4EYMA

Mapk13 complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
350
structure length
340
Chain Sequence
b'SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 13
publication title IL-13-induced airway mucus production is attenuated by MAPK13 inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 103
structure length 340
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eymA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eymA01
3DNEA 3VUKA 2QU6A 4CKJA 2QLQA 3A2CA 3EQHA 3I81A 3QUDA 2XS0A 4KNBA 4BTJA 1WVWA 1J7LA 2IVVA 2C3KA 5LVMA 4X3FB 3CTHA 5DT0A 3ANRA 3MPAA 4DFUA 2HXQA 3DLZA 4PTGA 5F20A 3R02A 4MCVA 2BFYA 2QU5A 1ZOHA 2OICA 2IN6A 4BGGA 3V5LA 2XCHA 3RCJA 1R0PA 4O7SA 3BPRA 4O0VA 2H8HA 2HIWA 4TYEA 5J9ZA 2ZV7A 3VJNA 2XRWA 1LPUA 4OTQA 1GJOA 4YZNA 2RG5A 4ZZOA 2Z2WA 2PE0A 5HO7A 5ICPA 5KO1A 3TNQB 1OIRA 3DAEA 3QX2A 4FT3A 1J3HA 2RF9A 3QD4A 4JRVA 3L8XA 3ZMMA 4G6NA 4M14A 5EI2A 4EJ7A 3ANQA 4RIWA 3QQKA 3B8RA 2E9PA 4EOQA 1ZAOA 3P79A 5CWZA 2I0VA 5IA5A 2YDKA 4RFZA 2QOHA 5CSHA 4ANOA 4D1SA 2FGIA 4MAOA 4BZNA 4F6UA 1BLXA 2QOIA 1ZWSA 2X7OA 1KUTA 5DYJA 4YZ9A 4OGRA 1XH8A 4QYYA 2JFMA 4F08A 5K3YA 4CV9A 3GT8A 3JPVA 4LRKA 1W84A 4FIJA 5AUYA 5JFSA 2JDRA 3PP0A 4J8MA 4O1PA 2OH4A 4ANBA 4HCUA 3RK7A 3DBDA 5JQ8A 5CSWA 4D4YA 5LMKA 1VZOA 5F94A 1PXNA 2XA4A 4IAYA 2WU7A 4F7NA 2OH0E 3EWHA 4N6ZA 3VIDA 3QAME 3PIXA 3U8WA 2OWBA 3EN7A 2C0IA 1WCCA 4GYIA 4QMNA 2WMBA 4G9RA 4OBOA 2YCSA 4X2KA 4WUAA 3TKUA 2XNEA 4BWPA 4DHFA 3OY3A 3IG7A 4FOBA 4FL2A 2Z60A 4PY1A 3FY0A 5CALA 3FZOA 5FM3A 3DQXA 1SVGA 3VS6A 3ZO3A 3L9LA 3TIYA 3G15A 3PA5A 4IWOA 4L42A 2Y8OA 2OIDA 3E3BX 3FE3A 4IHPA 5ANGA 4RA4A 3PY1A 4ITJA 5ANEA 4E6QA 2QHMA 4ZSEA 2BIKB 5HLWA 3HV6A 4IB1A 2ETRA 4HYUA 4GT4A 4JJRA 4C33A 3P78A 4OBPA 1FBNA 3W55A 1KWPA 1QPDA 3HL7A 3V5QA 2B4SB 3VUHA 2CCHA 4W8DA 4YGAA 4BTKA 5HLNA 4G3DA 4GSBA 3T9TA 3BI6A 3NCZA 3OBGA 5FP6A 4Z9LA 4MH7A 1H25A 3R8PA 4A4OA 2GNIA 3UO5A 3ELJA 4QMSA 4CFMA 3MV5A 3ZLSA 2OG8A 4LGHA 3S2PA 3ZSGA 2J0JA 3Q4ZA 3D83A 4EOLA 4NTTA 3OMVA 4H39A 2DQ7X 2GTNA 4FBXA 1G3NA 2WTCA 3LCTA 3QCSA 4LV5A 3ZXZA 2V55A 3JYAA 4RJ3A 5LARA 2ZM1A 5HE3A 4O91A 4D28A 5CF8A 1Q8UA 4BTFA 3EZVA 4D58A 4LUEA 5J95A 3RCDA 4XG4A 5L4QA 2PE2A 1WBOA 4BI0A 4DE4A 5ANIA 3HKOA 3EHAA 3FAAA 3A99A 4I23A 3KY2A 4IAZA 3MVMA 2RL5A 3KXXA 5EW3A 5L8JA 1WBSA 2B7AA 1A9UA 4FT5A 5DA3A 4TW9A 4ZSAA 3CLYA 3PIZA 5AA9A 4YHJA 4RIWB 1OI9A 5HNGA 5DBXA 4MXAA 5TO8A 3CJFA 2X1NA 4YLLA 4MXZA 2WMTA 3QZHA 4QP4A 4UBAA 5DT4A 5HVJA 5L2SA 5FBOA 4JDHA 1YXSA 2WMQA 3KXHA 3LPBA 4IDTA 2QVSE 4E7WA 2JBPA 2VD5A 4R3RA 1UA2A 3PG3A 3VW8A 3UOJA 1R3CA 2BZKB 4X6QC 3UOKA 4WSYA 1UV5A 4I4EA 4I6QA 2DYLA 5FLFA 3GCVA 4JBPA 4MD7E 5ETCA 4EH4A 2UZTA 4W9XA 2VX0A 5E9EA 3MVJA 1TVOA 5CEIA 2PZRA 4W4YA 4OR5A 4M3QA 4RVMA 3ORIA 3ZXTA 5IDNA 3QRUA 3SAYA 3OUNB 3JVSA 3ZZEA 4RIOA 3UMWA 3DBCA 3KRRA 4C0TA 1ERKA 4QYHA 5JK3A 1VYZA 1GZNA 4JDIA 3QWJA 2RIOA 4FIEA 1Y6BA 2F2UA 3O7LD 4ONAA 5J79A 2CNUA 2XIKA 1H08A 2ERZE 3G6GA 3LIJA 5BVWA 3VS5A 1XBBA 4UX9A 4LYNA 2EU9A 2WOTA 4M66A 4O0YA 2VGPA 4GU6A 5DMZA 4N57A 4YC3A 2YAKA 4L6QA 5J87A 1RE8A 5C9CA 3PZEA 2PE1A 4XBRA 3P23A 1Y8GA 1OB3A 2CSNA 2QKWB 4V05A 5KHXA 3MESA 4F9YA 3QCQA 2VTLA 4MYGA 2ZYBA 4XEYA 4CV8A 4BVUA 5CAUA 3NAYA 4UALA 4CEGA 3Q4TA 2HELA 3WZJA 4RWKA 4AN2A 2H6DA 5HD7A 3OROA 4IXPA 1XR1A 5JSMA 1WBTA 3ZRKA 4CD0A 2C3JA 4KRCA 4BKJA 5KCVA 2DS1A 3H10A 2X6DA 3TNWA 4DT8A 3OT8A 4QMYA 2C6IA 4NCTA 3QYZA 4N70A 3WILA 4DG3E 4FTMA 4FKQA 5JGDA 3R9NA 2X8DA 2YIYA 4FSZA 3QZIA 2CDZA 3EJ1A 1YDSE 3NNVA 1GIJA 1CKPA 4YZCA 2HY81 4AFEA 4HZSA 5T3QA 4U43A 3NUPA 4C4JA 2WHBA 3SD0A 5DEWA 4TXCA 2O0UA 4U41A 3GU7A 3ZUUA 4OTPA 5H8EA 5ANDA 4QYFA 4F7LA 2C6MA 4K18A 2QD9A 4FKRA 1ZOGA 2VTQA 4AOJA 2W1HA 4IW0A 2G15A 2YACA 4D2RA 4LI5A 4M0YA 4O96A 4N6YA 3MPMA 4GT5A 1BMKA 2FSMX 3R0TA 2GNHA 5EI6A 1J1BA 5I3OA 3ID6C 3FZSA 2XUUA 1AQ1A 2JLDA 2PTKA 3KKVA 3BU3A 2OZOA 1VEBA 3HECA 3COMA 3VF8A 1UWJA 1WFCA 1XJDA 2IZUA 2XMYA 1RW8A 2IZSA 3LZBA 1JLUE 4KWPA 3WIKA 5BVOA 5H9BA 4CVAA 3QRJA 2W1IA 5EM5A 1TQPA 4EOKA 5I3RA 3QX4A 4C2VA 2YWPA 4FTKA 2FSTX 5AR5A 2ITQA 1H1QA 3DFAA 4I1ZA 4B4LA 4G3EA 4YLJA 2V5QA 2ZDTA 5FDXA 4GK4A 4RIYA 3PPKA 2V7OA 2R3NA 4BDBA 3P7CA 5EHYA 5HIEA 4GK2A 1ZMUA 3THBA 2YJRA 5IMXA 4AQCA 2XIXA 4U44A 4IM0A 4KKEA 5E92A 1URWA 4HPTE 3TV4A 3QZGA 4BZDA 3MFUA 1ZY4A 4JI9A 2CHLA 3CP9A 3PSDA 4DN5A 2HZ0A 2YAAA 4FZ6A 2W4JA 4NU1A 3HRBA 4MNEA 3MW1A 4FGBA 3KFAA 5H8GA 2O65A 4LOQA 3ZYAA 3PJCA 1URCA 4R1YA 3O8UA 4RVKA 3T8OA 5HIBA 1KE5A 3VRYA 1PJKA 4HGLA 2ZM4A 2JGZA 3COKA 4FV3A 4NIFA 2R3LA 3OWLA 5JRSA 3FUPA 2VTSA 2W1GA 4FVRA 4P5ZA 2BZIB 3QWKA 4B0GA 2X81A 5IQAA 1G8AA 3MN3A 3FQSA 5GJDA 3RK5A 3VUGA 3U55A 1TQIA 2OSCA 4BL1A 1Y8YA 2VTHA 3OUKA 4FZFB 4XCUA 3LFQA 1LR4A 4MTAA 5CAQA 1L3RE 3EQGA 1ZYSA 3OW3A 1XO2B 1J91A 3BV3A 4IWPA 2QOOA 3P08A 4YC6A 4L67A 4WBBB 4CXAA 3BHUA 3PWYA 5EOLA 2OJGA 4CG8A 4GL9A 1RQQA 2PMNX 4TNDA 3MA6A 4MF1A 2P33A 5BYYA 4BCQA 3GNIB 4I22A 5HG8A 3LAUA 4U40A 4YLKA 2YLFA 4CFFA 4OTGA 3PZHA 3N9XA 3CIKA 4FSMA 2R64A 3F9NA 2QC6A 3GCQA 3W2CA 3F2NA 2AC3A 4WBOA 4CRSA 4IJ9A 4FIHA 3LXPA 2UVZA 