4XX9A

Crystal structure of pdk1 in complex with atp and the pif-pocket ligand rf4
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
289
structure length
288
Chain Sequence
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Small-Molecule Allosteric Modulators of the Protein Kinase PDK1 from Structure-Based Docking.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xx9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xx9A01
4HGLA 4TNDA 4L7FA 5EYCA 3BYSA 2ZB1A 3FXZA 4ANOA 4XG6A 1IG1A 4B6LA 4E6CA 5CENA 4C4IA 5HKMA 4HYHA 4O2ZA 3BWJA 2PL0A 2OIQA 3WOWA 2QOFA 3AMYA 2YDJA 4XG4A 2UVZA 4YLLA 2OJIA 4QMVA 3L8PA 4FIIA 3AD5A 4BCQA 1NXKA 4C4JA 2VRXA 3L1SA 5IA3A 4FTIA 4QP9A 5A4TA 4EK5A 1JVPP 2J4ZA 3NR9A 2O3PA 3O50A 5B2LA 2VV9A 4B8LA 3D7TB 5IF1A 2J6MA 2R9SA 4HW7A 2UW7A 3FDNA 3DKCA 4TYHA 4F6UA 4Z7HA 2VTHA 4BGGA 4CCUA 1IRKA 1F5QA 2PMIA 3DQWA 3SAYA 2A1AB 5AP2A 1YDTE 2OZAA 2DYLA 2VTJA 5HLNA 4O86A 3QFVA 4MXCA 4BI0A 3NWWA 3EIDA 3ZO1A 4Z7GA 4DTAA 5DRBA 4BRXA 3KXNA 2XYNA 2UW3A 3BEGA 4FI1A 4IZ7A 5C9CA 3KF4A 4FTQA 3ZOSA 3NNWA 4WNMA 4JAJA 5LVLA 4ERWA 1FMOE 2YHVA 2UZVA 4Z16A 2F4JA 3DA6A 4U3YA 2VX1A 5DH3A 2BDFA 4FIEA 3GVUA 3FMDA 3T3VA 3N51A 3FL5A 4RFYA 3PVWA 2WQMA 3TACA 4ASZA 1NVRA 4C4HA 5IA0A 5KMMA 5M07A 4UZDA 3ZM4A 4YNEA 4BYJA 3NYVA 3QLGA 4JQ7A 5JRSA 1H1QA 3VUDA 3GOKA 5AUXA 1BI7A 1H1SA 4A4OA 1GZ8A 2CKQA 4XHKB 3F5GA 4C02A 2QU5A 3LCKA 4Y83A 2ESMA 4IZYA 3CSVA 1M7QA 1PXKA 1J1BA 3AGMA 2F2UA 4JBPA 5CT0A 2WQBA 4FEXA 4HVHA 4RWIA 5KKRB 2FSOX 3LOKA 4QYHA 3BE2A 1VR2A 4ZMEA 3EQDA 3MSSA 2EU9A 3GCQA 3QCQA 1JNKA 4O7WA 3DDQA 4FV1A 4G34A 4FIGA 5ETAA 5FG8A 3MH2A 4E4XA 1FINA 4KSPA 4FA2A 5J5TA 1IAHA 3WF9A 2VWWA 3VS0A 5A14A 4DTBA 2VGOA 3Q96A 4G6OA 2Q0NA 1M7NA 2CKOA 3AQVA 4ZIMA 3LE6A 4YJQA 3QLFA 5EOBA 3AC4A 4J97A 5IUIA 5EH0A 3UNKA 4J1RA 1DI9A 2B0QA 4KS8A 5JFVA 4Y5HA 5KMJA 1JLUE 3I7CA 4U45A 3FXWA 3AC8A 2UZOA 1Q8YA 3UZTA 3KXZA 3LLAA 2OJGA 4QT1A 3TDVA 2XNOA 4FG8A 3FKLA 2C6KA 5DT4A 4R77A 2W1CA 3M2WA 2ITUA 3R63A 4XG3A 4I24A 4LOQA 3JVRA 4U9AA 3HMIA 3VBWA 3DGKA 3FKNA 3AT2A 3SRVB 5LWNA 3RPRA 2ZYBA 1J7IA 2UZTA 1U54A 4I21A 4ZY6A 5DFPA 3R7OA 4I93A 3BEAA 3BU5A 3HDNA 4TTHB 3DNDA 3GC9A 3RPSA 3S3IA 4X3FC 2ITXA 2UUEA 4R1VA 2PZ5A 5DIAA 2QC6A 2B54A 4FR4A 2REIA 2Z7RA 4F63A 2DWBA 2OFUA 2XNGA 3QTIA 2QCSA 2R2PA 1LP4A 2AC5A 4RFMA 5K5NA 2I1MA 1Z5MA 4QMYA 4A07A 3F2RA 2GNIA 5HIDA 3ZRLA 3ERKA 1GY3A 3QCYA 4QMXA 4XG7A 2X8EA 5GZ8A 4RT7A 4OR5A 4J99A 3QCXA 3JS2A 3V01A 1X8BA 2WO6A 5CANA 5IU2A 3LKMA 4TYEA 4OBPA 3A7FA 3OP5A 3DZOA 3PXKA 2H8HA 2J5EA 3VUTA 4CFNA 3LJ2A 3WZKA 3GU5A 4AFJA 4C2WA 2RG6A 3MFSA 3R04A 3VUHA 4FTNA 5L2QA 4D2PA 3F66A 2B53A 4RJ3A 2C3IB 4QQCA 2UZWE 4BCFA 3G6HA 2HWOA 2ITOA 1DM2A 3CKXA 3G33A 3KN6A 4HYSA 4EQMA 2QHMA 5FRIA 4AA4A 2HIWA 4YP8A 3IDPA 3MFRA 3RI1A 3KMUA 2VWUA 1YI3A 3BQRA 4YBKA 3V5PA 5C8NA 4YC8A 2BRMA 4LOOA 2JKMA 4MEDA 4G6LA 5BVOA 1UKHA 3G90X 3SOAA 2JDTA 3E93A 1ND4A 1R39A 2ONLC 4W4VA 4BCGA 3DBCA 4O96A 5K5XA 4O7YA 5CY3A 1PXIA 5FEQA 1QCFA 3W8QA 4FZ6A 3ZDUA 4C3PA 3BHHA 3COKA 3C4ZA 3P7CA 3KY2A 4BWXA 5HQ0A 4D4RA 1XWSA 5K9IA 3LCDA 3HAMA 4DITA 4ACHA 3NUAA 1GIHA 3KRXA 1CKPA 5CAPA 3FE3A 1CKIA 4RZVA 5HE0A 3RKBA 2ZM1A 3O8PA 5CI6A 4J96A 5CNNA 3VBYA 5IPJA 4DFZE 3OCTA 5J79A 4WNOA 3HV7A 5J9YA 3ET7A 5A4EA 1OM1A 4EKKA 1Q8TA 2QLQA 5I3RA 4S34A 3LQ8A 3B2TA 4IVDA 3DBQA 4RX9A 3UPXA 4C4FA 1RQQA 4UX9A 5JGAA 1W0XC 5HIBA 4PRJA 5IQGA 4DG2E 2CNVA 3Q9ZA 2C3KA 5CWZA 3HL7A 3MFTA 4TRLA 4F9AA 4ACDA 3VO3A 2J0LA 3MV5A 3PJ1A 1A48A 3OT8A 1NT2A 2HY0A 4P5QA 4CNHA 2XKEA 1VEBA 3SGCA 1KV2A 1PF8A 3MVLA 4FV4A 4IWQA 5HD4A 3ENHA 4GKHA 1PMUA 4RC3A 4LQMA 4KAOA 3AC5A 4FNYA 4GJ2A 4BBMA 3TJCA 1FVTA 1V0BA 3KXXA 3OHTA 4H1JA 2XEYA 4IWPA 4YJRA 3VS3A 4CRLA 3PLAE 3GNIB 3IW4A 3MPAA 5BVFA 4W8DA 4RSSA 4XX9A 5FM2A 4F64A 5EKNA 3Q32A 4O84A 4RFZA 3O7LD 1H25A 1FQ1B 4WG4A 3O8UA 3N4TA 2XUUA 3FI8A 5HBJA 1IEPA 3BE9A 3KFAA 3A99A 3W2RA 4F1OA 4YSJA 4YUQA 4U40A 4K18A 2OKRA 3KF7A 3F2NA 4AT5A 3BU3A 4LRMA 5DA3A 2RFNA 5IQBA 4GFOA 3TZ8A 3DS6A 2V22A 3D2KA 3KEXA 1LUFA 3MDYA 3G0EA 4DT8A 4I20A 4CFFA 4JVGA 3E7OA 2PVNA 4I4EA 5E90A 1WCCA 4JLCA 2WMUA 5CEIA 4P4CA 4A4LA 3C5UA 4OTDA 3MJ1A 4CFWA 2PULA 5FBOA 2J0JA 4I41A 4TWPA 3UOKA 5FTGA 3CY3A 1AQ1A 3DB6A 5I9WA 3PZHA 5E8TA 4YZ9A 2BRBA 2EXCX 5H3QA 4EOMA 5CF5A 3EN9A 1K3AA 2AYPA 4MK0A 2QOHA 4I0SA 4G5JA 5AUZA 3HP2A 2UZBA 3KRRA 1OIUA 4YHTA 3NPCA 1REJA 4CTBA 2F7EE 1PJKA 2J51A 5HIEA 3EZVA 3MGYA 4NM5A 4CQGA 2B9FA 3EN7A 5LMAA 2QODA 2HXQA 3FSKA 2PVFA 3P9JA 3UGCA 1BI8A 3FMNA 4O7TA 4JG7A 3QRJA 2UV2A 3WYXA 5EFQA 3GFEA 5AUTA 4E5AX 3MN3A 5HO7A 4CKIA 4I6BA 3GEQA 5KX8A 4RA5A 5HVJA 4R3PA 3T9TA 1CSNA 5GIPE 2YJSA 2WIHA 3UQGA 4FKPA 5HTIA 4EL9A 1KE7A 3VW6A 3GXLA 4GFMA 1TQMA 4E4MA 3HV6A 3A4PA 4YU2A 4MF0A 2X2MA 2RFDA 4L43A 3QYWA 2C30A 5JSMA 2IJMA 4M67A 4XRJA 2JD5A 1YWVA 4M69A 1R78A 4FT3A 5HHWA 4AW2A 3ZHPC 4PMSA 4HCUA 3FZTA 1OIQA 4FZFB 4DH5A 4UWBA 1FVVA 4USDA 2R0IA 5GNKA 5HBEA 5C1QB 4TT7A 4RVMA 5EOLA 4UWYA 5EQYA 3OWPA 2BZJA 2Z7LA 4XOZA 3D5WA 4X2NA 5BVEA 3V8TA 4EQUA 5CVFA 3R7IA 4NZWB 3HYHA 3BQCA 4QOXA 2XS0A 2W96B 4CZUA 4L52A 