4EYMA

Mapk13 complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
350
structure length
340
Chain Sequence
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 13
publication title IL-13-induced airway mucus production is attenuated by MAPK13 inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 340
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eymA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eymA01
2Y4PA 3UE4A 5KMOA 3H10A 3VHKA 4TNBA 5IEVA 4I5MA 3C1XA 1J3HA 3RPOA 5AAGA 4P4CA 2R5TA 2ZM3A 5E1SA 3RPRA 2QOQA 4XG6A 4L7FA 2EU9A 4NM0A 1QCFA 4ASEA 4D4YA 4G5JA 3KXMA 5AMNA 3BYVA 2NNWB 3LCKA 1MQBA 2GNFA 2ZV8A 1EH4A 4V0GB 4CZTA 4D2TA 3W2QA 1GAGA 2G1TA 4E26A 4EUUA 5M4CA 3R6XA 4N70A 5M44A 3FZTA 3I79A 2W1GA 4QTDA 4GYIA 4AZVA 3Q52A 3FKOA 4R3CA 1IEPA 4JBOA 4TL0A 1XH7A 4DT8A 1GZKA 3R83A 2R2PA 2CSNA 2QHNA 3NYNA 3VF9A 2KULA 2O2UA 4QYYA 5DLSA 2JKQA 4PTGA 2OFVA 4U8ZA 4AT5A 4OAVB 4XG4A 3R8VA 3BE9A 2W5AA 5IA5A 2VWZA 3RBWA 4ZS4A 3SDJA 1MRUA 4K6ZA 3M2WA 1WCCA 3QQFA 3F2NA 1V1KA 2WAJA 3DT1A 4QP6A 5DR6A 3F3WA 4O0WA 2R4BA 1CTPE 4YZNA 1YI4A 3QQHA 4FKUA 4JDHA 5H8GA 4DBXA 5JFWA 4KSPA 2JAVA 2WGJA 4BCNA 2ETKA 5CEQA 3TL8A 3TNWA 3V3VA 2P3GX 4E1ZA 2W5BA 3RZFA 4AACA 3TUDA 1MRVA 3MY5A 4N6ZA 4F70A 1M7QA 4E6AA 3D2IA 1H08A 3QCYA 4WNMA 3I0QA 3LVPA 3MPAA 4D58A 4BI0A 4C4IA 4J99A 4EQMA 2BRBA 2I0HA 4XP3A 1O6YA 2QG5A 4DFUA 5IQDA 4BBMA 4XRJA 2XNMA 3PY3A 4TWCA 1PMVA 3PUPA 4Y83A 5FM3A 3H30A 5H8EA 4BKYA 5HNIX 4FEWA 3O17A 3PSDA 5KMJA 3FSFA 3PJ3A 3F66A 3W18A 5HOAA 3SAYA 3P9JA 3CBLA 3ATTA 3JYAA 2PVMA 3PZEA 4YJOA 5IG1A 2C3LA 1YDTE 4IM0A 2CNQA 2VWBA 3BELA 4TT7A 4ZTLA 5ETIA 3LCDA 4PPAA 3VBTA 4FBXA 4F1OA 4OTQA 2I40A 2BZJA 3OF0A 1ZXEA 2R7IA 5D41A 4IDVA 3RINA 4AA0A 3TIZA 3FI3A 4RMZA 4XS2A 5FUTA 3HDNA 3P86A 5E1EA 3KRXA 1GIIA 4B9DA 1JSTA 3MN3A 4RZVA 3G9NA 1OPLA 1E1XA 3FLZA 3KU2A 5LVMA 5M51A 5M56A 3QRKA 4C0TA 4S30A 4EK5A 3NUNA 3MTLA 3VF8A 3WOWA 2QOCA 4DBNA 2IVVA 2C30A 3HRBA 3SLSA 4F99A 4BCHA 2F7ZE 5EK7A 2JIIA 2BRGA 2W06A 3KQ7A 2VO6A 3IG7A 3TTJA 2Z7RA 5GINE 4UXQA 2DYLA 4MD7E 5DFPA 1H4LA 4YLJA 5EDPA 3PXFA 4HVGA 1G8SA 4YBJA 5CU3A 2ZB0A 4EOMA 4X3JA 4K8AA 1UU3A 3HP5A 5CALA 3OEZA 2X8IA 3DNDA 2B7AA 2HELA 3ZLWA 1H8FA 2Y4IC 3MPTA 4C61A 4IAKA 3PG1A 2BMCA 2P2IA 3SC1A 4MXZA 1BL6A 1JKSA 4EOSA 2GPHA 1Q99A 3E8CA 4KIKA 3I5NA 3B8RA 1REKA 3BYSA 2XH5A 3EOCA 3IOPA 3PVBA 4OGRA 3ACJA 3ORNA 5EH0A 5HU9A 2Z7QA 4F9CA 4J1RA 3RZBA 3HUCA 2YABA 4NIFA 5CTPA 1GZOA 5AM7A 4I5CA 1XH6A 4C58A 1SMHA 3WARA 1U5RA 3H3CA 4IEBA 4DEEA 3D4QA 2XIXA 5CVFA 5LXMA 5JQ5A 1JVPP 1LPUA 2OJGA 3HV3A 5ANEA 4I6HA 5DWRA 2REIA 4EJNA 5HO7A 5F9EA 4DCAA 3UODA 2WMUA 5EM7A 4ERKA 4IBMA 2C4GA 4JG6A 4DLIA 4TWOA 3LJ1A 4ZJIA 3DKFA 3EFWA 1A06A 2F2CB 2HW6A 4GS6A 5FTOA 4E5BA 4FT5A 5JH6A 4TW9A 5AUVA 2WMBA 4D1XA 4BZNA 2FSTX 4TYIA 1K3AA 3A62A 4KBKA 4O83A 4FGBA 4AG8A 1DAYA 2ITXA 4L52A 4ZIMA 4N6YA 4JOAA 4CVAA 5IEYA 1E1VA 5IQGA 3VQHA 4QP7A 5KMNA 4RA4A 5JFVA 1NW1A 3WYYA 5FLFA 3GI3A 2F7XE 4JR3A 4C4FA 5AV4A 4X3FB 3U9CA 4S32A 5EDQA 1OMWA 3PJCA 5J87A 3U6HA 2J6MA 4XRLA 5CVGA 5TOZA 4CKIA 2QO9A 4QP2A 1YHSA 4J53A 4C33A 3F61A 2XIZA 4X2NA 4C4EA 1P14A 2AYPA 3QUDA 3RHKA 4BGQA 3E8EA 3ZHPC 5IQEA 4JI9A 3EQCA 2GSFA 2W1EA 2H6DA 3LFBA 3MH1A 3ZOSA 4AN2A 4BDFA 3FYKX 5BPYA 4YLKA 5KBQA 3HAVA 2ZDUA 4P5ZA 3DCVA 4OT6A 4BDDA 5KX8A 3IOKA 1PXIA 5BVDA 3VUIA 4CG9A 3RCDA 2H96A 3IO7A 2VNWA 2UZOA 4QMVA 3P0MA 3ZLXA 5AA9A 3V5JA 3HMIA 5HVJA 1UV5A 1WBVA 3FUPA 4U6RA 3RAIA 2Y7JA 1QPCA 3MBLA 3VS0A 4CFVA 2XS0A 4BWXA 5E8VA 5I9WA 1T45A 1PW2A 5HG8A 1YXXA 4FKSA 4GG5A 3G0FA 2NPQA 3ZBFA 5DEYA 1AGWA 4CZUA 4YJQA 5HE0A 2QOFA 5CEMA 4F7SA 5EM8A 5ANDA 1P4OA 2QOOA 2IW9A 2XRWA 4APPA 1H07A 2Y8OA 3H0ZA 5L2QA 4PL5A 1NVQA 2OZAB 4FTNA 4IJ9A 3LQ5A 4NM5A 5AR5A 1DAWA 3R22A 5M55A 4FV8A 5GJFA 4K33A 4F9YA 3EQFA 2BKKA 3EHAA 4GEOA 3SQQA 1TQIA 3HX4A 3GCQA 3QX4A 4AGDA 3BLQA 1W98A 3QUEA 4LUEA 5I9UA 2YIXA 3KKVA 3LM0A 2W05A 3ZDUA 4FUYA 3FI4A 3PDTA 3V01A 2B54A 4ASDA 1AD5A 4IQ6A 3HA6A 3PRIA 3C5UA 2Y4IB 4NFMA 2ONLA 4J8MA 1OBDA 3EFKA 2C6KA 2H34A 3OEFX 5BVOA 2VX0A 3LHJA 5BMMA 4JL9A 2WOUA 5DI1A 3ROYA 2ZM4A 2YZAA 3NR9A 2LAVA 2WQNA 3U4WA 3C4EA 2F57A 4EWQA 3ERKA 4BDKA 4BR3A 2PVKA 4E73A 4YU2A 2W96B 4MNEA 3V8TA 4ALWA 4D5KA 4JBQA 2OO8X 5CAUA 3O8TA 3QQKA 3UO4A 3C0HA 3EQRA 4WSQA 3R8LA 2PSQA 2F49A 3OOGA 5CU0A 3G33A 1R78A 3DBCA 3R1QA 2RFNA 5HGIA 3SV0A 4L3PA 1CKIA 1H0VA 4G5PA 4TYEA 5CF5A 3IDPA 3U9NA 2J0JA 4FIHA 4MD9E 5DRBA 5HZNA 4FZDB 5TO8A 4W9XA 2ITUA 2PL0A 2C5NA 4RX8A 4MVFA 2GTMA 4A9SA 3HMNA 1X8BA 4EOJA 2B1PA 1ZWSA 2VTTA 2QC6A 4Y73A 4AGUA 4C4JA 3VUKA 5KHXA 5L6PA 5FM2A 5GIOE 4QQCA 4MQ1A 1ZYJA 2I7QA 3VC4A 4A4XA 4IZAA 2WTCA 4O0XA 3HKOA 4J95A 4DF3A 3AC8A 4FEVA 1Y8YA 5KMMA 4I3ZA 4YBKA 3Q6WA 4MXAA 2UZWE 4GH2A 5AUUA 3DK6A 2Z8CA 3DA6A 3D15A 4JRNA 4QO9A 4UYAA 1MP8A 5GNKA 5T68A 3OCGA 5L6WL 4IX4A 3KF7A 3QC4A 3ODZX 3FWQA 4FTTA 3IPHA 2GS6A 5AP1A 4V01A 2C5OA 2I6LA 5AWMA 3UNKA 3BBWA 3A4PA 3H0YA 4ASZA 4LL5A 2WTIA 3KULA 1ZOHA 4EOIA 3NVMB 2FSLX 3MH0A 3SOAA 3U8WA 5EHLA 3G0EA 4LM5A 4AUAA 4DFXE 4WG5A 4HYSA 2RFSA 4DEBA 3A8WA 5T6KA 2ESMA 