4LMNA 4K1BA 3TNIA 1OPLA 4DGLC 3VBWA 5IUGA 3C4FA 1JPAA 3IGGA 4HYHA 4FK6A 4UWBA 1FQ1B 2XBJA 3ZLXA 4EHGA 2VWIA 4RX7A 3RHKA 4IAIA 3W1FA 5BMMA 5FBNC 2OLCA 2WMAA 2AYPA 3L9PA 2HK5A 4IM3A 4O2ZA 1DS5A 5AADA 4QMWA 5KMNA 2E9NA 2XZSA 4IH8A 4E1ZA 2P2IA 1OM1A 3DV3A 5BYZA 3EOCA 5HE1A 2UW5A 2PULA 2BRHA 4L01A 3HMMA 4HYSA 4IQ6A 4OBQA 4APPA 1KE6A 4USEA 2E2BA 3UZPA 3ZHPC 3PPZA 4ANSA 3DB8A 4XG7A 2C1AA 3L9MA 3FLYA 4CMOA 2PVNA 1BYGA 5EYDA 4C34A 3D7TA 5E4HA 3E7OA 3O23A 4D4SA 3C4WA 2A27A 3AMYA 2OGVA 2YEXA 4RIYB 3DK7A 5L2TA 4AZFA 4M69B 1YKRA 3P1AA 2XNOA 2UW4A 4EBWA 1Y91A 2XK3A 4AS0A 2W1FA 4QTCA 3LQ3A 4AW5A 3ULZA 4EWQA 4IWDA 3WZUA 2YDJA 4H1JA 3ROCA 3MI9A 4EOMA 3KK8A 5ANOA 3UYSA 1MRYA 4MNEB 4XG9A 4ANLA 3U6JA 2BTSA 4ZZNA 4ALVA 5FQDC 2A1AB 3QKMA 5AAGA 2NO3A 4L3LA 4Z55A 4BCKA 1M2RA 2WTKC 3BYVA 1ZMWA 3RPVA 5C4LA 3O7LB 3D14A 4YURA 4YSMA 2QOQA 4JX3A 5ITAA 3G6HA 5DN3A 4BWXA 3LM0A 2B0QA 4NJDA 4USDA 5M4FA 5CZIA 3ZM4A 4RVLA 2R3PA 2YHVA 2X9FA 4FC0A 4WNOA 2PUUA 4CGAA 2WU6A 1HOWA 3QLGA 4GFOA 4AA4A 4BCJA 5GZAA 3GC7A 4KSQA 4ANMA 3MH0A 4E4XA 3BCEA 2CMWA 3PRFA 2QI8A 2C3IB 2RFSA 4L52A 4X2JA 3ZZWA 4CFWA 3HA8A 1XH7A 2I1MA 2R3MA 4A9YA 1Q61A 4BIBA 4BDJA 3GFWA 4KBKA 1R78A 2E9OA 4Q5EA 4RX9A 5L6PA 2HWOA 1Q8WA 2YCRA 5EOBA 3VS1A 2B52A 2JIUA 3S4QA 4A07A 4ZTMA 3AC8A 4O0XA 3CC6A 1W82A 3NX8A 4PMMA 3HV5A 3ZLYA 4EZ3A 3BIZA 1UNLA 4O27B 4Z7GA 4TTHB 5K9IA 3SG8A 4AUAA 3DBFA 5CEOA 2ZJWA 3RZBA 4Y72A 4MWIA 1UU9A 5AUUA 2CLXA 3OWJA 4QMOA 5ANJA 5K4IA 3QRTA 4FV6A 2BHHA 4G17A 4U3ZA 1CDKA 3KF4A 4I92A 4O0SA 2BAKA 3AT4A 5KKRC 3IO7A 3R1YA 5E8WA 3R9HA 4D55A 2UUEA 3KVWA 4RBLA 4C8BA 1FVTA 5JFXA 1B38A 2OXDA 4ZK5A 5EI8A 3REPA 3PDTA 4RSSA 2RFDA 3ZUVA 1PYEA 4FZ7A 2PMIA 1OIYA 3NAXA 2QODA 3ODZX 4H3BA 2CKOA 2W05A 4D0XA 1QMZA 3C7QA 5M4CA 4O7YA 4EOPA 3R04A 4C4HA 2O64A 3D7TB 5EYKA 4YPDA 1P4FA 3E7VA 2QNJA 4YNOA 4RVTA 4IVCA 4ZIMA 3EMGA 2XNBA 5B7VA 5FXRA 4FTQA 4YO6A 2CJMA 3RP9A 4DTKA 5HVYA 3JS2A 3NYXA 4JDJA 3EQBA 3R83A 3M2WA 3HUBA 4EOJA 3H4JA 4M84A 4MXOA 2UZDA 3CJGA 4CCBA 4FNZA 3QRKA 1H4LA 4S2ZA 3A62A 3MY5A 2QONA 4QPMA 1YRPA 3CTQA 4FODA 5AJQA 1Q8ZA 3BYOA 1Z5MA 4F7JA 2ETMA 3OG7A 5EHOA 2XJ2A 1DI8A 4C7TA 4U45A 4EC9A 3F5XA 1X8BA 3FKNA 1XHAA 3MS9A 5K4JA 2GDOA 4MQ1A 2Y6OA 3FMHA 2WO6A 4I3ZA 2PVHA 5L2QA 3FPMA 4R8QA 3C5IA 2UVYA 3FV8A 4W4VA 3WF6A 4BB4A 3Q3BA 4WSQA 3WF7A 2QCSA 4QP8A 2X2MA 3VBYA 2PVFA 3UQFA 2GNJA 2LAVA 4EOSA 1M7QA 1H0WA 4IZ7A 5ETIA 2R7IA 3WF5A 1MUOA 4BCFA 3N4VA 2IO6A 4PP9A 2UZLA 5EM7A 4ZTSA 3L9NA 2VTJA 2JKOA 4K2RA 4K6ZA 4TKSA 3Q60A 1U59A 4HCVA 3R2YA 4X3FA 3FC2A 3U6HA 3WOWA 3NDMA 1OKYA 3QYWA 4XV2A 3WI6A 4BKZA 3OCGA 5LWMA 1L8TA 3M1SA 2VAGA 2ACXA 3MYGA 4IJPA 3LXNA 2F7ZE 2HW7A 3KGAA 3OWKA 4OAVB 5EQPA 1XH9A 3QD0A 4GG5A 4NKAA 3ZFYA 4EI4A 3KREA 2ZV9A 2YABA 4PRJA 3FBVA 2UZVA 4BI2A 3HV4A 4AW0A 5DG5A 1ZYJA 3QC4A 4XG8A 1H27A 3SXSA 2G2FA 3LKMA 2B1PA 4L53A 3EQPA 2V22A 3P5KA 3KU2A 4OTRA 4C02A 2I7QA 1PXPA 4F0IA 1CTPE 4QPAA 4XP2A 4AZVA 2X2LA 4C38A 3COHA 3LXKA 4QTEA 4CLJA 2BAJA 2RFNA 4RLLA 4Q9SA 4S30A 3FMMA 3HYHA 4CSVA 3PVWA 4O7WA 2PVRA 5T68A 4O22A 4K9YA 3PVGA 3GC9A 4XUFA 4U80A 4YNEA 4UMUA 4QP2A 5ACKA 2WTKB 4O7TA 1E1XA 2VV9A 5IF1A 4XP0A 3W2RA 3NW5A 3ATSA 4I0RA 3TTIA 1OIQA 1H26A 2XK8A 3HVCA 4FX3A 3L1SA 4MXCA 2VTPA 3RGFA 2WMXA 2PHKA 3NRMA 3P7BA 3F3UA 4TN6A 4ALUA 4YZMA 3JY0A 2GQGA 4CZUA 3QTRA 1I09A 3IKAA 4MK0A 3HUCA 5C26A 3ENMA 3D94A 4FKJA 1NVRA 3UDBA 3TV6A 3DXPA 4JQEA 2GFCA 5FGKA 2HAKA 3VS0A 3LFFA 5AIKA 4ITHA 5TKDA 3D5UA 3RI1A 2UZNA 1KSWA 5AR3A 4LL5A 3HRFA 4EQMA 3JVRA 3K5UA 3KN5A 2CGUA 1PMUA 3PTGA 2F57A 4TZRA 4WHZA 4JAIA 4EH6A 1SVHA 2F9GA 3EL8A 2XIRA 3VBVA 2VTOA 4B99A 4PNKA 3HAVA 3AT3A 4J98A 2XJ1A 1Z9XA 3BHVA 1Q8YA 4C62A 1Y6AA 1BL7A 3G0EA 3TZ7A 4EKKA 4UMRA 3R7UA 4PDYA 3W32A 4PL3A 3EB0A 3WZEA 3G0FA 1IA9A 3LCDA 1P5EA 2VX3A 2WQBA 3VUTA 2UW0A 2BALA 4NH1A 3R7EA 4IB3A 5KKRB 2ONLA 1NVSA 1H1WA 2UZOA 3CY2A 1REKA 3EN4A 3G33A 4G2FA 5D1JA 5JRQA 2Z7SA 4XMOA 5D9HA 3F3WA 4K11A 4N0SA 2IG7A 3ET7A 3AMAA 5H3QA 2PMOX 4GKHA 2W5AA 5I4NA 4XS2A 4YPSA 2ITWA 4ACDA 4DBNA 1ZLTA 5G1XA 5CU3A 3VHKA 2C5VA 3PVBA 3SLSA 4FT0A 4O0WA 1ZMVA 2R3QA 1WMKA 4XNEA 3ZEPA 4YJSA 5DHJA 3U54A 4U79A 2XM8A 1JKSA 1H1SA 3LVPA 4X0MA 3DPKA 3CKXA 4XV1A 4AF3A 4EOIA 5H2UA 2F49A 3K54A 1Q62A 2W1DA 3RPRA 2R3KA 4G31A 4BZOA 5E90A 4YO4A 3KRWA 2ZOQA 1SNXA 1YXXA 1NVQA 4MKCA 4IX6A 4R3PA 5LMAA 3RBWA 4B6LA 3PJ2A 3F3TA 1IA8A 2AUHA 2P4IA 5CNOA 3R8LA 3CBLA 3R71A 3UO4A 4WUNA 2W9FB 3FZTA 4NEUA 3VUMA 2KULA 4ZY4A 1OBGA 1DM2A 3CEKA 3OXZA 3PA4A 2H96A 4FSNA 1PRYA 5A4TA 3MDYA 3ROYA 1OL5A 3IDPA 4I5HA 4FTCA 4PTEA 3TKIA 4JNWA 4ANQA 4J8NA 3AC5A 4C37A 2J4ZA 4MF0A 4BYIA 3AXWA 3DNDA 4YSJA 4G34A 4U42A 1H1PA 4YZDA 4MD9E 4ASXA 5KMMA 4FOCA 3GCUA 3VJOA 4CMUA 3SVVA 4I24A 5B2KA 3MJ2A 4CTCA 4IZYA 2I0YA 2WEVA 5FTOA 4WO5A 4EHVA 3ZUTA 4A9SA 4KIOA 1CMKE 4FNYA 4QP9A 2P3GX 3FI3A 1NXKA 2ETKA 2BRBA 3DAKA 4RMZA 3ZBFA 4DFYA 3LMIA 3KMUA 3OF0A 5LXMA 4F63A 2GHMA 3LJ1A 4FV8A 2BKKA 4ZMEA 5CVHA 4QMXA 5DVRA 3DAJA 4C61A 1U54A 5AP5A 2REIA 3NUXA 2R7BA 5E7RA 4E4LA 4AT5A 4DEEA 1OBDA 4R5YA 4LOOA 3TM0A 4YJUA 4BDIA 4O6EA 3GU8A 1Z57A 4UXLA 