A 4MXZA 4W9WA 5BVWA 5A4TA 2ITWA 5EI8A 4ZTMA 2OH0E 2X0QA 2CKQA 2B54A 1Q3DA 2XM8A 3DTWA 3P86A 1Q97A 3FPMA 4MQ1A 2PZYA 3UP2A 4L45A 3R7OA 4EH4A 4E6QA 4QQCA 3VRZA 4LYNA 2UZNA 5A6NA 4OBQA 5JFXA 2W4KA 5ETFA 4F1TA 5A6OA 3NGAA 4FSQA 4GK3A 2GQGA 3FV8A 5JGBA 3AGMA 4FV2A 4JQEA 4U5JA 2WMWA 4RQKA 3I60A 3SLSA 1YHVA 2XM9A 4RA4A 4RWIA 4AT5A 4ZLYA 4USEA 1PMUA 5H8GA 4CNHA 5HQ0A 4ASEA 4GJ2A 3VHKA 5HOAA 1KE6A 3FXWA 3BL7A 4IXPA 4IBMA 3QRUA 3JVRA 4I6FA 4R1YA 2QG5A 2PE0A 1LEWA 3CPBA 3CQWA 3RALA 2WMBA 3LLTA 1A9UA 1Y8GA 2X0GA 1P4FA 3PJCA 4PPBA 5DT4A 5LARA 5AUTA 4I41A 4ANSA 4F63A 1FVTA 3I1AA 4WT6A 5M57A 4GJ3A 1XQZA 5AR3A 3V8TA 2IWIA 3BZ3A 4K1BA 4O4DA 4CEGA 3QKLA 4L52A 2I0HA 1VJYA 4NEUA 3B2TA 4FL1A 3FKNA 4QQ5A 3I6UA 2XJ0A 3F3WA 3GXLA 4S30A 2GS2A 3AD6A 2X6EA 3R7GA 2QLUA 5KMOA 1JWHA 1R0EA 2J90A 2WD1A 5A3XA 1WBOA 4FI1A 4DEBA 4FTMA 4E6AA 3LAUA 4YNEA 2R3IA 3E62A 3A2CA 3F9NA 5DG5A 2WZJA 3FSKA 1H27A 1Z9XA 2C69A 3KN5A 2R3NA 2YJSA 3KK8A 3PUPA 4FKLA 4FV6A 5LVOA 3DKOA 3HA6A 5HIDA 3SXRA 4TZRA 3EJ1A 3QHRA 4FIEA 5ANKA 4XH6A 3MH1A 5KZIA 3C5IA 4GMYA 3QTRA 1XBCA 1H4LA 2ITQA 2ZB1A 3COKA 3MY5A 4B7TA 2C6EA 3MTLA 2Q83A 1H24A 2WB8A 5AP3A 5HTBA 4M69A 4HPTE 4UYAA 4KSQA 5C4LA 4G6LA 1ZY4A 3C9WA 1REKA 3R83A 4BR3A 2OJFE 3SD0A 1QMZA 2W1CA 4F7NA 1Q62A 3DNEA 4E5WA 2B0QA 2PTKA 4BBEA 2KTYA 1UA2A 5E8UA 5E1SA 2C1AA 4IQ6A 1RW8A 4L7FA 1URWA 4F6WA 2XK3A 3GC0A 4DEGA 3GFWA 3NFFB 1BL6A 4F7JA 3FQEA 5C8NA 4RZWA 2FSOX 1TKIA 3MB7A 4IANA 2R3JA 1FVRA 4AA0A 4C4IA 3LHJA 1OGYA 4HPUE 4QP7A 2R9SA 4CLIA 4PMSA 3OMVA 1J3HA 1Z5MA 3U9NA 5F94A 4QOXA 3PP1A 3BL9A 2WEIA 1TQMA 4CGAA 5AA9A 1J7LA 4DBXA 5AA8A 5GHVA 4C4FA 1ZOEA 3U4UA 3BYVA 3SQQA 4X2GA 3BHTA 3UOKA 1HCKA 4EOKA 4PNKA 3B2WA 3ZO4A 3PUFC 5HZNA 4O7RA 4MK0A 3Q2MA 4D9UA 4Z16A 2I6LA 4FVQA 3GCSA 4EQMA 2A1AB 4O96A 5KHWA 4O0TA 4RWLA 1R1WA 3OUNB 2YAKA 1WMKA 1M2PA 2WPAA 4DH3A 2CPKE 5LVNA 4IX6A 5CVFA 4FTAA 1RQQA 4KNBA 4P5QA 1OL1A 4TWNA 3GCPA 3ORPA 1P4OA 2HK5A 3SOCA 3AMYA 2OLCA 4O6EA 3FMHA 4CFMA 3RP9A 2VO7A 3SG8A 2OIQA 4KS8A 2BUJA 