5DWRA 4AZTA 3RALA 3MY5A 3WF8A 4NM7A 3ZLSA 4TW9A 4DEHA 2WOUA 2XIKA 3F61A 3W10A 1Q62A 4YJPA 5ANGA 1YXSA 2Y8OA 4O38A 4C34A 1PKGA 3AC1A 2YM4A 3GC0A 2QQ7A 4BWKA 2W1ZA 1WFCA 3DKGA 4BCJA 2KULA 4WNKA 4GMYA 4X2FA 3EL8A 5AR3A 2OK1A 4L9IA 5HX8A 4TYIA 5JFXA 3Q53A 2PSQA 4AX8A 5FEDA 1L8TA 2XMYA 3KGAA 4O21A 4UMTA 3Q52A 2HW6A 3EQGA 5AFVA 1KE5A 5BPYA 2GFSA 3NS9A 3ANQA 4IAKA 4PMMA 4X3FB 1YI4A 1WBTA 2GNHA 5ETCA 2F57A 4D5HA 4E73A 4BBFA 3NYXA 4BKZA 2WMRA 2Y9QA 5CT7A 4HOKA 2UW8A 3A7IA 3UP2A 4D1SA 2VZ6A 4U97A 5DI1A 2J90A 4I0RA 3V5LA 5KHXA 3DBDA 3PUPA 5IQEA 4QP6A 4D1XA 2YWVA 4FK3A 2YAKA 3O51A 2EB2A 2YJRA 5IA5A 4OBOA 4E93A 2B9IA 3CP9A 4MWHA 1R0EA 2W1GA 5IG1A 3OY3A 3RNYA 4PX6A 4FGBA 5HO6A 4F0GA 1GJOA 4OT5A 3BYOA 3N4VA 2O2UA 4O7LA 3RK5A 3EN6A 4KIKA 2HZNA 2BFXA 5CU6A 3AMAA 2W1IA 5FTOA 1ZYLA 4R7BA 3II5A 3KRWA 4GIHA 4Z55A 2XJ0A 2XNPA 3K5UA 3SOCA 2IVVA 3R02A 4AA0A 4EBVA 3CXWA 3U8WA 4MNEA 2J9MA 4V0GB 4E26A 3R2YA 4ZSAA 5CQUA 4FKIA 4DT9A 2GCDA 4GS6A 2C5OA 4F7LA 3BLRA 2FSLX 4L7SA 5C27A 3KRLA 3LCOA 3THBA 1EH4A 1RW8A 4ZJIA 2JKOA 3Q60A 3TV4A 4O6LA 3DCVA 5E8UA 4QRCA 3WARA 3ROCA 2XIYA 4FL3A 5IUGA 5AX9A 2AC3A 1OIRA 1Y91A 3D94A 3BYUA 3AG9A 2XM9A 3H0YA 4EJNA 4M12A 1OECA 3UBDA 4DGNA 4UXQA 4CKJA 1Q99A 4DCAA 1ERKA 4ZLOA 2VWIA 3PVGA 1OMWA 5A4CA 5LVMA 2J50A 2JKKA 3LFSA 4Z9LA 1R1WA 3BGQA 2C6OA 2GNJA 3RTPA 4YLJA 3OTUA 5HO8A 2OW3A 3BHTA 2F49A 2X2LA 3RGFA 3OWKA 4KBAA 4EOOA 5HCZA 4A9RA 4YTCA 2UW5A 2WIPA 3HRCA 4CFVA 2DS1A 4S32A 3IW8A 3WF7A 2GS2A 3DK7A 4WUAA 5D7AA 4N57A 1CMKE 5GZAA 3DKOA 3GU4A 3HV5A 4MQ1A 4APCA 4DEIA 3CCNA 4ZXTA 3PYYA 5LMKA 3QTUA 5BUJA 2X0GA 4R3RA 4RIXB 3F69A 4UY9A 4YR8A 2PWLA 5F9EA 4OAUC 4DTKA 4WA9A 2ITWA 3SQQA 4MD9E 3HEGA 3OFMA 2OLCA 4ZSLA 4PL5A 1U5RA 2WU6A 3LJ0A 4OUCA 4F4PA 2QD9A 4YZNA 3WI6A 3KXMA 3MTLA 4FTKA 4F7NA 3PPJA 4FKVA 4YSMA 4FKRA 2C0IA 5E8SA 5KO1A 3QC9A 4ZS0A 3ZCLA 3DXNA 2UZDA 5DR6A 3DT1A 3NAYA 2GPHA 4FEWA 3EJ1A 3D5VA 2WMVA 5AWMA 2CSNA 4RWJA 3P7BA 2QOLA 3PXFA 2CDZA 3DJ7A 2X7GA 2XCHA 4IVBA 4PDPA 2RFEA 2CKEA 3DY7A 3PXYA 5EHYA 3K3JA 3SXSA 2KTYA 3NAXA 5IQDA 5EW3A 3GQIA 3LQ5A 3IECA 2PVKA 1QMZA 2CGVA 3LCTA 4BYIA 1ATPE 2WMWA 3NYNA 5J95A 3NZ0A 3GOPA 5KMKA 4WOVA 3TN8A 3W16A 2FO0A 2ZMCA 2E9NA 3IW5A 1WBNA 3OD6X 3PDTA 2BIYA 1GZOA 1KUTA 2YCRA 3ZFYA 3DLZA 1JSVA 1GAGA 1UU3A 4FTRA 5JMSA 3D15A 2OXDA 4NJDA 2ERZE 4XCUA 2XYUA 4AOJA 1OKZA 4P5ZA 3T3UA 4YMJA 1FPUA 2C5NA 4IH8A 3FLNC 4XP3A 5KUPA 1WBWA 4FSQA 2YCFA 2ZB0A 4H3QA 5KMIA 4H39A 1YDSE 2YAAA 4RVTA 2IW9A 5JK3A 3BKBA 3UVPA 1QPDA 4D4SA 2J0IA 3HV3A 3MFUA 2CLQA 1JSTA 4LOPA 1MP8A 2G2HA 4YZDA 2NP8A 3PG1A 3TIYA 4HZSA 3ZBXA 2ITQA 4E6DA 4BGHA 4PF4A 3GCVA 3S00A 3HAVA 1ZARA 2BILB 2WOTA 4GG5A 5FLFA 4F1TA 4A9UA 4QP1A 5FQDC 3I7BA 2F7XE 3G9NA 4NCTC 3ODYX 4DFUA 4CTCA 4DFYA 3UZRA 1PMVA 5CF8A 4IB0A 1V0PA 5KZ0A 4EH7A 5EK7A 4IJ9A 4BTMA 5I0BA 5IEXA 4F6SA 4M97A 2R0UA 2WELA 4XV9A 4D4YA 1E1XA 4ZSEA 2GHLA 1OB3A 3G51A 5AV4A 3P1AA 4RVKA 3MPTA 2WHBA 5AMNA 3NMUF 3RPOA 5E1EA 1UWJA 5T6KA 4FV9A 4TYHB 5CAOA 3FHIA 3D0EA 4OTIA 4ID7A 1FOTA 2JITA 3TZ9A 2PE2A 4HGEA 5KE0A 4LGDA 2R3RA 3VUGA 2C6IA 2Z60A 3QC4A 4CCBA 5B7VA 5JQ8A 5ANJA 4GK4A 1PXNA 1XQZA 2YM5A 2OZAB 3U6JA 4PWNA 3P23A 2Z02A 4WT6A 4QYYA 5ANDA 4YZBA 1HCLA 5EQEA 3RCJA 5HE3A 1XH7A 2VO7A 2W4OA 2GTNA 5EW9A 2PZPA 5TE0A 3V6RA 4ANQA 4QTCA 4B8MA 4W8EA 4X6QC 3W8LA 3QRKA 3OXZA 4BHZA 4BCIA 3HX4A 4I5CA 2UZNA 5AV0A 4DH8A 2WXVA 3UNJA 2R3JA 4FICA 1PHKA 3L9NA 2WB8A 5CSVA 3FZ1A 4GV1A 3R73A 3ZLWA 4AWIA 3GCSA 1Q3WA 1QPCA 3EMGA 1NY3A 2ZV8A 4IMYA 3FMHA 2JIVA 2WQOA 3WIKA 3UQFA 3N4UA 4N70A 4FC0A 4KB8A 4FIJA 1ZYDA 3FPMA 3AMBA 3LXLA 3OTVA 4UMRA 3VS7A 5I5ZA 5L2TA 3DTWA 2FUMA 2RF9A 2W06A 1SVGA 3POZA 3PZEA 3Q9WA 3QQUA 3UG1A 3SG8A 4ZSJA 5IISA 4R5SA 4YC3A 2PVRA 2W7XA 2X8DA 2DQ7X 3H3CA 5BVWA 3R9DA 4D5KA 2OIBA 5IUHA 5LCJA 4FTAA 1XBAA 3H9OA 4HVSA 4FV7A 3FZRA 3ORTA 4XG8A 2QOCA 4OTPA 3RHKA 3CPBA 4O6EA 3VNTA 2JIIA 3JY0A 2WTIA 4I1ZA 1QPJA 3WF5A 2BZIB 5EDPA 2R3HA 4L67A 2R4BA 3UODA 5E9EA 4DBXA 1Y8YA 1GZNA 5C8MA 4C2VA 2OBJA 3PY0A 4YHJA 3TKHA 2CLXA 4PL4A 3FYKX 4OTRA 1JOWB 4RJ5A 5DPVA 4QMUA 2UW0A 3OOMA 4QP2A 5AEPA 4O0TA 3F9NA 3FY0A 3PSBA 1YHWA 2VX3A 3V51A 2VUWA 4K2RA 4MBLA 4W9XA 4KWPA 3ZSGA 4QTDA 1H1PA 1U54B 4WG5A 4GJ3A 3V8SA 4KINA 4RJ6A 5HEZA 5I4NA 5KCVA 2C6DA 2W5BA 2BKKA 2ZM3A 3NNUA 4LL5A 4O81A 4Y85A 4F99A 3S0OA 4IM3A 4QYFA 3VQHA 5JT2A 3MPMA 4XBRA 2NRUA 3C4FA 2ITYA 4JDKA 5DGZA 3W55A 2O8YA 5E91A 2OFVA 4BZOA 1KOAA 3GB2A 4ZTHA 4E4LA 4AU8A 2XIRA 3HDMA 4FNWA 5BMSA 4IB5A 3QYZA 5GJFA 3T8OA 3I81A 4M3QA 4R3CA 5HGIA 4JXFA 4FUXA 4XP2A 4ANBA 3ULZA 3DJ5A 5AM7A 4ZTSA 5AV1A 3IPHA 4AS0A 1CKJA 5DE2A 5CAVA 2XK9A 3MH0A 4FOCA 5I9YA 4S31A 4DYMA 4BDEA 4DN5A 3KQ7A 4ZTLA 2YLEA 4RC4A 3GU8A 4EOKA 4OAVB 2O5KA 3QBNA 1H0WA 1Z9XA 1V0OA 2JLDA 4QTBA 3F3TA 5CZHA 3LFCA 4GG7A 4M0ZA 4W4YA 1FGIA 2C47A 4HNIA 3IW7A 2JC6A 4FV5A 3HMNA 3ATSA 4ZK5A 4L6QA 4EEVA 3CKWA 2XBJA 2FGIA 2PVLA 3K2LA 2BFYA 4JX3A 3GUBA 2BTRA 1YOJA 4RJ4A 4YPDA 4AXAA 3EKNA 5D7VA 3QQGA 3R71A 5FM3A 4BDAA 2YERA 4I3ZA 3U9NA 2NNWB 3KL8A 3UIBA 5FDPA 5FXRA 2XM8A 3PJCA 1WVXA 4HGSA 5HD7A 4DC2A 2X1NA 5IQHA 