2WIHA 2W4KA 2XYUA 1PKGA 1ZYLA 4O7ZA 2PZ5A 5AUVA 5TR6A 5I9XA 2XB7A 4U6RA 4I6FA 2J6MA 3NIZA 3PJ8A 3Q4UA 5M51A 4RA5A 2WD1A 3A7HA 4L3PA 2H34A 2B53A 3ENHA 2XP2A 1O6LA 3LJ0A 1YHVA 4G6OA 4RQVA 3H9FA 5GZ8A 3PA3A 5CNNA 4IWQA 3TT0A 3HRCA 4E5WA 3RWPA 3KMMA 2QHNA 2PUNA 3ZRLA 1UWHA 3DTCA 2VGOA 3NUUA 5LVPA 1H8FA 3EKKA 4GVAA 3UQCA 5FDPA 2XYNA 5AV3A 4D2WA 2BAQA 3TXOA 4PDOA 3C4ZA 3ITZA 3R73A 3FY2A 3CPCA 3NLBA 3OVVA 2B9JA 3BU5A 3VBQA 1SNUA 3D5XA 3IS5A 5CI6A 5EQEA 4FG8A 3MTLA 1YDRE 4FNXA 1IRKA 4RC2A 4YJVA 4DGMA 4FGRA 5AP7A 5M56A 4R7BA 1PF8A 2PVKA 3ORZA 5HE2A 5A54A 1UKIA 5DR9A 5E8XA 3RPYA 4FYOA 2W4OA 4HYIA 1JSVA 2XNNA 4TY1A 4FIIA 2Q83A 2WFYA 2YISA 5G6VA 5HHWA 3VS4A 1W98A 2W1EA 3AQVA 5DR6A 2J90A 2SRCA 3OTVA 4AZSA 4H58A 4AFJA 5DRBA 3HMPA 4W8EA 4UYAA 1W83A 4R77A 4F1TA 2R3OA 4H36A 3I0OA 4FKOA 5AUWA 3V5JA 3NCGA 4OW8A 3QUPA 3TKHA 4EK5A 4GVJA 3TEIA 3UVRA 2YM7A 3E8DA 1R1WA 5M06A 3N4TA 2I0HA 2XNPA 2YN8A 3QUEA 4HVDA 5DWRA 4ZAUA 1UU3A 3QA0A 4USFA 3TACA 3S00A 4FG9A 1OITA 3GQLA 4I5PA 4I0SA 2W9ZB 3CTJA 5AX9A 3BWFA 4AW2A 3D7ZA 5JQ5A 4DT9A 4DH3A 3ZO1A 1T46A 4CKRA 2C6TA 5ANKA 4YBKA 4BDAA 2EXMA 5HESA 3RNYA 4TL0A 2ZAZA 4S34A 4FV0A 2W96B 5D41A 5LCKA 3ACJA 2PYWA 4AN9A 2FO0A 5AWMA 5IMEA 2QOBA 4Z3VA 5B0XA 3V5TA 3WF9A 4B7TA 2VTNA 3BRBA 3B2TA 1R39A 5J7HA 3PSBA 3DXQA 3E8NA 2OIBA 3QTXA 2YM4A 4BDKA 3AMBA 4UB7A 2C5NA 3BZ3A 3GC0A 3L8PA 3QA8A 3T3VA 4EH8A 3MA3A 3RALA 1UU7A 1YXTA 4Y73A 4E6DA 1U54B 4XRJA 4MNFA 4NM7A 3S95A 4BCGA 3FKOA 4HOKA 4JLCA 4LGDA 2WMUA 3RM7A 2JAMA 1NW1A 5HNBA 2Q0NA 1O6KA 3GP0A 4FA2A 3FXZA 2Y4PA 4M67A 4YBJA 1OMWA 5AM6A 2WTWA 2VU3A 3F5GA 3DFCB 3BYSA 3UVPA 4D1ZA 2WQNA 4M7IA 4BYJA 1JWHA 4GYGA 4EBVA 2R5TA 2XK9A 3MY0A 4Y85A 1QPEA 2R3HA 5IUIA 5L6WL 5EKNA 5IQBA 3M42A 4QQTA 4ENYA 3PPJA 4FKSA 4XH6A 5CEMA 3MBLA 4PWNA 4KD1A 5JFVA 5HX6A 2I0EA 5IEVA 4WA9A 2QO2A 4E26A 2BMCA 5CAOA 4KABA 2X4FA 4XP3A 3U87A 4GV1A 3R9OA 3I5ZA 3IECA 4IDVA 4ZLYA 4ZSJA 4W9WA 4AU8A 5A4LA 2PK9A 3F66A 2BILB 4RZVA 2XRUA 4U81A 2J5EA 3QKLA 4ZJVA 1JKKA 4JS8A 4R1VA 3SQQA 4YUQA 3UG2A 4ZSGA 4UMQA 4TYGA 3DJ5A 4XJ0A 3UIUA 4FT9A 3UPZA 5K5XA 4F6SA 2X2KA 1LEZA 5LCJA 3W2QA 4GUEA 1K3AA 4N4SA 2VRXA 3KCFA 2WMSA 1H0VA 3KA0A 2OK1A 3OBJA 2JDTA 1M2PA 4P2KA 1IAJA 4KKHA 3I7CA 1E1VA 1OKWA 3CR0A 4BCPA 3QQHA 5BVFA 2UV2A 1XH6A 5EYMA 1PHKA 3AC4A 5HTCA 5AFVA 3TI1A 3VNTA 4I41A 3FL5A 4QPSA 1E9HA 3AOXA 4CT1A 5DLSA 4U3YA 1JKLA 2YIWA 4E5AX 5EW8A 2BROA 3C50A 1H07A 3R2BA 4TWPA 3HP5A 4DBXA 4FTAA 5E8TA 2Y9QA 3DOGA 3G90X 4AT3A 5HNIX 2Q0BA 4L45A 4NW5A 3O8PA 3F3VA 1UKHA 4F1OA 3AGLA 3U51A 4FI1A 5DIAA 2CN5A 3OCSA 3QTIA 4YU2A 2JDOA 4F1MA 2BDWA 4DLIA 3FQEA 1HCLA 4RC4A 2W5BA 2C6LA 4M69A 3G5DA 5HQ0A 4OUCA 3CY3A 4NK9A 4QMTA 4PNIA 3MB7A 4O2PA 4XOZA 5K5NA 4A4XA 1SVEA 3DKOA 4IANA 4D4VA 3W10A 1IEPA 4FT7A 3R7OA 4DH7A 2G2HA 3JY9A 4GS6A 5EQYA 3EZRA 2XNGA 5TE0A 3UP2A 4F0GA 4DITA 4HVGA 5IQHA 4J1RA 3OZ6A 3D5WA 1FMKA 4F9CA 5A9UA 3D9VA 4IM2A 5KHWA 5A46A 3IDBA 4HGSA 1G8SA 2XK7A 3PRIA 4NJ3A 2C69A 2WQMA 1JKTA 3EN9A 4K33A 2X6EA 3HZTA 4WIHA 2VTIA 4JBQA 2OKRA 4G1WA 3VC4A 5A4EA 3HAMA 1T45A 3GENA 2X4ZA 2FSLX 2VWVA 3ZONA 1YXUA 5HEZA 5BNJA 2FH9A 4ZTQA 3O2MA 2YITA 4I93A 5T6KA 5HBHA 5CEKA 3ZM9A 3QXOA 1ZY5A 4L00A 4M15A 5CU2A 5J8IA 4JIAA 2C5OA 3GCPA 1GNGA 2HW6A 4BHNA 3CS9A 4AG8A 4J95A 1H01A 4QTDA 3D15A 1STCE 4QYEA 4Z7HA 4P5QA 2I40A 2GCDA 3FLSA 2BDJA 4E6CA 5LJJA 4C57A 4G3CA 2CNQA 3N4UA 1UNGA 1FOTA 2PVMA 5AX3A 5C01A 1ZYCA 3QU0A 1MP8A 4ANNA 4CMTA 3OOGA 5E1EA 2OW3A 4PF4A 3VRZA 3AC2A 3FWQA 3FL4A 3LCSA 4XG6A 5IH5A 5CLPA 3LFEA 2ITZA 1SMHA 2QOCA 2XBAA 3II5A 4NZWB 2WELA 2J0LA 3R30A 4LQMA 3E8CA 3NNWA 4MEDA 4TYJA 3AD4A 2FB8A 4RT7A 3LFDA 1DAYA 1YWVA 3ZS5A 3O71A 4IX5A 4CFNA 4D9UA 3FI4A 1Q41A 1YDTE 4GFGA 5M57A 3FC1X 4WRGA 2UW3A 2ZB1A 3ORPA 4FSQA 4I21A 3UTOA 1PMNA 4FTOA 2BRMA 3MIAA 3K3IA 3OWPA 3OOMA 4BC6A 3IW7A 4CKIA 3GEQA 5A4QA 2C0OA 4FG7A 5LOHA 4PP7A 1KV1A 4U7ZA 1YI3A 4ACGA 3VVHA 3FKLA 5FXSA 5A6OA 4FV4A 3WBLA 4RJ8A 5E8VA 3OEZA 3PE1A 5C8KA 2IPXA 4IVDA 5J7BA 2XEYA 5D10A 3HLLA 4AA0A 3HMNA 1JSUA 3FMEA 2YWVA 4L8MA 2F2CB 1K9AA 3O96A 3RPSA 3PFQA 3Q5ZA 4J53A 5EDPA 5HD4A 4TYHA 2F7XE 4TPTA 3F69A 2BKZA 3ORMA 4ASEA 4E20A 2UW7A 3VO3A 4ZS4A 2YFXA 4JL9A 5LVLA 4FKVA 4JG6A 2HWPA 2CCIA 2QURA 4WNPA 5IKWA 3QHWA 4OTHA 2YM6A 2PVYA 2UZUE 5ACBC 3SV0A 3BELA 3CSVA 5LMBA 4DEDA 2OFUA 3PJ1A 4TWOA 4ACHA 1J7UA 4C4IA 2B9IA 5M08A 4BGQA 5FRIA 4JOAA 2OIQA 4ZLOA 1PXMA 4L68A 2F7EE 2DWBA 4PMTA 3R63A 4ZP5A 4BDCA 2A19B 5C4KA 3FZ1A 1LEWA 4KS7A 3OFMA 1JQHA 5K0KA 3UZRA 3ZCLA 4QQJA 4AWIA 4R78A 4XX9A 4KB8A 4C36A 4WNMA 5AR4A 2UW9A 3EYHA 2HZIA 4M68A 4PPBA 5EM6A 5F1ZA 4H05A 3MFTA 4GK3A 3QALE 3HMOA 2GHLA 3MY1A 1B39A 1W7HA 2RG6A 1APME 3FMDA 4BN1A 4X2NA 4BWKA 4D2VA 4DC2A 3V5PA 3D5VA 3IW4A 4RFYA 2PUIA 1H00A 2UZEA 3WARA 5KZ0A 4AX8A 2NRUA 3DKGA 4RPVA 3DB6A 2FA2A 1KE9A 4RJ7A 1U5QA 3BEGA 4MXYA 3ZO2A 5HCYA 4X7QA 3FHRA 3I1AA 4QMQA 5M07A 4QQ5A 3Q96A 4PPAA 2GNFA 4WD5A 4E6AA 2VNWA 2Z7QA 2P55A 2EXCX 3NEWA 5HICA 4CTBA 2JC6A 4C4EA 3MH1A 4DCAA 2GS6A 2W1ZA 3C4XA 2OXYA 4FV2A 4DA5A 4BF2A 5HORA 5FEEA 2W99B 3CGFA 3LW0A 1FVVA 4FV7A 3MFSA 4QNAA 