3NYOA 4ACHA 4YURA 3COMA 4BYIA 3A8XA 4WO5A 2VTLA 3NUXA 5EI2A 5I9XA 4EH9A 1YDRE 2YA9A 2EXCX 3W55A 3VIDA 5LVOA 3BGZA 3FQHA 3LCTA 1OL5A 4RWIA 3O50A 4OTDA 4ENYA 4KIOA 1Q8TA 4TTHB 3ORXA 3TNQB 3F2RA 1PXKA 2OW3A 2B9JA 3KB7A 3CSVA 2UW5A 2HCKA 3CR0A 3I5ZA 2C6IA 4YHFA 3C7QA 1Q3WA 2WIHA 3QKKA 3VBVA 3U51A 2XJ1A 3MJ1A 4ACGA 3GFEA 3WF8A 4CV9A 2WMTA 4MBJA 2JDOA 3SW4A 1UU8A 3DAJA 3TZ8A 2OZOA 2XIRA 3ELJA 3MY1A 2PU8A 3DLSA 2X2KA 2PMLX 4MTAA 3D14A 5DBXA 4CFMA 5IA4A 4QYEA 4EWHA 5GZ8A 3PVUA 2HZIA 3OXZA 4XJ0A 3FMKA 4DFNA 5H8BA 2P4IA 3FI2A 3L1SA 4FNXA 2YCRA 5GJDA 4ANBA 4BB4A 4I20A 2B55A 4AE9A 5ANIA 4MNEB 2XIKA 4NFNA 4Q5EA 3KRWA 2H8HA 2C47A 4EH4A 3W2SA 4FV1A 4HGTA 3IW7A 4ALUA 2BRNA 4UZDA 4J71A 2YEXA 1JOWB 2GS2A 5LVNA 3VWAA 4K2RA 3JPVA 4M8TA 4NTSA 4QMOA 4B7TA 2FO0A 3QZGA 4R3PA 3UZPA 4BBFA 4JAIA 5IZFA 5EYMA 1H0WA 2XJ2A 4OBQA 4IC7A 1G5SA 1V0PA 3AG9A 5HO8A 4Q9ZA 4CGAA 5DPVA 3K3JA 4G1WA 3K2LA 2WMVA 2OF2A 2R9SA 4I21A 4RWJA 3VO3A 1Q8ZA 3PLSA 2VTNA 2J51A 4PP7A 3ACKA 3V5PA 4JQ7A 3RTPA 4HYIA 3PXYA 3PIZA 1RDQE 5CSPA 3T9TA 5LARA 2X9FA 2WQMA 1OBGA 4PTCA 3BU3A 5M57A 3QD2B 4YR8A 3QTWA 4MXOA 3R01A 4JLCA 5AR3A 3EYHA 2QURA 4NM7A 3QTRA 1PMNA 2V62A 3PY0A 3TI1A 4BDGA 1XH9A 4NL0A 2EWAA 4QMZA 5E8WA 5HG5A 3VBYA 3DKCA 2P0CA 1ZYLA 3I0OA 4R7BA 3PXQA 5CASA 2XVDA 3ZXZA 2IZUA 3IW4A 3E63A 4BIEA 3D7ZA 3FDNA 4CCUA 4H39A 2V7OA 4J97A 3MFRA 3GCVA 5GHVA 2ITWA 2UW4A 4QMYA 4YC6A 1FMOE 4ZJVA 3AC1A 1YI3A 2PZ5A 2YAKA 4LOOA 4XV3A 3QRUA 1R0PA 4XH6A 4GU9A 4QP9A 5C01A 4YPDA 3TNIA 2A0CX 1SVEA 2WD1A 3FY0A 3R8UA 2BHEA 4U42A 4TYGA 4X2GA 2YWPA 5BQ0A 5EOLA 2B4SB 2Z7LA 2VX1A 3L8SA 1ZOEA 3LXNA 4D9UA 1ZMWA 1UWJA 2QQ7A 2BVAA 3WILA 3EN9A 4LI5A 5HNBA 3TZ9A 5KNJA 2PUNA 3SRVB 3MGYA 3TG1A 5K0XA 3GBZA 3FQSA 4EKKA 3ZEPA 2R64A 3DXQA 3RVGA 1OL6A 4K9YA 4D1ZA 3JY9A 4U3YA 2VU3A 4OT5A 4ID7A 2VTOA 4BICA 4DG0E 1U46A 3ZM9A 4RJ5A 3R8ZA 4IFCA 5AUZA 5C27A 2ZYBA 4O0RA 3CTJA 4C2WA 1HCKA 2XB7A 5CU2A 3LQ3A 4D0WA 3OXIA 3P7BA 4ZLOA 1LEWA 1WBWA 4CT1A 2PUPA 1ZOGA 2PZPA 5E92A 3RNIA 2V7AA 1M2PA 1JBPE 1OKVA 2OK1A 3NRMA 5ETAA 2WKMA 4FZ7A 4D5HA 3RCJA 5EDRA 2QVSE 2JKKA 4FT0A 2HOGA 4GG7A 3ANQA 4JRVA 3EFJA 3PJ1A 4GK4A 4M84A 3PA4A 4RIXA 2XNPA 4FK6A 4D4SA 4EBWA 3ZH8A 5K0KA 2P2HA 4MXXA 4DITA 5M53A 3C5IA 3LKMA 3IK3A 4E4LA 2DS1A 3RWQA 1W8CA 1J91A 2YISA 4IXPA 4B0GA 4FV9A 3NZ0A 4WNKA 3DZQA 4L3JA 4QQTA 5L3AA 5L2SA 2WNTA 1L3RE 5FWKK 1A9UA 5D11A 3NUAA 4USEA 3UVPA 5FDXA 2CDZA 3CJFA 2X7GA 3FMMA 4JG8A 1NVRA 4WOVA 3RAWA 3R1YA 5CI6A 1KSWA 2QKWB 4IX6A 3Q60A 3RMFA 5BVFA 5IKWA 3HMPA 3QLFA 2W0JA 4P2KA 2C68A 3O71A 4I94A 4AWIA 5JRSA 1RE8A 3FY2A 3NW5A 3RHXA 2AC5A 5AUYA 3U87A 4BVUA 3UO6A 2IZRA 3ZEWA 5I3OA 1ATPE 4E20A 4E6DA 5CSHA 4K18A 3R9DA 2ZMDA 3EIDA 3LE6A 3KMMA 4CRLA 1XBCA 4UZHA 3MA6A 5FXSA 4RA5A 2ZVAA 1PXPA 4W4YA 4IVCA 5IISA 4NZWB 3CIKA 2UZBA 4UEUA 4XEYA 4BFMA 5KMKA 3C0GA 4O82A 1B39A 3C13A 3PXKA 3IGOA 5FBOA 3U54A 3C50A 3DPKA 4FICA 4CEGA 3P5KA 1QMZA 4HYUA 4MF0A 5FEQA 4BTJA 2XK3A 2DUVA 4RVLA 3PXZA 3CPCA 2ZM1A 4GIHA 3O8UA 3E8NA 5CENA 2VWWA 1YVJA 3VNTA 3KFAA 3W33A 2QLUA 3HA8A 5J9ZA 1VR2A 3GP0A 2J4ZA 3ANRA 5AX9A 4ZSLA 3E7OA 3GEQA 4M3QA 4G16A 4M7IA 5E4HA 2PPQA 2C6OA 5FDPA 1G8AA 4GW8A 4AT3A 3V6RA 4QD6A 3S2PA 4CD0A 3UP7A 4X21A 4FK3A 5I4NA 2QI8A 3D5VA 2SRCA 3O23A 4FF8A 5HG7A 3GNIB 3ODYX 4R1YA 4O7YA 1ZAOA 4PF4A 5HE1A 4FSNA 2NRYA 2C6TA 4TKSA 5EYCA 5I0BA 3MVLA 2WMSA 3Q6UA 3IDCA 4F0IA 5C8MA 3ZTXA 3ORLA 2CNVA 3O2MA 2X39A 2YERA 3NNVA 4FG7A 3BLHA 3TEIA 3TV4A 3NNUA 2YHVA 2AUHA 3IW8A 4FKRA 3VJOA 4BDHA 3NIEA 4AW1A 5BX0A 3QXPA 3M11A 5AP2A 4NK9A 3TJCA 2UW9A 4PPBA 1MQ4A 2CNUA 5HORA 3KVWA 4JG7A 4LFIA 4W4WA 4YC8A 3R7OA 3UQCA 3NLBA 4IAAA 4QMPA 1IR3A 4RJ4A 1YKRA 3Q53A 2XP2A 4P7EA 1IA8A 1OIYA 5ACBC 5EKOA 4F9AA 2W1IA 1GIJA 1H1QA 4ZTNA 3EN5A 2BPMA 3VRZA 4F6WA 4NYEA 4YPSA 3G15A 3LFFA 3TKIA 5C1QB 2HZNA 5KE0A 2X4FA 2BRMA 2R3LA 3QKMA 4MD8E 5IUIA 4XP0A 3RM7A 1BKXA 1XH5A 4E5WA 5I3RA 4UMUA 1Z9XA 2OH0E 3R1NA 4IM2A 4O2ZA 5JFXA 1REJA 3WBLA 3GCUA 2C5XA 4QTAA 5HCXA 3R0TA 3DBQA 4QRCA 3G6GA 3ZSGA 3O0GA 4H1JA 5J5SA 3ULIA 4FSQA 2IVTA 2VTIA 3OC1A 5A4CA 3B8QA 4OBOA 2NRUA 1XR1A 3W10A 4MF1A 1KE9A 3UIUA 3L9MA 2C6EA 5TT7A 4EH5A 4BIBA 4KS8A 5F4NA 3BYUA 3FLSA 5HLNA 5EW8A 2E9NA 3ZLSA 5HQ0A 4NUSA 2X6EA 3ENMA 3A60A 3LAUA 3P4KA 2B9IA 3ORMA 3DXPA 4H3BA 4IB0A 4UMRA 5IQFA 4YTFA 3R8PA 3PY1A 1YHVA 2R3FA 5AP3A 3C0IA 3T9IA 4FG8A 2J5EA 3SXSA 2QOKA 2OJIA 2W4OA 5HHWA 1PHKA 3OTVA 5JGDA 4RX7A 4D2PA 2PMNX 1Q5KA 5CLPA 3MJ2A 4FIJA 4NU1A 4C02A 2XNOA 1KV2A 3EQPA 4K0YA 1FINA 4YJPA 4C62A 1GZ8A 2ACXA 4EBVA 4FZAB 2XZSA 5J7HA 3I81A 4M67A 3BHUA 3T3UA 1IRKA 2YM6A 3UQFA 2XK8A 2OXYA 3RPYA 4XV9A 3EN6A 2ZV7A 2WU6A 3TUBA 1GZNA 3QALE 2BCJA 3V04A 3EJ1A 4X3FC 1KWPA 1VEBA 2R3JA 4F6UA 4ITHA 4DGLC 3D94A 3WIKA 3WZEA 3KVXA 4L9IA 3M42A 3E7VA 4WRGA 4DFLA 4FV6A 5FP5A 1LEZA 3LZBA 4YZMA 4FVQA 3BZ3A 3CCNA 4U3ZA 4X7QA 3F3TA 4CTBA 2CKPA 4S31A 1OPJA 5C8KA 4DA5A 4CNHA 1OGUA 2GCDA 2XBJA 3A7IA 4UWBA 3GB2A 1XO2B 3TTIA 3N4VA 4PL3A 5IU2A 5LVLA 1NA7A 1P4FA 2R0UA 2R3NA 3L8VA 3A7FA 4F9WA 1H1SA 5JSMA 4XNEA 4H36A 4U97A 4R5YA 2ZDTA 4FG9A 5KCVA 3R04A 4X2FA 