1RE8A 4B99A 1Q8UA 3W2PA 3GFWA 4Q9ZA 1I09A 4K8AA 3FLYA 4O1OA 3G5DA 4FTCA 4J8NA 3LM5A 3RZFA 3H9FA 3NCGA 3OWJA 5TT7A 4P7EA 4F1MA 5E8VA 4QP7A 2B1PA 4Y5QA 3GCPA 4IQ6A 2BZHB 4OGRA 1P5EA 1YRPA 3CD3A 4FKGA 2P2HA 4IFGA 2ACXA 4A4XA 4QTAA 5CYIA 2YIRA 5DHJA 2OSCA 4IZ5A 3C0GA 3ZFXA 2QOOA 5BYZA 3UOJA 1QPEA 2R64A 2FB8A 3AGLA 1OUYA 2PVHA 3LMGA 4TY1A 3E8NA 2JFMA 4W4XA 2BZKB 3EHAA 3POOA 5IKWA 3SVVA 4BCHA 2OZOA 5J9ZA 2YEXA 2BKZA 2WZJA 4KSQA 5LMKC 2LGCA 4RWLA 3FPQA 5BVNA 4DA5A 3QZIA 5IQFA 4J95A 4KS7A 4MD7E 4OTWA 4XS2A 5D10A 1Q97A 2GHMA 2QO7A 5FWKK 4M14A 3Q6WA 3BHUA 4NW6A 4W4WA 4YNOA 3LJ1A 2PZRA 3BI6A 3NX8A 3OW4A 4U6RA 4DCEA 1W7HA 4AGDA 4RG0A 1O6YA 3L9MA 4GEOA 2GU8A 2ZOQA 3OBJA 4EH8A 3FSFA 4OT6A 2HOGA 3VJOA 4BDFA 4R78A 3R9RA 5K0XA 4I6FA 5BVKA 1UU9A 3R01A 3LAUA 4DBNA 4PDSA 2OXXA 2CMWA 4GT4A 4EHGA 4ZZOA 5AR7A 4TKSA 3KCKA 3OROA 2LAVA 1ZOEA 3KULB 5L3AA 4HPTE 1BLXA 2ITZA 3TXOA 1OI9A 3Q6UA 3O17A 3UG2A 3KREA 4FSYA 5LWMA 5DEYA 5CQWA 3IONA 3ZYAA 2Y4PA 4NFMA 3DK6A 2UZEA 2H96A 3NW7A 3ODZX 1KWPA 3LFEA 4FVQA 4LUEA 2PUUA 3O8TA 4RX7A 4B0GA 1WBSA 3E64A 4FYOA 4DH3A 4IACA 4DF3A 5TR6A 4FSTA 1MUOA 3BLQA 1PYEA 1XH9A 2YDIA 2ETRA 2WU7A 3EN5A 4FKLA 1E1VA 4QP3A 2XBAA 2YWPA 2WTCA 3UO5A 4NK9A 5A6OA 3UPZA 3LPBA 4QMOA 5BYYA 4CFMA 4LL0A 3RHXA 2BDJA 2YN8A 3GQLA 3UC3A 2PY3A 1GIJA 4GVJA 4FZAB 4Q2AA 4MQ2A 4JQ8A 5KMLA 4JI9A 5IH6A 2JDOA 3C50A 3PLSA 5L8LA 5IDPA 5KMOA 1ZAOA 1WVYA 4IWDA 5HNIX 4CLJA 4F9YA 1YXXA 2E9UA 3B8QA 5HVYA 4DGLC 4BVUA 2VO3A 3DFCB 1ZY5A 2P2IA 3OCGA 2IN6A 5M51A 3S4QA 3LFQA 3VWAA 4OW8A 4HZRA 2OXYA 3Q4UA 4CSVA 2IZTA 2VAGA 4DEDA 2ETMA 1OKYA 5AA9A 2WTKC 3DAJA 2JAVA 4O2PA 4ACMA 5GZ9A 4D1ZA 4G16A 3ZBFA 3WZDA 3GBZA 3OXTA 4B9DA 4O22A 5M55A 3MY1A 3PFQA 3Q04A 4QMMA 3ZC5A 4M0YA 3CD8A 3PP0A 5C8KA 5E4HA 1ZYJA 3Q2JA 4FKTA 4K6ZA 3RM6A 2G2FA 3FZSA 5L2WA 2YLFA 4M69B 5LJJA 2I7QA 2YM6A 1ZRZA 3FXXA 5IQCA 3OVVA 3QRTA 4O7VA 2F7ZE 3GU7A 5ANIA 4BHNA 3EWHA 4PP9A 1QL6A 3EQCA 2XNNA 2Q83A 3JY9A 3KXGA 3Q3BA 2NPQA 2YCQA 3GGFA 2VWBA 2GQSA 4UEUA 5EG3A 5JEBA 4BFMA 5HU9A 2CN8A 1TKIA 3TWJA 3QKLA 2C5VA 4RIWA 5LXMA 3VBVA 1J3HA 4GIIA 2PVYA 1RJBA 3C51A 4CYJA 2C6LA 3OEZA 4MBJA 4YBJA 3VVHA 4YGAA 5IZFA 4CV9A 3PY1A 4QMTA 4MAOA 5DEWA 3F3UA 1CDKA 3G6GA 4FTOA 2XK4A 4KRCA 1XHAA 3LFBA 4FUYA 5E8WA 5H9BA 3VIDA 4NIFA 3MH3A 4G2FA 2PZIA 3ETAA 1R0PA 3IG7A 3KULA 3QQLA 4ASEA 4AZWA 3UZPA 5E1SA 4I5PA 3R8PA 2OH4A 2A2AA 2GDOA 1WZYA 4D2VA 5TKDA 4DEAA 3BELA 1BYGA 4UMQA 2X7FA 4LMUA 3ZO3A 4AUAA 3OC1A 4BCPA 1W83A 5L6PA 3E7VA 4XV3A 4NL0A 4F9WA 4FK6A 3EN4A 2IPXA 1TQIA 2H9VA 1SVHA 5M09A 2CCIA 4NH1A 5AP4A 1UV5A 5L2IA 3Q4ZA 2YZAA 4XJ0A 5CF4A 3LIJA 5AP3A 2W1EA 4CVAA 1IA8A 4C3FA 2C5YA 3MB7A 4ONAA 4O7RA 2C69A 2VTLA 3FQEA 3LZBA 4WNPA 2OI4X 4JT3A 2B4SB 2XVDA 4PPCA 4YJOA 4AW0A 1H24A 3QGWA 3BPRA 3R28A 3P08A 4KIKB 3IOKA 3A7HA 2CHLA 1SYKA 1XBCA 3IOPA 5M4IA 3PA5A 2OJFE 1ZMUA 3H9RA 4C62A 4D0XA 4XV1A 3E92A 3SG9A 2W05A 4G9CA 4QMZA 2IW8A 3V5JA 3NYOA 4AT4A 4L01A 4EK3A 2BR1A 4FT0A 3R9OA 4JOAA 4MNEB 5AR4A 3ROYA 3NNXA 4LV8A 2GS7A 2JDRA 3QRIA 4FSWA 4I94A 4O7NA 1SNUA 1O6KA 4L3LA 4ZY4A 4KKGA 4KIOA 4FKUA 4BZDA 4RWKA 4EUTA 3LLTA 4YJTA 4AGWA 1AGWA 2XB7A 3TNQB 3HVCA 4L3JA 2HXLA 2Z2WA 3GP0A 4BDGA 3VF8A 3DU8A 2WFYA 2ZAZA 2PVMA 5I9UA 3HRBA 3A60A 3QTQA 1Q8ZA 3MS9A 4R7IA 3RCDA 3OXIA 4ALWA 3FJQE 3NGAA 4J71A 3UP7A 1A06A 3D83A 3HGKA 3E8EA 3W1FA 3S1HA 4USFA 3CJGA 1SMHA 3R7YA 5FXSA 3I5NA 1KE9A 4CMTA 4AZVA 3QQHA 2VNWA 2G9XA 2E9VA 1PXLA 4JR7A 4M8TA 4C8BA 2W4KA 1S9JA 2BRGA 4JRVA 3NSZA 3KCFA 3ZTXA 1KOBA 2PE1A 5FEEA 2EUFB 3LXPA 3A61A 4GFGA 2GTMA 3JYAA 4YJSA 3R83A 1FVRA 2BUJA 1K2PA 3O71A 5FUTA 3FMLA 5F20A 3OOGA 2OWBA 4EOSA 3B8RA 4UB7A 3FEGA 1DAYA 3DBFA 3JXWA 4IAFA 4EWHA 4ZMFA 3NNVA 3EYGA 4C36A 1H8FA 2V7AA 3LM0A 4JX7A 3TI1A 2I0HA 5HNGA 4D2RA 4XNEA 5KHWA 3DXQA 4L3PA 4KKHA 1YOMA 4LFIA 4PPBA 5AP5A 4EC9A 4FZDB 1H00A 4YURA 2VD5A 5EHOA 4MVFA 2IG7A 3NVKI 3I0OA 4K1BA 4OTFA 4RC2A 3FMMA 5DN3A 4S2ZA 2O64A 4WSQA 1W84A 4XRLA 3U9CA 4G3CA 3PIZA 5AJQA 5F4NA 2VWZA 2BHHA 3EYHA 4QPMA 4IWOA 1DAWA 3Q5IA 1AD5A 4H3PA 5H2UA 1T45A 3ACJA 5TO8A 4ALUA 4ANLA 4BY9E 1H27A 3PJ2A 1P4OA 5CSWA 2IVTA 5T3QA 3PIYA 2YM8A 3COHA 2OH0E 4HNFA 4JDJA 4PUZA 2XA4A 4V05A 4FTUA 3DTCA 5HU3A 2X81A 2GNGA 2UVXA 2YABA 3PSCA 4AP7A 5C4LA 2HZIA 3Q4CA 4A9YA 4YJUA 5L6WL 1G8AA 2VTNA 2CGUA 3SW7A 1JWHA 4Z3VA 3H10A 3V8WA 1E9HA 4MBIA 2C1AA 2EWAA 3QXPA 3FAAA 3KVWA 3JR1A 5J9LA 4ACCA 1U46A 3OT3A 3QTZA 3TKIA 3VUMA 3ZONA 3HMMA 4ALVA 4DFLA 3A8WA 3NVMB 4DFBA 4I22A 4JAIA 3R1QA 4PTGA 3MIYA 2YACA 3C4CA 4FX3A 1JBPE 2EVAA 4JBQA 3W18A 4KIQA 4ZLYA 4RQKA 4FV2A 3ZU7A 4QPSA 5HG8A 1IA9A 4TN6A 1H28A 2PPQA 2UZUE 5CVGA 3WF6A 1APME 3MTFA 3PA3A 3RAWA 4MNFA 3V3VA 4ZZNA 5HVKA 3IDCA 4AACA 4QPAA 2WTKB 4V01A 2W0JA 2B9HA 4WRGA 2I0VA 3D4QA 4D2TA 1Q3DA 3C0HA 2VTTA 2JEDA 3CGOA 3PXRA 3V5WA 4LMNA 2XIZA 2FA2A 2BAKA 5CU2A 4EHVA 4FV0A 5BVDA 2CGWA 2BAQA 4Q5EA 4IB1A 3TL8A 1CM8A 3C0IA 4FTLA 5B2KA 5GJDA 4O83A 2QNJA 4MF1A 2R7IA 3R8LA 3CE3A 3F3VA 2JKQA 5DNRA 1XH4A 5AR2A 4G6NA 4G1WA 1SM2A 2WMSA 2HWPA 3DV3A 3KKVA 4FVRA 5EQPA 2XK6A 3F2AA 4UBAA 4GW8A 1OIYA 5H8BA 4AG8A 1KV1A 