4HVIA 2WIPA 3C4EA 2CKPA 2HY0A 2W7XA 1J1CA 3WF8A 4BDHA 3LFNA 5BVDA 4CYJA 2BRGA 2ITXA 3UMXA 4ZY6A 3LMGA 3ERKA 1PXOA 3LE6A 1SM2A 4I6BA 3WZDA 3PJ3A 3NYOA 3QRIA 3COIA 4FMQA 3JUHA 4RQKA 2QKRA 2IWIA 4LMUA 5KMKA 1YOMA 2GMXA 2C4GA 4DAWA 4NSTA 3I6UA 3C4CA 2EVAA 3R8MA 4AZEA 4FKPA 2GFSA 3FXXA 4DEBA 4DEIA 2HCKA 2ITPA 3HP2A 3ODYX 3H0ZA 4WG3A 5EDQA 4NKSA 2Z02A 2R3RA 3R6XA 3TUDA 4EKLA 1YXVA 4C2WA 2C68A 1BKXA 3LLTA 5AV4A 4QMPA 1PW2A 4EQCA 1Q3WA 2QQ7A 3I6WA 2B9HA 3CE3A 4M12A 1Q4LA 4TYHB 1SZMA 4DFNA 3NUYA 2XJ0A 3FLWA 4O7LA 3MWUA 2WZJA 3WYXA 3S1HA 4MD8E 2CGWA 4OLIA 5KMLA 3ZC6A 1CM8A 3A4PA 1RDQE 3A8XA 2W1CA 1BUHA 3ZOSA 2WTIA 2CPKE 3QFVA 3W8QA 3BLHA 5AR8A 5JH6A 4FK3A 3TZ9A 2GU8A 3RPOA 3ORTA 3QQUA 3MGYA 5AP0A 5FEDA 4GU9A 4D2SA 3GGFA 4LG4A 4IFCA 1RJBA 2OJJA 3IK3A 4MVFA 5EH0A 2DUVA 5DPVA 5IH6A 5CENA 3TJCA 5EHLA 1QCFA 2BDFA 4FZAB 5HI2A 2V0DA 5I0BA 2ITVA 3LQ8A 3PE2A 3HA6A 2YM3A 5JKGA 3I79A 5KNJA 3TL8A 3NNXA 4G6LA 2XVDA 5GHVA 5C03A 3LLAA 2JDSA 4G3FA 3MH2A 3KB7A 3AD5A 2CGXA 4O84A 1OECA 5HGIA 4D1XA 3R1SA 2PUPA 2NPQA 3ALNA 4CNHA 1WBVA 2R3GA 2PWLA 1P14A 1VR2A 2J0MB 2VO3A 2Y4IC 5CANA 3BYUA 3LFCA 3CCNA 4W4WA 5FTQA 3W18A 3D2KA 4F7SA 5CF6A 4FSTA 3NMUF 2R3JA 4BRXA 3C13A 4C3RA 3Q5IA 5IA3A 2X7FA 3IW5A 3LOKA 5I9YA 4FL3A 4O0TA 4IVAA 4LV8A 4V0GA 4JR3A 4JG8A 5A3XA 4YR8A 4ZTHA 3E92A 2GPHA 2YJSA 2R0IA 2R4BA 3FZPA 4AGWA 5JGBA 5FXQA 3F7ZA 4AN3A 3LQ5A 4FTTA 2EWAA 3KN6A 3SRVB 5HZNA 3EKNA 3I5NA 1GZKA 3AC1A 4LM5A 2V62A 3GOKA 5DI1A 1KOAA 4CQGA 3CQEA 5BX0A 4ZMFA 4U0IA 3QZFA 3MIYA 2J0IA 3KRLA 3OT3A 2VZ6A 4IACA 1IR3A 3POOA 1VJYA 3SXRA 4ZEGA 5F9EA 4DINA 3E63A 3Q6WA 3QC9A 2G01A 4E73A 4BBEA 2ZB0A 3PXFA 2YCFA 1GY3A 2WMWA 2ZM3A 4BTMA 2A4LA 4F6WA 4UXQA 4YJPA 2J50A 4K8AA 4NUSA 4O38A 1PYXA 4F9BA 1JVPP 5IDPA 2PSQA 3DDQA 4NT4A 4ERWA 4BY9E 1XH5A 5LWNA 1V1KA 4JG7A 2OO8X 4IAFA 4C3FA 2YZAA 4UMTA 5HTIA 2WEIA 1MRVA 2BZHB 3IDCA 3KL8A 3DGKA 4QMLA 4KA3A 3RAWA 5CXZA 3MVLA 4JT3A 5CF4A 3UOHA 2QG7A 3JR1A 1B6CB 3BGPA 2Y6MA 5BVNA 3W8LA 3F6XA 4RWLA 2OF2A 4KUJA 3HMIA 4O1OA 4DGNA 2ZDUA 2FYSA 2C0TA 2VO7A 4KAOA 4A06A 4QT1A 3UGCA 3NUAA 3Q9XA 3FHIA 1LP4A 4DCEA 4C59A 1P4OA 4Q5HA 4GMYA 3SXFA 4ZTNA 3KXNA 3OY1A 1BI8A 2H9VA 2VWUA 2XNMA 4PL5A 2G2IA 4E93A 2ZMDA 2OU7A 2OFVA 1AGWA 3O51A 4XLIA 3SC1A 3R7GA 5BQ0A 3U6IA 1WAKA 4FKUA 2Z7LA 4FVQA 2OJIA 4CFVA 4CLIA 4X3JA 4NWMA 1QL6A 3NVKI 3P0MA 1FINA 2X0GA 4F70A 4I20A 5AUTA 4I0TA 4ZY5A 2IZTA 5A14A 2EB3A 2YIRA 3E62A 3Q04A 4GJ2A 5AV2A 3IQ7A 3LCOA 4KRDA 4BBMA 4E4NA 4EUTA 4FEUA 1M2QA 3C0IA 1OPKA 5D11A 3RZFA 5HKMA 4KSPA 2QG5A 4NTSA 1PXJA 3FMKA 5HO8A 4DFXE 4EORA 4AW1A 3O0GA 4IC8A 3WZKA 3BU6A 3QHRA 3A7JA 4L9IA 2WNTA 3KXMA 4X2FA 5E8YA 2O8YA 4JBOA 5CAPA 3WIGA 4EC8A 4FEXA 5DOSA 4EJNA 2QOLA 2IW8A 3UO6A 1J7IA 4GRBA 3KEXA 4ZS0A 5IPJA 1ND4A 5EYCA 2J51A 3ORLA 5LMKC 5FM2A 4DFBA 3DJ6A 1VYWA 1P2AA 4V0GB 3MVHA 3PSCA 5IH4A 4GIIA 4JQ7A 5C27A 4DEAA 1FPUA 4JR7A 4OT6A 5CX9A 3SA0A 2B9FA 3V8WA 5HBJA 5HLPA 5JZJA 2BR1A 5LQFA 1TQMA 4XRLA 1U46A 2QR7A 3PLSA 2PU8A 3ZH8A 4C58A 4HZRA 4P7EA 4YHTA 1PMVA 2P2HA 2KTYA 1M52A 3E3PA 3FLQA 4TRLA 4U8ZA 5KMOA 4BR3A 3Q6UA 1YVJA 4R7HA 3UNZA 2FUMA 4RIXA 3FSKA 1JOWB 3IONA 1FVRA 4LOPA 2O3PA 3V04A 4DGGA 1JBPE 4FKGA 4A4LA 3K3JA 5CI7A 2GQSA 4I4FA 2IVSA 2HYYA 3V8SA 5M44A 4AE9A 2WTDA 3DJ7A 1QPCA 2R2PA 5BVKA 3RMFA 3VBXA 2UZBA 4A7CA 5AA8A 1OPJA 3L8VA 5IQGA 3R21A 3CQUA 4TWCA 3V6RA 4F9AA 4IBMA 4NM3A 3C5UA 5GJFA 3DS6A 5FD2A 4KKGA 2J7TA 4X2GA 2JKQA 3BQRA 3RKBA 3GU4A 3I60A 3ZDIA 3KXGA 2CKEA 3QQFA 4IX3A 4PTCA 2GSFA 1K2PA 3Q52A 1PKDA 2Y4IB 5EKOA 1REJA 3PXZA 4KBAA 5K0XA 4GH2A 3CQWA 4LL0A 4QO9A 3NW7A 4NM5A 1OIUA 5CASA 4RFMA 2Y0AA 4AA5A 3DZQA 2OJFE 4YJRA 2BVAA 3C1XA 5IA2A 2FVDA 1Q3DA 5HG9A 4O7VA 4F64A 3BKBA 3EIDA 3PIYA 2J5FA 4IMYA 5HIDA 2NNWB 4PDPA 3CKWA 3KRXA 3QD2B 3Q9WA 5AV0A 1ZOEA 3E64A 3W2OA 3CXWA 3B2WA 3BE9A 3QGYA 5AM7A 3BLRA 4OT5A 3UYTA 5I9VA 3NGAA 4O6LA 5CZHA 3QTQA 3ULIA 2YM5A 5CY3A 2NP8A 3NYVA 4AAAA 2A2AA 3UQGA 3QCYA 4GIHA 5GZ9A 3LMHA 2VO6A 2BTRA 5M4IA 3E88A 2EUFB 2ZMCA 4QP7A 3RNIA 5IQEA 3NIEA 2RFEA 3R8ZA 2ZVAA 4O21A 1OL2A 3KF7A 3OS3A 3AT2A 3IW6A 3FLZA 4IAKA 3PXYA 4QNYA 1Q5KA 3I4BA 3EFJA 3IPHA 4IEBA 4WT6A 5I9UA 1PMEA 4IC7A 4AGUA 4C3PA 2P0CA 3GUBA 4XBUA 2JIIA 5FG8A 3OTUA 5C8NA 4OTFA 2XKDA 5HO6A 4FV1A 4Y5QA 1PXIA 3RJCA 3BGZA 3QQLA 2JFLA 4NFNA 4AGCA 5L8LA 3C51A 2B54A 4PMSA 3UIMA 5JN2A 3KQ7A 4FVPA 4ZJJA 4EK4A 4JIKA 4TYIA 2QO9A 3DZOA 3H30A 4HNFA 1KE7A 2C6EA 2XKFA 3A7FA 3N51A 3PXRA 3PXQA 2JEDA 4IX4A 3LFBA 4V01A 5A6NA 3FEGA 3R1QA 4YP8A 4YTCA 2C6OA 4H3PA 2WB8A 4LFIA 4CRLA 2XK4A 3NUNA 4FE2A 1YWRA 4UEUA 1XWSA 3E5AA 5H8BA 4EQUA 5TF9A 4BDGA 5AUXA 3IOPA 3ZEWA 2VTTA 3VW6A 4RIXB 1GZ8A 3OCBA 4KS8A 3QD3A 1IG1A 1OL7A 3GU5A 4PL4A 5AP3A 4B8LA 4UY9A 3KXZA 4EH3A 5IZFA 1DAWA 4MX9A 4HGTA 2X7GA 5CYIA 2WGJA 3Q4CA 5AP1A 2IW9A 3LHJA 4FTRA 5I9ZA 5IQFA 1PY5A 1ZZ2A 4CT2A 4QQCA 3KVXA 4FKLA 4R5SA 5F95A 3WE8A 2W06A 2JAVA 5JGAA 4EZ5A 2BCJA 1WVXA 4NCTC 4L7SA 3L8SA 1OVEA 4E8AA 2VWYA 3VF9A 4QD6A 5ETAA 4P90A 3UBDA 5IA1A 5J9LA 5CS6A 4U97A 4YJOA 2XF0A 4YZBA 1OL6A 1YQJA 2Z8CA 4BBFA 4KBCA 4UN0C 1XQZA 4GUBA 4FSRA 