5AR3A

Rip2 kinase catalytic domain (1 - 310) complex with amp-pcp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
305
structure length
279
Chain Sequence
ICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMGGTIIYMPPENYASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
total genus 87
structure length 279
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar3A00
3BGQA 3WF5A 3GFWA 1Q8ZA 3O71A 5GZ8A 1PXJA 1PXMA 3Q32A 1OL1A 5AWMA 4N0SA 3O8TA 4NM5A 2AUHA 4AFJA 2PZIA 2BAQA 2VO6A 2XK9A 2CGXA 2YJRA 4FTCA 5AP2A 3W2OA 4BBMA 2ITPA 2O64A 5F1ZA 5IG1A 4PL5A 5AV0A 2VTRA 5HD7A 3PWDA 2X4ZA 1JBPE 3RM6A 4IVBA 2RGPA 3QRIA 5EH0A 1MQBA 2WMRA 3DAEA 3U4UA 3UVPA 1JKKA 3VULA 1E1XA 3QA0A 3RJCA 4MQ2A 2YWPA 2BVAA 4IDVA 2OH0E 2X1NA 3T8OA 3U6IA 2O8YA 4RWJA 2XIYA 3TT0A 3AC4A 5A14A 3SKCA 5CSWA 2ETMA 3ZSGA 3FZSA 3IS5A 5CQWA 3RAHA 4DAWA 3BI6A 3NR9A 1U54B 3MH2A 4FV7A 5AR8A 2OF4A 3NIEA 1KE7A 3UP7A 5EDQA 3GBZA 3M42A 3DU8A 2BFXA 3BHHA 3ORXA 3VS4A 3Q4ZA 4Y83A 2YJSA 3TZ8A 4E93A 4XG7A 1UWHA 3MA6A 4I5CA 4ITJA 2WOTA 5KMMA 3HX4A 4TWOA 4W8DA 5HEZA 3F66A 2ZM1A 3TKUA 4EORA 3IONA 4EZ5A 4G6LA 4RIYB 4E8AA 5CF6A 4CD0A 4W4VA 4C35A 2QR8A 1Q8TA 4EYMA 3PFQA 4F0FA 5M4UA 1IR3A 3K2LA 2BDFA 4YJOA 5HNIX 4LUEA 3E64A 4QPSA 3HLLA 3R9NA 3HV6A 3ERKA 1NVQA 2QG5A 4FTMA 4H36A 2W17A 3MWUA 2X6DA 3O0GA 4JX3A 1OI9A 4CRLA 3D2IA 3DQXA 4ZS0A 4YGAA 5GNKA 2PVFA 3AC2A 3HUBA 3NPCA 3U4WA 4FIIA 4UWCA 3R71A 4BFMA 4CZTA 3IW6A 4ZZNA 5I9VA 3ZS5A 1PMUA 2C5XA 3GUBA 3CTJA 3VUHA 4D4SA 2WHBA 2O3PA 1SMHA 1VJYA 3BU3A 4A9RA 4QO9A 2CLXA 5KUPA 4YJNA 5D7AA 3OUNB 3UOHA 3VO3A 1F0QA 2G2FA 3NIZA 2ITWA 3M1SA 4QYHA 3DJ7A 2QOCA 3EFJA 3D7ZA 5AR3A 5BX0A 1PF8A 2Z8CA 4G6NA 3A60A 5JT2A 4WIHA 2XB7A 4ID7A 4QMUA 4S30A 4Y46A 3ORPA 4F6WA 1Q5KA 1JSUA 4BDJA 4HGLA 4RC4A 3GOKA 5CU6A 5K9IA 4JRVA 4OGRA 1AQ1A 3MPAA 3UVQA 2X0GA 2PVJA 3MA3A 4EOMA 3IW7A 4EJNA 3EZRA 1H1RA 1T45A 1ZYJA 5JK3A 4CKIA 4G9CA 5CU3A 1WFCA 3NNWA 3F3UA 3D5XA 3QHRA 4L7FA 2QHNA 4Y95A 3IG7A 1O6KA 4B9DA 5BUIA 1M17A 4FOBA 3IDCA 2ITZA 1GIIA 4YO6A 4M66A 1YXTA 4IBMA 4D2WA 1H0WA 2VTTA 3LAUA 4M67A 4BN1A 4GT4A 3QGWA 4U81A 3RPVA 2UZBA 5EHLA 3VUMA 3V8WA 4EH6A 2BRMA 2HW7A 2YAKA 4RJ5A 5CXZA 3JY9A 1KE8A 2VTLA 3RGFA 4KIKB 4G6OA 4GT3A 4X7QA 5E8XA 1FMKA 1XBBA 3W2PA 3DAKA 5G6VA 5ITAA 3K5UA 2H34A 5CEPA 3DFAA 4UZDA 4IDTA 3UPXA 1OIRA 3E88A 5HX6A 4DHFA 3KK8A 5JZJA 2GHLA 2UVZA 4N70A 2VTQA 3UPZA 3V6SA 2YISA 5DOSA 3VS2A 4CYJA 3GCUA 4TYHB 4DEAA 4KB8A 3RAKA 3QC4A 2WQOA 1NA7A 3NWWA 5M4IA 4USEA 3SVVA 5E1EA 1LPUA 3CKWA 1WBSA 3OFMA 4JG8A 5FXQA 3VC4A 4UEUA 4DGNA 3QTUA 3VW8A 2A4LA 1YRPA 4I6BA 4QQJA 3WE4A 4MBLA 3ZDUA 2F57A 3OWKA 3LVPA 5A54A 1DAWA 2XCHA 3QUDA 4GFOA 4CLIA 2XK7A 4PL3A 3TTJA 4CKJA 3RBWA 2WQMA 4IB0A 5HCXA 3BHVA 4QMXA 4AW0A 5FEEA 4E6QA 1ZWSA 5EYKA 4L01A 3R7VA 3FY0A 4NIFB 3RALA 5DEYA 4EUTA 3KC3A 4JNWA 4PQNA 3LXKA 4GFGA 5DRDA 1G5SA 4MTAA 5HU3A 3MYGA 4HYIA 3DK7A 3GC0A 4QMPA 3ZRLA 5A4CA 5DT3A 2YCSA 4Y5HA 1H24A 4QMVA 5D7VA 3WZKA 4GMYA 4DH3A 4BCJA 3NRMA 1R1WA 2JITA 4D2TA 3SV0A 4D0WA 3PJ2A 4EZ3A 2V62A 4DTKA 4R6VA 4CFVA 3LJ2A 3BU6A 4UXQA 3FQHA 4FV0A 3EQDA 2IJMA 4EH9A 4P5QA 4TKSA 4HYSA 2R3MA 1ERKA 3TIZA 3FV8A 3KRLA 5AX9A 5DEWA 4CV8A 2UZNA 3HUCA 4BDHA 3KQ7A 4I4EA 2ZB1A 2W1EA 4K11A 1ZRZA 2UW9A 5DHJA 5EI8A 5KMNA 3ZCLA 4AGCA 3SD0A 4L6QA 3BEGA 3JXWA 4QTCA 4TZRA 1IRKA 3VUKA 2ZV8A 2BRNA 2R4BA 4YBJA 5CXHA 3H0ZA 4OTIA 5ACBC 4D0XA 4BVUA 5CANA 3UJGA 4FKLA 5BMMA 4KWPA 3KXXA 4FA2A 4GG7A 4MBJA 4AOTA 2VTOA 3EN4A 3PZEA 2RG6A 2QKRA 1KOBA 3IKAA 4X2JA 1F5QA 3O50A 2JKOA 1DI8A 5CSVA 2H96A 5HO6A 4A4XA 4CT1A 4B4LA 2IVVA 4F9CA 5EKOA 4FG7A 4GFMA 1YOJA 5KZ0A 3ZZWA 4BKZA 4BWPA 4IX4A 3DZOA 4RX8A 2XYUA 5ANDA 5GZ9A 3FZTA 3E5AA 4ZJVA 4QTEA 3GQIA 1P14A 3K5VA 4MF1A 4BWKA 3V5LA 1WZYA 2YM3A 5BPYA 4YZ9A 2XIRA 5K0XA 3VS3A 3R7UA 4DH8A 4EHEA 2IZTA 5KX8A 2X6EA 3S95A 3DK6A 3R9HA 5I0BA 2UW8A 3ZDIA 3OY1A 