4FKSA 2R3GA 4NM0A 4E4NA 3IGGA 4TYGA 3NUNA 4HVIA 3KN5A 5JZJA 4YZMA 4O82A 2YCSA 1OUKA 3ORIA 4X2JA 5BNJA 1OGUA 4JRNA 4CMOA 2X2KA 3FLSA 5HG9A 5CEKA 4EOLA 4YHFA 4FEQA 4ZSGA 5ANEA 5HG7A 4QQTA 4EH2A 3E88A 4E6AA 1UKIA 2H34A 2AUHA 4DINA 3D9VA 5FDXA 2QHNA 3LFAA 4IE9A 4YPSA 2JIUA 4HYIA 3G0FA 2RIOA 1PMEA 2GHGA 3E8DA 4KKEA 3L8VA 4H3BA 4U0IA 4UN0C 4BCMA 5B2MA 4K11A 3BCEA 5M4CA 4QP4A 4HVGA 5LQFA 3TNWA 2ZMDA 3WBLA 3SA0A 3F5UA 5HTCA 4AGCA 3QKKA 2C0TA 3PA4A 4J52A 3OF0A 1BX6A 1PXPA 1U5QA 2VNYA 4OBQA 4IX3A 4U44A 3L9PA 4Y8DA 3UMXA 2YIWA 1OZ1A 4BDKA 3P86A 5LOHA 4PTCA 4QMLA 5J5SA 4PNKA 3TV6A 5GHVA 4LGGA 2IW6A 3PTGA 4EH4A 1UNHA 4UYAA 1OPKA 4IDVA 3FI3A 1H4LA 4IDTA 2BAJA 4TZRA 1XH8A 4G5PA 4WBBB 5DRDA 3N9XA 4RA4A 3VRZA 4LG4A 3WZEA 3PSDA 4FSMA 5HE1A 4Q9SA 2OF2A 3VULA 4DGMA 4DEEA 4PP7A 3R1SA 5A54A 4G3DA 4HCVA 4QQ5A 2R5TA 2O65A 3F6XA 4BI2A 4FSZA 4X2GA 4NTSA 2YM7A 1GZKA 3O23A 4J53A 1YVJA 2X8IA 2XJ1A 3ID6C 4MXYA 4FT5A 4JJRA 5BQ0A 3AD4A 4IHPA 3CIKA 5EM5A 2QOKA 3NUYA 4U41A 3WYYA 2R7BA 2UW4A 1PW2A 3MYGA 4ERKA 3TDWA 3VRYA 2I0YA 3DBEA 1GOLA 5DT3A 1H0VA 4USEA 4KNBA 2NO3A 4KBKA 1G5SA 4QQJA 5TF9A 5GJGA 2W9ZB 5LMBA 4NM3A 5JH6A 3U6HA 3FBVA 5IMXA 2IO6A 5HE2A 1S9IA 4HJOA 3W32A 2QR8A 4I6HA 2WGJA 5HBHA 5ACKA 5C03A 5DR2A 1Y8GA 2A19B 1B38A 4JR3A 3DB8A 5M06A 3UO4A 3P7AA 3R7VA 3RK7A 3W33A 4CGAA 4M84A 3UIMA 1OVEA 3EFKA 1UNGA 1JKSA 1M52A 4GYIA 4YJNA 4V04A 5AUYA 5KBRA 5AP1A 4GK2A 1M2RA 5CU3A 2EXMA 4D2SA 2Z7SA 5HCYA 3EQHA 3R00A 2PVJA 3WE4A 4BTFA 5FTQA 1ZLTA 3PXQA 5IEYA 4RQVA 4U3ZA 5IH5A 1G3NA 2G15A 2IZUA 2PMLX 3DDPA 3KA0A 3QQFA 4U7ZA 1BMKA 1CTPE 1IAJA 3FUPA 5CF6A 3QTXA 4I5HA 2XNBA 4BTKA 3CR0A 4JQEA 4DH7A 2IVUA 5IDNA 1Y6BA 4C35A 4RLLA 3A62A 4ZY5A 4BICA 1LEWA 3QL8A 3O0GA 4QMNA 1L3RE 3F7WA 3I1AA 5J1WA 3C5IA 3TZ7A 2VO0A 4JIKA 1W98A 1XBBA 4ITJA 4XLIA 4AN3A 3UMWA 4XUFA 3EKKA 2BALA 3RZBA 3PVBA 4M15A 3CQUA 3L9LA 4FEUA 5HORA 2H6DA 3TCPA 4MXZA 2W99B 3PE1A 2WTWA 3JVSA 4WIHA 4Y73A 4ASXA 3TKUA 2R3OA 3VUKA 2ZM4A 3VBTA 4BCOA 4O91A 5CXZA 4C58A 4UXLA 3SX9A 5HZNA 2V62A 4F6WA 4EH3A 3RP9A 3TM0A 2XRUA 1OPJA 3KK9A 3SXFA 5EYDA 4LRKA 1PMNA 3DAEA 3FZPA 4OTQA 3SXRA 4TNBA 2QG7A 4EK6A 3QTSA 4WHZA 5KZIA 2UZLA 1YI6A 2WPAA 2I6LA 3LVPA 2JDSA 3QTWA 4NT4A 4UWCA 5EI8A 3TNPC 3G15A 4Y46A 1REKA 4M7IA 3C1XA 3NUXA 3E63A 4CXAA 4E5BA 2ZJWA 4I0TA 2RL5A 4MTAA 3VS5A 4AE9A 2XK8A 2C6TA 4Y72A 5I9XA 3RVGA 4EZ5A 1OITA 4C7TA 1PRYA 4CQEA 4RZWA 4LUDA 4RX5A 2Y0AA 3F3ZA 3H4JA 4XEYA 2JBPA 5F95A 4YO4A 2W9FB 3NW6A 5C4KA 3KC3A 4FV6A 3DAKA 1Q8WA 2HCKA 1UA2A 2Y4IC 2HK5A 1ZOGA 3GC7A 4FKQA 3MW1A 2XIXA 3ORXA 2V0DA 3QA0A 5EM8A 5LVNA 3IK3A 4BTJA 4IVAA 3GI3A 5J8IA 3SC1A 3WE8A 3AT4A 2B52A 2E9PA 4XP0A 3BYVA 1P14A 2BROA 4YTFA 2JAMA 4G17A 4EH9A 5L2SA 4CRSA 4D2WA 2VO6A 3KK8A 4GYGA 4H1MA 4RIYA 3QZHA 4I92A 3OY1A 3ZO2A 3RINA 3ZM9A 3KXHA 1H08A 2BDWA 3WIGA 5C26A 5IA4A 3V04A 1H1WA 4JS8A 5IH4A 4FYNA 3C4EA 4FMQA 4PV0A 3AD6A 2X9EA 4P2KA 3GC8A 1WBPA 3TTJA 4BL1A 3FMKA 2V55A 1IR3A 3S95A 4PMPA 4EORA 2RSVA 5AR5A 1FBNA 3UNZA 4O0VA 5CAUA 3AT3A 4YJVA 5A6NA 3ZO4A 2ZV2A 4RMZA 5KBQA 4WUNA 5DOSA 3U4UA 5EDRA 4CFUA 2RKUA 2P55A 4F9BA 4JG8A 4MXAA 3QD2B 3MVJA 5M57A 2XZSA 3R7GA 5AAEA 2OU7A 1OL7A 3GENA 2ITPA 3GT8A 3VF9A 4KRDA 3IS5A 5HLWA 3W2SA 5JKGA 1J7LA 1MQ4A 4J8MA 5DT0A 5FP5A 3ORNA 2WQNA 4IC7A 4XG9A 3ZFMA 4AN2A 5LCKA 2YM3A 4EOJA 1BL6A 4J7BA 3BV2A 1XH5A 2Q0BA 3EFLA 2PHKA 3PPZA 2BIKB 4CT2A 2OO8X 1P4FA 4RPVA 4K77A 1I44A 3NEWA 1NW1A 3FKOA 3OCBA 3A8XA 2W5AA 3ZRKA 3I4BA 3A4OX 3SKCA 4QD6A 2I0EA 3BU6A 2W1FA 3TEIA 1YDRE 5K4JA 4WKQA 1ZYSA 4NWMA 5LARA 3VHEA 4QNYA 2GS6A 3ALNA 2PU8A 1ZZLA 2B55A 3EQRA 3DOGA 5C01A 4BC6A 4PPAA 3MA3A 4I23A 2PMNX 2HY81 4BZNA 4AZSA 4II5A 5L4QA 3NRMA 4KIPA 1YXUA 4FL2A 4F65A 4F0FA 4FEVA 5A46A 2YA9A 2J0KA 1OKVA 4MWIA 2X4ZA 2XNEA 1IASA 2OG8A 2E2BA 3ACKA 4BGQA 4U81A 3VS6A 5DLSA 4CKRA 5DYJA 3MWUA 4WSYA 4O0WA 4C0TA 3UC4A 3PE2A 2CKPA 2UW9A 4AT3A 3F82A 3A2CA 5JQ5A 3NUSA 1YXTA 3MIAA 3DFAA 4ZLZA 2HYYA 3ITZA 2Z8CA 4AN9A 2R3KA 1FMKA 5HCXA 1J7UA 2UW6A 3C9WA 4DFXE 4EK4A 4JDIA 2WQEA 2X6EA 3KMWA 3V5QA 4HVDA 4NYEA 4AQCA 1XR1A 1Z57A 3OW3A 3PRFA 2XH5A 4QNAA 5AV2A 2UVYA 3ZZEA 4ANNA 4ITIA 5J7HA 4NTTA 3R9HA 4YZCA 5JGDA 4GT5A 5CXHA 4RIWB 3EZRA 2IZRA 3MB6A 4M13A 2CCHA 3MY0A 3HZTA 4WBOA 5CVHA 3UOHA 3FYJX 4GT3A 5EM7A 5HLPA 3QALE 4O1PA 5HESA 4A7CA 2DUVA 3ZUTA 4GU9A 1JKLA 2VTSA 3OG7A 3MVHA 3PWYA 4IVCA 4LM5A 3UDBA 3AXWA 5I9VA 2WTJA 2OIDA 3ZC6A 3VJNA 3SD0A 3COMA 4E5WA 2CGXA 4DGGA 1B39A 4NW5A 4GKIA 4NIFB 3QHWA 3UE4A 4JDHA 4A9TA 4K9YA 2OJJA 1URWA 1W8CA 2B9JA 1NA7A 4TPTA 4WD5A 1JPAA 3M11A 4M66A 4XYFA 4EH5A 3D7TA 4G3GA 3R22A 4WG3A 4D55A 5EYMA 2HENA 5AAFA 4BDIA 3VBXA 3QQJA 4EJ7A 3TTIA 4IXPA 3PIXA 5AP7A 2P4IA 5EKOA 4YC6A 3R2BA 3EH9A 4B4LA 4DGOA 2QU6A 5KNJA 4FIFA 5JZNA 4KUJA 2F9GA 2X6DA 2SRCA 4K33A 4DH1A 1XJDA 4R1YA 1ZMWA 4CG8A 5HOAA 2O0UA 1UU7A 5AUWA 5HNBA 2R3LA 3D2IA 4UALA 2XKFA 5FP6A 4EBWA 4X3JA 1WVWA 3MH1A 5DMZA 4FZ7A 4BF2A 4CEGA 3U54A 5CU0A 3ZLYA 5BUIA 4N6YA 4F7SA 5BX0A 5AX3A 2B7AA 3QA8A 3OS3A 4FV8A 4E8AA 1UU8A 5AP6A 4BDBA 3IGOA 5CAQA 3ZDIA 2HAKA 3ELJA 4TYJA 3LW0A 1YOLA 1ZXEA 