5L8KA 2CKQA 3R9DA 5AUZA 5AP6A 2X39A 3KK9A 1XBCA 3QXPA 4H1MA 2B55A 4ZJIA 5IU2A 3CGOA 1O9UA 3DT1A 4IIRA 3U9NA 4A9UA 4AOTA 4BDFA 3TIZA 5CU6A 5IQCA 4F9WA 4BCNA 2YZLA 4DFZE 1ZYDA 5AMNA 3SKCA 2WKMA 3TTJA 4QTBA 3UZTA 1Q8TA 2JKKA 4XLVA 5M4UA 3ORNA 5AR2A 4FTUA 4JX7A 5ETFA 5IUHA 4DF3A 4EH2A 3BWJA 4FF8A 4NL0A 1OGUA 4OTWA 3DA6A 4BCHA 4G16A 3R00A 5KBRA 3F5PA 1A06A 3C9WA 4KINA 3RAIA 1XBAA 4JVGA 4J99A 3QTUA 1F3MC 2UZWE 3B8QA 3PY3A 4PPCA 5M55A 1F0QA 3PWDA 1S9JA 3A8WA 3P86A 3MPTA 2PVLA 3LM5A 3QQGA 4D2TA 4YJTA 4EUUA 3BE2A 4R3CA 5CT7A 2R0UA 5BUIA 2W5HA 4J97A 4BIDA 4O86A 3TZ8A 4EK6A 5LVOA 4AZTA 2ZV8A 1FGIA 3GBZA 2CNVA 2XIZA 3DKFA 2WTJA 3ZFXA 4AXAA 2BIYA 5AP2A 4LRMA 3NS9A 2XKCA 2IVTA 1YWNA 4RLKA 4RWIA 5D7AA 4UYNA 4LRJA 3TZMA 3W16A 4EK3A 3K2LA 4ASDA 5KMIA 5JFWA 2QO7A 3FI8A 2OJ9A 5AV1A 5L6OA 3PLAE 3JXWA 4U5JA 4D2PA 2X8EA 4IB0A 1Q24A 2ITTA 2PVJA 1OKVA 3EQIA 3HNGA 3I7BA 4FSYA 1IASA 4DEHA 4EH7A 4OAUC 5KZIA 4A9TA 2VWXA 3RVGA 3TNPC 2J2IB 4OTIA 4AP7A 5CF5A 4LGGA 3BYMA 3UC4A 4G5PA 5JEBA 5DEYA 4O82A 3QTWA 2ESMA 3EYGA 2JIVA 3BLQA 4CCUA 2PZYA 4FSWA 3RINA 2HXLA 4HGEA 3DU8A 4GG7A 4U9AA 1GAGA 1S9IA 3LXLA 4JDKA 5HU9A 3FDNA 3SW7A 3TUBA 4YTHA 4FTLA 5E8ZA 2Z7RA 3MSSA 3G2FA 4WG5A 4JBVA 4DG0E 4Y46A 3QGWA 4FTIA 2XIYA 3CD8A 4IE9A 3FYKX 4EHEA 4I5MA 3NPCA 4F4PA 3EQRA 2ITYA 3QCXA 4M97A 5AEPA 5DGZA 1AD5A 5J5TA 4ID7A 5KUPA 4V04A 4EH9A 4II5A 4NFMA 5EK7A 4KIKA 4RRVA 3RTPA 3R7YA 5HX8A 4MHAA 4FUYA 2YM8A 3FJQE 4RZWA 3HV7A 4BICA 3DK3A 3UNJA 3ZO4A 5DE2A 2JD5A 2YLEA 4WKQA 4RX8A 5CEQA 3GB2A 5I5ZA 1H24A 2BRNA 3F61A 1SYKA 4DH1A 3SG9A 4Y95A 3FZRA 2WQEA 4RJ5A 4UWCA 2O5KA 5LVNA 5BYLA 3ALOA 3V51A 4ARKA 3M11A 3Q9ZA 1YI6A 2HENA 1IAHA 1Q99A 1CKIA 3BBTB 5CSVA 3EQCA 4L3JA 3KMWA 4O0UA 4FUXA 1KE8A 5A4CA 3R7IA 4HVHA 1M17A 3DCVA 3U4WA 3Q9YA 5BUEA 3F82A 3TNHA 4UMPA 4I5CA 3QLFA 2JDVA 3IOKA 5HG7A 3SHEA 2QOFA 1PXLA 1GZOA 4HPUE 3W2PA 3TG1A 2W0JA 3S3IA 3TDWA 3Q32A 5DNRA 1GOLA 2C3LA 4J7BA 4FIGA 3OP5A 3FLNC 2GTMA 3KULA 4EYJA 1Q97A 3FQHA 4PQNA 3GVUA 4IFGA 4BDEA 1UU8A 4ERKA 5BPYA 3BHYA 2ITUA 3ATTA 3ACKA 3AD6A 5HE0A 5I9WA 3I0QA 3SDJA 1WZYA 4FV9A 3NUSA 4WOVA 3DBEA 3AGMA 2XM9A 3F2AA 2GHGA 4RX5A 2VN9A 3EFKA 3OXIA 4GJ3A 4ITIA 3SOCA 4EONA 2BPMA 2X8IA 1OZ1A 1W0XC 5IISA 1BX6A 3EQDA 1MQBA 5AAFA 4X21A 3E8EA 3QTSA 4HNIA 3VAPA 4E5BA 2XH5A 5KX8A 5CQUA 5J1VA 4D5KA 2ITOA 1NA7A 3QBNA 5E1SA 4CYIA 3MTFA 2J9MA 3R22A 4ZZMA 1JSTA 5HTBA 4HW7A 3Q2MA 3QL8A 2CLQA 4GCJA 3MJ1A 4FYNA 1OUKA 1KV2A 4KIPA 3LJ2A 1UNHA 3BHHA 3GC8A 1V0BA 3R7VA 3T9IA 4YTFA 3UC3A 2JITA 3H0YA 3BV2A 2OI4X 3TCPA 4FNWA 3OW4A 4IADA 4UZHA 1R0EA 1XH4A 1UVRA 2UVXA 3VN9A 3VWAA 4O7RA 4ZOGA 4FEQA 3HDMA 4L43A 3LFAA 3DTWA 4CFUA 3GI3A 4A9RA 1MQ4A 3OHTA 3UNKA 3IGOA 1OKZA 5DH3A 5IA0A 1YW2A 3KC3A 3ZSHA 4GEOA 1OL1A 3LFSA 4BKYA 3BBWA 3S0OA 3SOAA 3FPQA 3ZLWA 1OUYA 3HV3A 4PMPA 5FTGA 3VUDA 4I94A 4ZLZA 3H9OA 5J9YA 3BX5A 2HOGA 4J71A 3A4OX 3NSZA 3TJDA 4KIKB 4ACMA 4YJNA 4X6RA 4MQ2A 5HCXA 4EEVA 3RWQA 3QF9A 3FYJX 4Y83A 4FICA 4BGHA 3KCKA 4L7FA 3FSFA 4FSUA 2EXEA 2W17A 3FXWA 3R1NA 4YHFA 3A7IA 4IZAA 4HCTA 4MBLA 5EFQA 2J0KA 3K5VA 5E91A 3UPXA 5BVEA 1O6YA 3D0EA 3ORKA 1ZRZA 2R9SA 4GT3A 5FEQA 4MWHA 3QKKA 5JMSA 4ZSLA 5CQWA 3R8VA 3NWWA 3UVQA 4QMMA 4EOOA 2WOUA 4R7IA 4PUZA 3NR9A 3GXLA 5TOZA 2OZAA 4D9TA 1BI7A 3GQIA 1U5RA 3V5WA 1GIIA 2R3FA 1YOLA 4IB5A 5E8SA 5L2IA 3TUCA 2G9XA 5D12A 3WYYA 3OD6X 2C1BA 1Y57A 4FKWA 1F5QA 4QMVA 4YJQA 4DLJA 5CT0A 5J5SA 5GIPE 1YOJA 4AGDA 3HDNA 4AOIA 1HCKA 5IQDA 4QMZA 4P4CA 4BCOA 3E87A 4JRNA 4NIFB 2GQRA 2JKMA 3KULB 4H3QA 3QTZA 2VNYA 4CG9A 3GU6A 5EM8A 3F5UA 5DT3A 3VBTA 5GJGA 4TNBA 5EG3A 2YDIA 4EH5A 4FV5A 2WTVA 3PYYA 2E9VA 3P7AA 3RHXA 3H3CA 3V6SA 4XOYA 3NW6A 4IVBA 5IG1A 4YTIA 5CU4A 5CTPA 4C4GA 4MBIA 3SRVA 2A0CX 3A61A 2BFXA 3PP1A 2QR8A 3F3ZA 4RJ4A 1WBWA 4DTBA 3R01A 3ZFMA 5CSPA 4D5HA 5AP4A 3RM6A 3ZC5A 4FZDB 4Y5HA 4M8TA 2GS7A 3ZTXA 3RAKA 3UJGA 2Y7JA 4ZXTA 4NYEA 3A60A 1H1RA 3NNUA 1YI4A 3DQWA 5DR2A 5C1QB 2LGCA 3GFEA 2BHEA 2QOKA 3V3VA 4L44A 4ZTRA 3UOLA 4E4MA 3W2SA 3MH3A 5DRDA 3OEFX 2YERA 4D4RA 5BUJA 1A48A 3SGCA 3BEAA 2OBJA 1ATPE 2QLUA 3R8UA 4FEWA 1ZZLA 2YA9A 2UW6A 1QPJA 4WNKA 4ENXA 4RWJA 4BI1A 1FMOE 2R3IA 4DGOA 4O83A 4ORKA 3FMNA 3G9LX 2WQOA 1H28A 3T3UA 4ASZA 2UW8A 4DFLA 4WRSA 4G3GA 3HEGA 2C6KA 3R28A 3Q53A 4QP1A 4DH5A 4I6HA 5CAVA 1PXKA 4O7NA 5AAEA 2HZ4A 5EW9A 2C47A 3POZA 2OXXA 3ZU7A 5F4NA 1I44A 3SX9A 2PL0A 4FIFA 4X3FC 5IQIA 2IZRA 3E93A 4PDSA 4ZTLA 4QYGA 3DDPA 4GFMA 5M53A 3UE4A 4FL1A 4XV3A 4C4FA 3C0HA 5GINE 4GKIA 4FKIA 3CD3A 5HCZA 4NW6A 4AE6A 4W4XA 4XV9A 4UV0A 3ZDUA 4CFXA 3BQCA 4EZ7A 2JBOA 2F4JA 2XKEA 4BFMA 4R6VA 4MBJA 4WG4A 4AZWA 2PMLX 3ZRMA 4B9DA 4QP6A 3OC1A 3RAHA 3EL7A 3G9NA 4S31A 3UP7A 2WXVA 3BGQA 5HBEA 4CQEA 4BHZA 4Y8DA 4IAAA 3TN8A 3U4UA 3VS7A 4C35A 3SW4A 4DTAA 4G9CA 4F65A 5BMSA 2O63A 3DY7A 4JAJA 4PX6A 2OZAB 3GCSA 5DFPA 4MXXA 2FSOX 3TDVA 2VWZA 3TV7A 2YIQA 2ERKA 3DXNA 1U4DA 4CZTA 5CU0A 5FUTA 3NZ0A 2VUWA 1WBPA 3P4KA 4J52A 4FR4A 5AR7A 4DH8A 4NM0A 4O0RA 3IW8A 3MFRA 3DK6A 2BZJA 3EFWA 4FEVA 1NY3A 2GNGA 3PVUA 2VO0A 4FTJA 4E3CA 4XG3A 4YC8A 5CXHA 3OXTA 3QQJA 5EDRA 2WMRA 1YHWA 2O2UA 