3H4JA 3FMHA 5LMKA 3I5NA 4JR7A 3EYHA 4U45A 5FBOA 1F3MC 5AV2A 4TYJA 4G3GA 2WMVA 4YJVA 2FYSA 5AV4A 3G0FA 4PMMA 3QD3A 5EM8A 4YC3A 5FDPA 4NH1A 2V55A 3PJCA 5FEQA 2WTWA 2SRCA 4BI2A 2WKMA 3NYOA 2HIWA 3V51A 3BYOA 5ANEA 5F4NA 3HZTA 3G5DA 4EH8A 5AM7A 3GP0A 3ACKA 4FT5A 4ANQA 4U6RA 4H1JA 3UQGA 2YLFA 2QI8A 3QLGA 2O63A 3K54A 3I5ZA 4C02A 3VUTA 3HGKA 4AQCA 4YP8A 1BKXA 4RWIA 4ZTHA 2X39A 4O0RA 3A99A 4U97A 5ANIA 4C8BA 3D7TA 4RLLA 3F9NA 3QFVA 3FZRA 4GEOA 1A06A 2UW6A 4M97A 3CY3A 1RW8A 3VHEA 4C61A 2VTAA 3D0EA 3ORLA 4DFZE 5CZHA 2XK4A 4WD5A 4O21A 5CU2A 2EWAA 1CM8A 2OBJA 1YI6A 1W8CA 2X7FA 4GH2A 4FC0A 4EZ7A 3VIDA 2IZRA 3E63A 3PJ1A 3BBTB 3DZQA 2FSMX 5E90A 3MVMA 5CEOA 4NSTA 1FVVA 2WTKB 4ZSLA 5AAGA 5IU2A 1BL7A 3PY1A 4YR8A 4RZVA 2Z60A 2XJ2A 4TRLA 2QOOA 4IX5A 4FTTA 2Y0AA 3LQ8A 3HDMA 4WT6A 3CP9A 3A7HA 2X4FA 2ZV2A 2BIYA 2W1ZA 2F9GA 4EH5A 4O0SA 1YI3A 3R7OA 1JNKA 2WEIA 2UZDA 4OTPA 3Q3BA 4BB4A 3SRVA 5IF1A 1BI8A 3QQLA 5KMIA 1DAYA 4L00A 2WQNA 5E7RA 4IVCA 3W1FA 5KMKA 4BDKA 3MFUA 4CFNA 3MFRA 3NCGA 1UNGA 3BHUA 5E1SA 5JZNA 2C30A 3Q2MA 4IVAA 4FIHA 3AT3A 3ZUTA 5B2LA 5TT7A 3NW7A 4ENXA 3I6UA 4IJPA 4FSMA 1Y8YA 4HVDA 3OCSA 4BDDA 4H1MA 4YUQA 1YQJA 2C69A 1SM2A 3D4QA 3KXNA 4HW7A 1YW2A 1J1CA 3GENA 1R78A 2HW6A 4F7NA 4U3ZA 5J1VA 2R3JA 3HNGA 4RIWB 4FUXA 3LE6A 4EBWA 5HGIA 1JAMA 3FQSA 3UBDA 1L3RE 4QD6A 2GPHA 4U40A 2EXEA 2JGZA 2ERZE 2CJMA 4MXOA 1VEBA 3ZLXA 4F6SA 4IAAA 3WIKA 3NCZA 3RAIA 4BCMA 5CYIA 2B52A 4FK3A 4AOIA 5HBHA 3EN7A 3ZXTA 4ASXA 2VRXA 5AIKA 1VYWA 1WMKA 4J7BA 3QCQA 4GUBA 3MBLA 5E91A 2OZAB 5AP6A 3F5GA 1K9AA 3QX4A 5LJJA 3G90X 3I1AA 4D2RA 1H27A 2W1IA 4G17A 4M7IA 3C1XA 5HVJA 3KN5A 5JKGA 2B9FA 5C03A 5H3QA 1REJA 4DEHA 3UOJA 3FYKX 4FKOA 1S9IA 4L8MA 3HV5A 4UN0C 2C1BA 4JQ7A 1OL6A 3OT3A 4WUNA 3AMBA 3WZUA 3L8SA 1XJDA 4FZ7A 5D1JA 3L8PA 5T3QA 5M44A 2XNEA 1R0PA 5CU0A 5CI7A 3U6HA 2CDZA 3KMUA 5E8WA 1W82A 4OTFA 5HG7A 4MD8E 4S2ZA 1FVRA 5AP7A 3ET7A 4DH1A 5M51A 5L2IA 2VX1A 2YIXA 3DAJA 4ZK5A 1JWHA 3CPBA 1PJKA 3KU2A 4PTGA 2BROA 1FGIA 2CN5A 5BVNA 2GS2A 4ANOA 4EOQA 3FMDA 3Q5ZA 4F1OA 3AG9A 3QGYA 4IWDA 2BILB 2RSVA 3O96A 4ASDA 2BALA 1QMZA 2W1DA 3MS9A 3GI3A 2WAJA 1Y6BA 2R3KA 3QLFA 4L44A 5M57A 1BMKA 2B9IA 4ANMA 4AOJA 5J9ZA 2YEXA 2Y6OA 3NUSA 4I24A 2R3FA 3UTOA 3VUGA 5C27A 5DLSA 4BI0A 5GJDA 5A4LA 4P5ZA 3V5TA 4ACHA 1H01A 2YACA 4NJ3A 2HWPA 4HNFA 4TYHA 3FLZA 4HOKA 4RC3A 4AZWA 2DQ7X 5HTBA 2BPMA 5TKDA 4PY1A 3WI6A 2YIWA 4O0TA 4CTCA 4PDPA 5D41A 3H30A 4G5PA 2GS6A 4EQMA 3EL7A 4QTDA 3E62A 3QRJA 4MNEA 4YBKA 1GOLA 1M14A 4TW9A 2PMIA 5A4QA 5I4NA 2VO0A 4FVPA 4JRNA 2UVYA 4KSPA 2YIQA 4ZTRA 2CHLA 4M84A 3RHKA 1W84A 4XBUA 5BVOA 2BKZA 4B7TA 5FLFA 4DG0E 3EL8A 3AXWA 2PVRA 5TO8A 3PG3A 3VBVA 2VTNA 4AAAA 3P86A 1YHWA 3NUPA 3Q6UA 2QOQA 3BEAA 1OGUA 3C4CA 4FTIA 4BIEA 3WF8A 4Z7HA 4CRSA 4AF3A 3R8ZA 4MXYA 3NUYA 3ZHPC 5D11A 4J95A 4NKAA 1PW2A 1ZOEA 3DKCA 4YHJA 2XK8A 1MRYA 4KINA 3DXNA 4J1RA 5T68A 5I3OA 3L9PA 1E9HA 4U7ZA 2XJ1A 4F0IA 2JIUA 2R3LA 4IAZA 3RZBA 2CLQA 2A27A 5EG3A 4XLIA 1ZY4A 1M2PA 2FUMA 5CT7A 1UNHA 4RIXB 3IPHA 3PUPA 2I40A 2UW4A 3C51A 4IWQA 3R1NA 1TQIA 4NM0A 1ZZ2A 5CEQA 4CYIA 2XYNA 3WIGA 3T9TA 4D2SA 1JVPP 4OTGA 4FV2A 3BE2A 5CVFA 2QU5A 2R3IA 2OFUA 1WBNA 2CGVA 2PE1A 3LCKA 3PIZA 3QAME 4ZTQA 3ZLSA 3BZ3A 3AGMA 5AM6A 2VZ6A 4JAIA 2W1GA 3F5UA 2ZMDA 2P2IA 3QD4A 3WZJA 3HA6A 3NSZA 2ONLA 4LV8A 5AMNA 3V04A 2PVNA 4LMNA 3KB7A 3WF7A 4FZAB 4I6FA 4E73A 1Z9XA 2BR1A 2EUFB 4FMQA 4ZY5A 5HNGA 3CQUA 4NFNA 4AT5A 2I6LA 3FMEA 4L9IA 3OVVA 1FGKA 4R3RA 5LWMA 1GZNA 4YC8A 1SZMA 3CQEA 4IANA 2CMWA 1ZAOA 3PA4A 3RMFA 4F64A 5IUHA 3M2WA 1HCLA 3RNYA 3UNJA 5IDPA 2VO7A 2X2KA 3IOPA 3R7IA 4R1VA 2WMUA 4CZYB 3S4QA 4G3CA 4BICA 1H8FA 4BGHA 4RJ6A 5AP0A 5HBEA 3S2PA 1MQ4A 5IA3A 3LXPA 2XRWA 3O17A 1PXOA 4I6HA 2XEYA 1ZOHA 4JXFA 3GNIB 3TNWA 2FSLX 4EEVA 2C5YA 1SVHA 4XV9A 1TQMA 4D1ZA 2OXDA 3NNUA 5FTQA 5ICPA 1YI4A 2Y8OA 4FL1A 4M14A 4U42A 2R3PA 3IDPA 4Y8DA 