4U42A 3ZRMA 4GU6A 3E62A 4IEBA 2WMXA 4AZFA 5IQAA 5F1ZA 3ATTA 5L8JA 1M2PA 4CZTA 2WMQA 5AV3A 3ZXTA 4C37A 4IANA 4MXXA 2E9OA 3F3WA 4TWCA 2WKMA 4YTHA 3ZZWA 5HG5A 4IX4A 5A4LA 4HPUE 2VWYA 3VHKA 2ITNA 1DS5A 2VTOA 3RBWA 3W2CA 4ZS4A 4RGJA 4DLJA 3R8VA 4NSTA 2GNFA 4RVLA 4FF8A 3RAHA 5HTBA 3Q9YA 4EYMA 4TL0A 1M14A 3HMPA 2WAJA 3BGPA 3CQEA 3DJ6A 2XNMA 3QZFA 4FSRA 5AUVA 3V5TA 4A9SA 4BCNA 3B2WA 3HLLA 4AZEA 2FH9A 4QMSA 2Y4IB 4P90A 4A06A 5K0KA 5ACBC 3U55A 3K5VA 2R3FA 2VN9A 4BR3A 3MESA 4N6ZA 2VTQA 3QKMA 4LI5A 3VN9A 4F09A 3G2FA 2VTIA 2W1HA 3Q5ZA 3ORMA 3MJ2A 5D1JA 4CLIA 4UV0A 2I40A 3NUUA 3FLQA 4HYUA 4L44A 4X6RA 3QGYA 3LMIA 3MVMA 2YIQA 3F5PA 2NRYA 2C4GA 4UZHA 2V7OA 4ANMA 4BN1A 5DBXA 1JKKA 2XKDA 3AC2A 5FGKA 3SRVA 4ZTMA 3BHYA 4ENXA 4GVAA 2QOQA 4BDDA 3IW6A 3Q2MA 4I4FA 1VYZA 2CN5A 2YFXA 3QRUA 5KMNA 4G3EA 1YWNA 5M4UA 2GFCA 3UOLA 2QG5A 4IM0A 5D11A 5AR8A 2R3PA 4QMQA 5CEPA 4ORKA 3D5XA 4U43A 3U51A 4ZJJA 4MCVA 3O2MA 4RIOA 5D9HA 5EI6A 1A9UA 3I6WA 3OCSA 1FGKA 4NCTA 2QOBA 3CY2A 3KRJA 3QCSA 5FD2A 2XJ2A 5ANOA 4C4EA 2YDKA 3C7QA 4QMWA 3W2OA 1MQBA 2QLUA 5DVRA 2C5XA 2XEZA 3BBWA 4D4VA 4EKLA 3RWPA 4PQNA 4RBLA 5AIRA 3VUIA 4BDJA 1JKTA 4H36A 1SNXA 3QD0A 4XMOA 3PY3A 4XBUA 4DEBA 5IA2A 4AF3A 3I79A 2PK9A 4FOBA 4FE2A 4GCJA 2WD1A 5CSXA 4MX9A 4BB4A 1VJYA 4EOQA 3UIUA 2QO2A 1DI8A 2W17A 4GK3A 4FKJA 2WEIA 3RWQA 5L6OA 3ZEPA 3R6XA 2GMXA 4XOYA 3Q9XA 1W82A 3MBLA 4EOIA 3VQUA 4XG2A 3TV7A 3K3IA 3PVUA 5A3XA 4IX6A 4K0YA 2ITTA 3BGZA 5AA8A 1JSUA 4D28A 5I9ZA 3FQHA 3P4KA 3F5XA 3IKAA 4IIRA 2YISA 4L45A 3HA8A 3NW5A 4JIAA 3NIEA 1Q24A 3S2PA 3JUHA 4FG7A 4FTJA 3UQCA 2RGPA 2JGZA 4IW0A 5G6VA 4AE6A 4IB3A 3SV0A 3QX2A 3R9NA 4JG6A 4DG0E 4TXCA 4ZEGA 2HELA 3RPYA 5F94A 2R3IA 4EK8A 3P0MA 1V1KA 2FSMX 4PY1A 1YHSA 1TVOA 4O0SA 4NKAA 4EHEA 2XP2A 2C3JA 5AAGA 4C3RA 2X39A 4D9TA 3QUPA 5EI2A 4E20A 3D5UA 4FT9A 4KBCA 4G3FA 4QYEA 2YZLA 3KU2A 3OZ6A 3KB7A 3E8CA 2BCJA 1GIIA 3R1NA 3M42A 4CV8A 4FTTA 4H05A 1WBVA 2VX0A 4F9CA 4MXOA 3CQWA 3LFNA 3FC1X 3RJCA 4JNWA 5DR9A 4D0WA 5G1XA 1OL5A 4CD0A 5M08A 3OBGA 3CJFA 5E92A 2EB3A 2IWIA 5JGBA 3RNIA 3OUKA 4AGUA 3BLHA 4CMUA 2VTPA 3QUEA 3VS4A 3HP5A 3LMHA 2G2IA 5BYLA 4AAAA 4UYNA 2QI8A 4OLIA 5EW8A 2PUNA 3R21A 4O0XA 1ZZ2A 4DAWA 5L8KA 3I6UA 5ANKA 3C4XA 1OL6A 2ZV7A 4GL9A 5M4FA 4FNXA 5EDQA 5CS6A 3CPCA 2OF4A 4FTMA 4O0UA 3WILA 3QWKA 3ZXZA 3VC4A 3CC6A 3UVQA 4FNZA 4NFNA 2EXEA 4E1ZA 2JFLA 4EYJA 4C59A 2X7OA 3GU6A 2XCKA 4WO5A 1LR4A 2CJMA 1SVEA 1HCKA 3R8MA 4FODA 4C38A 3ORLA 4EZ3A 3EFJA 4L46A 3COIA 4E7WA 3NCZA 2GSFA 2QURA 1OPLA 1VYWA 5DG5A 4ZTRA 1LPUA 1B6CB 4GUBA 4FBXA 4KABA 3VS2A 4RLKA 3IQ7A 2QONA 2ITVA 2W4JA 1K9AA 4IM2A 5ETFA 3RM7A 5CTPA 3K54A 2V5QA 3ANRA 3HRFA 4CZYB 1F0QA 4C61A 5IMEA 4XV2A 4BKYA 4EWQA 3LCSA 3QZGA 4R5YA 5M53A 2A0CX 1YWRA 1Y6AA 4U79A 4U80A 1LEZA 1TQPA 1U4DA 2BVAA 4C57A 2A27A 2ZDTA 1YXVA 3V6SA 4ANSA 3FQSA 2VTAA 2WMAA 3R0TA 1O6LA 3PG3A 1ZYCA 4TWOA 3RAKA 3QQKA 4NUSA 1M2QA 3EOCA 1NVSA 2C6MA 3QTRA 3QWJA 2WTDA 3SW4A 4QP8A 5H8EA 4E3CA 4EQCA 4EI4A 5K4IA 5M56A 1J1CA 4HCTA 3FL4A 4GRBA 2BMCA 1H26A 2C68A 5T68A 3BRBA 5AIKA 1OKWA 4ZOGA 4LRJA 4ZAUA 4GUEA 5EYKA 1WAKA 4GSBA 5ITAA 5E7RA 3BV3A 4O7SA 1MRYA 1Q4LA 2BHEA 3LXNA 3R8ZA 2ZV9A 4MKCA 3EFWA 5A9UA 4FT7A 2GQRA 2G1TA 4I5MA 3E3PA 4BCKA 5FBNC 4U5JA 4APPA 3PJ3A 4DLIA 3DQXA 5CLPA 2Y6OA 5I3OA 4FKOA 4BDCA 2C0OA 3DPKA 3CLYA 4M68A 3ORPA 4XLVA 1U59A 1STCE 2XK3A 4EUUA 1O9UA 2GNLA 3E87A 3ZUVA 4DE4A 3FV8A 2CNUA 2QKWB 2QVSE 3FC2A 3UIXA 1PYXA 3FI4A 3NDMA 4NEUA 4XH6A 4G31A 3U87A 3F88A 2QKRA 4BKJA 5IEVA 3KVXA 3L8SA 4N0SA 4IFCA 2VTRA 3ULIA 3TZMA 3ZH8A 4X0MA 3FLWA 4AA5A 3QAME 3DLSA 4RJ8A 3WZJA 1BKXA 4BIBA 5LVOA 3PRIA 3LFFA 3AC3A 3P79A 4JBVA 2A4LA 4L68A 2C3LA 3PXZA 3PP1A 4AFEA 3HUBA 5CNOA 2IZSA 1PXJA 1YQJA 2PTKA 4ITHA 4AOIA 3QD3A 3GCUA 4B7TA 1ZMVA 4IAAA 3QX4A 4D58A 3UO6A 3EQPA 2WMTA 1YW2A 2FYSA 3VW8A 4JBOA 2XRWA 5ICPA 2W5HA 1Q5KA 3R7UA 4PDYA 3E5AA 1UWHA 5IA1A 5EM6A 2QOIA 3T9IA 5D12A 1Y57A 3DZQA 3FLZA 4I6QA 3A7JA 4KD1A 4ZP5A 4FKWA 4IX5A 2ZVAA 1URCA 4MH7A 2X4FA 3U4WA 3DKFA 3P78A 1ZY4A 1YKRA 4X3FA 2WEVA 4QMPA 1KE8A 3PPKA 5LVPA 3ALOA 1PXMA 3I60A 5TOZA 5D41A 1WMKA 3M1SA 3RAIA 4E6QA 1JAMA 3ZEWA 3OEFX 3QU0A 2J0MB 4BI1A 4FVPA 2BRNA 4ZTQA 1JQHA 2J7TA 5CSHA 5CZIA 5J7BA 4YO6A 3PWDA 1UVRA 4LGHA 5E8XA 5HICA 2VGPA 3RPVA 4DFNA 3NIZA 5B0XA 3UTOA 2Y7JA 4O0RA 5CEOA 1XH6A 4EOPA 3HNGA 4NU1A 2C1BA 4R6VA 2VU3A 5J1VA 4FGRA 4RX8A 3W2QA 5KKRC 4X2KA 5CALA 2YIYA 2HW7A 3KMMA 3Q4TA 4PTEA 4L8MA 2WMBA 1BL7A 3UYSA 2XK7A 2CPKE 3ZSHA 3ZUUA 4EZ7A 1J91A 2BRHA 2G01A 4UMPA 3IO7A 2J2IB 4ASDA 4X21A 4O27B 2PE0A 3BHVA 3TUDA 3OWLA 3BX5A 3F7ZA 4JL9A 3E3BX 3O96A 4RRVA 5AADA 1NVQA 4V0GA 1M17A 4W9WA 4DHFA 2WTVA 3TT0A 5AUUA 3CTHA 5FXQA 2QR7A 1PY5A 3G9LX 4OTHA 5E8ZA 5H8GA 3UYTA 3MA6A 3D14A 3L8XA 4S30A 3FY2A 5CEQA 4BBEA 2J5FA 4ENYA 4BIDA 2X9FA 4LV5A 3HMOA 2ONLA 2Y6MA 4RIYB 4F7JA 2PMOX 2P33A 2P0CA 1PXOA 2BTSA 5JRQA 3C4WA 3BZ3A 2R3NA 3R8UA 4YTIA 4CG9A 4DEGA 1RDQE 4X7QA 1Q41A 5E8YA 3IDBA 3TNHA 1OBGA 4ZZMA 1BUHA 1R3CA 5AM6A 3TNIA 3UJGA 2FSTX 4AOTA 4YLKA 4QO9A 4QYGA 4WRSA 4UMUA 3FMEA 3HECA 4FV3A 2BPMA 4FSNA 4MD8E 4RJ7A 