3VUIA 1M14A 3PUPA 4S33A 3F2RA 4G5JA 2GNLA 2XCKA 3WE4A 4QRCA 4UZDA 4XG2A 4M13A 3AC3A 4BCIA 2VWBA 2PY3A 2WPAA 3BHTA 3PG1A 4M0ZA 3C0GA 2V7AA 4YMJA 2VTAA 1CSNA 4FTNA 4S32A 3ZBXA 5GNKA 2WAJA 4K0YA 1JAMA 3G51A 5FWKK 2E9UA 3O50A 5HOAA 3A7GA 2CN8A 3FI2A 4J96A 5CVFA 4F0FA 3UG1A 3VHEA 2GS2A 4ALWA 4B8MA 2YIXA 2YCQA 1CKJA 1MRUA 4XHKB 3EH9A 3O8TA 4L46A 3VQUA 4F99A 2VWWA 3VS2A 4EYMA 4F09A 5IA4A 1WVYA 3ETAA 2RSVA 4EWHA 5B2LA 4RJ6A 4UWYA 3VQHA 4PV0A 2ITNA 5KBQA 4QMUA 1NT2A 4QTAA 4D0WA 2BUJA 4LUDA 5TT7A 3VS3A 3U9CA 3D2IA 4RG0A 1TKIA 2OF4A 3V8TA 2PZPA 1G5SA 1V0OA 5JT2A 2XEZA 2AC5A 1YHSA 2C6DA 3DBQA 3DKCA 4BIEA 3OCTA 2PPQA 5AIRA 2EB2A 5HU3A 2ZV2A 3EN6A 1DI9A 1BL6A 3VULA 4O81A 4TT7A 2I6LA 1V0PA 3EN5A 4GW8A 4TWNA 4DYMA 3Q2JA 2ONLC 2NRYA 4IZ5A 4HJOA 3KRJA 3W33A 4Q2AA 4JQ8A 2WMVA 3RK9A 1XKKA 5E8UA 5CVGA 4EK8A 3CPBA 4AT4A 1GIHA 4FKTA 5D7VA 4OTDA 4DEGA 2RGPA 2IVUA 4DG2E 3GOPA 3O17A 3MB6A 1FGKA 5CSXA 4BDDA 4BCMA 2PZIA 4QP3A 3NYNA 4CZYB 3EFLA 5C8MA 3D4QA 2IW6A 4XYFA 4Q9ZA 1EH4A 5JZNA 1LUFA 2VTMA 3TWJA 3F7WA 5B2MA 3H9RA 4Z16A 3NVMB 2C5XA 1WBNA 5KE0A 3UODA 2VX1A 4ACCA 5CEPA 2RKUA 3DLSA 1ZARA 4JXFA 3F88A 2IJMA 4HVSA 5J1WA 2X9EA 4EL9A 1JNKA 4APCA 3HX4A 5IEYA 2G1TA 4K77A 3V01A 5L3AA 2VTRA 3UIBA 2C30A 5HG5A 3LCKA 4EHZA 4RGJA 1ZXEA 3FMLA 5IEXA 3PXKA 5HVKA 3ZSIA 5KMJA 3R9RA 3ORXA 4KIQA 3FMJA 5L2WA 4RC3A 3EQFA 4QOXA 1M7NA 1W8CA 2XK6A 3AG9A 5FP5A 5M09A 2C5YA 3PY0A 1KOBA 2CGVA 3UIXA 2HZNA 5GIOE 3HGKA 3P9JA 4AACA
chains in the Genus database with same CATH superfamily
3DNEA 3VUKA 2QU6A 4CKJA 2QLQA 3A2CA 3EQHA 3I81A 3QUDA 3BLAA 2XS0A 4KNBA 4BTJA 1WVWA 1J7LA 2IVVA 2C3KA 5LVMA 4X3FB 3CTHA 5DT0A 3ANRA 3MPAA 4DFUA 2HXQA 3DLZA 4PTGA 5F20A 3R02A 4MCVA 2BFYA 2QU5A 1ZOHA 2OICA 2IN6A 4BGGA 3V5LA 2XCHA 3RCJA 1R0PA 4O7SA 3BPRA 4O0VA 2H8HA 2HIWA 4TYEA 5J9ZA 2ZV7A 3VJNA 2XRWA 1LPUA 4OTQA 1GJOA 4YZNA 2RG5A 4ZZOA 2Z2WA 2PE0A 5HO7A 5ICPA 5KO1A 3TNQB 1OIRA 3DAEA 3QX2A 4FT3A 1J3HA 2RF9A 3QD4A 4JRVA 3L8XA 3ZMMA 4G6NA 4M14A 5EI2A 4EJ7A 3ANQA 4RIWA 3QQKA 3B8RA 2E9PA 4EOQA 1ZAOA 3P79A 5CWZA 2I0VA 5IA5A 2YDKA 4RFZA 2QOHA 5CSHA 4ANOA 4D1SA 2FGIA 4MAOA 4BZNA 4F6UA 1BLXA 2QOIA 1ZWSA 2X7OA 1KUTA 5DYJA 4YZ9A 4OGRA 1XH8A 4QYYA 2JFMA 4F08A 5K3YA 4CV9A 3GT8A 3JPVA 4LRKA 1W84A 4FIJA 5AUYA 5JFSA 2JDRA 3PP0A 4J8MA 4O1PA 2OH4A 4ANBA 4HCUA 3RK7A 3DBDA 5JQ8A 5CSWA 4D4YA 5LMKA 1VZOA 5F94A 2XARA 1PXNA 2XA4A 4IAYA 2WU7A 4F7NA 2OH0E 3EWHA 4N6ZA 3VIDA 3QAME 3PIXA 3U8WA 2OWBA 3EN7A 4DHZA 2C0IA 1WCCA 4GYIA 4QMNA 2WMBA 4G9RA 4OBOA 2YCSA 4X2KA 4WUAA 3TKUA 2XNEA 4BWPA 4DHFA 3OY3A 3IG7A 4FOBA 4FL2A 2Z60A 4PY1A 3FY0A 5CALA 3FZOA 5FM3A 3DQXA 1SVGA 3VS6A 3ZO3A 3L9LA 3TIYA 3G15A 3PA5A 4IWOA 4L42A 2Y8OA 2OIDA 3E3BX 3FE3A 4IHPA 5ANGA 4RA4A 3PY1A 4ITJA 5ANEA 4E6QA 2QHMA 4ZSEA 2BIKB 5HLWA 3HV6A 4IB1A 2ETRA 4HYUA 4GT4A 4JJRA 4C33A 3P78A 4OBPA 1FBNA 3W55A 1KWPA 1QPDA 3HL7A 3V5QA 2B4SB 3VUHA 2CCHA 4W8DA 4YGAA 4BTKA 5HLNA 4G3DA 4GSBA 3T9TA 3BI6A 3NCZA 3OBGA 5FP6A 4Z9LA 4MH7A 1H25A 4O4FA 3R8PA 4A4OA 2GNIA 3UO5A 2AEGA 3ELJA 4QMSA 4CFMA 3MV5A 3ZLSA 2OG8A 4LGHA 3S2PA 3ZSGA 2J0JA 3Q4ZA 3D83A 4EOLA 4NTTA 3OMVA 4H39A 2DQ7X 2GTNA 4FBXA 1G3NA 2WTCA 3LCTA 3QCSA 4LV5A 3ZXZA 2V55A 3JYAA 4RJ3A 5LARA 2ZM1A 5HE3A 4O91A 4D28A 5CF8A 1Q8UA 4BTFA 3EZVA 4D58A 4LUEA 5J95A 3RCDA 4XG4A 5L4QA 2PE2A 1WBOA 4BI0A 4DE4A 5ANIA 3HKOA 3EHAA 3FAAA 3A99A 4I23A 3KY2A 4IAZA 3MVMA 2RL5A 3KXXA 5EW3A 5L8JA 1WBSA 2B7AA 1A9UA 4FT5A 5DA3A 4TW9A 4ZSAA 3CLYA 3PIZA 5AA9A 4YHJA 4RIWB 1OI9A 5HNGA 5DBXA 4MXAA 5TO8A 3CJFA 2X1NA 4YLLA 4MXZA 2WMTA 3QZHA 4QP4A 4UBAA 5DT4A 5HVJA 5L2SA 4BJJA 5FBOA 4JDHA 1YXSA 2WMQA 3KXHA 3LPBA 4IDTA 2QVSE 4E7WA 2JBPA 2VD5A 4R3RA 1UA2A 3PG3A 3VW8A 3UOJA 1R3CA 2BZKB 4X6QC 3UOKA 4WSYA 4O4EA 1UV5A 4I4EA 4I6QA 2DYLA 5FLFA 3GCVA 4JBPA 4MD7E 5ETCA 4EH4A 2UZTA 4W9XA 2VX0A 5E9EA 3MVJA 1TVOA 5CEIA 2PZRA 4W4YA 4OR5A 4M3QA 4RVMA 3ORIA 3ZXTA 5IDNA 3QRUA 3SAYA 3OUNB 3JVSA 3ZZEA 4RIOA 3UMWA 3DBCA 3KRRA 4C0TA 1ERKA 4QYHA 5JK3A 1VYZA 1GZNA 4JDIA 3QWJA 3TMOA 2RIOA 4FIEA 1Y6BA 2F2UA 3O7LD 4ONAA 5J79A 2CNUA 2XIKA 1H08A 2ERZE 3G6GA 3LIJA 2X0OA 5BVWA 3VS5A 1XBBA 4UX9A 4LYNA 2EU9A 2WOTA 4M66A 4O0YA 2VGPA 4GU6A 5DMZA 4N57A 4YC3A 2YAKA 4L6QA 5J87A 1RE8A 5C9CA 3PZEA 2PE1A 4DHIB 4XBRA 3P23A 1Y8GA 1OB3A 2CSNA 2QKWB 4V05A 5KHXA 3MESA 4F9YA 3QCQA 2VTLA 4MYGA 2ZYBA 4XEYA 4CV8A 4BVUA 5CAUA 3NAYA 4UALA 4CEGA 3Q4TA 2HELA 3WZJA 4RWKA 4AN2A 2H6DA 5HD7A 3OROA 4IXPA 1XR1A 5JSMA 1WBTA 3ZRKA 4CD0A 2C3JA 4KRCA 4BKJA 5KCVA 2DS1A 3H10A 2X6DA 3TNWA 4DT8A 3OT8A 4QMYA 2C6IA 4NCTA 3QYZA 4N70A 3WILA 4DG3E 4FTMA 4FKQA 5JGDA 3R9NA 2X8DA 2YIYA 4FSZA 3QZIA 2CDZA 3EJ1A 1YDSE 3NNVA 1GIJA 1CKPA 4YZCA 2HY81 4AFEA 4HZSA 5T3QA 4U43A 3NUPA 4C4JA 2WHBA 3SD0A 5DEWA 4TXCA 2O0UA 4U41A 3GU7A 3ZUUA 4OTPA 5H8EA 5ANDA 4QYFA 4F7LA 2C6MA 3W0MA 4K18A 2QD9A 4FKRA 1ZOGA 2VTQA 4AOJA 2W1HA 4IW0A 2G15A 2YACA 4D2RA 1TFFA 4LI5A 4M0YA 4O96A 4N6YA 3MPMA 4GT5A 1BMKA 2FSMX 3R0TA 2GNHA 5EI6A 1J1BA 5I3OA 3ID6C 3FZSA 2XUUA 1AQ1A 2JLDA 2PTKA 3KKVA 3BU3A 2OZOA 1VEBA 3HECA 3COMA 3VF8A 1UWJA 1WFCA 1XJDA 2IZUA 2XMYA 