1Q61A 5EM5A 1SZMA 4FODA 4EOLA 2A1AB 2J50A 3LM5A 3D5WA 2FSOX 3NCZA 3ZFXA 2R3RA 5A54A 2VNYA 4BKJA 4U5JA 4X3FA 4OUCA 5DT4A 5LJJA 1OL1A 4FTUA 2YM3A 5BVKA 4ZZNA 4YHTA 2GNHA 4FNWA 5E7RA 4I5HA 2C3IB 2WQBA 2C5VA 3VW8A 3VHEA 4MK0A 5LWMA 3H9OA 4QP1A 5AP4A 1H01A 4QNYA 3MTFA 4GUBA 2BHHA 3QRIA 4KB8A 4NW6A 3RM6A 3WF9A 5J8IA 2VUWA 1BI7A 3CLYA 2VD5A 5CY3A 1H1PA 1JWHA 3AT4A 4UX9A 1V0BA 3MESA 3ZSHA 1H1WA 5K4IA 3FMLA 2J2IB 4FYOA 4EZ5A 2JGZA 2VO0A 3EMGA 3NVKI 4AA5A 2W9FB 5BVWA 4JT3A 5IH4A 3I6WA 5D12A 4C38A 5IUGA 3AGLA 3I4BA 5CXHA 4RFYA 1OUKA 3QRTA 2O8YA 5J7BA 3G5DA 4TWPA 3ORKA 3CD3A 4BHNA 4FV0A 3IECA 4GKHA 4K77A 3PPKA 5HCZA 4N57A 2XNBA 4E4MA 4F4PA 4DLJA 1ZMVA 4YNEA 5BVNA 1OKWA 2OSCA 4QMMA 4BCPA 4DEGA 4AP7A 3ZO4A 4YTIA 4MXCA 3GQLA 3MB6A 4RJ7A 4QPSA 4LRMA 5ANKA 4FTAA 2PWLA 3CJGA 3WE4A 2X0GA 2EVAA 4GYGA 4W4XA 2EUFB 2OZAA 4HVIA 5HESA 2GDOA 3R02A 2DWBA 2OJJA 3QAME 2GNLA 3QCXA 4DEIA 4AZEA 2VGPA 4EK6A 4ZMFA 5M09A 3E5AA 3EQBA 3DKOA 1R0EA 3Q9ZA 5HG9A 4EZ3A 4XYFA 5JKGA 5F95A 2F7EE 2ZMCA 3MPMA 3PIXA 3UVRA 4C2VA 2OJFE 3OCTA 4EKLA 2E2BA 4HCUA 1SNXA 3GC8A 4IAFA 4Q2AA 4FZ6A 3P08A 3UYTA 4KABA 4ASXA 3Q4UA 3CKXA 3TV6A 2AC3A 2BRHA 3GU6A 3KXNA 4NKSA 4O2PA 4Y8DA 4DH1A 4HOKA 5A4TA 3S00A 5IQHA 3QQGA 4YO4A 4PP9A 5J1WA 3QD0A 4YNOA 5HLWA 5TE0A 3MYGA 3SD0A 4PDYA 4QP3A 2HZ0A 2C3KA 2VTHA 3CQUA 3LJ0A 3PVGA 4KD1A 3RAKA 1B38A 3JUHA 5LCKA 4NKAA 2YDKA 3GCSA 3QCSA 2JDTA 4GK2A 5M4IA 3QGWA 2ITVA 4OW8A 5B0XA 2RSVA 2YJRA 4D1SA 5TKDA 1JQHA 1OI9A 4CCBA 3A7JA 2YACA 2IG7A 4CG8A 4Z9LA 2PVRA 3BCEA 3FMJA 4L67A 5F1ZA 3TIYA 1CMKE 4ZY4A 5AM6A 3VRYA 4XHKB 2Q0BA 1YOJA 4TYJA 4CRSA 2IJMA 3BLRA 4LYNA 3THBA 4DT9A 1H24A 4R1VA 4RVMA 1OKYA 3DGKA 3AMBA 2C0OA 5M4UA 1OPKA 4S34A 4EH7A 1WFCA 4F09A 4YGAA 4BN1A 4RGJA 3DXNA 4BC6A 5JQ8A 1SYKA 3AC4A 2YZLA 4RBLA 1NY3A 2PE2A 3EZVA 4HGLA 3R73A 3ZUUA 3LFQA 1ZLTA 4PDPA 1WVXA 5CAQA 4YZDA 1PY5A 5KMLA 3QZFA 4BCKA 2JAMA 4AW5A 4DAWA 5EYDA 3QA8A 2R0IA 4E4NA 2GFCA 4QQ5A 1BL7A 4JR7A 4ANOA 3UIXA 3HEGA 3S4QA 3BYMA 1Z57A 2XKDA 3LLTA 4W9WA 3UVQA 3LXKA 1ZY4A 2J0IA 2YCSA 2YDJA 1CDKA 2HZ4A 4AZTA 3FZ1A 3MFTA 5IMEA 4R77A 2PZRA 1BMKA 4L43A 3JXWA 4GMYA 4CFUA 3PPJA 3GC7A 4DINA 3CEKA 4ACCA 4XG7A 5C26A 3U6JA 2VTMA 2IZSA 1OL7A 3Q5ZA 3FZOA 2XJ0A 1WAKA 1KUTA 2W1CA 4RC3A 1F3MC 5DT3A 4IE9A 4OTWA 3F88A 4R3RA 4TRLA 5HIEA 2W9ZB 4HCTA 4MQ2A 5LVPA 3ZO2A 3FLQA 4PPCA 3DKGA 4BDJA 2CN8A 3R21A 5ICPA 3HZTA 4XBUA 2QONA 3D5XA 2QO2A 4FA2A 1UKIA 5E9EA 3ORTA 3OW4A 1T46A 2RF9A 1PKDA 4FSTA 4QTCA 5CNNA 1LP4A 4E3CA 3NWWA 3W1FA 5KMIA 4XV1A 1JKLA 4HCVA 4C37A 4CYIA 2BUJA 3N9XA 3OWLA 5CF8A 3PPZA 4RIOA 4U9AA 1M2RA 4ZTRA 4AZFA 5IUHA 3SA0A 2NP8A 3TUCA 1OIUA 2R3MA 5K5NA 3R9NA 4FZFB 3F82A 4PWNA 4L00A 3U4UA 3LMHA 4L01A 4WUAA 3MFSA 3R63A 4M0ZA 5AUWA 4BCOA 4IB1A 4FTMA 3RAHA 5J5TA 1FVRA 5DT0A 4ZZOA 4BIDA 3GU7A 1IAJA 3QWKA 2X9EA 3D2KA 2PZYA 5AR8A 2VWIA 5FBNC 3DB8A 4IADA 2VTPA 4ZJJA 4BDAA 3GOPA 2EB2A 2CPKE 4A4OA 5JN2A 2WU7A 4TY1A 2ERZE 3W2OA 4A9YA 4CMUA 3LFDA 4NJ3A 4Z3VA 3FPMA 4U81A 4X0MA 4EI4A 3CC6A 4GUEA 5K4JA 5CT7A 2UZDA 4UMTA 4DHFA 1W82A 1URCA 2YIYA 2W17A 4H1MA 5IQIA 4A4LA 4AQCA 2RG6A 4NSTA 4AZWA 1JSVA 1J1CA 1IASA 4Q9SA 3EB0A 5AP6A 1CKJA 2WTWA 4YJVA 1W7HA 3KK9A 3VS5A 3NYVA 4LRKA 3AT3A 3D7TB 2PZIA 4O6LA 4BDCA 3QD4A 5HD4A 4L42A 3A61A 1YOMA 4L68A 4O7LA 4O7RA 1JSUA 3QA0A 4J8NA 1FQ1B 3QGYA 2VGOA 2ITOA 4E7WA 4BI2A 3DOGA 2I0EA 4X2KA 2PVFA 4GJ2A 2O3PA 3OT3A 3ZZEA 4BZOA 3FC1X 5DMZA 5LMBA 3ULZA 5AFVA 3UTOA 2OF4A 2BZHB 1Q3DA 2ZV9A 3Q5IA 3JVRA 2CKOA 4I22A 4XG2A 4IZYA 3CP9A 2P55A 1HOWA 2BZKB 2LGCA 3DAKA 3P78A 1VZOA 4LUDA 3F7ZA 5A46A 5A4QA 5CAVA 1OITA 4RQKA 1R39A 2WEIA 4FNZA 1ZY5A 3Q2MA 5E8SA 3T8OA 4KUJA 4AA4A 3C51A 3ZLYA 5A4EA 3LQ8A 3R2YA 4ZTQA 4QMTA 3ROCA 4DG2E 5F20A 4W4VA 4AT4A 2GU8A 3KK8A 5HNGA 4JIAA 4Z7HA 4ZLYA 4TN6A 1IAHA 4TNDA 5GIPE 4FKVA 5HEZA 2XCHA 2B53A 5L8LA 4UWYA 3AC5A 1YWVA 3LMGA 4EK4A 2QU6A 3Q4CA 4H3QA 3GU8A 4LQMA 3AMYA 2P33A 4ONAA 4G3FA 4UV0A 3VBWA 2WIPA 3BEAA 3UC4A 3ZO3A 1CKPA 2XKEA 2YAAA 3S1HA 2X6DA 4RZWA 2JDVA 3SRVA 4USFA 3AC2A 5HVYA 4LMNA 1TVOA 1ZYSA 3QC9A 5DRDA 3NAXA 1RW8A 5KZIA 3DU8A 3ITZA 4AXAA 4Z16A 4PDOA 2RG5A 2UW0A 4FKJA 4XP2A 4H58A 4NH1A 2PE0A 5CU6A 2QOBA 4ENXA 2OLCA 4M69B 4O0VA 1U54A 3QL8A 1M2QA 1PF8A 4R78A 3EWHA 3FLWA 3ZC6A 3B2TA 4L7SA 4LL0A 1YXTA 2XKCA 4PDSA 5CVHA 3BGQA 3HRFA 2OXDA 4MKCA 3DDPA 3DQWA 5IA3A 2VO3A 3H9FA 3F5XA 1F0QA 4DG3E 3JY0A 3MS9A 3KXGA 4YJTA 2C1AA 3OTUA 3VW6A 1Y6BA 3VUDA 4MHAA 3CY2A 5KHWA 4IZ5A 4IC8A 1NVSA 4MBLA 3MDYA 4GSBA 4BCJA 5AV1A 1PXMA 3WZKA 4BCFA 3RJCA 2ZAZA 2VTJA 3GXLA 4QP8A 1UNLA 3UNJA 2EB3A 3MIYA 3PRFA 4QTBA 3K54A 1GJOA 3QTZA 3HLLA 2J9MA 4W8EA 5I9VA 4WHZA 2HWPA 2WB8A 5K9IA 4ZY5A 2CGWA 2GHGA 3BKBA 3BGPA 1WBOA 3UG2A 2VAGA 2W1FA 1FBNA 4HNIA 3BQCA 5HIDA 3V5WA 4AN3A 4X6QC 4QOXA 1S9IA 3GFWA 3CE3A 5IF1A 2YFXA 1B6CB 4FTKA 2Z2WA 4WG3A 3OP5A 5A6NA 2IPXA 3VS4A 3QFVA 4G6OA 4PQNA 3WF6A 2Z7SA 2BDJA 3LFSA 4L8MA 1PKGA 3SG8A 4RWKA 3TV7A 3VJNA 5TR6A 4BZDA 3IDBA 4C36A 1ND4A 2R3PA 1TKIA 3NPCA 2B52A 4D2RA 4XOYA 4FIGA 4DTKA 5HU3A 4AN9A 4AZSA 5LWNA 1BI8A 3RKBA 5CAPA 3PFQA 3R2BA 1Q24A 1DI9A 