4F70A 2CNQA 3HV4A 1G8SA 3VBQA 2IVSA 5CI7A 3ZLXA 3OMVA 3OUNB 3O7LB 4R7HA 5M44A 3TUCA 2F2CB 5IQIA 3HUCA 3BIZA 4EHZA 5CEMA 2PZYA 5CSPA 5AP0A 1H07A 4N4SA 3FMJA 4IAZA 3QUDA 2JDVA 3DK3A 2PYWA 3TJDA 4F0IA 5GINE 1P2AA 1UNLA 3QHRA 4EH6A 3FI2A 3P5KA 1Q61A 3C13A 4FL1A 4FSUA 4G9RA 4ZJVA 3SHEA 5JN2A 4RIXA 3EQFA 4FIHA 2P3GX 4H58A 5BMMA 3FZOA 4F08A 3TUBA 3QXOA 4R8QA 4CYIA 1XKKA 2YIXA 4GH2A 3CGFA 4PDOA 4DG3E 1XO2B 3R7EA 3RMFA 1H1RA 2HZ0A 3CBLA 4IAIA 4OTGA 3VAPA 3ZS5A 1OBDA 4C33A 4L00A 2JBOA 3I5ZA 3CEKA 4MYGA 4Q5HA 4S33A 1VZOA 4L42A 5HX6A 5A4QA 5J87A 3REPA 3DNEA 3NLBA 3LHJA 3FWQA 2GQGA 4ZTNA 4EC8A 5ETIA 3I0QA 3QD4A 3ZMMA 5GIOE 2O63A 2WNTA 3JPVA 4TWNA 5EHLA 4O0YA 3EQIA 3LQ3A 3CTQA 4PNIA 3MI9A 4O7ZA 4NJ3A 1F3MC 1YHVA 4IC8A 2R3QA 2YITA 5CU4A 4QTEA 4L53A 1SZMA 5CASA 3BWFA 3A7GA 3EQBA 3QF9A 4HGTA 3WZUA 1WBOA 2OJ9A 3CTJA 4FG9A 2VTMA 2C6EA 4IZAA 4EONA 3ORZA 4LYNA 4AW1A 3D7ZA 2ZDUA 2OGVA 3CS9A 3RK9A 3ENMA 1OL1A 3FHRA 2XF0A 3R30A 4NKSA 4Y95A 3BYMA 3AOXA 2FVDA 2RFSA 3LXKA 4AW5A 1ZOHA 4IJPA 4BWPA 3DXPA 1H01A 2VWVA 3LFDA 2PUIA 2QO9A 3ORKA 4PMTA 2W1DA 1HOWA 1KSWA 2R3MA 3TG1A 2OICA 3HKOA 3ZSIA 5JFWA 4MHAA 2VWXA 4BDHA 4IADA 4KA3A 5BUEA 3EL7A 5JFSA 2Z7QA 3U6IA 3BBTB 2XKCA 1PKDA 1KE6A 1MRUA 1T46A 2PUPA 3VS1A 3HA6A 1MRVA 2RG5A 4CT1A 4ARKA 3PJ8A 5CX9A 3EB0A 4CFXA 3H0ZA 4IAYA 1GNGA 4U8ZA 5HI2A 4IBMA 1ZWSA 4J98A 3R1YA 5K3YA 2HZ4A 3TIZA 4D9UA 3NUPA 3SDJA 2ERKA 2ETKA 3SLSA 4ACGA 4C4GA 3H30A 4PL3A 1OL2A 4BIEA 3UVRA
chains in the Genus database with same CATH superfamily
4HGLA 4TNDA 4L7FA 5EYCA 3BYSA 2ZB1A 3FXZA 4ANOA 3NFFB 4XG6A 1IG1A 4B6LA 4E6CA 5CENA 4C4IA 5HKMA 4HYHA 4O2ZA 3BWJA 2PL0A 2OIQA 3WOWA 2QOFA 3AMYA 2YDJA 4XG4A 2UVZA 4O4FA 4YLLA 2OJIA 4QMVA 3L8PA 4FIIA 3AD5A 4BCQA 1NXKA 1G8JA 4C4JA 2VRXA 3L1SA 5IA3A 4FTIA 4QP9A 5A4TA 4EK5A 1JVPP 2J4ZA 3NR9A 2O3PA 3O50A 5B2LA 2VV9A 4B8LA 3D7TB 5IF1A 3P5JC 2J6MA 2R9SA 4HW7A 2UW7A 3FDNA 3DKCA 4TYHA 4F6UA 4Z7HA 2VTHA 4BGGA 4CCUA 1IRKA 1F5QA 1TZDA 2PMIA 3DQWA 3SAYA 2A1AB 5AP2A 1YDTE 2OZAA 2DYLA 2VTJA 5HLNA 4O86A 3QFVA 4MXCA 4BI0A 3NWWA 3EIDA 3ZO1A 4Z7GA 4DTAA 5DRBA 4BRXA 3KXNA 2XYNA 2UW3A 3BEGA 4FI1A 4IZ7A 5C9CA 3KF4A 4FTQA 3ZOSA 3NNWA 4WNMA 4JAJA 5LVLA 4ERWA 1FMOE 2YHVA 2UZVA 4Z16A 2F4JA 3DA6A 4U3YA 2VX1A 5DH3A 2BDFA 4FIEA 3GVUA 3FMDA 3T3VA 3N51A 3FL5A 4RFYA 3PVWA 2WQMA 3TACA 4ASZA 1NVRA 4C4HA 5IA0A 5KMMA 5M07A 4UZDA 3ZM4A 4YNEA 3W0SA 4BYJA 3NYVA 3QLGA 4JQ7A 5JRSA 1H1QA 3VUDA 3GOKA 5AUXA 1BI7A 1H1SA 4A4OA 1GZ8A 2CKQA 4XHKB 3F5GA 4C02A 2QU5A 3LCKA 4Y83A 3UDTA 2ESMA 4IZYA 3CSVA 1M7QA 1PXKA 1J1BA 3AGMA 2F2UA 4JBPA 5CT0A 2WQBA 4FEXA 4HVHA 4RWIA 5KKRB 2FSOX 3LOKA 4QYHA 3BE2A 1VR2A 4ZMEA 3EQDA 3MSSA 2EU9A 3GCQA 3QCQA 1JNKA 4O7WA 3DDQA 4FV1A 4G34A 4FIGA 5ETAA 5FG8A 3MH2A 4E4XA 1FINA 4KSPA 4FA2A 5J5TA 1IAHA 3WF9A 2VWWA 3VS0A 5A14A 4DTBA 2VGOA 3Q96A 4G6OA 2Q0NA 1M7NA 2CKOA 3AQVA 4ZIMA 3LE6A 4YJQA 3QLFA 5EOBA 3AC4A 4J97A 5IUIA 5EH0A 3UNKA 4J1RA 1DI9A 2B0QA 4KS8A 5JFVA 3W0PA 4Y5HA 5KMJA 1JLUE 3I7CA 4U45A 3FXWA 3AC8A 2UZOA 1Q8YA 3UZTA 3KXZA 3LLAA 3W0QA 2OJGA 4QT1A 3TDVA 2XNOA 4FG8A 3FKLA 2C6KA 5DT4A 4R77A 2W1CA 3M2WA 2ITUA 3R63A 4XG3A 4I24A 4LOQA 3JVRA 4U9AA 3HMIA 3VBWA 3DGKA 3FKNA 3AT2A 3SRVB 5LWNA 3RPRA 2ZYBA 1J7IA 2UZTA 1U54A 4I21A 4ZY6A 5DFPA 3R7OA 4I93A 3BEAA 3BU5A 3HDNA 4TTHB 3DNDA 3GC9A 3RPSA 3S3IA 4X3FC 2ITXA 2UUEA 4R1VA 2PZ5A 5DIAA 2QC6A 2B54A 4FR4A 2REIA 2Z7RA 4F63A 2DWBA 2OFUA 2XNGA 3QTIA 2QCSA 2R2PA 1LP4A 2AC5A 4RFMA 5K5NA 2I1MA 1Z5MA 4QMYA 4A07A 3F2RA 2GNIA 5HIDA 3ZRLA 3ERKA 1GY3A 3QCYA 4QMXA 4XG7A 2X8EA 5GZ8A 4RT7A 4OR5A 4J99A 3QCXA 3JS2A 3V01A 1X8BA 2WO6A 5CANA 5IU2A 3LKMA 4TYEA 4OBPA 3A7FA 3OP5A 3DZOA 3PXKA 2H8HA 2J5EA 3VUTA 1G8KA 4CFNA 3LJ2A 3WZKA 3GU5A 4AFJA 4C2WA 2RG6A 4O4DA 3MFSA 3R04A 3VUHA 4FTNA 5L2QA 4D2PA 3F66A 2B53A 4RJ3A 2C3IB 4QQCA 2UZWE 4BCFA 3G6HA 2HWOA 2ITOA 1DM2A 3CKXA 3G33A 3KN6A 4HYSA 4EQMA 2QHMA 5FRIA 4AA4A 2HIWA 4YP8A 3IDPA 3MFRA 3RI1A 3KMUA 2VWUA 1YI3A 3BQRA 4YBKA 3V5PA 5C8NA 4YC8A 2BRMA 4LOOA 2JKMA 4MEDA 4G6LA 5BVOA 1UKHA 3G90X 3SOAA 2JDTA 3E93A 1ND4A 1R39A 2ONLC 4W4VA 4BCGA 3DBCA 4O96A 5K5XA 4O7YA 5CY3A 1PXIA 5FEQA 1QCFA 3W8QA 4FZ6A 3ZDUA 4C3PA 3BHHA 3COKA 3C4ZA 3P7CA 3KY2A 4BWXA 5HQ0A 1TFFA 4D4RA 1XWSA 5K9IA 3LCDA 3HAMA 4DITA 4ACHA 3NUAA 1GIHA 3KRXA 1CKPA 5CAPA 3FE3A 1CKIA 4RZVA 5HE0A 3RKBA 2ZM1A 3O8PA 5CI6A 4J96A 5CNNA 3VBYA 5IPJA 4DFZE 3AKLA 3OCTA 5J79A 4WNOA 3HV7A 5J9YA 3ET7A 5A4EA 1OM1A 4EKKA 1Q8TA 2QLQA 5I3RA 4S34A 3LQ8A 3B2TA 4IVDA 3KIOC 3DBQA 4RX9A 3UPXA 4C4FA 1RQQA 4UX9A 5JGAA 1W0XC 5HIBA 4PRJA 5IQGA 4DG2E 2CNVA 3Q9ZA 2C3KA 5CWZA 3HL7A 3MFTA 4TRLA 4F9AA 4ACDA 3VO3A 2J0LA 3MV5A 3PJ1A 1A48A 3OT8A 1NT2A 2HY0A 4P5QA 4CNHA 2XKEA 1VEBA 3SGCA 1KV2A 1PF8A 3MVLA 4FV4A 4IWQA 5HD4A 3ENHA 1ST4A 2AEGA 1PMUA 4GKHA 4RC3A 4LQMA 4KAOA 3AC5A 4FNYA 4GJ2A 4BBMA 3TJCA 1FVTA 1V0BA 3KXXA 3OHTA 4H1JA 2XEYA 4IWPA 4YJRA 3VS3A 4CRLA 3PLAE 3GNIB 3IW4A 3MPAA 5BVFA 4W8DA 4RSSA 4XX9A 5FM2A 4F64A 5EKNA 3Q32A 4O84A 4RFZA 3O7LD 1H25A 1FQ1B 4WG4A 3O8UA 3N4TA 2XUUA 3FI8A 5HBJA 1IEPA 3BE9A 3KFAA 3A99A 3W2RA 4F1OA 