1YDTE 4L3PA 4UY9A 1SYKA 4BGQA 1V0BA 4FT0A 2ZOQA 5JRSA 1H07A 2YFXA 2X9FA 2B54A 3D5UA 2F2CB 2VN9A 3MFTA 3R22A 4DFLA 1K3AA 2R0IA 5I9ZA 2OW3A 4FV5A 3BCEA 3ZM4A 3F69A 3QTXA 3S00A 3W18A 4FKPA 4C57A 2RG5A 2YM5A 5CQUA 4YZDA 4FV9A 1H00A 2YLEA 5IH5A 4IIRA 4YLKA 5HI2A 3FMLA 5HNBA 5JQ5A 4MKCA 3UVRA 3H0YA 3MTLA 2ACXA 4D1SA 5LWNA 2V0DA 4ANNA 4PUZA 4KA3A 3ZUUA 5CAVA 3A7FA 3OZ6A 4O91A 4YTFA 3EYGA 3GU7A 1UKIA 2IO6A 4LOPA 3ZO2A 1NXKA 4C3RA 4DGLC 3ZBFA 5LMAA 4P2KA 5E8YA 3UIUA 1NVSA 3EQCA 5BVFA 4FG8A 4ZOGA 5IEXA 2C0TA 4BCNA 2XA4A 3UYTA 4JOAA 1YWRA 4UWBA 3WZEA 3KULA 5TR6A 5DI1A 1OUYA 1FINA 2VUWA 4I92A 2J9MA 3SXFA 4EOLA 1FOTA 2GNFA 4N6ZA 4RA4A 4XUFA 4EC9A 1GY3A 1LEZA 2BAKA 3FLSA 4HCUA 4APPA 5K5XA 3F2NA 2J6MA 4V0GA 5D12A 4DYMA 4KBAA 4E4XA 2EXCX 4ZTNA 1H1PA 4O0YA 4C62A 3BELA 3CR0A 3G9LX 4QMNA 2BAJA 3PP1A 3QZIA 2F2UA 3ROYA 5IISA 1Q62A 3TNPC 4FIEA 3E7VA 4YLLA 5CEKA 2BTSA 4W4XA 4M69A 5F9EA 4FKTA 2YDIA 5J5TA 3EJ1A 5L2SA 5CASA 3FLYA 3GCVA 5HCYA 2WTVA 4F7JA 2QOIA 5L3AA 4TL0A 3UIBA 3NS9A 4FTNA 5M4CA 3AD4A 3VF8A 5DR9A 5GJFA 3LFQA 4FICA 5HG5A 3NW5A 1MP8A 5IA4A 4FKUA 4DFYA 4GU6A 1X8BA 3REPA 4MF0A 5HE0A 2BZIB 3BX5A 4OT6A 3ZMMA 2OWBA 4C33A 4RVLA 4Y85A 4ZSEA 3LCDA 3PE1A 4W4WA 5KZIA 4CFFA 2X8EA 4D28A 3E93A 1T46A 4WG4A 5CENA 3VF9A 4FVRA 4ITHA 2C0OA 3EQFA 4AA5A 2VU3A 2HZ4A 4ARKA 3TZMA 2XIZA 4CXAA 1ZOGA 4RGJA 4D9TA 2IVUA 3IO7A 3PA5A 5LVNA 4FIFA 4YC6A 4EK5A 4MEDA 4CFMA 4J98A 5J9YA 1DM2A 5EM5A 4TPTA 4L45A 4GK4A 4F6UA 3OXTA 2JIVA 3LZBA 3GU5A 4TTHB 4WBOA 5AIRA 2GNLA 2VTJA 4R8QA 4JL9A 4AN3A 5JFWA 5LMBA 3V5QA 2GSFA 3VRZA 3AC8A 3ZH8A 4XHKB 2VNYA 5HLPA 3I7BA 4E5WA 4Z3VA 5KBRA 2X7GA 4YPSA 2W06A 3NUNA 5IMXA 5ANKA 3VHKA 2CKEA 3VBQA 2X2MA 4E7WA 4WNKA 2RIOA 4BDIA 2ZM4A 1KE6A 1UU9A 4JX7A 3R1SA 2CPKE 4F70A 2R3OA 3CJGA 2IW6A 5AV3A 4B8MA 3I4BA 5KKRC 3MY0A 4FTKA 3LMGA 4IZYA 3E3BX 3KRRA 2WFYA 1JLUE 2UZOA 1I09A 3BRBA 4MQ1A 3R1QA 4AG8A 1P4FA 3E8EA 2RFNA 3FPQA 4AE6A 2J7TA 4MHAA 4FTOA 5H8EA 2XH5A 2YCFA 3AC5A 3HV4A 5CEMA 4FSQA 4XLVA 3G9NA 5K3YA 4XEYA 1BL6A 1XH8A 2I0YA 3LIJA 4L53A 2XNGA 3UIXA 2NRYA 2QLQA 3LOKA 3R00A 5ANJA 4HNIA 2BZKB 3FUPA 2OZOA 2GNHA 3BPRA 3BGZA 3H9RA 3FXZA 2R9SA 3A7GA 2OXYA 5I3RA 3F88A 2YIYA 1WAKA 4I93A 3BLQA 2EXMA 5CF8A 4QTAA 2WU7A 2YCRA 3LCOA 5JSMA 4U80A 3ORZA 2VTSA 1B6CB 3A4PA 2PMLX 3QUPA 3SW7A 3W32A 4EONA 4N6YA 4PMPA 3FLNC 5IUGA 1OECA 2Z7RA 3FC2A 2XNOA 4IZ5A 5FGKA 1OKVA 5CWZA 3UYSA 1H1WA 5L6WL 3EQBA 3RAWA 3QXOA 1WVXA 2UW7A 3GC9A 1P5EA 4R7HA 4C37A 1XQZA 2JDSA 3F2AA 4FK6A 3QKMA 5FM2A 5AUYA 4DCEA 4FSZA 2JDOA 3ZTXA 5IA1A 5HIBA 4BDEA 4ZJJA 3A7JA 4X2FA 2JKQA 4L67A 1E1VA 3OW3A 3P7AA 4RFMA 3W2SA 2B9JA 3HV7A 4AXAA 4J8MA 1OL5A 3CC6A 1WBTA 5ETAA 2R3RA 4KKHA 2IW8A 2PL0A 4J53A 1OPJA 3E7OA 3CGOA 3PSCA 3QRKA 2HOGA 5C01A 4PRJA 3QALE 4L52A 2OI4X 3DLSA 4EH2A 3U9CA 3CQWA 2PVHA 5B0XA 1GZOA 5EW3A 5FG8A 4JG7A 3TEIA 2W4JA 3ETAA 4X3JA 3C0IA 3IGGA 5LCJA 5DPVA 3Q96A 5J87A 2FSOX 3ULZA 4DG2E 4YMJA 3ZYAA 1PKGA 4IVDA 4OTWA 3NGAA 4P4CA 4U8ZA 5HOAA 1XBCA 1O6YA 2HAKA 5JFVA 4M12A 4MXCA 2ZVAA 2W1HA 5EM6A 3IDBA 1OKYA 4RJ7A 4FTUA 3LCTA 3OY3A 3W8QA 2XJ0A 2ERKA 2J51A 3DCVA 1UVRA 3I0OA 4RWLA 3RINA 4AGWA 3BQRA 4AZVA 1ZY5A 3MVHA 5DN3A 3VWAA 4QQTA 2J0IA 2DUVA 4W9WA 2ZDTA 2UVXA 4GCJA 1H28A 2OFVA 4AN2A 5DNRA 4EOJA 4APCA 3V8SA 4A9TA 4GW8A 3UNZA 2JD5A 3FJQE 2R2PA 4QP6A 3OCBA 2XMYA 4P90A 4OBOA 5AP5A 2G9XA 4FI1A 3R8LA 3R63A 1HOWA 3R04A 2HZ0A 5AUTA 1ZMUA 2J0JA 3Q60A 4S34A 4XP3A 2WTKC 2W05A 4E6CA 4X3FB 1LEWA 2PY3A 3I60A 3ENMA 3QBNA 1ZYSA 4KBCA 4QP7A 5G1XA 5F95A 2OZAA 3VJNA 5JGDA 4QP9A 3EKNA 4LGHA 3TKIA 4PMTA 4QYGA 4HVGA 2HYYA 4ZSGA 2X8IA 4XG3A 3QTWA 2XRUA 1RDQE 4QMTA 3UZPA 3FWQA 1H08A 3NYVA 3F3VA 5L8JA 3CTHA 4AT4A 4JS8A 2R0UA 4EKKA 4LOOA 3HMNA 2UZEA 3C4ZA 3BV2A 3QTQA 3WILA 4Y73A 3DDPA 4TN6A 3F7ZA 5HE3A 2OJGA 4U0IA 3TACA 5I9XA 4CFUA 3NX8A 4EK3A 1PMEA 4O1OA 4BBEA 5EDRA 3OTVA 1R3CA 5H8GA 