3HV5A 5D7AA 2B9HA 3WZDA 3NUUA 3RALA 4C7TA 4XG8A 3UYSA 4CSVA 4F0GA 3ZUTA 4CFWA 3JR1A 3Q04A 3RP9A 2V22A 4M14A 1JLUE 4YJSA 3W2CA 3CS9A 2C0TA 2C6DA 4F9BA 3FSKA 4O6EA 4JVGA 1FGIA 1SVHA 2VWYA 4ZY6A 3ZFYA 3LFEA 1U5QA 2A27A 3DK7A 1H1RA 2E9UA 4EOQA 4ZMEA 5FGKA 3QZIA 4DFZE 5H9BA 3ZONA 4EORA 4FUXA 3TXOA 2BAQA 2JIVA 1QL6A 2VZ6A 5AADA 4GVJA 2XMYA 4DFBA 4G3EA 3K3IA 3PE1A 3MWUA 2YM4A 3QLGA 3UPZA 2XBAA 4E6CA 2Q0NA 1U54B 5FG8A 4CFNA 4C4HA 4IWQA 2G01A 1KOAA 3W2RA 5AR7A 5BYZA 3AD5A 5HX8A 2XKFA 3DNEA 3P79A 3GU5A 5D10A 4P5QA 1H25A 2C6MA 4YLLA 4UYNA 5AX3A 3EN7A 1UU9A 2GQSA 2RFEA 3FKNA 1M7NA 2QCSA 3ZSIA 3SW7A 3KF4A 3KREA 4AW2A 4YUQA 4BWKA 1QPJA 3G6HA 2VX3A 4NEUA 4BCQA 4OTHA 5DR9A 4E93A 2FB8A 3SOCA 3FXWA 3PSCA 4I4FA 4KKHA 3KN5A 1FVVA 3KC3A 3HECA 3UOJA 4IANA 4PMSA 2J0LA 3MW1A 5IH5A 3UJGA 4EYMA 5HX6A 3RK7A 4B99A 5HVKA 2B0QA 3QWJA 3ZMMA 1TQPA 1M17A 2XRUA 4AU8A 2VWXA 2C6LA 3ZBXA 3AC3A 3C4WA 1DI8A 3KXZA 3UO5A 2BTRA 4I6BA 4RJ3A 3FEGA 4EC8A 3ORPA 3S3IA 5EI8A 2Z60A 3LJ2A 1O6LA 2XF0A 3Q32A 4MEDA 5JT2A 2XNNA 2JFLA 4U44A 3KRLA 4PL4A 4BY9E 3O7LD 1XJDA 1DM2A 3QTSA 3FXXA 4RQVA 2YCFA 5HE3A 5FEDA 3TACA 3VUTA 5C4LA 2PHKA 4G2FA 4I6FA 1YWNA 4G6LA 4HNFA 4ITIA 4LRJA 4JDIA 2R3QA 2C1BA 3KA0A 3RPVA 4D0XA 2E9VA 4ZK5A 3BRBA 3QKLA 4KINA 4CT2A 3UZRA 2ERKA 3E8DA 3ZCLA 4D2WA 3ETAA 4X6RA 1OL2A 2JKMA 4GIIA 4JIKA 4Y5HA 5E8XA 5M07A 5B2MA 3F5PA 5F94A 4NTTA 4FKTA 3H9RA 3NW7A 4GJ3A 2HENA 4OTFA 2PTKA 4UY9A 3FXZA 3TZMA 1YXSA 4XX9A 3R71A 1Q8YA 4WBOA 5EHYA 2BROA 4AAAA 4C34A 2G2HA 1YXUA 2QD9A 3PXRA 3H4JA 2F4JA 3GC9A 1XBBA 2CMWA 2WO6A 5M08A 2BILB 5M4FA 3WE8A 5IA0A 2UZTA 3BU6A 3EL7A 4CLIA 5L8JA 3T3VA 1VJYA 3NUPA 2EXEA 3UC3A 5JZNA 3WZJA 3UGCA 4EUTA 5CEKA 4O86A 3HV7A 5CEPA 3OFMA 2PUUA 1U4DA 4IWPA 3V8SA 4WBBB 4FTLA 3DBFA 4DTAA 3BWJA 4WKQA 4LOQA 3SXFA 5J1VA 3NMUF 5B2LA 1J7IA 1Y8GA 4AGCA 3E3BX 3LFCA 4BYJA 3HAMA 3N51A 4JJRA 4A9UA 3I7BA 5BVEA 3E87A 3V6SA 3WF7A 1KV1A 3TT0A 3DTCA 3QF9A 4KRDA 4RT7A 3PVWA 5JEBA 3ZU7A 4GCJA 4HVHA 5IH6A 5C03A 2HY81 2OG8A 3ZS5A 4BTKA 1E9HA 1VYZA 5EQPA 4QT1A 2CLQA 3M1SA 3DS6A 1RJBA 4RRVA 1O9UA 1NXKA 3MV5A 3DV3A 2GHMA 2QG7A 2BAJA 1CM8A 5EQEA 2QNJA 4DN5A 1Q62A 2FVDA 3EQGA 4O7SA 2J0KA 3HRCA 4CFXA 4ZOGA 3Q9YA 1Y57A 4QYGA 4BI1A 5CS6A 2JITA 4KKGA 3IKAA 2YIQA 3ZC5A 3A7GA 3BEGA 2WTJA 3BQRA 5HE2A 4AS0A 4HZSA 3BYOA 2PMIA 2CGVA 2WELA 3GCPA 2JD5A 3W8QA 2WMAA 4IWDA 4XUFA 4KIPA 5ACKA 4OR5A 2R3IA 3DY7A 4E5AX 4QMLA 3OHTA 3MY0A 3QXOA 3TJDA 4IIRA 2J5FA 3FV8A 4XG3A 2CKEA 5IQBA 1OKZA 2BALA 2BFXA 2G2FA 2G9XA 3VS7A 1KE5A 2ITNA 3GT8A 5FEEA 1Q97A 3ALOA 3NYXA 5CZIA 5CSWA 4C3FA 1FPUA 3F5GA 4O0UA 3VAPA 4F64A 4ARKA 5C8NA 5CX9A 5D1JA 5HBJA 1J7UA 4IJPA 2UVZA 2XK4A 4CV8A 5ETCA 4EHEA 3HYHA 4IM3A 2W99B 4OTRA 4MXYA 5IDNA 2RFDA 3OBGA 3WIGA 2GHLA 4RX5A 3UG1A 4NCTC 5DH3A 5DN3A 1NT2A 5H2UA 5DYJA 2Y0AA 5FRIA 3TZ7A 3UNZA 3DAEA 4BCGA 3DQXA 2VTQA 2W1ZA 3QRJA 3TNPC 5AEPA 4I1ZA 4CKRA 2YIWA 3JS2A 2OI4X 2WPAA 4Y46A 3R8MA 3VUGA 4IB3A 4BGGA 5EKNA 1SM2A 3UDBA 2BR1A 4L46A 3S95A 5EFQA 1WBSA 2RIOA 4G6NA 5DA3A 2UVYA 4JNWA 4M12A 4WRSA 1W83A 2JBOA 5CNOA 3UMXA 1TQMA 4BL1A 2R3HA 2BDWA 1U59A 4L45A 5C9CA 2WMRA 4FOCA 3VS2A 1A48A 2FUMA 1S9JA 5EQYA 3HVCA 5T3QA 5FTGA 4FV7A 4U40A 4D55A 4G3DA 3FHIA 4FKOA 2UVXA 4NCTA 5FD2A 5FQDC 2W5HA 4L3LA 4YZBA 2R3KA 4N4SA 4EZ7A 1PXJA 2YLEA 3PG3A 4IHPA 2GQRA 2JKOA 5HCYA 5HO6A 2OH4A 3KL8A 2IW8A 2C69A 2W7XA 2WMQA 4WUNA 2O0UA 3IW5A 4IDTA 2JFMA 2ITTA 5DIAA 5AV0A 5CI7A 3VULA 4TPTA 4U0IA 5CQUA 2VRXA 3VQUA 2PK9A 3OY1A 2I0YA 3E93A 4QMUA 5JFSA 2PVNA 4HGEA 4MWHA 5DOSA 3BPRA 1GY3A 4KAOA 4J98A 2UW8A 2BFYA 2VTAA 2YM7A 1L8TA 3CTQA 4YHJA 3F9NA 3G51A 3L8XA 5DVRA 4O7TA 1CSNA 3FMHA 4DC2A 2PVHA 4M15A 4BBEA 3F3VA 3V5QA 4EHVA 4DH5A 5J9LA 5CT0A 5EM6A 1IG1A 3A4OX 4JDKA 4AW0A 4YJRA 5IA2A 3FZPA 4UMQA 1H00A 3KRRA 2IWIA 2GFSA 4YTCA 1ZYDA 3PE2A 2YM5A 3VBQA 3OY3A 3COHA 2WMXA 3UOHA 1KE6A 4A7CA 3GGFA 4IAZA 3UIMA 1IA9A 2V55A 3COIA 3E62A 4ZEGA 1J7LA 4IMYA 1PXNA 2J0MB 2O65A 5J95A 5E8UA 4UBAA 5I9YA 4LGGA 4I0TA 1WBTA 3W32A 4BKZA 1QPEA 3AD4A 3EKKA 4EK8A 3NIZA 4OBPA 2W1DA 5CAOA 4NW5A 4GT4A 4PV0A 2CCHA 3MVMA 1OZ1A 2JEDA 2W4JA 5AAEA 5B7VA 3B2WA 5JGBA 4AGWA 4PMPA 2XK9A 2UZEA 1YDSE 3QQUA 3KCKA 2FGIA 2WQOA 2YITA 4EK3A 4FTCA 4BF2A 5B2KA 4RSSA 1JKKA 1I09A 4Q5HA 1ERKA 4FSZA 5AA8A 5LOHA 4FIIA 3HMOA 4QYHA 4ZSGA 3NDMA 2XK7A 3OT8A 2F2UA 3BBTB 2OBJA 1Q4LA 4FVRA 1YOLA 4FTJA 5TF9A 4QYFA 2IZTA 2WOTA 4U41A 4V04A 4O0TA 4KKEA 2B9FA 4DEAA 2FH9A 3KEXA 5E8ZA 4F0FA 3I6UA 4EHZA 4QTEA 5JMSA 1XBAA 3I7CA 5LQFA 4FEQA 4FL2A 4NT4A 3MI9A 4EL9A 4U7ZA 4O0YA 3OUKA 2OGVA 3VUMA 3U6IA 3BE2A 2C0IA 4CLJA 4F65A 1BUHA 3F7WA 4GT3A 3ZYAA 4OAUC 2RL5A 3PSBA 4FV4A 1K9AA 5AR4A 3MFUA 2CCIA 4A07A 2ITQA 4JQ8A 5DGZA 5GJGA 1DS5A 5ANJA 4DGGA 4RC4A 3RK5A 3FL5A 4FTQA 2UUEA 3Q4TA 2OIDA 2UZVA 4I92A 5E8TA 4DCEA 3Q9XA 3RNYA 3QYZA 4F7LA 3FL4A 4I4EA 5AV2A 3C9WA 3MH3A 4YSJA 4ZAUA 4FKIA 3DJ6A 3EKNA 4BGHA 2PMOX 3F3UA 5HKMA 4ACDA 3OCSA 4U43A 3ZFMA 1YRPA 2VWUA 4APCA 5LMKC 4DGOA 3FJQE 5FTQA 2R3GA 4PMTA 4IAIA 4TWNA 4ZLZA 2UW6A 2ITZA 5AAFA 4GV1A 5HTBA 1KE7A 3A99A 4FV2A 1Q8WA 2QR8A 4R6VA 4XV2A 