3H10A 2GCDA 4FG8A 3BGPA 4NKAA 4QMLA 4YZNA 4LG4A 4XV9A 2QQ7A 4APCA 4BVUA 3W2QA 5CQUA 5E90A 1UU3A 3VS1A 5CWZA 3S95A 4IW0A 4RJ8A 4AW0A 5AR5A 4HZSA 3T3UA 2CGUA 3E93A 3SVVA 3ORLA 1DI9A 3KEXA 4FKOA 5DRDA 4TYHA 4BIDA 4C02A 1OBGA 5LMKA 2P55A 4BICA 3DAJA 4R3CA 4ANBA 4UALA 4CYIA 2I0EA 4DHIB 3AQVA 5ETIA 4O0WA 5FXRA 4ZZMA 3H3CA 4G6OA 2XKFA 4DGGA 4GCJA 4FRFA 4ZMEA 4NM5A 5AP1A 2QR7A 4FV3A 3KVWA 4PUZA 2HWPA 2ITXA 4O1OA 4RC4A 5HG8A 5KUPA 2YZLA 4TY1A 3MVHA 4DBNA 4RX9A 3UVPA 3LE6A 3FWQA 4JLCA 2YCFA 5L4QA 4M7IA 5M44A 1UNHA 3CP9A 1W7HA 1Y6BA 2JDRA 5FTOA 1XBBA 4AGWA 3FMDA 4KIKB 2VTPA 4L42A 3LJ2A 3ZFXA 2C6KA 4ZOGA 3D7TA 2IZSA 3GBZA 4BY9E 1AD5A 3ODYX 4Z55A 3GCUA 2NPQA 3KF7A 4PDSA 1MRUA 3UGCA 5L6OA 2J4ZA 3ML1A 5HHWA 2VGOA 2JKKA 4OTIA 1CKJA 4HVSA 2X8IA 4TYGA 4AZTA 2WFYA 3QTWA 5HLNA 3FXXA 5J9LA 2XANA 4D5HA 2A27A 4G6NA 5IQGA 3PDTA 1KV2A 4IVBA 3T9TA 3FDNA 3E63A 2VGPA 4GH2A 5F20A 4XOZA 2O63A 3NYXA 2OBJA 4OTRA 2XALA 4X21A 4NH1A 2DS1A 4GUBA 1GZKA 4GIIA 4IZ7A 4X2KA 5BPYA 3W32A 5CQWA 5IA4A 2PUUA 4CQGA 2W9ZB 1PKGA 4XLVA 4DGLC 3LFNA 1JNKA 3AC1A 3Q5IA 4X3FC 4H39A 1V0OA 4Q2AA 5E92A 1VYZA 2G1TA 4R77A 2X0PA 5KMNA 3HUBA 4IIRA 4TXCA 3DZQA 2Y0AA 2J2IB 3DBCA 3NNUA 4BBFA 1M52A 4XJ0A 2JKQA 4K33A 3MIYA 3F82A 3ORTA 4BI0A 4BCOA 3LOKA 4WRSA 3NUYA 4G3FA 3MY0A 5L2QA 1YXUA 3FLSA 3WZDA 3VBQA 4AW1A 4QP9A 2UUEA 2F57A 4C3PA 5CU2A 4IMYA 2J51A 4NJ3A 4BI2A 1GIJA 3GENA 3VS2A 3KRRA 1T46A 3QD2B 3QZFA 3TYKA 3R21A 5M55A 3E92A 2R0IA 1MQ4A 3LXLA 4G9CA 2BIKB 3VWAA 3S1HA 1F5QA 4NCTC 1PHKA 3OWPA 5B0XA 1SVEA 1YWRA 4Y8DA 2RGPA 2XUUA 3ZSIA 3U4WA 3BGZA 4JRNA 2DYLA 2R3QA 4GU6A 4YJRA 2C6DA 3V51A 3TL8A 3SDJA 3UDBA 4YTFA 4DH8A 1YXVA 4I94A 4A07A 4LM5A 4LRJA 3FUPA 1YDRE 1OKZA 3NUNA 3QWJA 4FVPA 5AUUA 4GS6A 3VUGA 2XK4A 4FTLA 3ZO2A 2J0IA 3BIZA 3Q60A 1ZYSA 4EH5A 4G5JA 4U44A 1APME 4W9XA 3V5PA 4EOMA 2XAMA 2W96B 4ACMA 4XX9A 5T68A 3R9HA 2PUPA 4U7ZA 5C4KA 2UZOA 2OJ9A 5C26A 3NPCA 4RG0A 3TNHA 2A2AA 2ESMA 4QYEA 2YDJA 3NUSA 4OBPA 5CI6A 3R6XA 2VO0A 5IA5A 2E9VA 1JKTA 1JVPP 4MXCA 