2OSCA 1PXNA 2GFSA 3NZ0A 5CVGA 4LGDA 4UYNA 4NZWB 4JAJA 1W7HA 2AYPA 3T9IA 5K4IA 4FKGA 4XG6A 3WOWA 4R3PA 3RCJA 5HX8A 3VRYA 2B7AA 3TN8A 4AZSA 3A62A 4F7LA 4P7EA 5FP6A 3QQUA 5HVYA 4HVIA 3R83A 4XJ0A 5HZNA 3OOGA 4R3CA 2ETRA 5E8UA 3OC1A 4LRMA 5FD2A 4WNMA 3R2YA 4FR4A 3GCPA 4HVSA 1VR2A 3LLTA 2ITTA 2JKMA 4D4RA 3LXNA 4NFMA 4PPBA 3G51A 4QPAA 5CU4A 3U87A 4AE9A 4BWXA 3SAYA 3MW1A 4NK9A 2R3NA 5CEIA 3BYMA 3KF4A 4FSRA 4UYAA 4AN9A 2OGVA 2QODA 2GU8A 4AW2A 1PKDA 4F08A 2PZ5A 3ORIA 1RQQA 3QQKA 4YNOA 3AC1A 2NO3A 4O0VA 3UMXA 2G01A 4MVFA 3VS1A 3GC8A 1NY3A 2C5NA 4Z16A 1YWVA 1VZOA 4BIDA 3FKOA 3KMMA 3PE2A 3ZO4A 2XF0A 4ZLOA 3JS2A 4G5JA 2ITNA 2HY0A 3EKKA 2QU6A 2E9OA 2XS0A 3NEWA 4U41A 3V3VA 4DEEA 3PY3A 4QP4A 5DMZA 3KKVA 1XBAA 2VWZA 3JPVA 3G2FA 4UBAA 2WMTA 3ZOSA 3ZEWA 4FKJA 3MB7A 3RZFA 3PJ3A 4R5SA 2ZAZA 3G0EA 3GQLA 2GMXA 2YDKA 1H0VA 4TWPA 2WQEA 4R5YA 4ZLYA 3WYYA 2ZJWA 2QO2A 4W9XA 5EHOA 4HPUE 1Q41A 4YJPA 4LRJA 3UOKA 4E4LA 4QMSA 2X8DA 3FLQA 4S31A 4BCOA 5CAOA 3PVWA 3DGKA 3UZTA 4XH6A 2OKRA 4HZRA 1RJBA 4IJ9A 1Q24A 3KRXA 4CVAA 4GG5A 5DG5A 4ACMA 4RRVA 4LRKA 4GIHA 2ZYBA 1URWA 3UG1A 2IZUA 4RG0A 3N9XA 5LXMA 3EQIA 3NDMA 3PYYA 4JIKA 4EI4A 3UE4A 3C50A 4RIOA 3HRFA 2ZB0A 4IH8A 3WBLA 3ZRKA 3CLYA 3KN6A 2P55A 3RPYA 4ZEGA 2YAAA 4WNPA 4WKQA 3MGYA 4XOZA 3EN6A 5IEYA 3WE8A 4IX3A 4BZOA 3FC1X 2XKEA 3FHRA 2J5EA 4RIWA 2KULA 3BKBA 1PMVA 3P78A 4EK6A 5EKNA 5KHXA 4QMOA 2P33A 5LVMA 5LARA 4UMTA 3RP9A 3R7EA 3RPOA 5CSPA 5IH6A 3GU6A 5L8KA 5E8ZA 3G33A 2C5VA 5HO8A 4EOIA 3PRIA 2YITA 4R7IA 4FKQA 5IMEA 2ZM3A 3MB6A 5HIDA 2C6MA 2OO8X 2PE2A 2C6EA 4X3FA 5AAEA 4FSTA 4ENYA 3A8WA 4EH7A 4II5A 5DH3A 2RFDA 4EC8A 3ELJA 1BYGA 4FTRA 4K33A 3PIXA 4RBLA 1IA8A 1QL6A 3Q9WA 4FTJA 1UA2A 3V5WA 4IC8A 4KIQA 1DS5A 4HGEA 4XRJA 3TJDA 4RQKA 4C38A 4JDHA 2X2LA 3FZ1A 3PSBA 3MH3A 3UMWA 3AMAA 3SOAA 4NW5A 3NW6A 4ZZMA 3IK3A 1WBPA 3Q4CA 4GJ2A 4QYYA 2YN8A 3KXMA 4RZWA 2YZAA 1U5RA 3VS6A 5I9WA 3EQHA 4O2PA 3TNIA 2WU6A 3C7QA 3AOXA 4C3FA 4ACGA 4FKVA 5H8BA 2YM8A 4GK2A 4NM7A 4G3FA 3QXPA 5CSHA 4EQUA 3ITZA 4ZY6A 3TL8A 2F49A 4O0WA 4F1MA 4V04A 4XV2A 2WO6A 4Z9LA 1YOMA 4WBBB 4CFWA 5J79A 4MXXA 4PDSA 3UGCA 3W2RA 3BYSA 4GSBA 4BCGA 4F63A 3NAYA 4HYHA 4FEQA 3MVJA 3C4EA 3LFCA 3ULIA 4AW1A 4UMPA 1LUFA 5HO7A 1QPDA 3O2MA 5TE0A 5L4QA 4FSNA 5E8VA 2QLUA 2JEDA 2XCKA 3U6JA 3EHAA 1UNLA 4Q9ZA 4E20A 4X6QC 4NTTA 4AUAA 3R7GA 3TWJA 3ZU7A 4AA0A 2W1CA 2XNMA 2P0CA 3HRBA 3QHWA 3K3JA 2RKUA 3DJ6A 2C6LA 2ITOA 3MH0A 4UZHA 1CKJA 4TWCA 4JBPA 3M11A 3KVXA 4K6ZA 1Q8UA 2WMSA 2X9EA 3PPZA 2WZJA 4YZNA 3DFCB 4CNHA 3DNDA 3BWFA 5IZFA 1YXVA 5EW8A 2ZMCA 5FDXA 2Y9QA 2AC3A 3LFDA 5DIAA 4CMOA 3R28A 1UKHA 1VYZA 4JDIA 4HGTA 1RE8A 3ZLYA 4YPDA 1ZARA 2BUJA 2VWYA 4KNBA 3V5JA 3HL7A 4GUEA 1JKSA 2WXVA 3GEQA 5CI6A 3IECA 5KMOA 3VS7A 3VVHA 2ITVA 4G9RA 4D2PA 4EOKA 1KV1A 3JYAA 4XX9A 2QOLA 3A4OX 3S1HA 3R6XA 2BHHA 2HZIA 2Z7LA 4FVQA 3CD8A 3ZXZA 4PNKA 2FA2A 2QOKA 2X81A 1Q8WA 4AWIA 2XIKA 2BZJA 3EQRA 2P3GX 4IACA 3RCDA 3GVUA 3OROA 3VQHA 1U5QA 1BLXA 4OAUC 3A8XA 3BHYA 3PG1A 5CAQA 3QUEA 2B9HA 5CF5A 4X3FC 5A9UA 2PZYA 4N4SA 4E6AA 3QRUA 4CV9A 1KOAA 4CT2A 4GVJA 1YHVA 1UU3A 4M8TA 4DN5A 1YXUA 3I79A 3O23A 4K0YA 4EYJA 1ZMVA 4AGUA 4JVGA 3UOLA 4YZCA 5DFPA 4RIXA 1ZXEA 4FSWA 4FZ6A 2UUEA 4F1TA 4TYIA 2IZSA 3II5A 5CSXA 3OCTA 3KA0A 1J91A 4U5JA 3WARA 2PVYA 3KF7A 5AUXA 4EK4A 1CTPE 4G3DA 4TNDA 3OHTA 4I0SA 3D83A 3WF9A 1PMNA 4GVAA 2CGWA 3VS5A 3HRCA 3LFBA 1XH7A 4CMTA 3BV3A 4FT9A 3RI1A 3KULB 3R8MA 4EOPA 4BKYA 1Z57A 1OIUA 4J52A 3NAXA 1GZ8A 3QQGA 4IE9A 5T6KA 4BCFA 4FT3A 5K4JA 3UO5A 2QKWB 2W5AA 4QP2A 4RVTA 3TUBA 3MPTA 1K2PA 1Q8YA 2R64A 4USFA 2QQ7A 2XKFA 4G3EA 3UIMA 3LM5A 4RQVA 4EHGA 1PXLA 4FL3A 4O1PA 4HZSA 3V6RA 4KRCA 3MJ2A 4FYOA 4D4YA 2QD9A 1W98A 2V7AA 3UO6A 4AX8A 1OKWA 3UC3A 4PWNA 3KEXA 3LFFA 3KXZA 4IM0A 4A9UA 4KSQA 4A07A 2JBOA 5HCZA 3FI2A 5F20A 3L9MA 5DGZA 2ESMA 2QR7A 5JFSA 5M4FA 3W16A 3ZC6A 5A3XA 4IADA 2VGPA 