3ATSA 3U55A 4M13A 2HYYA 5HLPA 5FP6A 3OXTA 3CQWA 3D7TA 3GENA 4LV5A 4RG0A 2E9PA 3PA5A 5KZ0A 2VTRA 4B4LA 3QBNA 1ZZLA 4OTPA 2CHLA 1FGKA 2QKRA 4D28A 5EOBA 4GRBA 4YSMA 2WMWA 4ERWA 5A14A 4FSUA 2NO3A 5ITAA 5DEWA 2W1HA 4NWMA 5AUTA 3GVUA 2BIYA 3C4XA 4C8BA 3TNHA 2YJSA 2J7TA 3QHWA 1JAMA 4ZTSA 4AOIA 3R9OA 3AQVA 3OWJA 3QQLA 3TKUA 3SG9A 4BRXA 3PYYA 4RLLA 2GS7A 2GMXA 1LR4A 4AFEA 5LMKA 1Y6AA 5A9UA 3LMIA 1XWSA 4EHGA 5HIBA 4IH8A 3REPA 3BV2A 4RFZA 4CFFA 1WZYA 4I0SA 2X81A 3RGFA 5CU4A 4GFGA 4FC0A 5L8KA 4ZP5A 1OUYA 1PRYA 3R9HA 3R7UA 4USDA 3PP0A 3HL7A 1PMUA 2Q83A 1ZYCA 5BYLA 4FSRA 4IAYA 3TDVA 3KMWA 2HXLA 1APME 5D9HA 3UOLA 1ZMUA 5C4KA 3WI6A 4N0SA 3OROA 4BDEA 4FEXA 4PNIA 2FSMX 4WNOA 4UB7A 3ZUVA 4PRJA 3Q4ZA 2QR7A 4P90A 1RQQA 2XYUA 3OD6X 4R8QA 3SX9A 4F7NA 2YM8A 4O1PA 2ONLC 3II5A 4O1OA 2OIBA 2UV2A 2GNJA 3VN9A 3O7LB 1VYWA 5KO1A 3PLAE 3MVHA 3HV6A 4KIKB 4ZSEA 2X4ZA 3QZHA 2DQ7X 2HXQA 5HTCA 4M69A 4S2ZA 4O7ZA 4HYHA 3ZO1A 5A3XA 3BHYA 4UN0C 4G9RA 5ANOA 4QMWA 4YP8A 4DGMA 3QCQA 3QU0A 4S33A 4NIFB 4OLIA 1SNUA 2PYWA 4Y85A 5L2TA 3BI6A 4EOOA 2XNEA 4JXFA 5E91A 3V8WA 2X2MA 4DYMA 3Q2JA 3F3ZA 4O27B 5IA1A 4BDBA 3NAYA 4FSMA 1PJKA 4RIWB 3VS3A 4KSQA 3PIYA 4IZ7A 2I1MA 2YIRA 3AD6A 3QQJA 3PA3A 2CGUA 4JBPA 1WBNA 3QTXA 2JC6A 4BWPA 3TDWA 3ZRMA 2WEVA 2OXXA 4B8LA 4O7WA 3D83A 4G17A 4JQEA 4HZRA 3ET7A 4O7NA 1O6KA 3DZOA 5IQCA 4C57A 5ETFA 2GNIA 4M97A 3WZUA 3OW3A 5M06A 4O22A 1UNGA 1SVGA 1V0OA 3O8PA 2H9VA 3DTWA 3W2PA 4I0RA 3BHVA 5J79A 3IONA 3HV4A 5HBHA 1OM1A 2A4LA 4CTCA 3ZRKA 5CYIA 3NEWA 2OWBA 4BCIA 3AGMA 3NSZA 1G3NA 2ITYA 1OB3A 2X8DA 3PWYA 3R1SA 4YMJA 3VS6A 1FOTA 4ACMA 3L8PA 3ZZWA 1WBPA 2ZV2A 3CY3A 3F2AA 1Q8UA 3LIJA 5CEOA 5IPJA 3DLZA 4HPUE 5EG3A 2GQGA 3ORZA 4F1MA 3C4FA 4K11A 4DGNA 3LCOA 2IVSA 2V5QA 3VUHA 4XOZA 4D2VA 3UPXA 5CF6A 3KCFA 3ALNA 3L9NA 3OBJA 2A19B 2BKZA 1OVEA 2X7FA 3HP2A 2QHMA 3KGAA 4FOBA 1URWA 4RLKA 5AUXA 3CKWA 3OS3A 5CSVA 4AOJA 2O64A 3BHTA 3BV3A 5FXQA 2Y6OA 2Y6MA 1WVWA 2QLQA 2HY0A 3CPBA 1XH4A 1K2PA 5JZJA 2PUIA 1I44A 4FSWA 2E9OA 5EHOA 1JPAA 2R3OA 3R00A 1PYEA 4G3CA 2CN5A 3FPQA 5DNRA 4O96A 1FVTA 4E6QA 5BUEA 4CQEA 3FAAA 1YQJA 4ALVA 2CKQA 4AX8A 2WQEA 3QTUA 3KMUA 2HIWA 4DTBA 5IMXA 3MIAA 4WNPA 2ITPA 4HVSA 3NX8A 2RKUA 4K1BA 4RJ8A 4FT7A 3Q3BA 1UKHA 5HBEA 4BCMA 4CYJA 4ZSAA 4NM3A 3EQDA 2UZUE 1JKTA 2PY3A 3E64A 3SXRA 1Q41A 2BAKA 3K5UA 2UW7A 4LG4A 5A4LA 3QD3A 3ZDIA 4EJ7A 4HJOA 3R30A 3NNXA 5CF4A 2Z02A 5AIRA 4JBVA 2C5YA 4MYGA 5FXRA 3FKLA 4ANNA 3LXLA 3OUNB 4O21A 4EH3A 3ORIA 5HI2A 4FMQA 4MWIA 4FL1A 2OKRA 3EL8A 4YC3A 4M68A 2ETRA 4ZTHA 5CQWA 4CMOA 2F9GA 4FTIA 4LOPA 4UMPA 2WTVA 4KA3A 2PVLA 4H05A 3PJ8A 2OJ9A 3COKA 3FE3A 4FKPA 4HGSA 4LGDA 3R7IA 4H3PA 2XM8A 2UZLA 5JGAA 4O81A 2XCKA 3LOKA 3A2CA 3OZ6A 2WXVA 3BU5A 3LCSA 4HW7A 3TKHA 2WTKC 2OICA 4Y5QA 3FC2A 4BDIA 2OIQA 3IW6A 4QPMA 5GZAA 1UVRA 3DBDA 4MAOA 4GU6A 1AQ1A 2X7OA 4ZSJA 2CJMA 4D9TA 4FEUA 3ZM4A 4Z55A 3R7GA 3CXWA 3NUSA 3NW6A 3TCPA 1Y91A 4O91A 2VV9A 2WTDA 3FMNA 4I41A 4EONA 4HVDA 2JDSA 3F69A 1UA2A 3LLAA 4CKJA 3AOXA 4F1TA 3KN6A 3R28A 3EZRA 3I1AA 3CGOA 4NJDA 4OTIA 2HWOA 4CQGA 5BNJA 2I0VA 3POOA 1R1WA 4XBRA 3QTQA 4QNAA 2BIKB 2XUUA 5AP5A 4AFJA 2XM9A 3PWDA 4ZS0A 4TXCA 3SGCA 3WF5A 5KKRC 5HICA 4D4VA 2VWVA 5E90A 4PTEA 2CLXA 3EH9A 4LV8A 3VBXA 2YLFA 1XH8A 3OOMA 4FKLA 4I5PA 4EC9A 3JVSA 5AR2A 4R7IA 3HUBA 2HAKA 3FYJX 4L44A 4RVTA 5IEXA 3DK3A 3R7VA 2IVUA 2W4KA 4O7VA 3IGGA 5J9YA 1J1BA 4AOTA 4WD5A 5L6OA 3PTGA 4I24A 2QO7A 2JDRA 4MH7A 1H27A 4GL9A 4QPAA 3UIBA 4DH8A 2JBPA 3CD8A 4XLVA 5CEIA 4A9RA 1PMEA 1ZRZA 5L2IA 4DE4A 5EW9A 2O63A 3EN4A 4IVDA 5IQAA 4II5A 4RPVA 3K5VA 4AE6A 4QMNA 4DEHA 3FZSA 4FSYA 2IN6A 3QHRA 1F5QA 2X8EA 3LPBA 2BTSA 2J90A 4MNFA 4PMMA 4QMSA 4TYHA 4F6SA 1UNHA 3KRJA 2PULA 3DJ5A 4G31A 1P5EA 3KULB 1OIRA 5H3QA 4ANQA 4C59A 5BMSA 5JRQA 3V5LA 4FT9A 4YZCA 1YW2A 1PXLA 2OFUA 3PJ2A 2R7BA 3VVHA 3BWFA 2FYSA 3DFCB 3NUYA 5HD7A 5KUPA 3R9RA 3OWKA 3E92A 5BUJA 3HNGA 2JLDA 1LUFA 3QX2A 4WT6A 4EOKA 5EW3A 2YWVA 1XHAA 4J52A 4FKWA 3N4UA 4J7BA 2UW3A 5CZHA 3ID6C 4I93A 1XKKA 1GOLA 2V0DA 3EFLA 1Z5MA 4Y95A 3MSSA 3NS9A 4L6QA 4PUZA 5DG5A 4ZZMA 3MB7A 4IX3A 4FL3A 4MX9A 2PE1A 3CGFA 3BHHA 4KS7A 3V51A 4G34A 1YXVA 4B6LA 5A6OA 4FKGA 1MUOA 3I60A 4B8MA 2PVYA 4E4XA 4EYJA 4PNKA 2XEYA 4RIYA 5K3YA 1M14A 3NGAA 4O84A 1P2AA 3FZRA 3KXHA 4G3GA 4XG9A 3L9PA 1ZARA 2XNGA 2XYNA 2ZOQA 4IB5A 3SHEA 3SKCA 4C3RA 3IS5A 4O38A 3FBVA 4W8DA 4M0YA 5AV3A 2XA4A 3HGKA 4IVAA 4IWOA 1OIQA 3EYGA 3TM0A 3R7EA 1H28A 4KWPA 4HPTE 3F5UA 2XIYA 1WMKA 1WVYA 1BLXA 3E3PA 2X2LA 4EQCA 3DFAA 5AIKA 1H26A 4GVAA 4KRCA 4YTHA 4YJNA 3FMDA 2QOLA 4FV3A 4FYNA 1HCLA 2C3JA 1W84A 1ZZ2A 4F7JA 3DJ7A 4ANSA 5CXZA 3GQIA 5BUIA 4FGRA 5DHJA 1GIHA 2QODA 5E8YA 1GNGA 4RWLA 2Y9QA 3OCBA 3UOKA 2IO6A 4A06A 3MA3A 3Q96A 1UU7A 3TN8A 4OTGA 4KBCA 3KXXA 4U79A 4BTFA 4DEDA 3ENHA 4BTMA 4MBIA 3P1AA 4IFGA 4RX9A 4BHZA 4KBAA 3G9LX 1KOBA 3QTIA 3R7YA 3G2FA 2WTKB 4GK3A 3AXWA 2VN9A 4UWCA 4AF3A 3O96A 5LCJA 2YCQA 4ANLA 3O51A 3MVJA 5JK3A 4PY1A 3GC0A 4FR4A 4XLIA 3GOKA 4FE2A 4JX7A 5G1XA 3P23A 4GKIA 4EH8A 4RIWA 4DFYA 4L53A 4EH2A 3A7HA 4QMQA 1XQZA 3POZA 1YI6A 3QUPA 4IX5A 5CWZA 3UQGA 1QPDA 