4YJUA 2FUMA 4BDCA 4E4NA 3OWKA 4M8TA 3QRTA 5CEIA 3FLNC 2F2UA 2ONLA 4D9TA 4JIKA 4F9AA 1YVJA 4O4CA 5AUVA 3VS5A 5CU0A 1U54A 2O64A 3DGKA 4D0WA 5KMJA 2B9FA 3UOLA 2AC5A 3WF7A 4BKYA 4NM7A 2WO6A 3KIOC 5HG7A 4PRJA 3FAAA 4FGBA 3LXKA 4IAZA 2X39A 3GFEA 5IQCA 4W8DA 3FY0A 2IZUA 4RIXA 3GCQA 4O0VA 2OXXA 1P5EA 2QVSE 4FKTA 4LOOA 1PKDA 4EJNA 1F3MC 4D1XA 3DFAA 3E7OA 3FQSA 1SZMA 2XP2A 3QC9A 3BX5A 5L2TA 3HRFA 3Q53A 1ZOGA 5IZFA 5M56A 4MHAA 4ALVA 5IH4A 3QBNA 3F5PA 4CXAA 5IQBA 2IZTA 3R1QA 1PXPA 3BLHA 5EG3A 4DGNA 2BIYA 4A7CA 3QUEA 3CTQA 3U54A 4E7WA 4A4XA 2Y8OA 2YERA 1MRYA 5DR9A 3ZM9A 2OIDA 3MA3A 5ACBC 3LFSA 2ERZE 4ALUA 4YO6A 4KIOA 3RVGA 4NIFB 5DRBA 5D12A 3VAPA 4HZRA 1FOTA 1H26A 2B53A 5D7AA 5FD2A 5JKGA 2X9EA 5D10A 1A48A 3DBEA 3R9OA 4KKEA 3RKBA 4DAWA 2Z02A 1YOJA 3HRCA 5AV4A 1KE8A 4NU1A 1XH6A 3ANRA 3PG3A 3DJ5A 3PRIA 2REIA 4PDPA 4DT8A 2PZPA 1YW2A 3F7WA 3K2LA 1Y91A 3D15A 3MGYA 4ZSGA 3CD8A 4CKIA 5DIAA 2V5QA 5AR4A 1KOBA 3BE2A 4ZJIA 5EQYA 2VNWA 3O5AA 1PMNA 4LFIA 5C27A 4S33A 5GZAA 3P79A 3V04A 2VD5A 3NIZA 1Q8TA 5E8XA 3DS6A 3TUDA 1UNLA 4UXLA 2HY0A 2YM5A 4EOLA 4FTUA 3PJ1A 3ZEWA 3FMEA 4U0IA 1TZDA 5JFSA 2R3HA 4FF8A 3HNGA 5I9YA 3TMOA 4FZ6A 3ENHA 3ZZEA 5EKNA 3NS9A 5L8LA 3EKNA 5HO8A 3ID6C 4ENYA 2FYSA 4FV1A 1KOAA 5ACKA 2OFUA 2OK1A 4EJ7A 1W82A 3SHEA 3ATSA 1U5QA 4CYJA 4WUAA 4ZLOA 2BZIB 5DGZA 4BDEA 2CLXA 2WHBA 2Y4IC 3Q3BA 5GIPE 3D7ZA 4JG7A 1OVEA 4QMZA 4XRLA 3IW7A 2PE1A 2WGJA 4AXCA 2JAVA 4X7QA 3BYUA 3PZHA 4F1OA 4DHZA 3MFSA 5CENA 4D28A 2O8YA 3SOAA 2IW6A 3RAIA 5K5NA 4F78A 4I0RA 3W10A 3DKFA 2OI4X 2OO8X 2VN9A 2ZV8A 3MYGA 4DC2A 2XIKA 3V5LA 3V8WA 3VF8A 5EQPA 3CGFA 2WTDA 4JI9A 4O6LA 2NRYA 5GNKA 2GU8A 4QP8A 3DNDA 3DBQA 3QRIA 3DQXA 2C3KA 2V22A 3VUHA 4F08A 5AV3A 2W5HA 3PTGA 2BFXA 1UU7A 3O2MA 2ITOA 4J98A 4YJSA 5LMAA 4IAFA 5BX0A 4FA2A 2GDOA 4O0SA 4FZAB 2XZSA 4U9AA 5M4FA 1H0WA 3G9NA 5A46A 1JQHA 5EM7A 2WMSA 4YMJA 4AAYA 3CQUA 3OD6X 3C4WA 5HICA 3C0IA 3GOPA 5C8MA 2UV2A 4JBOA 3R9RA 5CEMA 3GUBA 2GNIA 5L2SA 2C3JA 3EQBA 1W98A 4UY9A 4BIBA 4CMUA 3QYWA 5AWMA 2AEGA 