4KIOA 4RMZA 2F4JA 4FIGA 2VTMA 4CFXA 2YCQA 2YDJA 2XNPA 3QD2B 4QMYA 4KKGA 3FYJX 3P08A 3OD6X 3TZ9A 5KMLA 2OJJA 3QTRA 5HLNA 5TF9A 4FG9A 4BHZA 4RJ8A 3FDNA 4RVMA 5EYMA 4C4HA 2PZRA 2OICA 3B2TA 1KE9A 4XOYA 3R9DA 4BL1A 1M7NA 1OB3A 4K9YA 4WG5A 3PXYA 3ZLWA 5C26A 3QRTA 3QYWA 2VWWA 4FL2A 2YA9A 1PXPA 1PYEA 3POZA 4J71A 3LJ0A 3FXWA 5DVRA 3SRVB 5KKRB 2QVSE 4OT5A 3DY7A 3P79A 3PY0A 2YABA 1A9UA 3C4XA 1QPCA 2PMOX 1P4OA 3PLSA 4M15A 3TV4A 2W0JA 4BKJA 3NNXA 2J4ZA 1QCFA 4TNBA 2WTCA 4AZFA 4F65A 1Y8GA 3EQGA 3QCXA 3A7IA 3TJCA 3TI1A 4K1BA 5JH6A 2PUUA 2WGJA 3JUHA 1QPEA 3FMMA 4HCTA 3PP0A 3NYXA 1WBWA 3H9OA 3FXXA 4ZP5A 4XV1A 3SC1A 5EDPA 4DG3E 4J96A 3E87A 4CTBA 3CEKA 4C59A 2VTIA 5AUZA 4KS7A 3E8NA 2UV2A 2WB8A 5AX3A 5C8KA 5EW9A 2PTKA 3F5PA 4QNYA 3HA8A 4XRLA 5CF4A 5HE2A 3OCGA 4MAOA 1M2RA 4L43A 3LXLA 4B99A 4IFCA 4ACDA 1OL7A 3NUUA 2OIQA 5H2UA 5J95A 2XM8A 3ANQA 3LQ5A 4NUSA 3JVRA 4NKSA 2XK3A 4GT5A 3E3PA 4BDAA 4E6DA 3CS9A 4QPMA 5A6NA 4YTCA 3PTGA 2FGIA 5K0KA 4JDKA 4Y5QA 1SNXA 1GAGA 3JY0A 3IOKA 4K77A 3E92A 4S32A 3GFEA 3R9OA 2Y7JA 3VJOA 4F09A 4RX5A 1ZYLA 4PF4A 1OVEA 3DV3A 5AR2A 4L3LA 2XNNA 4DEDA 2E9NA 5BYYA 4H39A 3W33A 3DT1A 1WBOA 4MK0A 4D2VA 1Q99A 2OH4A 1OIYA 4I0TA 4NIFA 2ETKA 2VNWA 3ZSIA 4F99A 1Z5MA 4I0RA 2PK9A 3Q4UA 5BNJA 3EFLA 1Y57A 4FSUA 2HELA 1J3HA 1HCKA 1AD5A 3G6HA 3T3VA 4YJQA 3DKOA 4KRDA 5HLWA 3LM0A 2C6DA 4JLCA 5L2TA 4L68A 4PL4A 4ANLA 5LVOA 4MBIA 4OTQA 3R01A 3EOCA 4IXPA 4JQEA 3NUXA 3MVLA 5JFXA 5AA9A 3FPMA 3TKHA 4ZTMA 4U9AA 4BIBA 5JGBA 1WBVA 3VBXA 4FT7A 1LP4A 2O0UA 4QP8A 5J7BA 3CGFA 3Q04A 4LUDA 3CTQA 5AEPA 5HICA 1GIJA 4FTQA 1QPJA 2DYLA 5E92A 5AP1A 4ZJIA 1PXIA 3OEZA 3N51A 5LVLA 4D4VA 5B7VA 4NU1A 1FPUA 3KL8A 2C68A 4ZAUA 3RPRA 2BCJA 4C7TA 2HK5A 4DFXE 4BCIA 2Z7SA 4FKIA 4UALA 4I41A 3UNKA 3VQUA 5LMKC 3UQCA 3R21A 5DT4A 1UU8A 4I94A 3OTUA 4G31A 5FRIA 3BWJA 1YHSA 4GK3A 3FLWA 4BC6A 3OG7A 4MNEB 5AR7A 4ZSJA 4GL9A 3LFAA 1V0PA 1KSWA 4RT7A 3QC9A 3HMPA 4XG2A 1PY5A 2VWIA 4J97A 4XP2A 1ZMWA 2A1AB 1TVOA 4JI9A 2GHGA 5CZIA 3SDJA 1OZ1A 3ZBXA 5J7HA 4H3QA 3P23A 3OWPA 5EHYA 1PYXA 1U54A 2C6TA 3R2BA 4MYGA 3ZSHA 4RPVA 3RM7A 3HYHA 3OF0A 1Q61A 5A6OA 2QURA 1BUHA 2Y4IB 4NCTC 3RK7A 2HY81 4D1XA 3GT8A 4IZAA 3B2WA 5A4TA 3POOA 4AP7A 3CE3A 1IEPA 3RTPA 1M52A 3Q9YA 4D9UA 4MD9E 2W9FB 4QMMA 2XIXA 4A7CA 4DLJA 4EHVA 2XVDA 3MSSA 4OTRA 4BTMA 4USDA 1J1BA 2UW5A 3SLSA 4BTJA 4LG4A 4FIJA 2OK1A 3OXIA 1G3NA 4ZTSA 2OU7A 4UB7A 4DBNA 4ERWA 2IW9A 1OIQA 2GNJA 2WD1A 4EH3A 2EB2A 3DS6A 5DA3A 2WMWA 3PVGA 3R73A 3TV6A 5K5NA 3QKLA 4JBOA 2Y6MA 3SQQA 2GQGA 3H3CA 4GJ3A 3TV7A 3ZO3A 4DGGA 5I9YA 3VBTA 4QTBA 4CKRA 3FKNA 4XS2A 3HMOA 3DBCA 3DB6A 5CT0A 5GJGA 5EFQA 2WEVA 4FODA 3BYVA 3COIA 1WCCA 3FI4A 4IB1A 3P7BA 4HCVA 3AC3A 3UP2A 4C4EA 2WIHA 3R7YA 4E5AX 1ATPE 3MFSA 5J1WA 3VN9A 3KY2A 2HWOA 2JFLA 2O65A 1I44A 3MY1A 3CD3A 2JAVA 4U3YA 4CLJA 3U9NA 3TUDA 4H58A 2Z7QA 3PXQA 5CNNA 3KXGA 2JBPA 3PSDA 3Q5IA 4V01A 4X2GA 1OL2A 5I5ZA 2GNIA 3UC4A 3DNEA 3AMYA 3BQCA 3D94A 4C34A 4YSMA 4GIIA 3HP2A 3OWJA 2OIDA 3KXHA 2W7XA 2Z2WA 1GNGA 2Y4IC 3BU5A 2F7XE 5AUWA 2QONA 5FXSA 5BMSA 2XKDA 4LM5A 4LFIA 3EN9A 4RVKA 2GFCA 5BVEA 4AZTA 4X21A 4YJTA 3ZFMA 3BBWA 2PVMA 5EM7A 3F82A 3O8UA 4RX7A 4IMYA 3T3UA 4E26A 2UZUE 2FSTX 4D58A 2A19B 5M56A 5J8IA 4WA9A 3ALNA 3P5KA 2OIBA 1AGWA 2GCDA 4KBKA 4WRSA 1P2AA 2CCHA 3ORMA 4WO5A 3GB2A 3Q6WA 4W4YA 4IC7A 1CDKA 4MXAA 5AR5A 1PHKA 4FV6A 4S33A 4AA4A 3QKKA 5I9UA 3DTCA 3C0GA 1CKPA 1OMWA 5FEDA 5KMJA 2Q0NA 5KE0A 1H25A 2XNBA 3SX9A 2YHVA 2IWIA 3FSKA 1MUOA 4FNXA 5IUIA 4QQCA 1S9JA 3TUCA 5M55A 3COHA 2YM7A 4EUUA 4BDFA 4RIYA 2RFEA 3FQEA 3BLRA 1YWNA 3EMGA 4D55A 3RWPA 2R5TA 3GXLA 5FXRA 2H9VA 4CQGA 3FMKA 4QRCA 4DEGA 3TZ7A 1YXXA 2ITQA 3ORKA 3R8UA 1SVEA 2I0HA 2B53A 4C4FA 3HV3A 4GU9A 2W5BA 3MH1A 4W8EA 2WQBA 2NPQA 5BUEA 4FF8A 3OT8A 5HESA 2W1FA 5E8SA 3D2KA 3AD5A 2HENA 4FTLA 5BUJA 4FGBA 5D10A 3KMWA 3PWYA 5FWKK 4OTDA 3PXKA 2C3KA 4RFZA 