1W0XC 2UZNA 4WIHA 4ZTMA 3UBDA 3GUBA 2A2AA 3C4ZA 4CXAA 3P7AA 4DH3A 4I6QA 5L2WA 2WZJA 4KNBA 4ANMA 1BX6A 3FMEA 5K5XA 4D4RA 4TYHB 4XCUA 4Y72A 4CMTA 4FKQA 4R5SA 4EOPA 3E88A 3PP1A 4V0GA 4EQUA 2HW7A 5KKRB 3FHRA 4UXLA 1R3CA 3GU4A 4F63A 1FMKA 5I9ZA 5EI6A 2HK5A 2OU7A 3KY2A 4X2JA 4Z7GA 2CGXA 4FVPA 2YDIA 1UWHA 3HDMA 3RI1A 4GFOA 4JS8A 4CZYB 2G2IA 3UMWA 5L4QA 5DE2A 3HMMA 2VTSA 2VO7A 1YWRA 3W8LA 2WFYA 3EQIA 4U80A 4G9CA 4TZRA 3FQEA 3BX5A 3OG7A 3RK9A 3BIZA 1OECA 3L9LA 3MH2A 4EH6A 3LXPA 3N4TA 3CTHA 4FIEA 4YZ9A 1KE8A 5KBRA 3PZHA 5EYKA 3LFNA 3W16A 4IVBA 5IDPA 1STCE 4WSYA 3NNWA 3G90X 1BYGA 3OMVA 3Q9WA 4M66A 4RVKA 4DH7A 3P7CA 3AT2A 1JNKA 4JAJA 4RIYB 4LGHA 4E8AA 4V05A 5ANGA 5DR2A 3ZXTA 4J96A 3LFAA 3WYXA 4C4GA 4C3PA 5LMAA 4GT5A 4LMUA 3NCGA 3SVVA 2PVJA 4O0SA 3F6XA 1PXOA 5CANA 2X1NA 4F08A 4FI1A 2QOIA 4XMOA 3RPSA 4A9TA 1YHWA 3EQHA 3D9VA 4FV5A 4YO6A 4FTRA 3OWPA 2BZIB 5CSXA 4FX3A 2JIUA 2IW6A 2QOHA 3DB6A 2G15A 4JDJA 4MCVA 4WA9A 4EEVA 3TWJA 1PYXA 4QMXA 4FT3A 4YJUA 4KIQA 3FLNC 4FIFA 4C35A 4D2SA 5I5ZA 3UP2A 3VS1A 2O5KA 4WG4A 4QQJA 4RC2A 2XEZA 1M52A 2YN8A 3D0EA 4RIXB 4IW0A 3C4CA 4QP4A 5AP7A 2ETMA 4JX3A 4PX6A 3RWPA 2EXMA 5GZ9A 1MRYA 3FI8A 4FNYA 4RFMA 2ZJWA 4U45A 3UZTA 2GTNA 3AMAA 4UALA 2KTYA 5D7VA 2WHBA 3IQ7A 4IACA 3D5UA 5AJQA 2GNGA 2RGPA 3LW0A 3QYWA 2BDFA 3DDQA 4GFMA 4RJ6A 2FA2A 4ITJA 4ZXTA 2XK6A 3OVVA 3CQEA 5HTIA 2ZB1A 4FTOA 4R7HA 3FLYA 3ZRLA 5AP0A 3V5TA 3DBEA 4ORKA 5G6VA 3S0OA 2QU5A 5BYYA 4I23A
chains in the Genus database with same CATH superfamily
2Y4PA 3UE4A 5KMOA 3H10A 3VHKA 4TNBA 5IEVA 4I5MA 3C1XA 1J3HA 3RPOA 5AAGA 4P4CA 2R5TA 2ZM3A 5E1SA 3RPRA 2QOQA 4XG6A 4L7FA 2EU9A 4NM0A 1QCFA 4ASEA 4D4YA 4G5JA 3KXMA 5AMNA 3BYVA 2NNWB 3LCKA 1MQBA 2GNFA 2ZV8A 1EH4A 4V0GB 4CZTA 4D2TA 3W2QA 1GAGA 2G1TA 4E26A 4EUUA 5M4CA 3R6XA 4N70A 5M44A 3FZTA 3I79A 2W1GA 4QTDA 4GYIA 4AZVA 3Q52A 3FKOA 4R3CA 1IEPA 4JBOA 4TL0A 1XH7A 4DT8A 1GZKA 3R83A 2R2PA 2CSNA 2QHNA 3NYNA 3VF9A 2KULA 2O2UA 4QYYA 5DLSA 2JKQA 4PTGA 2OFVA 4U8ZA 4AT5A 4OAVB 4XG4A 3R8VA 3BE9A 2W5AA 5IA5A 2VWZA 3RBWA 4ZS4A 3SDJA 1MRUA 4K6ZA 3M2WA 1WCCA 3QQFA 3F2NA 1V1KA 2WAJA 3DT1A 4QP6A 5DR6A 3F3WA 4O0WA 2R4BA 1CTPE 4YZNA 1YI4A 3QQHA 4FKUA 4JDHA 5H8GA 4DBXA 5JFWA 4KSPA 2JAVA 2WGJA 4BCNA 2ETKA 5CEQA 3TL8A 3TNWA 3V3VA 2P3GX 4E1ZA 2W5BA 3RZFA 4AACA 3TUDA 1MRVA 3MY5A 4N6ZA 4F70A 1M7QA 4E6AA 3D2IA 1H08A 3QCYA 4WNMA 3I0QA 3LVPA 3MPAA 4D58A 4BI0A 4C4IA 4J99A 4EQMA 2BRBA 2I0HA 4XP3A 1O6YA 2QG5A 4DFUA 5IQDA 4BBMA 4XRJA 2XNMA 3PY3A 4TWCA 1PMVA 3PUPA 4Y83A 5FM3A 3H30A 5H8EA 4BKYA 5HNIX 4FEWA 3O17A 3PSDA 5KMJA 3FSFA 3PJ3A 3F66A 3W18A 5HOAA 3SAYA 3P9JA 3CBLA 3ATTA 3JYAA 2PVMA 3PZEA 4YJOA 5IG1A 2C3LA 3PFYA 1YDTE 4IM0A 2CNQA 2VWBA 3BELA 4TT7A 4ZTLA 5ETIA 3LCDA 4PPAA 3VBTA 4FBXA 4F1OA 4OTQA 2I40A 2BZJA 3OF0A 1ZXEA 2R7IA 5D41A 4IDVA 3RINA 4AA0A 3TIZA 3FI3A 4RMZA 4XS2A 5FUTA 3HDNA 3P86A 5E1EA 3KRXA 1GIIA 1W2FA 4B9DA 1JSTA 3MN3A 4RZVA 3G9NA 1OPLA 1E1XA 3FLZA 3KU2A 5LVMA 5M51A 5M56A 3QRKA 4C0TA 4S30A 4EK5A 3NUNA 3MTLA 3VF8A 3WOWA 2QOCA 4DBNA 2IVVA 2C30A 3HRBA 3SLSA 4F99A 4BCHA 2F7ZE 5EK7A 2JIIA 2BRGA 2W06A 3KQ7A 2VO6A 3IG7A 3TTJA 2Z7RA 5GINE 4UXQA 2DYLA 4MD7E 5DFPA 1H4LA 4YLJA 5EDPA 3PXFA 4HVGA 1G8SA 4YBJA 5CU3A 2ZB0A 4EOMA 4X3JA 4K8AA 1UU3A 3HP5A 5CALA 3OEZA 2X8IA 3DNDA 2B7AA 2HELA 3ZLWA 1H8FA 2Y4IC 3MPTA 4C61A 4IAKA 3PG1A 2BMCA 2P2IA 3SC1A 4MXZA 1BL6A 1JKSA 4EOSA 2GPHA 1Q99A 3E8CA 4KIKA 3I5NA 3B8RA 1REKA 3BYSA 2XH5A 3EOCA 3IOPA 3PVBA 4OGRA 3ACJA 4AXFA 3ORNA 5EH0A 5HU9A 2Z7QA 4F9CA 4J1RA 3RZBA 3HUCA 2YABA 4NIFA 5CTPA 1GZOA 5AM7A 4I5CA 1XH6A 4C58A 1SMHA 2IF8A 3WARA 1U5RA 3H3CA 4IEBA 4DEEA 3D4QA 2XIXA 5CVFA 5LXMA 5JQ5A 1JVPP 1LPUA 2OJGA 3HV3A 5ANEA 4I6HA 5DWRA 2REIA 4EJNA 5HO7A 5F9EA 4DCAA 3UODA 2WMUA 5EM7A 4ERKA 4IBMA 2C4GA 4JG6A 4DLIA 4TWOA 3LJ1A 4ZJIA 3DKFA 3EFWA 1A06A 2F2CB 2HW6A 4GS6A 5FTOA 4E5BA 4FT5A 5JH6A 4TW9A 5AUVA 2WMBA 4D1XA 4BZNA 2FSTX 4TYIA 1K3AA 3A62A 4KBKA 4O83A 4FGBA 4AG8A 1DAYA 2ITXA 4L52A 4ZIMA 4N6YA 4JOAA 4CVAA 5IEYA 1E1VA 5IQGA 3VQHA 4QP7A 5KMNA 4RA4A 5JFVA 1NW1A 3WYYA 5FLFA 3GI3A 2F7XE 4JR3A 4C4FA 5AV4A 4X3FB 3U9CA 4S32A 5EDQA 1OMWA 3PJCA 5J87A 3U6HA 2J6MA 4XRLA 5CVGA 5TOZA 4CKIA 2QO9A 4QP2A 1YHSA 4J53A 4C33A 3F61A 2XIZA 4X2NA 4C4EA 1P14A 2AYPA 3QUDA 3RHKA 4BGQA 3E8EA 4AXCA 3ZHPC 5IQEA 4JI9A 3EQCA 2GSFA 2W1EA 2H6DA 3LFBA 3MH1A 3ZOSA 4AN2A 4BDFA 3FYKX 5BPYA 4YLKA 5KBQA 4I6LA 3HAVA 2ZDUA 4P5ZA 3DCVA 4OT6A 4BDDA 5KX8A 3IOKA 1PXIA 5BVDA 3VUIA 4CG9A 3RCDA 2H96A 3IO7A 2VNWA 2UZOA 4QMVA 3P0MA 3ZLXA 5AA9A 3V5JA 3HMIA 4O4BB 5HVJA 1UV5A 1WBVA 3FUPA 4U6RA 3RAIA 2Y7JA 1QPCA 3MBLA 3VS0A 4CFVA 2XS0A 4BWXA 5E8VA 5I9WA 1T45A 1PW2A 5HG8A 1YXXA 4FKSA 4GG5A 3G0FA 2NPQA 3ZBFA 5DEYA 1AGWA 4CZUA 4YJQA 5HE0A 2QOFA 5CEMA 4F7SA 5EM8A 5ANDA 1P4OA 2QOOA 2IW9A 2XRWA 4APPA 1H07A 2Y8OA 3H0ZA 5L2QA 4PL5A 1NVQA 2OZAB 4FTNA 4IJ9A 3LQ5A 4NM5A 5AR5A 3PUFC 1DAWA 3R22A 5M55A 4FV8A 5GJFA 4K33A 4F9YA 3EQFA 2BKKA 3EHAA 4GEOA 3SQQA 1TQIA 3HX4A 3GCQA 3QX4A 4AGDA 3BLQA 1W98A 3QUEA 4LUEA 5I9UA 2YIXA 3KKVA 3LM0A 2W05A 3ZDUA 4FUYA 3FI4A 3PDTA 3V01A 