1RW8A 2IZSA 3LZBA 1JLUE 4KWPA 3WIKA 5BVOA 3AKLA 5H9BA 4CVAA 3QRJA 2W1IA 5EM5A 1TQPA 4EOKA 5I3RA 3QX4A 4C2VA 2YWPA 4FTKA 2FSTX 5AR5A 2ITQA 1H1QA 3DFAA 4I1ZA 4B4LA 4G3EA 4YLJA 2V5QA 2ZDTA 5FDXA 4GK4A 4RIYA 3PPKA 2V7OA 2R3NA 4BDBA 3P7CA 5EHYA 5HIEA 4GK2A 1ZMUA 3THBA 2YJRA 5IMXA 4AQCA 2XIXA 4U44A 4IM0A 4KKEA 5E92A 1URWA 4HPTE 3TV4A 3QZGA 4BZDA 3MFUA 1ZY4A 4JI9A 2CHLA 3CP9A 3PSDA 4DN5A 2HZ0A 2YAAA 4FZ6A 2W4JA 4NU1A 3HRBA 4MNEA 3MW1A 4FGBA 3KFAA 5H8GA 2O65A 4LOQA 3ZYAA 3PJCA 1URCA 4R1YA 3O8UA 4RVKA 3T8OA 5HIBA 1KE5A 3VRYA 1PJKA 4HGLA 2ZM4A 2JGZA 3COKA 4FV3A 4NIFA 2R3LA 3OWLA 5JRSA 3AKJA 3FUPA 2VTSA 2W1GA 4FVRA 4P5ZA 2BZIB 3QWKA 4B0GA 2X81A 5IQAA 1G8AA 3MN3A 3FQSA 5GJDA 3RK5A 3VUGA 3U55A 1TQIA 2OSCA 4BL1A 1Y8YA 2VTHA 3OUKA 4FZFB 4XCUA 3LFQA 1LR4A 4MTAA 5CAQA 1L3RE 3EQGA 1ZYSA 3OW3A 1XO2B 1J91A 3BV3A 4IWPA 2QOOA 3P08A 4YC6A 4L67A 4WBBB 4CXAA 3BHUA 3PWYA 5EOLA 2OJGA 4CG8A 4GL9A 1RQQA 2PMNX 4TNDA 3MA6A 4MF1A 2P33A 5BYYA 4BCQA 3GNIB 4I22A 5HG8A 3LAUA 4U40A 4YLKA 2YLFA 4CFFA 4OTGA 3PZHA 3N9XA 3CIKA 4FSMA 2R64A 3F9NA 2QC6A 3GCQA 3W2CA 3F2NA 2AC3A 4WBOA 4CRSA 4IJ9A 4FIHA 3LXPA 2UVZA 4LMNA 4K1BA 3TNIA 1OPLA 4DGLC 5M51A 3VBWA 5IUGA 3C4FA 1JPAA 3IGGA 4HYHA 4FK6A 4UWBA 1FQ1B 2XBJA 3ZLXA 4EHGA 2VWIA 4RX7A 3RHKA 4IAIA 3W1FA 5BMMA 5FBNC 2OLCA 2WMAA 2AYPA 3L9PA 2HK5A 4IM3A 4O2ZA 1DS5A 5AADA 4QMWA 5KMNA 2E9NA 2XZSA 4IH8A 4E1ZA 2P2IA 1OM1A 3DV3A 5BYZA 3EOCA 5HE1A 2UW5A 2PULA 2BRHA 4L01A 3HMMA 4HYSA 4IQ6A 4OBQA 4APPA 1KE6A 4USEA 2E2BA 3UZPA 3ZHPC 3PPZA 4ANSA 3DB8A 4XG7A 2C1AA 3L9MA 3FLYA 4CMOA 2PVNA 1BYGA 5EYDA 4C34A 3D7TA 5E4HA 3E7OA 3O23A 4D4SA 3C4WA 2A27A 3AMYA 2OGVA 2YEXA 4RIYB 3DK7A 5L2TA 4AZFA 4M69B 1YKRA 3P1AA 2XNOA 2UW4A 4EBWA 1Y91A 2XK3A 4AS0A 2W1FA 4QTCA 3LQ3A 4AW5A 3ULZA 4EWQA 4IWDA 3WZUA 2YDJA 4H1JA 3ROCA 3MI9A 4EOMA 3KK8A 5ANOA 3UYSA 1MRYA 4MNEB 4XG9A 4ANLA 3U6JA 5BV3A 2BTSA 4ZZNA 4ALVA 2NYAA 5FQDC 2A1AB 3QKMA 5AAGA 2NO3A 4L3LA 4Z55A 4BCKA 1M2RA 2WTKC 3BYVA 1ZMWA 3RPVA 5C4LA 3O7LB 3D14A 4YURA 4YSMA 2QOQA 4JX3A 5ITAA 3G6HA 5DN3A 4BWXA 3LM0A 2B0QA 4NJDA 2IEWA 4USDA 5M4FA 5CZIA 3ZM4A 4RVLA 2R3PA 2YHVA 2X9FA 4FC0A 4WNOA 2PUUA 4CGAA 2WU6A 1HOWA 3QLGA 4GFOA 4AA4A 4BCJA 5GZAA 3GC7A 4KSQA 4ANMA 3MH0A 4E4XA 3BCEA 2CMWA 3PRFA 2QI8A 2C3IB 2RFSA 4L52A 4X2JA 3ZZWA 4CFWA 4JMQA 3HA8A 1XH7A 2I1MA 2R3MA 4A9YA 1Q61A 4BIBA 4BDJA 3GFWA 4KBKA 1R78A 2E9OA 4Q5EA 4RX9A 5L6PA 2HWOA 1Q8WA 2YCRA 5EOBA 3VS1A 2B52A 2JIUA 3S4QA 4A07A 4ZTMA 3W0SA 3AC8A 4O0XA 3CC6A 1W82A 3NX8A 4PMMA 3HV5A 3ZLYA 4EZ3A 3BIZA 1UNLA 4O27B 4Z7GA 4TTHB 5K9IA 3SG8A 4AUAA 3DBFA 5CEOA 4AXFA 2ZJWA 3RZBA 4Y72A 4MWIA 1UU9A 5AUUA 2CLXA 3OWJA 4QMOA 5ANJA 5K4IA 3QRTA 4FV6A 2BHHA 4G17A 4U3ZA 1CDKA 3KF4A 4I92A 4O0SA 2BAKA 3AT4A 5KKRC 1ST4A 3IO7A 3R1YA 5E8WA 3R9HA 4D55A 2UUEA 3KVWA 4RBLA 4C8BA 1FVTA 5JFXA 1B38A 2OXDA 4ZK5A 5EI8A 3REPA 3PDTA 4RSSA 2RFDA 3ZUVA 1PYEA 4FZ7A 2PMIA 1OIYA 3NAXA 2QODA 3ODZX 4H3BA 2CKOA 2W05A 4D0XA 1QMZA 3C7QA 5M4CA 4O7YA 4EOPA 3R04A 4C4HA 2O64A 3D7TB 5EYKA 4YPDA 1P4FA 3E7VA 2QNJA 4YNOA 4RVTA 4IVCA 4ZIMA 3EMGA 2XNBA 5B7VA 5FXRA 4FTQA 4YO6A 2CJMA 3RP9A 4DTKA 5HVYA 2XALA 3JS2A 3NYXA 4JDJA 3EQBA 3R83A 3M2WA 3HUBA 4EOJA 3H4JA 4M84A 4MXOA 2UZDA 3CJGA 4CCBA 4FNZA 3QRKA 1H4LA 4S2ZA 3A62A 3MY5A 2QONA 4QPMA 1YRPA 3P5JC 3CTQA 4FODA 5AJQA 1Q8ZA 3BYOA 1Z5MA 4F7JA 2ETMA 3OG7A 5EHOA 2XJ2A 1DI8A 4C7TA 4U45A 4EC9A 3F5XA 1X8BA 3FKNA 1XHAA 3MS9A 5K4JA 2GDOA 4MQ1A 2Y6OA 3FMHA 2WO6A 4I3ZA 2PVHA 5L2QA 3FPMA 4R8QA 3C5IA 2UVYA 3FV8A 4W4VA 3WF6A 4BB4A 3Q3BA 4WSQA 3WF7A 2QCSA 4QP8A 2X2MA 3VBYA 2PVFA 3UQFA 2GNJA 2LAVA 4EOSA 1M7QA 1H0WA 4IZ7A 5ETIA 2R7IA 3WF5A 1MUOA 4BCFA 3N4VA 2IO6A 4PP9A 2UZLA 5EM7A 4ZTSA 3L9NA 2VTJA 2JKOA 4K2RA 4K6ZA 4TKSA 3Q60A 1U59A 4HCVA 3R2YA 4X3FA 3FC2A 3U6HA 1XMLA 3WOWA 3NDMA 1OKYA 3QYWA 4XV2A 3WI6A 4BKZA 3OCGA 5LWMA 1L8TA 3M1SA 2VAGA 2ACXA 3MYGA 4IJPA 3LXNA 2F7ZE 2HW7A 3KGAA 3OWKA 4OAVB 5EQPA 1XH9A 3QD0A 4GG5A 4NKAA 3ZFYA 4EI4A 3KREA 2ZV9A 2YABA 4PRJA 3FBVA 2UZVA 4BI2A 3HV4A 4AW0A 5DG5A 1ZYJA 3QC4A 4XG8A 1H27A 3SXSA 2G2FA 3LKMA 2B1PA 4L53A 3EQPA 2V22A 3P5KA 3KU2A 4OTRA 3TYKA 4C02A 2I7QA 1PXPA 4F0IA 1CTPE 4QPAA 4XP2A 4AZVA 2X2LA 4C38A 3COHA 3LXKA 4QTEA 4CLJA 2BAJA 3NFGB 2RFNA 4RLLA 4Q9SA 4S30A 3FMMA 3HYHA 4CSVA 3PVWA 4O7WA 2PVRA 5T68A 4O22A 4K9YA 3PVGA 4AXEA 3GC9A 4XUFA 4U80A 4YNEA 4UMUA 4QP2A 5ACKA 2WTKB 3UDTA 4O7TA 1E1XA 2VV9A 5IF1A 4XP0A 3W2RA 3NW5A 3PFYA 3ATSA 4I0RA 3TTIA 1OIQA 1H26A 2X0PA 2XK8A 3HVCA 3L1SA 4FX3A 4MXCA 2VTPA 3RGFA 2WMXA 2PHKA 3NRMA 3P7BA 2AQXA 3F3UA 4TN6A 4ALUA 4YZMA 3JY0A 2GQGA 4CZUA 3QTRA 1I09A 3IKAA 4MK0A 3HUCA 5C26A 3ENMA 3D94A 4FKJA 1NVRA 3UDBA 3TV6A 3DXPA 4JQEA 2GFCA 5FGKA 2HAKA 3VS0A 3LFFA 5AIKA 4ITHA 5TKDA 3D5UA 3RI1A 2UZNA 1KSWA 5AR3A 4LL5A 3HRFA 2IF8A 4EQMA 3JVRA 3K5UA 3KN5A 2CGUA 1PMUA 3PTGA 2F57A 4TZRA 4WHZA 4JAIA 4EH6A 1SVHA 2F9GA 3EL8A 2XIRA 3VBVA 2VTOA 4B99A 4PNKA 3HAVA 3AT3A 4J98A 2XJ1A 1Z9XA 3BHVA 1Q8YA 4C62A 1Y6AA 1BL7A 3G0EA 3TZ7A 4EKKA 4UMRA 3R7UA 4PDYA 3W32A 4PL3A 3EB0A 3WZEA 3G0FA 1IA9A 1XMMA 3LCDA 1P5EA 2VX3A 2WQBA 3VUTA 2UW0A 