4YSJA 4YUQA 4U40A 4K18A 2OKRA 3KF7A 3F2NA 4AT5A 3BU3A 4LRMA 5DA3A 2RFNA 5IQBA 4GFOA 3TZ8A 3DS6A 2V22A 3D2KA 3KEXA 1LUFA 3MDYA 3G0EA 4DT8A 4I20A 4CFFA 4JVGA 3E7OA 2PVNA 4I4EA 5E90A 1WCCA 4JLCA 2WMUA 5CEIA 4P4CA 4A4LA 3C5UA 4OTDA 3MJ1A 4CFWA 2PULA 5FBOA 2J0JA 4I41A 4TWPA 3UOKA 5FTGA 3CY3A 1AQ1A 3DB6A 5I9WA 3PZHA 5E8TA 4YZ9A 2BRBA 2EXCX 5H3QA 4EOMA 5CF5A 3EN9A 1K3AA 2AYPA 4MK0A 2QOHA 4I0SA 4G5JA 5AUZA 3HP2A 2UZBA 3KRRA 1OIUA 4AXEA 4YHTA 3NPCA 3UDSA 1REJA 4CTBA 2F7EE 1PJKA 2J51A 5HIEA 3EZVA 3MGYA 4NM5A 4CQGA 2B9FA 3EN7A 5LMAA 2QODA 2HXQA 3FSKA 2PVFA 3P9JA 3UGCA 1BI8A 1W2DA 3FMNA 4O7TA 4JG7A 3QRJA 2UV2A 3WYXA 5EFQA 3GFEA 5AUTA 4E5AX 3MN3A 5HO7A 4CKIA 4I6BA 3GEQA 5KX8A 4RA5A 5HVJA 4R3PA 3T9TA 1CSNA 5GIPE 2YJSA 2WIHA 3UQGA 4FKPA 5HTIA 4EL9A 1KE7A 3VW6A 3GXLA 4GFMA 1TQMA 4E4MA 3HV6A 3A4PA 4YU2A 4MF0A 2X2MA 2RFDA 4L43A 3QYWA 2C30A 5JSMA 2IJMA 3AKKA 4M67A 4XRJA 2JD5A 1YWVA 4M69A 1R78A 4FT3A 5HHWA 4AW2A 3ZHPC 4PMSA 4HCUA 3FZTA 1OIQA 4FZFB 4DH5A 4UWBA 1FVVA 4USDA 2R0IA 5GNKA 5HBEA 5C1QB 4TT7A 4RVMA 5EOLA 4UWYA 5EQYA 3OWPA 2BZJA 2Z7LA 4XOZA 3D5WA 4X2NA 5BVEA 3V8TA 4EQUA 5CVFA 3R7IA 4NZWB 3HYHA 3BQCA 4QOXA 2XS0A 2W96B 4CZUA 4L52A 5DWRA 4AZTA 3RALA 3MY5A 3WF8A 4NM7A 3ZLSA 4TW9A 4DEHA 2WOUA 2XIKA 3F61A 3W10A 1Q62A 4YJPA 5ANGA 1YXSA 2Y8OA 4O38A 4C34A 1PKGA 3AC1A 2YM4A 3GC0A 2QQ7A 4BWKA 2W1ZA 1WFCA 3DKGA 4BCJA 2KULA 4WNKA 4GMYA 4X2FA 3EL8A 5AR3A 2OK1A 4L9IA 1W2FA 5HX8A 4TYIA 5JFXA 3Q53A 2PSQA 4AX8A 5FEDA 1L8TA 2XMYA 3KGAA 4O21A 4UMTA 3Q52A 2HW6A 3EQGA 5AFVA 1KE5A 5BPYA 2GFSA 3NS9A 3ANQA 4IAKA 4PMMA 4X3FB 1YI4A 1WBTA 2GNHA 5ETCA 2F57A 4D5HA 4E73A 4BBFA 3NYXA 4BKZA 2WMRA 2Y9QA 5CT7A 4DHJA 4HOKA 2UW8A 3A7IA 3UP2A 4D1SA 2VZ6A 4U97A 5DI1A 2J90A 4I0RA 3V5LA 5KHXA 3DBDA 3PUPA 5IQEA 4QP6A 4D1XA 2YWVA 4FK3A 2YAKA 3O51A 2EB2A 2YJRA 5IA5A 4OBOA 4E93A 2B9IA 3CP9A 4MWHA 1R0EA 2W1GA 5IG1A 3OY3A 3RNYA 4PX6A 4FGBA 5HO6A 4F0GA 1GJOA 4DDIA 4OT5A 3BYOA 3N4VA 2O2UA 4O7LA 3RK5A 3EN6A 4KIKA 2HZNA 2X0OA 2BFXA 5CU6A 3AMAA 2W1IA 5FTOA 1XMLA 1ZYLA 4R7BA 3II5A 3KRWA 4GIHA 4Z55A 2XJ0A 2XNPA 3K5UA 3SOCA 2IVVA 3R02A 4AA0A 4EBVA 3CXWA 3U8WA 4MNEA 2J9MA 4V0GB 4E26A 3R2YA 4ZSAA 5CQUA 4FKIA 4DT9A 2GCDA 4GS6A 2C5OA 4F7LA 3BLRA 2FSLX 4L7SA 5C27A 3KRLA 3LCOA 3THBA 1EH4A 1RW8A 4ZJIA 2JKOA 3Q60A 3TV4A 4O6LA 3DCVA 5E8UA 4QRCA 3WARA 3ROCA 2XIYA 4FL3A 5IUGA 5AX9A 2AC3A 1OIRA 1Y91A 3D94A 3BYUA 3AG9A 2XM9A 3H0YA 4EJNA 4M12A 1OECA 3UBDA 4DGNA 4UXQA 4CKJA 4I6LA 1Q99A 4DCAA 1ERKA 4ZLOA 2VWIA 3PVGA 1OMWA 5A4CA 5LVMA 2J50A 2JKKA 3LFSA 4Z9LA 1R1WA 3BGQA 2C6OA 2GNJA 3RTPA 4YLJA 3OTUA 5HO8A 2OW3A 3BHTA 2F49A 2X2LA 3RGFA 3OWKA 4KBAA 4EOOA 5HCZA 4A9RA 4YTCA 2UW5A 2WIPA 3HRCA 4CFVA 3BLAA 2DS1A 4S32A 3IW8A 3WF7A 2GS2A 3DK7A 4WUAA 5D7AA 4N57A 1CMKE 5GZAA 3DKOA 3GU4A 3HV5A 4MQ1A 4APCA 4DEIA 3CCNA 4ZXTA 3PYYA 5LMKA 3QTUA 5BUJA 2X0GA 4R3RA 4RIXB 3F69A 4UY9A 4YR8A 2PWLA 5F9EA 4OAUC 4DTKA 4WA9A 2ITWA 3SQQA 4MD9E 3HEGA 3OFMA 2OLCA 4ZSLA 4PL5A 1U5RA 4BJJA 2WU6A 3LJ0A 4OUCA 4F4PA 2QD9A 4YZNA 3WI6A 3KXMA 3MTLA 4FTKA 4F7NA 3PPJA 4FKVA 4YSMA 4FKRA 2C0IA 5E8SA 5KO1A 3QC9A 4ZS0A 3ZCLA 3DXNA 2UZDA 5DR6A 3DT1A 3NAYA 2GPHA 4FEWA 3EJ1A 3D5VA 2WMVA 5AWMA 2CSNA 4RWJA 3P7BA 2QOLA 3PXFA 2CDZA 3DJ7A 2X7GA 2XCHA 4IVBA 4PDPA 2RFEA 2CKEA 3DY7A 3PXYA 5EHYA 3K3JA 3SXSA 2KTYA 3NAXA 5IQDA 5EW3A 3GQIA 3LQ5A 3IECA 2PVKA 1QMZA 2CGVA 3LCTA 4BYIA 1ATPE 2WMWA 3NYNA 5J95A 3NZ0A 3GOPA 5KMKA 4WOVA 3TN8A 3W16A 2FO0A 2ZMCA 2E9NA 3IW5A 3AKJA 1WBNA 3OD6X 3PDTA 2BIYA 1GZOA 1KUTA 2YCRA 3ZFYA 3DLZA 1JSVA 1GAGA 1UU3A 4FTRA 5JMSA 3D15A 3TYKA 2OXDA 4NJDA 2ERZE 4XCUA 2XYUA 4AOJA 1OKZA 4P5ZA 3T3UA 4YMJA 1FPUA 2C5NA 4IH8A 3FLNC 4XP3A 5KUPA 1WBWA 4FSQA 2YCFA 2ZB0A 4H3QA 5KMIA 4H39A 1YDSE 2YAAA 4RVTA 2IW9A 5JK3A 3BKBA 3UVPA 1QPDA 4D4SA 2J0IA 3HV3A 3MFUA 2CLQA 1JSTA 4LOPA 1MP8A 2G2HA 4YZDA 2NP8A 3PG1A 3TIYA 4HZSA 3ZBXA 2ITQA 4E6DA 4BGHA 4PF4A 3GCVA 3S00A 3HAVA 1ZARA 2BILB 2WOTA 4GG5A 5FLFA 4F1TA 4A9UA 4QP1A 5FQDC 3I7BA 2F7XE 3G9NA 4NCTC 3ODYX 4DFUA 4CTCA 4DFYA 3UZRA 1PMVA 5CF8A 4IB0A 1V0PA 5KZ0A 4EH7A 5EK7A 4IJ9A 4BTMA 5I0BA 5IEXA 4F6SA 4M97A 2R0UA 2WELA 4XV9A 4D4YA 1E1XA 4ZSEA 2GHLA 1OB3A 3G51A 5AV4A 3P1AA 4RVKA 3MPTA 2WHBA 5AMNA 3NMUF 3RPOA 5E1EA 1UWJA 5T6KA 4FV9A 4TYHB 5CAOA 3FHIA 3D0EA 4OTIA 4ID7A 1FOTA 2JITA 3TZ9A 2PE2A 4HGEA 5KE0A 4LGDA 2R3RA 3VUGA 2C6IA 2Z60A 3QC4A 4CCBA 5B7VA 5JQ8A 5ANJA 2XARA 4GK4A 1PXNA 1XQZA 2YM5A 2OZAB 3U6JA 4PWNA 3P23A 2Z02A 4WT6A 4QYYA 5ANDA 4YZBA 1HCLA 5EQEA 3RCJA 5HE3A 4QDEA 1XH7A 2VO7A 2W4OA 2GTNA 5EW9A 2PZPA 5TE0A 3V6RA 4ANQA 4QTCA 4B8MA 4W8EA 4X6QC 3W8LA 3QRKA 3OXZA 4BHZA 4BCIA 3HX4A 4I5CA 2UZNA 5AV0A 4DH8A 2WXVA 3UNJA 2R3JA 4FICA 1PHKA 3L9NA 2WB8A 5CSVA 3FZ1A 4GV1A 3R73A 3ZLWA 4AWIA 3GCSA 1Q3WA 1QPCA 3EMGA 1NY3A 2ZV8A 4IMYA 3FMHA 2JIVA 2WQOA 3WIKA 3UQFA 3N4UA 4N70A 4FC0A 4KB8A 4FIJA 1ZYDA 3FPMA 3AMBA 3LXLA 3OTVA 4UMRA 3VS7A 5I5ZA 5L2TA 3DTWA 2FUMA 2RF9A 2W06A 1SVGA 3POZA 3PZEA 3Q9WA 3QQUA 3UG1A 3SG8A 4ZSJA 5IISA 4R5SA 4YC3A 2PVRA 2W7XA 2X8DA 2DQ7X 3H3CA 5BVWA 3R9DA 4D5KA 2OIBA 5IUHA 5LCJA 4FTAA 1XBAA 2NYAA 