4A9YA 2B55A 4XV3A 4PP7A 2VWUA 3F3TA 2G1TA 3R30A 3OBGA 4EOSA 3EFKA 2VTHA 3SW4A 4ACCA 4DGMA 3FAAA 3KCKA 3U8WA 3BIZA 3QTSA 5IPJA 4O0UA 4PDOA 3VAPA 2VTPA 3CPCA 3EH9A 4O0XA 3PXRA 3GOPA 1O9UA 4ASZA 1YDSE 3OUKA 4BDBA 3ZFYA 2XM9A 1O6LA 4G16A 3C4FA 4FOCA 4KAOA 2OJFE 4AFEA 4QMLA 2F7ZE 2ITYA 3QWJA 3LFSA 4QMQA 3PXFA 3W2CA 4Q9SA 4WG3A 1Q4LA 2C1AA 2NP8A 3QTIA 3R0TA 4OW8A 3EIDA 1JKTA 4OTHA 2RFSA 3Q4TA 3IQ7A 2CN8A 1YXSA 3L8VA 3QU0A 1Y6AA 4RA5A 4DLIA 3H9FA 2C6KA 2JFMA 1CMKE 3KGAA 3SA0A 3QQJA 2A0CX 1XO2B 3W2QA 4NW6A 3FZOA 4I5PA 3V01A 2JIIA 3SHEA 1XKKA 4UMUA 2R7IA 3BE9A 3QZFA 1IG1A 4AU8A 4C2VA 2ZV7A 2NRUA 3FKLA 1KWPA 1ZYCA 4IFGA 4IM2A 4L46A 1Q3WA 2BFYA 5ACKA 1FVTA 5CAUA 2O2UA 3C0HA 2HXQA 3UO4A 2V7OA 2E9UA 3FZPA 1H4LA 1BX6A 1YVJA 3DB8A 3QX2A 4OR5A 5B2KA 3CY2A 4C3PA 4X2KA 3I0QA 3QCYA 1JOWB 4FZDB 5BVWA 5EI6A 2XP2A 2R3QA 2VWVA 2ITXA 4IQ6A 3RK9A 5HHWA 3PXZA 3COMA 5EYCA 4RJ3A 5DRBA 3ODZX 2RL5A 4M69B 4O6EA 3DKGA 3P0MA 4HPTE 2WTIA 2UW0A 3PPKA 5HG9A 2ITUA 2E2BA 4G2FA 3E8CA 4ALVA 4C0TA 4BBFA 3ZC5A 3PVBA 5L2WA 4A4LA 5C8MA 2J0LA 4BTKA 4XYFA 5BQ0A 2W5HA 3RVGA 2J0MB 4UX9A 4FYNA 3D5WA 2H6DA 2VD5A 4MX9A 4I6QA 4RWKA 5IKWA 1MRVA 5C8NA 4WUAA 2I0EA 5IDNA 4B0GA 3DBFA 3CBLA 2WNTA 2PMNX 3L9NA 2OG8A 4MWIA 4NJDA 3W8LA 5A46A 2Y4PA 3QF9A 5IEVA 4BYIA 4U44A 5LQFA 4BZDA 4FKWA 4O22A 2EU9A 2R7BA 4Z7GA 3C5UA 4EHZA 3DLZA 4DITA 2QOHA 4JG6A 1JSTA 4L7SA 4WHZA 2ZV9A 3ENHA 4MXZA 4ZZOA 2UZWE 3QZHA 2J0KA 5EOLA 3ZFXA 3ORTA 5HTCA 4CCBA 4F9BA 4LV5A 2GS7A 3Q9ZA 3OEFX 4PTEA 2XBAA 3PIYA 4Y72A 5A4EA 4TYGA 2VV9A 4BHNA 4XCUA 1U59A 4ZLZA 2WTDA 4MH7A 4AS0A 2QCSA 4KIPA 4I1ZA 5J9LA 4D5HA 4E4NA 4YJUA 2VO3A 2QO7A 3WF6A 3ZO1A 4E4MA 4WSYA 1FMOE 3DBQA 2ONLC 5FTOA 3PZHA 5HE1A 3D14A 2R3HA 3NYNA 3DOGA 3R1YA 2C6IA 4YTHA 4JBQA 3MIYA 3U51A 2JAMA 2H8HA 2BHEA 2GTMA 2W4KA 1EH4A 1H1QA 2CGUA 4PMSA 4M68A 2UZTA 5JGAA 3TIYA 2E9VA 4JIAA 5C1QB 1XH5A 3I81A 4HJOA 3KFAA 2C4GA 4A9SA 4HVHA 4ANBA 2AC5A 3LJ1A 4ZIMA 4ANSA 4YJSA 5AV1A 5D9HA 2B4SB 2HZNA 3QQHA 2W4OA 3H10A 3OMVA 5CY3A 4D5KA 1OPLA 3ZONA 3GGFA 3ZRMA 4QP1A 4WOVA 5BVKA 4WSQA 2X7OA 4UV0A 1WVYA 5CALA 3NNVA 1M2QA 4XG4A 3PVUA 4O38A 3ANRA 3OXZA 3DA6A 4OLIA 1XH9A 4ONAA 4Q2AA 4FV8A 5F94A 4IB5A 3DPKA 4IZ7A 1XWSA 3R8PA 4XNEA 3HDNA 4LGGA 4F4PA 1GIHA 5AUVA 2C47A 3GU8A 2JDRA 2VX3A 3QL8A 4XG9A 3VBWA 4CSVA 5DR2A 3AGLA 2PZPA 4R1YA 4DC2A 4MNFA 2J90A 4LMUA 2G2IA 5KO1A 4FNWA 5CTPA 4YHTA 4EOOA 2VWXA 3COKA 3KK9A 3RKBA 4YSJA 4L3JA 4YNEA 3UQFA 2LGCA 5ETFA 4ALWA 4ITIA 1Y91A 4G1WA 3THBA 4E1ZA 4BZNA 4YU2A 4RJ4A 2CCIA 4JJRA 5IH4A 4Q5HA 2W9ZB 3F7WA 3BLHA 1CSNA 1R0EA 2XBJA 5J5SA 2G15A 4NM3A 1TQPA 3DDQA 4I23A 1CKIA 1V0OA 2WMXA 3QA8A 4ZTLA 4BCHA 4I5MA 2GNGA 2PE0A 4O96A 3QQFA 4ZSAA 3D15A 3HECA 3EWHA 3DTWA 3LFEA 1SNUA 3E8DA 4XMOA 2QHMA 5AADA 3JVSA 3O7LB 3QTZA 1STCE 1W83A 4AW5A 5AR4A 2BRGA 3GCQA 3LHJA 4YHFA 2BRBA 1KE5A 2IVSA 3EB0A 3OWLA 4RSSA 3RHXA 5IA0A 4DGOA 1YDRE 3I6WA 4RLKA 4KD1A 4QNAA 4BCKA 3AT2A 4LYNA 3DBDA 5GZAA 1OITA 4F0GA 4BCPA 3AT4A 2WIPA 2WELA 3C4WA 3AD6A 5KHWA 1IASA 2W96B 5FM3A 4M0YA 2UZLA 5DR6A 4G34A 3R8VA 4IWOA 4BTFA 5HORA 3B8RA 2IVTA 3ACJA 4UWYA 4A4OA 2C0IA 2BDWA 3BGPA 3F61A 3S0OA 3KRJA 2DWBA 4WRGA 3FL5A 4DEBA 4F7SA 4FNZA 4UXLA 1ZYDA 4ZY4A 4NCTA 1SVGA 2QO9A 4UMQA 4ASEA 4QMZA 2XUUA 1XHAA 4EK8A 5DBXA 5HD4A 2GTNA 3LCSA 3F3WA 1ZLTA 4C2WA 1U46A 3P1AA 5HTIA 5LCKA 1REKA 5DWRA 4LQMA 4MWHA 5C9CA 4LI5A 4I4FA 4O2ZA 4PV0A 2BTRA 3EQPA 4JR3A 4FZFB 4TWNA 4K2RA 2C3LA 3FHIA 2WMBA 5L8LA 2WOUA 2XKCA 4YTIA 1W0XC 2O5KA 4QOXA 4C4IA 1YOLA 2XZSA 2JDTA 3PRFA 5IA5A 3W10A 3Q52A 5B2MA 4IAFA 4EWQA 2J2IB 4JDJA 4IWPA 2V5QA 3OS3A 3FSFA 3RWQA 5LVPA 4QT1A 3V5PA 3ROCA 4DH7A 3TXOA 3RPSA 4FNYA 4PX6A 1YKRA 5JMSA 4C4JA 4CMUA 4LOQA 2E9PA 3PPJA 4V05A 3MDYA 3O51A 3HKOA 2P4IA 4MCVA 4BGGA 3VUIA 3KVWA 3MIAA 1GZKA 1JKLA 3ALOA 3F3ZA 2W99B 3OOMA 4EWHA 4PPAA 5TOZA 5EK7A 3CIKA 4FV4A 4V0GB 2OJ9A 5JQ8A 2XEZA 