1V1KA 3WF9A 2VTQA 2W1DA 1OUKA 3ZLYA 5CF5A 3FYJX 1OIRA 4D1SA 5ANIA 2ITYA 2XRWA 3CY3A 3HUCA 3A4OX 3QTZA 5CYIA 3R04A 5CU6A 5CAUA 3KRXA 4JQ8A 4PMTA 5IISA 3RAHA 2C0IA 3AMBA 4BGQA 1ZAOA 3OW4A 4ZTRA 3OF0A 5DHJA 4R8QA 2OJJA 2RIOA 2F9GA 3KMMA 5JGDA 3DBFA 3R7IA 2HXLA 4EOQA 1UWJA 4I5CA 4OBOA 4AF3A 2AQXA 3C4FA 4UMUA 3F6XA 2PZRA 3FI2A 4ERKA 4HYIA 3P7AA 4I93A 1XH9A 2H9VA 3AC2A 1ZMWA 3RI1A 2NO3A 5K9IA 5B2LA 5HIEA 2GNHA 3QA8A 4RA5A 2OXDA 3IPHA 1Z57A 5D1JA 4O84A 4GIHA 4MXXA 4O38A 2WU7A 4E4MA 4F0IA 3UC3A 4IFCA 1OKVA 4CD0A 4RGJA 4O7TA 4WOVA 4C7TA 4QYYA 4EORA 2GTNA 3I5ZA 3MN3A 5T3QA 5IU2A 4B4LA 5JMSA 4FG9A 3GU4A 3R8PA 3HV5A 3O7LD 3U55A 3VNTA 4EZ5A 4EBWA 3VS3A 4ZIMA 4FE2A 4P90A 2OF2A 3MPMA 4NK9A 5CASA 4LV7A 1PXKA 3GU8A 2WTKB 3KA0A 4FSZA 4MXYA 1YHSA 4J99A 2XH5A 4BDAA 3R63A 4ASZA 5ICPA 2X2MA 4E8AA 4A06A 4CFFA 5LXMA 4NL0A 2GQRA 5FTGA 2ZDTA 4BBMA 1K3AA 5M08A 3RK5A 1O6YA 4EHZA 4K77A 2QHMA 2IW8A 4U8ZA 5I9ZA 4QYHA 2RF9A 5JZNA 4ZTQA 5IH6A 3HV6A 3HMMA 3ZZWA 1XMMA 4FOCA 2IW9A 2EWAA 1DAWA 1H0VA 2UZEA 3M2WA 1ZZ2A 2CGVA 2OH4A 3HDNA 4AN2A 2WIPA 3E8NA 2VWIA 3LM0A 1IASA 3ODZX 3IKAA 4AQKA 5IUIA 4E1ZA 3BLRA 5EI2A 2HZIA 4MNFA 3FBVA 4Z7HA 4FSMA 4O7LA 4A4LA 3RBWA 3RHKA 5B2KA 3UODA 2QLQA 5AAFA 4AGDA 1OECA 4C37A 5E91A 3AMAA 4J7BA 4ZY4A 3TWJA 2AUHA 4YSMA 3L8XA 3F5XA 3LZBA 4N70A 1CTPE 4CV8A 1OI9A 2WOTA 4IM2A 1TFFA 1DAYA 3LQ5A 2WMXA 1U5RA 3P1AA 4H1JA 4QRCA 4TW9A 5KMIA 5KKRB 4IVAA 4A9YA 4RIWA 1OIQA 4XV2A 2PMOX 2XNPA 1Q4LA 3BEGA 3GU5A 4DYMA 4PV0A 3JR1A 1PF8A 5IQEA 1OM1A 1O6LA 3UIUA 4MBJA 5CZIA 2CNVA 4YTCA 3GC9A 3OXTA 3R00A 4LGDA 4F4PA 4DDGA 3HYHA 5AR8A 2QOHA 3KRJA 3TG1A 5HTCA 2XVDA 4LL5A 3TDVA 3R1NA 5F95A 2VTRA 2YDKA 3MS9A 3BWFA 3KGAA 3ZUUA 3VUMA 2DWBA 2HENA 4E4XA 4L3PA 2XKCA 3I79A 4QPSA 3OCGA 5IUHA 4ID7A 4AGCA 2OZOA 2J0KA 2VTHA 3N4TA 1ZARA 3ZO3A 1L8TA 2YM3A 4C4HA 2P0CA 4HYUA 3CR0A 3P5KA 5CAPA 2GFSA 3ET7A 3FZSA 3UYSA 4DFUA 3FZPA 4H58A 3IW8A 3O17A 4RFYA 5AIRA 3WZEA 1DM2A 2Z8CA 3IQ7A 2I40A 1MRVA 1OPJA 3OTUA 3UG2A 4BDDA 5CAOA 3EQFA 3R7YA