2B54A 4ASDA 1AD5A 4IQ6A 3KIOC 3HA6A 3PRIA 3C5UA 2Y4IB 4NFMA 2ONLA 4J8MA 1OBDA 3EFKA 2C6KA 2H34A 3OEFX 5BVOA 2VX0A 3LHJA 5BMMA 4JL9A 2WOUA 5DI1A 3ROYA 2NYAA 2ZM4A 2YZAA 3NR9A 2LAVA 2WQNA 3U4WA 3C4EA 2F57A 4EWQA 3ERKA 4BDKA 4BR3A 2PVKA 4E73A 4YU2A 2W96B 4MNEA 3V8TA 4ALWA 4D5KA 4JBQA 2OO8X 5CAUA 3O8TA 3QQKA 3UO4A 3C0HA 3EQRA 4WSQA 3R8LA 2PSQA 2F49A 3OOGA 5CU0A 3G33A 1R78A 3DBCA 3R1QA 2RFNA 5HGIA 3SV0A 4L3PA 1CKIA 1H0VA 4G5PA 4TYEA 5CF5A 3IDPA 3U9NA 2J0JA 4FIHA 4MD9E 5DRBA 5HZNA 4FZDB 5TO8A 4W9XA 2ITUA 2PL0A 2C5NA 4RX8A 4MVFA 2GTMA 4A9SA 3HMNA 1X8BA 4EOJA 2B1PA 1ZWSA 2VTTA 2QC6A 4Y73A 4AGUA 4C4JA 3VUKA 5KHXA 5L6PA 5FM2A 5GIOE 4QQCA 4MQ1A 1ZYJA 2I7QA 3VC4A 4A4XA 4IZAA 2WTCA 4O0XA 3HKOA 4J95A 4DF3A 3AC8A 4FEVA 1Y8YA 4LDTA 5KMMA 4I3ZA 4YBKA 3Q6WA 4MXAA 2UZWE 4GH2A 5AUUA 3DK6A 2Z8CA 3DA6A 3D15A 4JRNA 4QO9A 4UYAA 1MP8A 5GNKA 5T68A 3OCGA 5L6WL 4IX4A 3KF7A 3QC4A 3ODZX 3FWQA 4FTTA 3IPHA 2GS6A 5AP1A 4V01A 2C5OA 2I6LA 5AWMA 3UNKA 3BBWA 3A4PA 3H0YA 4ASZA 4LL5A 2WTIA 3KULA 1ZOHA 4EOIA 3NVMB 2FSLX 3MH0A 3SOAA 3U8WA 5EHLA 3G0EA 4LM5A 4AUAA 4DFXE 4WG5A 4HYSA 2RFSA 4DEBA 3A8WA 5T6KA 2ESMA 3NYOA 4ACHA 4YURA 3COMA 4BYIA 3A8XA 4WO5A 2VTLA 3NUXA 5EI2A 5I9XA 4EH9A 1YDRE 2YA9A 2EXCX 3W55A 3VIDA 3W0OA 5LVOA 3BGZA 3FQHA 3LCTA 1OL5A 4RWIA 3O50A 4OTDA 4ENYA 4KIOA 1Q8TA 4TTHB 3ORXA 3TNQB 3F2RA 1PXKA 2OW3A 2B9JA 3KB7A 3CSVA 2UW5A 2HCKA 3CR0A 3I5ZA 2C6IA 4YHFA 3C7QA 1Q3WA 2WIHA 3QKKA 3VBVA 3U51A 2XJ1A 3MJ1A 4ACGA 3GFEA 3WF8A 4CV9A 2WMTA 4MBJA 2JDOA 3SW4A 1UU8A 3DAJA 3TZ8A 2OZOA 2XIRA 3ELJA 3MY1A 2PU8A 3DLSA 2X2KA 2PMLX 4MTAA 3D14A 5DBXA 4CFMA 5IA4A 4QYEA 4EWHA 5GZ8A 3PVUA 2HZIA 3OXZA 4XJ0A 3FMKA 4DFNA 5H8BA 2P4IA 3FI2A 3L1SA 4FNXA 2YCRA 5GJDA 4ANBA 4BB4A 4I20A 2B55A 4AE9A 5ANIA 4MNEB 2XIKA 4NFNA 4Q5EA 3KRWA 2H8HA 2C47A 4EH4A 3W2SA 4FV1A 4HGTA 3IW7A 4ALUA 2BRNA 4UZDA 4J71A 2YEXA 1JOWB 2GS2A 5LVNA 1OGYA 3VWAA 4K2RA 3JPVA 4M8TA 4NTSA 4QMOA 4B7TA 2FO0A 3QZGA 4R3PA 3UZPA 4BBFA 4JAIA 5IZFA 5EYMA 1H0WA 2X0PA 2XJ2A 4OBQA 4IC7A 1G5SA 1V0PA 3AG9A 5HO8A 4Q9ZA 4CGAA 5DPVA 4O4DA 3K3JA 4G1WA 3K2LA 4DHZA 2WMVA 2OF2A 2R9SA 4I21A 4RWJA 3VO3A 1Q8ZA 3PLSA 2VTNA 2J51A 4PP7A 3ACKA 3V5PA 4JQ7A 3RTPA 4HYIA 3PXYA 3PIZA 1RDQE 5CSPA 3T9TA 5LARA 2X9FA 2WQMA 1OBGA 4PTCA 3BU3A 5M57A 3QD2B 4YR8A 3QTWA 4MXOA 3R01A 4JLCA 5AR3A 3EYHA 1ST4A 2QURA 4NM7A 3QTRA 1PMNA 2V62A 3PY0A 3TI1A 4BDGA 1XH9A 4NL0A 2EWAA 4QMZA 5E8WA 5HG5A 3VBYA 3DKCA 2P0CA 1ZYLA 3I0OA 4R7BA 3PXQA 5CASA 2XVDA 3ZXZA 2IZUA 3IW4A 3E63A 4BIEA 3D7ZA 3FDNA 4CCUA 4AAYA 4H39A 2V7OA 4J97A 3MFRA 3GCVA 5GHVA 2ITWA 2UW4A 4QMYA 4YC6A 1FMOE 4ZJVA 3AC1A 1YI3A 2PZ5A 2YAKA 4LOOA 4XV3A 3QRUA 1R0PA 4XH6A 3TMOA 4GU9A 4QP9A 5C01A 4YPDA 3TNIA 2A0CX 1SVEA 2WD1A 3FY0A 3R8UA 2BHEA 4U42A 4TYGA 4X2GA 2YWPA 5BQ0A 5EOLA 2B4SB 2Z7LA 2VX1A 3L8SA 1ZOEA 3LXNA 4D9UA 1ZMWA 1UWJA 2QQ7A 2BVAA 3WILA 3EN9A 4LI5A 5HNBA 1TFFA 3TZ9A 5KNJA 2PUNA 3SRVB 3MGYA 3W0QA 3TG1A 5K0XA 3GBZA 3FQSA 4EKKA 3ZEPA 2R64A 3DXQA 3RVGA 1OL6A 4K9YA 4D1ZA 3JY9A 4U3YA 2VU3A 4OT5A 4ID7A 2VTOA 4BICA 4DG0E 1U46A 3ZM9A 4RJ5A 3R8ZA 4IFCA 5AUZA 5C27A 2ZYBA 4O0RA 3CTJA 4C2WA 1HCKA 2XB7A 5CU2A 3LQ3A 4D0WA 3OXIA 3P7BA 4ZLOA 1LEWA 1WBWA 4CT1A 2PUPA 1ZOGA 2PZPA 5E92A 3RNIA 2V7AA 1M2PA 1JBPE 1OKVA 2OK1A 3NRMA 5ETAA 2WKMA 4FZ7A 4D5HA 3RCJA 5EDRA 2QVSE 2JKKA 4FT0A 2HOGA 4GG7A 3ANQA 4JRVA 3EFJA 3PJ1A 4GK4A 4M84A 3PA4A 4RIXA 2XNPA 4FK6A 4D4SA 4EBWA 3ZH8A 5K0KA 2P2HA 4MXXA 4DITA 5M53A 3C5IA 3LKMA 3IK3A 4E4LA 2DS1A 3RWQA 1W8CA 1J91A 2YISA 4IXPA 4B0GA 4FV9A 3NZ0A 4WNKA 3DZQA 4L3JA 4QQTA 5L3AA 5L2SA 2WNTA 1L3RE 5FWKK 1A9UA 5D11A 3NUAA 4USEA 3UVPA 5FDXA 2CDZA 3CJFA 2X7GA 3FMMA 4JG8A 1NVRA 4WOVA 3RAWA 3R1YA 5CI6A 1KSWA 2QKWB 4IX6A 3Q60A 3RMFA 5BVFA 5IKWA 3HMPA 3QLFA 2W0JA 4P2KA 2C68A 3O71A 4I94A 4AWIA 5JRSA 1RE8A 3FY2A 3NW5A 3RHXA 2AC5A 5AUYA 3U87A 4BVUA 3UO6A 2IZRA 3ZEWA 5I3OA 1ATPE 4E20A 4E6DA 5CSHA 4K18A 3R9DA 4AXEA 2ZMDA 3EIDA 3LE6A 3KMMA 4CRLA 4DHJA 1XBCA 4UZHA 3MA6A 5FXSA 4RA5A 2ZVAA 1PXPA 4W4YA 4IVCA 5IISA 4NZWB 3CIKA 2UZBA 4UEUA 4XEYA 4BFMA 5KMKA 3C0GA 4O82A 1B39A 3C13A 3PXKA 3IGOA 5FBOA 3U54A 3C50A 3DPKA 4FICA 4CEGA 3P5KA 1QMZA 4HYUA 4MF0A 5FEQA 4BTJA 2XK3A 2DUVA 4RVLA 1ST0A 3PXZA 3CPCA 2ZM1A 4GIHA 3O8UA 3E8NA 5CENA 2VWWA 1YVJA 3VNTA 3KFAA 3W33A 2QLUA 3HA8A 5J9ZA 1VR2A 3GP0A 2J4ZA 3ANRA 5AX9A 4ZSLA 3E7OA 3GEQA 4M3QA 4G16A 4M7IA 5E4HA 2PPQA 2C6OA 5FDPA 1G8AA 4GW8A 4AT3A 3V6RA 4QD6A 3S2PA 4CD0A 3UP7A 4X21A 4FK3A 5I4NA 2QI8A 3D5VA 2SRCA 3O23A 4FF8A 5HG7A 3GNIB 3ODYX 4R1YA 4O7YA 1ZAOA 4PF4A 5HE1A 4FSNA 2NRYA 2C6TA 4TKSA 5EYCA 5I0BA 3MVLA 2WMSA 3Q6UA 3IDCA 4F0IA 5C8MA 3ZTXA 3ORLA 2CNVA 3O2MA 2X39A 2YERA 3NNVA 4FG7A 3BLHA 3TEIA 3TV4A 3NNUA 2YHVA 2AUHA 3IW8A 4FKRA 3VJOA 4BDHA 3NIEA 4AW1A 5BX0A 3QXPA 3M11A 5AP2A 4NK9A 3TJCA 2UW9A 4PPBA 1MQ4A 2CNUA 5HORA 3KVWA 4JG7A 4LFIA 4W4WA 4YC8A 3R7OA 3UQCA 3NLBA 4IAAA 4QMPA 1IR3A 4RJ4A 1YKRA 3Q53A 2XP2A 4P7EA 1IA8A 1OIYA 5ACBC 5EKOA 4F9AA 2W1IA 1GIJA 1H1QA 4ZTNA 3EN5A 2BPMA 3VRZA 4F6WA 4NYEA 4YPSA 3G15A 3LFFA 3TKIA 5C1QB 2HZNA 5KE0A 2X4FA 2BRMA 2R3LA 3QKMA 4MD8E 