3OBJA 3GU4A 4A06A 5HBJA 3IW5A 4AGDA 2PVLA 2PWLA 2G2HA 4DEIA 3DBEA 4MD7E 3IW8A 3OW4A 4X6RA 4AACA 2R3GA 4IX6A 4BCQA 3GCSA 4KS8A 4PTCA 5JRQA 4YZMA 4CZUA 1XH6A 5H9BA 3D9VA 2BZHB 4CCUA 4E3CA 1JQHA 5M53A 5HKMA 2WPAA 4H3PA 3TNQB 4YJRA 4IB3A 3A61A 4IHPA 2WTJA 2VWBA 3QZGA 4M3QA 4YURA 2JKKA 3PJ8A 4FKRA 4JBVA 4OBPA 2P2HA 1OUKA 4QMWA 3IW4A 5AAFA 4FUYA 2BDJA 4Q5EA 3LFNA 2YIRA 3QYZA 4Z55A 5BVDA 3A2CA 3KCFA 3O7LD 2HCKA 3P4KA 4JT3A 3SXRA 3TCPA 4B8LA 1V1KA 4BI1A 3FMJA 1B39A 4J99A 2Q0BA 4JQ8A 4GV1A 5EOBA 5DE2A 3WYXA 3ZUVA 3ZZEA 2V22A 3RNIA 5AJQA 3QCSA 4TXCA 2GHMA 1R39A 3FMNA 1FQ1B 4ZXTA 3B8QA 2VGOA 4ALUA 5L6PA 2BRHA 2J50A 4KKEA 3CCNA 4C4GA 2C6OA 3MY5A 5ETIA 2CSNA 1GJOA 4BRXA 4I3ZA 4UMRA 3D7TB 3L1SA 4IAKA 2XK6A 3TG1A 1H26A 3R02A 1M7QA 3CKXA 4I22A 2OF2A 3UG2A 3EFWA 3GC7A 3WZDA 3MTFA 5CAPA 4FBXA 2YM6A 4HYUA 4GS6A 1OM1A 4YO4A 2BIKB 5ETCA 3DK3A 2C5OA 3DJ5A 3UDBA 4XBRA 4EBVA 3MV5A 2BMCA 4F9AA 2EB3A 4QP3A 3EZVA 4J8NA 4BF2A 1OKZA 5HU9A 4IAIA 1MRUA 2PHKA 2C3IB 5LOHA 5CX9A 5AA8A 3Q53A 4GYGA 4HGSA 1OPKA 4RFYA 3VNTA 3FL4A 5GHVA 4GRBA 3C9WA 1U4DA 3VW6A 3F6XA 5JN2A 4BDGA 3HEGA 5CVHA 3MN3A 1UWJA 3NLBA 2QOBA 4C36A 3VS0A 1BI7A 4NEUA 2FB8A 4M13A 3TTIA 4C58A 4F9WA 1XH4A 3L8XA 5KNJA 3CJFA 3FY2A 5ANGA 4QYEA 1ZZLA 4M0ZA 1UV5A 4I20A 4TT7A 4FKSA 2OJIA 4LL0A 4XP0A 4I5HA 3CXWA 3DQWA 3IGOA 4U79A 3ZEPA 3LPBA 4CEGA 5HIEA 2WMQA 3HMIA 3SOCA 3ODYX 4X2NA 3O8PA 4OBQA 5FBNC 3FE3A 5FQDC 3P7CA 3QD0A 4CQEA 3QWKA 5DT0A 4WNOA 2QC6A 4O27B 5JEBA 2J5FA 4TY1A 2QNJA 4IEBA 4YZBA 4E5BA 4FSYA 4K18A 5HQ0A 5KCVA 3VUDA 3ORNA 3DKFA 1LR4A 3LW0A 4EKLA 3D5VA 4QYFA 5CLPA 2WMAA 2JLDA 1APME 2PSQA 4X0MA 4RX9A 3V8TA 4FV1A 5FP5A 2REIA 2JDVA 1Q97A 2UW3A 1TKIA 1PXKA 4GYIA 4EL9A 3I7CA 3C13A 4YLJA 4AT3A 5AUUA 5HVKA 1Q3DA 2QOFA 3P9JA 5HG8A 2RF9A 1H1SA 3G6GA 2I1MA 3HMMA 4PNIA 5CNOA 4DINA 3FI3A 3BYUA 2JC6A 4OUCA 2KTYA 2IN6A 2VX0A 2C3JA 1URCA 3Q9XA 4PP9A 2LAVA 5AP3A 4IM3A 5IA2A 5AP4A 3MPMA 3K3IA 4EH4A 1UU7A 2FH9A 2YM4A 5E8TA 4TYEA 5ANOA 3SXSA 3PA3A 3S3IA 3UODA 3TNHA 4DFNA 5CS6A 4KABA 4LL5A 4O6LA 3RK5A 2EVAA 4QQ5A 1JPAA 1DI9A 5EI2A 1WVWA 4H3BA 2VAGA 3OP5A 2A2AA 2DS1A 2PVKA 2YERA 1B38A 5BYZA 4IAYA 4OAVB 1NVRA 4B6LA 2I0VA 4L42A 4U43A 2UZVA 3AQVA 2GDOA 3BHTA 3FBVA 3MI9A 4FTAA 4PPCA 2FVDA 3L9LA 1JSVA 4FV3A 4DH5A 3HP5A 3MJ1A 3VBYA 3EN5A 4BYJA 5KBQA 4NT4A 3W55A 4FX3A 4I21A 3HVCA 3KRWA 4XG8A 4K8AA 5EYDA 4ERKA 2FO0A 5L2QA 4BDCA 4AZEA 3F5XA 2HXLA 4NTSA 2ZDUA 4KIKA 4IW0A 4F9YA 4EQCA 5L6OA 1XR1A 2OXXA 4RC2A 2B1PA 2F7EE 1KV2A 4NWMA
chains in the Genus database with same CATH superfamily
3BGQA 3WF5A 3GFWA 1Q8ZA 3O71A 5GZ8A 1PXJA 1PXMA 3Q32A 1OL1A 5AWMA 4N0SA 3O8TA 4NM5A 2AUHA 4AFJA 2PZIA 2BAQA 2VO6A 2XK9A 2CGXA 2YJRA 4FTCA 5AP2A 3W2OA 4BBMA 2ITPA 2O64A 5F1ZA 5IG1A 4PL5A 5AV0A 2VTRA 5HD7A 3PWDA 2X4ZA 1JBPE 3RM6A 4IVBA 2RGPA 3QRIA 5EH0A 1MQBA 2WMRA 3DAEA 3U4UA 3UVPA 1JKKA 3VULA 1E1XA 3QA0A 3RJCA 4MQ2A 2YWPA 2BVAA 4IDVA 2OH0E 2X1NA 3T8OA 3U6IA 2O8YA 4RWJA 2XIYA 3TT0A 3AC4A 5A14A 3SKCA 5CSWA 2ETMA 3ZSGA 3FZSA 3IS5A 5CQWA 3RAHA 4DAWA 3BI6A 3NR9A 1U54B 3MH2A 4FV7A 5AR8A 2OF4A 3NIEA 1KE7A 3UP7A 5EDQA 3GBZA 3M42A 3DU8A 2BFXA 3BHHA 3ORXA 3VS4A 3Q4ZA 4Y83A 2YJSA 3TZ8A 4E93A 4XG7A 1UWHA 3MA6A 4I5CA 4ITJA 2WOTA 5KMMA 3HX4A 4TWOA 4W8DA 5HEZA 3F66A 2ZM1A 3TKUA 4EORA 3IONA 4EZ5A 4O4CA 4G6LA 4RIYB 4E8AA 5CF6A 4CD0A 4W4VA 4C35A 2QR8A 1Q8TA 4EYMA 3PFQA 4F0FA 5M4UA 1IR3A 3K2LA 2BDFA 4YJOA 5HNIX 4LUEA 3E64A 4QPSA 3HLLA 3R9NA 3HV6A 3ERKA 1NVQA 2QG5A 4FTMA 4H36A 2W17A 3MWUA 2X6DA 3O0GA 4JX3A 1OI9A 4CRLA 3D2IA 3DQXA 4ZS0A 4YGAA 5GNKA 2PVFA 3AC2A 3HUBA 3NPCA 3U4WA 4FIIA 4UWCA 3R71A 4BFMA 4CZTA 3IW6A 4ZZNA 5I9VA 3ZS5A 1PMUA 2C5XA 3GUBA 3CTJA 3VUHA 4D4SA 2WHBA 2O3PA 1SMHA 1VJYA 3BU3A 4A9RA 4QO9A 2CLXA 5KUPA 4YJNA 5D7AA 3OUNB 3UOHA 3VO3A 1F0QA 2G2FA 3NIZA 2ITWA 3M1SA 4QYHA 3DJ7A 2QOCA 3EFJA 3D7ZA 5AR3A 5BX0A 1PF8A 