3H9OA 4HVSA 4FV7A 3FZRA 3ORTA 4XG8A 2QOCA 4OTPA 3RHKA 3CPBA 4O6EA 3VNTA 2JIIA 3JY0A 2WTIA 4I1ZA 1QPJA 3WF5A 2BZIB 5EDPA 2R3HA 4L67A 2R4BA 3UODA 5E9EA 4DBXA 1Y8YA 1GZNA 5C8MA 4C2VA 2OBJA 3PY0A 4YHJA 1OGYA 3TKHA 2CLXA 4PL4A 3FYKX 4OTRA 1JOWB 4RJ5A 5DPVA 2ZFYA 4QMUA 2UW0A 3OOMA 4QP2A 5AEPA 4O0TA 3F9NA 3FY0A 3PSBA 1YHWA 2VX3A 3V51A 2VUWA 4K2RA 4MBLA 4W9XA 4KWPA 3ZSGA 4QTDA 1H1PA 1U54B 4WG5A 4GJ3A 3V8SA 4KINA 4RJ6A 5HEZA 5I4NA 5KCVA 2C6DA 2W5BA 2BKKA 4DHIB 2ZM3A 3NNUA 4LL5A 4O81A 4Y85A 4F99A 1XMMA 3S0OA 4IM3A 4QYFA 3VQHA 5JT2A 3MPMA 4XBRA 2NRUA 3C4FA 2ITYA 4JDKA 5DGZA 3W55A 2O8YA 5E91A 2OFVA 4BZOA 1KOAA 3GB2A 4ZTHA 4E4LA 4AU8A 2XIRA 3HDMA 4FNWA 5BMSA 4IB5A 3QYZA 5GJFA 3T8OA 3I81A 4M3QA 4R3CA 5HGIA 4JXFA 4FUXA 4XP2A 4ANBA 3ULZA 3DJ5A 5AM7A 4ZTSA 5AV1A 3IPHA 4AS0A 1CKJA 5DE2A 3NFGB 5CAVA 2XK9A 3MH0A 4FOCA 5I9YA 4S31A 4DYMA 4BDEA 4DN5A 3KQ7A 4ZTLA 2XALA 2YLEA 4RC4A 3GU8A 4EOKA 4OAVB 2O5KA 3QBNA 1H0WA 1Z9XA 1V0OA 2JLDA 4QTBA 3F3TA 5CZHA 3LFCA 4GG7A 4M0ZA 4W4YA 1FGIA 2C47A 4HNIA 3IW7A 2JC6A 4FV5A 3HMNA 3ATSA 4ZK5A 4L6QA 4EEVA 3CKWA 2XBJA 2FGIA 2PVLA 3K2LA 2BFYA 4JX3A 3GUBA 2BTRA 1YOJA 4RJ4A 4YPDA 4AXAA 3EKNA 5D7VA 3QQGA 3R71A 5FM3A 4BDAA 2YERA 4I3ZA 3U9NA 2NNWB 3KL8A 3UIBA 5FDPA 5FXRA 2XM8A 3PJCA 1WVXA 4HGSA 5HD7A 4DC2A 2X1NA 5IQHA 1RE8A 4B99A 1Q8UA 3W2PA 3GFWA 4Q9ZA 1I09A 4K8AA 3FLYA 4O1OA 3G5DA 4FTCA 4J8NA 3LM5A 3RZFA 3H9FA 3NCGA 3OWJA 5TT7A 4P7EA 4F1MA 5E8VA 4QP7A 2B1PA 4Y5QA 3GCPA 4IQ6A 2BZHB 4OGRA 1P5EA 1YRPA 1ST0A 3CD3A 4FKGA 2P2HA 4IFGA 2ACXA 4A4XA 4QTAA 5CYIA 2YIRA 5DHJA 2OSCA 4IZ5A 3PUFC 3C0GA 3ZFXA 2QOOA 5BYZA 3UOJA 1QPEA 2R64A 2FB8A 3AGLA 1OUYA 2PVHA 3LMGA 4FRFA 3E8NA 2JFMA 4TY1A 4W4XA 2BZKB 3EHAA 3POOA 5IKWA 3SVVA 4BCHA 2OZOA 5J9ZA 2YEXA 2BKZA 2WZJA 4KSQA 5LMKC 2LGCA 4RWLA 3FPQA 5BVNA 4DA5A 3QZIA 5IQFA 4J95A 3BL9A 4KS7A 4MD7E 4OTWA 4XS2A 5D10A 1Q97A 2GHMA 2QO7A 5FWKK 4M14A 3Q6WA 3BHUA 4NW6A 4W4WA 4YNOA 3LJ1A 2PZRA 3BI6A 3NX8A 3OW4A 4U6RA 4DCEA 1W7HA 4AGDA 4RG0A 1O6YA 3L9MA 4GEOA 2GU8A 2ZOQA 3OBJA 4EH8A 3FSFA 4OT6A 2HOGA 3VJOA 4BDFA 4R78A 3R9RA 5K0XA 4I6FA 5BVKA 1UU9A 3R01A 3LAUA 4DBNA 4PDSA 2OXXA 2CMWA 4GT4A 4EHGA 4ZZOA 5AR7A 4TKSA 3KCKA 3OROA 2LAVA 3TMOA 1ZOEA 3KULB 5L3AA 4HPTE 1BLXA 2ITZA 3TXOA 1OI9A 3Q6UA 3O17A 3UG2A 3KREA 4FSYA 5LWMA 5DEYA 5CQWA 3IONA 3ZYAA 2Y4PA 4NFMA 3DK6A 2UZEA 2H96A 3NW7A 3ODZX 1KWPA 3LFEA 4FVQA 4LUEA 2PUUA 3O8TA 4RX7A 4B0GA 1WBSA 3E64A 4FYOA 4DH3A 4IACA 4DF3A 5TR6A 4FSTA 3O5AA 1MUOA 3BLQA 1PYEA 1XH9A 2YDIA 2ETRA 4AXFA 2WU7A 3EN5A 4FKLA 1E1VA 4QP3A 2XBAA 2YWPA 2WTCA 3UO5A 4NK9A 5A6OA 3UPZA 3LPBA 4QMOA 5BYYA 4CFMA 4LL0A 3RHXA 2BDJA 2YN8A 3GQLA 3UC3A 2PY3A 1GIJA 4GVJA 4FZAB 4Q2AA 4MQ2A 4JQ8A 5KMLA 4JI9A 5IH6A 2JDOA 3C50A 3PLSA 5L8LA 5IDPA 5KMOA 1ZAOA 1WVYA 4IWDA 5HNIX 4CLJA 4F9YA 1YXXA 2E9UA 3B8QA 5HVYA 4DGLC 4BVUA 2VO3A 3DFCB 1ZY5A 2P2IA 3OCGA 2IN6A 5M51A 3S4QA 3LFQA 3VWAA 4OW8A 4HZRA 2OXYA 3Q4UA 4CSVA 2IZTA 2VAGA 4DEDA 2ETMA 1OKYA 5AA9A 2WTKC 3DAJA 2JAVA 4O2PA 4ACMA 5GZ9A 4D1ZA 4G16A 3ZBFA 3WZDA 3GBZA 3OXTA 4B9DA 4O22A 5M55A 3MY1A 3PFQA 3Q04A 4QMMA 3ZC5A 4M0YA 3CD8A 3PP0A 5C8KA 5E4HA 1ZYJA 3Q2JA 4FKTA 4K6ZA 3RM6A 2G2FA 3FZSA 5L2WA 2YLFA 4M69B 5LJJA 2I7QA 2YM6A 1ZRZA 3FXXA 5IQCA 3OVVA 3QRTA 4O7VA 2F7ZE 3GU7A 5ANIA 4BHNA 3EWHA 4PP9A 1QL6A 3EQCA 2XNNA 2Q83A 3JY9A 3KXGA 3Q3BA 2NPQA 2YCQA 3GGFA 2VWBA 2GQSA 4UEUA 5EG3A 5JEBA 4BFMA 5HU9A 2CN8A 1TKIA 3TWJA 3QKLA 2C5VA 4RIWA 5LXMA 3W0NA 3VBVA 1J3HA 4GIIA 2PVYA 1RJBA 3C51A 4O4EA 4CYJA 2C6LA 3OEZA 4MBJA 4YBJA 3VVHA 4YGAA 5IZFA 4CV9A 3PY1A 4QMTA 4MAOA 5DEWA 3F3UA 1CDKA 3G6GA 4FTOA 2XK4A 4KRCA 1XHAA 3LFBA 4FUYA 5E8WA 5H9BA 3VIDA 4NIFA 3MH3A 4G2FA 2PZIA 3ETAA 1R0PA 3IG7A 3KULA 3QQLA 4ASEA 4AZWA 3UZPA 5E1SA 4I5PA 3R8PA 2OH4A 2A2AA 2GDOA 1WZYA 4D2VA 5TKDA 4DEAA 3BELA 1BYGA 4UMQA 2X7FA 4LMUA 3ZO3A 4AUAA 3OC1A 4BCPA 1W83A 5L6PA 3E7VA 4XV3A 4NL0A 4F9WA 4FK6A 3EN4A 2IPXA 1TQIA 2H9VA 1SVHA 5M09A 2CCIA 4NH1A 5AP4A 1UV5A 5L2IA 3Q4ZA 2YZAA 4XJ0A 5CF4A 3LIJA 5AP3A 2W1EA 4CVAA 1IA8A 4C3FA 2C5YA 3MB7A 4ONAA 4O7RA 2C69A 2VTLA 3FQEA 3LZBA 4WNPA 2OI4X 4JT3A 2B4SB 2XVDA 4PPCA 4YJOA 4AW0A 1H24A 3QGWA 3BPRA 3R28A 3P08A 4KIKB 3IOKA 3A7HA 2CHLA 1SYKA 1XBCA 3IOPA 5M4IA 3PA5A 2OJFE 1ZMUA 3H9RA 4C62A 4D0XA 4XV1A 3E92A 3SG9A 2W05A 4G9CA 4QMZA 2IW8A 3V5JA 3NYOA 4AT4A 4L01A 4EK3A 2BR1A 4FT0A 3R9OA 4JOAA 4MNEB 5AR4A 3ROYA 3NNXA 4LV8A 2X0QA 2GS7A 3W0MA 2JDRA 3QRIA 4FSWA 4I94A 4O7NA 1SNUA 1O6KA 4L3LA 4ZY4A 4KKGA 4KIOA 4FKUA 4BZDA 4RWKA 4EUTA 3LLTA 4YJTA 4AGWA 1AGWA 2XB7A 3TNQB 3HVCA 4L3JA 2HXLA 2Z2WA 3GP0A 4BDGA 3VF8A 3DU8A 2WFYA 2ZAZA 2PVMA 5I9UA 3HRBA 3A60A 3QTQA 1Q8ZA 3MS9A 4R7IA 3RCDA 3OXIA 4ALWA 3FJQE 3NGAA 4J71A 3UP7A 1A06A 3D83A 3HGKA 3E8EA 3W1FA 3S1HA 4USFA 3CJGA 1SMHA 3R7YA 5FXSA 3I5NA 1KE9A 4CMTA 4AZVA 3QQHA 2VNWA 2G9XA 2E9VA 1PXLA 4JR7A 4M8TA 4C8BA 2W4KA 1S9JA 2BRGA 4JRVA 3NSZA 3KCFA 3ZTXA 1KOBA 2PE1A 5FEEA 2EUFB 3LXPA 3A61A 4GFGA 2GTMA 3JYAA 4YJSA 3R83A 1FVRA 2BUJA 1K2PA 3O71A 5FUTA 3FMLA 5F20A 3OOGA 2OWBA 4EOSA 3B8RA 4UB7A 3FEGA 1DAYA 3DBFA 3JXWA 4IAFA 4EWHA 4ZMFA