5IUIA 4XP0A 3RM7A 1BKXA 1XH5A 4E5WA 5I3RA 4UMUA 1Z9XA 2OH0E 3R1NA 4IM2A 4O2ZA 5JFXA 1REJA 3WBLA 3GCUA 2C5XA 4QTAA 5HCXA 3R0TA 3DBQA 4QRCA 3G6GA 3ZSGA 3O0GA 4H1JA 5J5SA 3ULIA 4FSQA 2IVTA 2VTIA 3OC1A 5A4CA 3B8QA 4OBOA 2NRUA 1XR1A 3W10A 4MF1A 1KE9A 3UIUA 3L9MA 2C6EA 5TT7A 4EH5A 4BIBA 4KS8A 5F4NA 3BYUA 3FLSA 5HLNA 5EW8A 2E9NA 3ZLSA 5HQ0A 4NUSA 2X6EA 3ENMA 3A60A 3LAUA 3P4KA 2B9IA 3ORMA 3DXPA 4H3BA 4IB0A 4QEBA 4UMRA 5IQFA 4YTFA 3R8PA 3PY1A 1YHVA 2R3FA 5AP3A 3C0IA 3T9IA 4FG8A 2J5EA 3SXSA 2QOKA 2OJIA 2W4OA 5HHWA 1PHKA 3OTVA 5JGDA 4RX7A 4D2PA 2PMNX 1Q5KA 5CLPA 3MJ2A 4FIJA 4NU1A 4C02A 2XNOA 1KV2A 3EQPA 4K0YA 1FINA 4YJPA 4C62A 1GZ8A 2ACXA 4EBVA 4FZAB 2XZSA 5J7HA 3I81A 4M67A 3BHUA 3T3UA 1IRKA 2YM6A 3UQFA 2XK8A 2OXYA 3RPYA 4XV9A 3EN6A 2ZV7A 2WU6A 3TUBA 1GZNA 3QALE 2BCJA 3V04A 3EJ1A 4X3FC 1KWPA 1VEBA 2R3JA 4F6UA 4ITHA 4DGLC 3D94A 3WIKA 3WZEA 3KVXA 4L9IA 3M42A 3E7VA 4WRGA 4DFLA 4FV6A 5FP5A 1LEZA 3LZBA 4YZMA 4FVQA 3BZ3A 3CCNA 4U3ZA 4X7QA 3F3TA 4CTBA 2CKPA 4S31A 1OPJA 5C8KA 4DA5A 4CNHA 1OGUA 2GCDA 2XBJA 3A7IA 4UWBA 3GB2A 1XO2B 3TTIA 3N4VA 4PL3A 5IU2A 5LVLA 1NA7A 1P4FA 2R0UA 2R3NA 3L8VA 3A7FA 4F9WA 1H1SA 5JSMA 4XNEA 4H36A 4U97A 4R5YA 2ZDTA 4FG9A 5KCVA 3R04A 4X2FA 1Q61A 5EM5A 1SZMA 4FODA 4EOLA 2A1AB 2J50A 3LM5A 3D5WA 2FSOX 3NCZA 3ZFXA 2R3RA 5A54A 2VNYA 4BKJA 4U5JA 4X3FA 4OUCA 5DT4A 5LJJA 1OL1A 4FTUA 2YM3A 5BVKA 4ZZNA 4YHTA 2GNHA 4FNWA 5E7RA 4I5HA 2C3IB 2WQBA 2C5VA 3VW8A 3VHEA 4MK0A 5LWMA 3H9OA 4QP1A 5AP4A 1H01A 4QNYA 3MTFA 4GUBA 2BHHA 3QRIA 4KB8A 4NW6A 3RM6A 3WF9A 5J8IA 2VUWA 1BI7A 3CLYA 2VD5A 5CY3A 1H1PA 1JWHA 3AT4A 4UX9A 1V0BA 3MESA 3ZSHA 1H1WA 5K4IA 3FMLA 2J2IB 4FYOA 4EZ5A 2JGZA 2VO0A 3EMGA 3NVKI 4AA5A 2XALA 2W9FB 5BVWA 4JT3A 5IH4A 3I6WA 5D12A 4C38A 5IUGA 3AGLA 3I4BA 5CXHA 4RFYA 1OUKA 3QRTA 2O8YA 5J7BA 3G5DA 4TWPA 3ORKA 3CD3A 4BHNA 4FV0A 3IECA 4GKHA 4K77A 3PPKA 5HCZA 2AEGA 4N57A 2XNBA 4E4MA 4F4PA 4DLJA 1ZMVA 4YNEA 5BVNA 2XARA 1OKWA 2OSCA 4QMMA 4BCPA 4DEGA 4AP7A 3ZO4A 4YTIA 4MXCA 3GQLA 3MB6A 4RJ7A 4QPSA 4LRMA 5ANKA 4FTAA 2PWLA 3CJGA 3WE4A 2X0GA 2EVAA 4GYGA 4W4XA 2EUFB 2OZAA 4HVIA 5HESA 2GDOA 3R02A 2DWBA 2OJJA 3QAME 2GNLA 3QCXA 4DEIA 4AZEA 2VGPA 4EK6A 4ZMFA 5M09A 3E5AA 3EQBA 3DKOA 1R0EA 3Q9ZA 5HG9A 4EZ3A 4XYFA 5JKGA 5F95A 2F7EE 2ZMCA 3MPMA 3PIXA 3UVRA 4C2VA 2OJFE 3OCTA 4EKLA 2E2BA 4HCUA 1SNXA 3GC8A 4IAFA 4Q2AA 4FZ6A 3P08A 3UYTA 4KABA 4ASXA 3Q4UA 3CKXA 3TV6A 2AC3A 2BRHA 3GU6A 3KXNA 4NKSA 4O2PA 4Y8DA 4DH1A 4HOKA 5A4TA 3S00A 5IQHA 3QQGA 4YO4A 4PP9A 5J1WA 3QD0A 4YNOA 5HLWA 5TE0A 3MYGA 3SD0A 4PDYA 4QP3A 2HZ0A 2C3KA 2VTHA 3CQUA 3LJ0A 3PVGA 4KD1A 3RAKA 1B38A 3JUHA 5LCKA 4NKAA 2YDKA 3GCSA 3QCSA 2JDTA 4GK2A 5M4IA 3QGWA 2ITVA 4OW8A 5B0XA 2RSVA 2YJRA 4D1SA 2A98A 1JQHA 1OI9A 5TKDA 4CCBA 3A7JA 2YACA 3TYKA 2IG7A 4CG8A 4Z9LA 2PVRA 3BCEA 3FMJA 4L67A 5F1ZA 3TIYA 1CMKE 4ZY4A 5AM6A 3VRYA 4XHKB 2Q0BA 1YOJA 4TYJA 4CRSA 2XAMA 2IJMA 3BLRA 4LYNA 3THBA 3P5JC 4DT9A 1H24A 4R1VA 4RVMA 1OKYA 3DGKA 3AMBA 2C0OA 5M4UA 1OPKA 4S34A 4EH7A 1WFCA 4F09A 4YGAA 4BN1A 4RGJA 3DXNA 4BC6A 5JQ8A 1SYKA 3AC4A 2YZLA 4RBLA 1NY3A 2PE2A 3EZVA 4HGLA 3R73A 3ZUUA 3LFQA 3NFFB 1ZLTA 4PDPA 2XAOA 1WVXA 5CAQA 4YZDA 1PY5A 5KMLA 3QZFA 4BCKA 2JAMA 4AW5A 4DAWA 5EYDA 3QA8A 2R0IA 4E4NA 2GFCA 4QQ5A 1BL7A 4JR7A 4ANOA 3UIXA 3HEGA 3S4QA 3BYMA 1Z57A 2XKDA 3LLTA 4W9WA 3UVQA 3LXKA 1ZY4A 2J0IA 2YCSA 2YDJA 1CDKA 2HZ4A 4AZTA 3FZ1A 3MFTA 5IMEA 4R77A 2PZRA 1BMKA 4L43A 3JXWA 4GMYA 4CFUA 3PPJA 3GC7A 4DINA 3CEKA 4ACCA 4XG7A 5C26A 3U6JA 2VTMA 2IZSA 1OL7A 3Q5ZA 3FZOA 2XJ0A 1WAKA 1KUTA 2W1CA 4RC3A 1G8KA 1F3MC 5DT3A 4IE9A 4OTWA 3F88A 4R3RA 4TRLA 5HIEA 2W9ZB 4HCTA 4MQ2A 5LVPA 3ZO2A 3FLQA 4PPCA 3DKGA 4BDJA 2CN8A 3R21A 5ICPA 3HZTA 4XBUA 2QONA 3D5XA 2QO2A 4FA2A 1UKIA 5E9EA 3ORTA 3OW4A 1T46A 2RF9A 1PKDA 4FSTA 4QTCA 5CNNA 1LP4A 4E3CA 3NWWA 3W1FA 5KMIA 4XV1A 1JKLA 4HCVA 4C37A 4CYIA 2BUJA 3N9XA 3OWLA 5CF8A 3PPZA 4RIOA 4U9AA 1M2RA 4ZTRA 4AZFA 5IUHA 3SA0A 2NP8A 3TUCA 1OIUA 2R3MA 5K5NA 3R9NA 4FZFB 3F82A 4PWNA 4L00A 3U4UA 3LMHA 4L01A 4WUAA 3MFSA 3R63A 4M0ZA 5AUWA 4BCOA 4IB1A 4FTMA 3RAHA 5J5TA 1FVRA 5DT0A 4ZZOA 4BIDA 3GU7A 1IAJA 3QWKA 2X9EA 3D2KA 2PZYA 5AR8A 2VWIA 5FBNC 3DB8A 4IADA 2VTPA 4ZJJA 4BDAA 3GOPA 2EB2A 2CPKE 4A4OA 5JN2A 2WU7A 4TY1A 2ERZE 3W2OA 4A9YA 4CMUA 3LFDA 4NJ3A 4Z3VA 3FPMA 4U81A 4X0MA 4EI4A 3CC6A 4GUEA 5K4JA 5CT7A 2UZDA 4UMTA 4DHFA 1W82A 1URCA 2YIYA 2W17A 4H1MA 5IQIA 4A4LA 4AQCA 2RG6A 4NSTA 4AZWA 1JSVA 1J1CA 1IASA 4Q9SA 3EB0A 5AP6A 1CKJA 2WTWA 4YJVA 4BJJA 1W7HA 3KK9A 3VS5A 3NYVA 4LRKA 3AT3A 3D7TB 2PZIA 4O6LA 4BDCA 3QD4A 5HD4A 4L42A 3A61A 1YOMA 4L68A 4O7LA 4O7RA 1JSUA 3QA0A 4J8NA 1FQ1B 3QGYA 2VGOA 2ITOA 4E7WA 4BI2A 3DOGA 2I0EA 4X2KA 2PVFA 4GJ2A 2O3PA 3OT3A 3ZZEA 4BZOA 3FC1X 5DMZA 5LMBA 3ULZA 2ZFYA 3UTOA 5AFVA 2OF4A 2BZHB 1Q3DA 2ZV9A 3Q5IA 3JVRA 2CKOA 4I22A 4XG2A 4IZYA 3CP9A 2P55A 1HOWA 2BZKB 2LGCA 3DAKA 3P78A 1VZOA 4LUDA 3F7ZA 5A46A 5A4QA 5CAVA 1OITA 4RQKA 1R39A 2WEIA 4FNZA 1ZY5A 3Q2MA 5E8SA 3T8OA 4KUJA 4AA4A 3C51A 3ZLYA 5A4EA 3LQ8A 3R2YA 4ZTQA 4QMTA 3ROCA 4DG2E 5F20A 4W4VA 4AT4A 2GU8A 3KK8A 5HNGA 4JIAA 4Z7H