2BALA 4NH1A 3R7EA 4IB3A 5KKRB 2ONLA 1NVSA 1H1WA 2UZOA 3CY2A 1REKA 3EN4A 3G33A 4G2FA 5D1JA 5JRQA 2Z7SA 4XMOA 5D9HA 3F3WA 4K11A 4N0SA 2IG7A 3ET7A 3AMAA 5H3QA 2PMOX 4GKHA 2W5AA 5I4NA 4XS2A 4YPSA 2ITWA 4ACDA 4DBNA 1ZLTA 5G1XA 5CU3A 3VHKA 2C5VA 3PVBA 3SLSA 4FT0A 4O0WA 1ZMVA 2R3QA 1WMKA 4XNEA 3ZEPA 4YJSA 5DHJA 3U54A 4U79A 2XM8A 1JKSA 1H1SA 3LVPA 4X0MA 3DPKA 3CKXA 4XV1A 4AF3A 4EOIA 5H2UA 2F49A 3K54A 1Q62A 2W1DA 3RPRA 2R3KA 4G31A 4BZOA 5E90A 4YO4A 3KRWA 2ZOQA 1SNXA 1YXXA 1NVQA 4MKCA 4IX6A 4R3PA 5LMAA 3RBWA 4B6LA 3PJ2A 3F3TA 1IA8A 2AUHA 2P4IA 5CNOA 3R8LA 3CBLA 3R71A 3UO4A 4WUNA 2W9FB 3FZTA 4NEUA 3VUMA 2KULA 4ZY4A 1OBGA 1DM2A 3CEKA 3OXZA 3PA4A 2H96A 4FSNA 1PRYA 5A4TA 3MDYA 3ROYA 1OL5A 3IDPA 4I5HA 4FTCA 4PTEA 3TKIA 4JNWA 4ANQA 4J8NA 3AC5A 4C37A 2J4ZA 4LV7A 4MF0A 4BYIA 3AXWA 3DNDA 4YSJA 4G34A 4U42A 1H1PA 4YZDA 4MD9E 4ASXA 5KMMA 4FOCA 3GCUA 3VJOA 4CMUA 3SVVA 4I24A 5B2KA 3MJ2A 4CTCA 4IZYA 2I0YA 2WEVA 5FTOA 4WO5A 4EHVA 3ZUTA 4A9SA 4KIOA 1CMKE 4FNYA 4QP9A 2P3GX 3FI3A 1NXKA 2ETKA 2BRBA 3DAKA 4RMZA 3ZBFA 4DFYA 3LMIA 3KMUA 3OF0A 5LXMA 4F63A 2GHMA 3LJ1A 4FV8A 2BKKA 1OGYA 4ZMEA 5CVHA 4QMXA 5DVRA 3DAJA 4C61A 1U54A 5AP5A 2REIA 3NUXA 2R7BA 5E7RA 4E4LA 4AT5A 4DEEA 1OBDA 4R5YA 4LOOA 3TM0A 4YJUA 4BDIA 4O6EA 3GU8A 1Z57A 4UXLA 2WIHA 2W4KA 2XYUA 1PKGA 1ZYLA 4O7ZA 2PZ5A 5AUVA 5TR6A 5I9XA 2XB7A 4U6RA 4I6FA 2J6MA 2X0QA 3NIZA 3PJ8A 3Q4UA 4RA5A 2WD1A 3A7HA 4L3PA 2H34A 2B53A 3ENHA 2XP2A 1O6LA 3LJ0A 1YHVA 4G6OA 4RQVA 3H9FA 5GZ8A 3PA3A 5CNNA 4IWQA 3TT0A 3HRCA 4E5WA 3RWPA 3KMMA 2QHNA 2PUNA 3ZRLA 1UWHA 3DTCA 2VGOA 3NUUA 5LVPA 1H8FA 3EKKA 4GVAA 3UQCA 5FDPA 2XYNA 5AV3A 4D2WA 2BAQA 3TXOA 4PDOA 3C4ZA 3ITZA 3R73A 3FY2A 3CPCA 3NLBA 3OVVA 2B9JA 3BU5A 3VBQA 1SNUA 3D5XA 3IS5A 5CI6A 5EQEA 4FG8A 3MTLA 1YDRE 4FNXA 1IRKA 4RC2A 4YJVA 4DGMA 4FGRA 5AP7A 5M56A 4R7BA 1PF8A 2PVKA 3ORZA 5HE2A 5A54A 1UKIA 5DR9A 5E8XA 3RPYA 4FYOA 2W4OA 4HYIA 1JSVA 2XNNA 4TY1A 4FIIA 2Q83A 2WFYA 2YISA 5G6VA 5HHWA 3VS4A 1W98A 2W1EA 3AQVA 5DR6A 2J90A 2SRCA 3OTVA 4AZSA 4H58A 4AFJA 5DRBA 3HMPA 4W8EA 4UYAA 1W83A 1G8JA 4R77A 4F1TA 2R3OA 4H36A 3I0OA 4FKOA 5AUWA 3V5JA 3NCGA 4OW8A 3QUPA 3TKHA 4EK5A 4GVJA 3TEIA 3UVRA 2YM7A 3E8DA 1R1WA 5M06A 3N4TA 2I0HA 2XNPA 2YN8A 3QUEA 4HVDA 5DWRA 4ZAUA 1UU3A 3QA0A 4USFA 3TACA 3S00A 4FG9A 1OITA 3GQLA 4I5PA 4I0SA 2W9ZB 3CTJA 5AX9A 3BWFA 4AW2A 3D7ZA 5JQ5A 4DT9A 4DH3A 3ZO1A 1T46A 4CKRA 2C6TA 5ANKA 4YBKA 4BDAA 2EXMA 5HESA 3RNYA 4TL0A 2ZAZA 4S34A 4FV0A 2W96B 5D41A 5LCKA 3ACJA 2PYWA 4AN9A 2FO0A 5AWMA 5IMEA 2QOBA 4Z3VA 5B0XA 3V5TA 3WF9A 4B7TA 2VTNA 3BRBA 3B2TA 1R39A 5J7HA 3PSBA 3DXQA 3E8NA 2OIBA 3KIOC 3QTXA 2YM4A 4BDKA 3AMBA 4UB7A 2C5NA 3BZ3A 3GC0A 3L8PA 3QA8A 3T3VA 4EH8A 4FJVA 3MA3A 3RALA 1UU7A 1YXTA 4Y73A 4E6DA 1U54B 4XRJA 4MNFA 4NM7A 3S95A 4BCGA 3FKOA 4HOKA 4JLCA 4LGDA 2WMUA 3RM7A 2JAMA 1G8KA 1NW1A 5HNBA 2Q0NA 1O6KA 3GP0A 4FA2A 3FXZA 2Y4PA 4M67A 4YBJA 1OMWA 5AM6A 2WTWA 2VU3A 3F5GA 3DFCB 3BYSA 3UVPA 4D1ZA 2WQNA 4M7IA 4BYJA 1JWHA 4GYGA 4EBVA 2R5TA 2XK9A 3MY0A 4Y85A 1QPEA 2R3HA 5IUIA 5L6WL 5EKNA 5IQBA 3M42A 4QQTA 4ENYA 3PPJA 4FKSA 4XH6A 5CEMA 3MBLA 4PWNA 4KD1A 5JFVA 5HX6A 2I0EA 5IEVA 4WA9A 2QO2A 4E26A 2BMCA 5CAOA 4KABA 2X4FA 4XP3A 3U87A 4GV1A 2XAOA 3R9OA 3I5ZA 3IECA 4IDVA 4ZLYA 4ZSJA 4AAYA 4W9WA 4AU8A 5A4LA 2PK9A 3F66A 2BILB 4RZVA 2XRUA 4U81A 2J5EA 1ST0A 3QKLA 4ZJVA 1JKKA 4JS8A 4R1VA 3SQQA 4YUQA 3UG2A 4ZSGA 4UMQA 4TYGA 3DJ5A 4XJ0A 3UIUA 4FT9A 3BL7A 3UPZA 5K5XA 4F6SA 2X2KA 1LEZA 5LCJA 3W2QA 4GUEA 1K3AA 4N4SA 2VRXA 3KCFA 2WMSA 1H0VA 3KA0A 2OK1A 3OBJA 2JDTA 1M2PA 4P2KA 1IAJA 4KKHA 3I7CA 1E1VA 1OKWA 3CR0A 4BCPA 3QQHA 5BVFA 2UV2A 1XH6A 5EYMA 1PHKA 3AC4A 5HTCA 5AFVA 3TI1A 3VNTA 4I41A 3FL5A 4QPSA 1E9HA 3AOXA 4CT1A 5DLSA 4U3YA 1JKLA 2YIWA 4E5AX 5EW8A 2BROA 3C50A 1H07A 3R2BA 4TWPA 3HP5A 4DBXA 4FTAA 5E8TA 2Y9QA 3DOGA 3G90X 4AT3A 5HNIX 2Q0BA 4L45A 4NW5A 3O8PA 3F3VA 1UKHA 4F1OA 3AGLA 3U51A 4FI1A 5DIAA 2CN5A 3OCSA 3QTIA 4YU2A 2JDOA 4F1MA 2BDWA 4DLIA 3FQEA 1HCLA 4RC4A 2W5BA 2C6LA 4M69A 3G5DA 5HQ0A 4OUCA 3CY3A 4NK9A 4QMTA 4PNIA 3MB7A 4O2PA 4XOZA 5K5NA 4A4XA 1SVEA 3DKOA 4IANA 4D4VA 3W10A 1IEPA 4FT7A 3R7OA 4DH7A 2G2HA 3JY9A 4GS6A 5EQYA 3EZRA 2XNGA 5TE0A 3UP2A 4F0GA 4DITA 4HVGA 5IQHA 4J1RA 3OZ6A 3BL9A 3D5WA 1FMKA 4F9CA 5A9UA 3D9VA 4IM2A 5KHWA 5A46A 3IDBA 4HGSA 1G8SA 2XK7A 3PRIA 4NJ3A 2C69A 2WQMA 1JKTA 3EN9A 4K33A 2X6EA 3HZTA 4WIHA 2VTIA 4JBQA 2OKRA 4G1WA 3VC4A 5A4EA 3HAMA 1T45A 3GENA 3ML1A 4LDTA 2X4ZA 2FSLX 2VWVA 3ZONA 1YXUA 5HEZA 5BNJA 2FH9A 4ZTQA 3O2MA 2YITA 4I93A 5T6KA 5HBHA 5CEKA 3ZM9A 3QXOA 1ZY5A 4L00A 4M15A 5CU2A 5J8IA 4JIAA 2C5OA 3GCPA 1GNGA 2HW6A 4BHNA 3CS9A 4AG8A 2A98A 1H01A 4J95A 3W0OA 4QTDA 3D15A 1STCE 4QYEA 4Z7HA 4P5QA 2I40A 2GCDA 3FLSA 2BDJA 4E6CA 5LJJA 4C57A 4G3CA 2CNQA 3N4UA 1UNGA 1FOTA 2PVMA 5AX3A 5C01A 1ZYCA 3QU0A 3UDSA 1MP8A 4ANNA 4CMTA 3OOGA 5E1EA 2OW3A 4PF4A 3VRZA 3AC2A 3FWQA 3FL4A 3LCSA 4XG6A 5IH5A 5CLPA 3LFEA 2ITZA 1SMHA 2QOCA 2XBAA 3II5A 4NZWB 2WELA 2J0LA 3R30A 4LQMA 3E8CA 3NNWA 4MEDA 4TYJA 3AD4A 2FB8A 4RT7A 3LFDA 1DAYA 1YWVA 3ZS5A 3O71A 4IX5A 4CFNA 4D9UA 3FI4A 1Q41A 1YDT