2Z8CA 4G6NA 3A60A 5JT2A 4WIHA 2XB7A 4ID7A 4QMUA 4S30A 4Y46A 3ORPA 4F6WA 1Q5KA 1JSUA 4BDJA 4HGLA 4RC4A 3GOKA 5CU6A 5K9IA 4JRVA 4OGRA 1AQ1A 3MPAA 3UVQA 2X0GA 2PVJA 3MA3A 4EOMA 3IW7A 4EJNA 3EZRA 1H1RA 1T45A 1ZYJA 5JK3A 4CKIA 4G9CA 5CU3A 1WFCA 3NNWA 3F3UA 3D5XA 3QHRA 4L7FA 2QHNA 4Y95A 3IG7A 1O6KA 4B9DA 5BUIA 1M17A 4FOBA 3IDCA 2ITZA 1GIIA 4YO6A 4M66A 1YXTA 4IBMA 4D2WA 1H0WA 2VTTA 3LAUA 4M67A 4BN1A 4GT4A 3QGWA 4U81A 3RPVA 2UZBA 5EHLA 3VUMA 3V8WA 4EH6A 2BRMA 2HW7A 2YAKA 4RJ5A 5CXZA 3JY9A 1KE8A 2VTLA 3RGFA 4KIKB 4G6OA 4GT3A 4X7QA 5E8XA 1FMKA 1XBBA 3W2PA 3DAKA 5G6VA 5ITAA 3K5UA 2H34A 5CEPA 3DFAA 4UZDA 4IDTA 3UPXA 1OIRA 3E88A 5HX6A 4DHFA 3KK8A 5JZJA 2GHLA 2UVZA 4N70A 2VTQA 3UPZA 3V6SA 2YISA 5DOSA 3VS2A 4CYJA 3GCUA 4TYHB 4DEAA 4KB8A 3RAKA 3QC4A 2WQOA 1NA7A 3NWWA 5M4IA 4USEA 3SVVA 5E1EA 1LPUA 3CKWA 1WBSA 3OFMA 4JG8A 5FXQA 3VC4A 4UEUA 4DGNA 3QTUA 3VW8A 2A4LA 1YRPA 4I6BA 4QQJA 3WE4A 4MBLA 3ZDUA 2F57A 3OWKA 3LVPA 5A54A 1DAWA 2XCHA 3QUDA 4GFOA 4CLIA 2XK7A 4PL3A 3TTJA 4CKJA 3RBWA 2WQMA 4IB0A 5HCXA 3BHVA 4QMXA 4AW0A 5FEEA 4E6QA 1ZWSA 5EYKA 4L01A 3R7VA 3FY0A 4NIFB 3RALA 5DEYA 4EUTA 3KC3A 4JNWA 4PQNA 3LXKA 4GFGA 5DRDA 1G5SA 4MTAA 5HU3A 3MYGA 4HYIA 3DK7A 3GC0A 4QMPA 3ZRLA 5A4CA 5DT3A 2YCSA 4Y5HA 1H24A 4QMVA 5D7VA 3WZKA 4GMYA 4DH3A 4BCJA 3NRMA 1R1WA 2JITA 4D2TA 3SV0A 4D0WA 3PJ2A 4EZ3A 2V62A 4DTKA 4R6VA 4CFVA 3LJ2A 3BU6A 4UXQA 3FQHA 4FV0A 3EQDA 2IJMA 4EH9A 4P5QA 4TKSA 4HYSA 2R3MA 1ERKA 3TIZA 3FV8A 3KRLA 5AX9A 5DEWA 4CV8A 2UZNA 3HUCA 4BDHA 3KQ7A 4I4EA 2ZB1A 2W1EA 4K11A 1ZRZA 2UW9A 5DHJA 5EI8A 5KMNA 3ZCLA 4AGCA 3SD0A 4L6QA 3BEGA 3JXWA 4QTCA 4TZRA 1IRKA 3VUKA 2ZV8A 2BRNA 2R4BA 4YBJA 5CXHA 3H0ZA 4OTIA 5ACBC 4D0XA 4BVUA 5CANA 3UJGA 1W2CA 4FKLA 4KWPA 5BMMA 3KXXA 4FA2A 4GG7A 4MBJA 4AOTA 2VTOA 3EN4A 3PZEA 2RG6A 2QKRA 1KOBA 3IKAA 4X2JA 1F5QA 3O50A 2JKOA 1DI8A 5CSVA 2H96A 5HO6A 4A4XA 4CT1A 4B4LA 2IVVA 4F9CA 5EKOA 4FG7A 4GFMA 1YOJA 5KZ0A 3ZZWA 4BKZA 4BWPA 4IX4A 3DZOA 4RX8A 2XYUA 5ANDA 5GZ9A 3FZTA 3E5AA 4ZJVA 4QTEA 3GQIA 1P14A 3K5VA 4MF1A 4BWKA 3V5LA 1WZYA 2YM3A 5BPYA 4YZ9A 2XIRA 5K0XA 3VS3A 3R7UA 4DH8A 4EHEA 2IZTA 5KX8A 2X6EA 3S95A 3DK6A 3R9HA 5I0BA 2UW8A 3ZDIA 3OY1A 3H4JA 3FMHA 5LMKA 3I5NA 1TZDA 4JR7A 3EYHA 4U45A 5FBOA 1F3MC 5AV2A 4TYJA 4G3GA 2WMVA 4YJVA 2FYSA 5AV4A 3G0FA 4PMMA 3QD3A 5EM8A 4YC3A 5FDPA 4NH1A 2V55A 3PJCA 5FEQA 2WTWA 2SRCA 4BI2A 2WKMA 3NYOA 2HIWA 3V51A 3BYOA 5ANEA 5F4NA 3HZTA 3G5DA 4EH8A 5AM7A 3GP0A 3ACKA 4FT5A 4ANQA 4U6RA 4H1JA 3UQGA 2YLFA 2QI8A 3QLGA 2O63A 3K54A 3I5ZA 4C02A 3VUTA 3HGKA 4AQCA 4YP8A 1BKXA 4RWIA 4ZTHA 2X39A 4O0RA 3A99A 4U97A 5ANIA 4C8BA 3D7TA 4RLLA 3F9NA 3QFVA 3FZRA 4GEOA 1A06A 2UW6A 4M97A 3CY3A 1RW8A 3VHEA 4C61A 2VTAA 3D0EA 3ORLA 4DFZE 5CZHA 2XK4A 4WD5A 4O21A 5CU2A 2EWAA 1CM8A 2OBJA 1YI6A 1W8CA 2X7FA 4GH2A 4FC0A 4EZ7A 3VIDA 2IZRA 3E63A 3PJ1A 3BBTB 3DZQA 2FSMX 5E90A 3MVMA 5CEOA 4NSTA 1FVVA 2WTKB 4ZSLA 5AAGA 5IU2A 1BL7A 3PY1A 4YR8A 4RZVA 2Z60A 2XJ2A 4TRLA 2QOOA 4IX5A 4FTTA 2Y0AA 3LQ8A 3HDMA 4WT6A 3CP9A 3A7HA 2X4FA 2ZV2A 2BIYA 2W1ZA 2F9GA 4EH5A 4O0SA 1YI3A 3R7OA 1JNKA 2WEIA 2UZDA 4OTPA 3Q3BA 4BB4A 3SRVA 5IF1A 1BI8A 3QQLA 5KMIA 1DAYA 4L00A 2WQNA 5E7RA 4IVCA 3W1FA 5KMKA 4BDKA 3MFUA 4CFNA 3MFRA 3NCGA 1UNGA 3BHUA 5E1SA 5JZNA 2C30A 3Q2MA 4IVAA 4FIHA 3AT3A 3ZUTA 5B2LA 5TT7A 3NW7A 4ENXA 3I6UA 4IJPA 4FSMA 1Y8YA 4HVDA 3OCSA 4BDDA 4H1MA 4YUQA 1YQJA 2C69A 1SM2A 3D4QA 3KXNA 4HW7A 1YW2A 1J1CA 3GENA 1R78A 2HW6A 4F7NA 4U3ZA 5J1VA 2R3JA 3HNGA 4RIWB 4FUXA 3LE6A 4EBWA 5HGIA 1JAMA 3FQSA 3UBDA 1L3RE 4QD6A 2GPHA 4U40A 2EXEA 2JGZA 2ERZE 2CJMA 4MXOA 1VEBA 3ZLXA 4F6SA 4IAAA 3WIKA 3NCZA 3RAIA 4BCMA 5CYIA 2B52A 4FK3A 4AOIA 5HBHA 3EN7A 3ZXTA 4ASXA 2VRXA 5AIKA 1VYWA 1WMKA 4J7BA 3QCQA 4GUBA 3MBLA 5E91A 2OZAB 5AP6A 3F5GA 1K9AA 3QX4A 5LJJA 3G90X 3I1AA 4D2RA 1H27A 2W1IA 4G17A 4M7IA 3C1XA 5HVJA 3KN5A 5JKGA 2B9FA 5C03A 5H3QA 1REJA 4DEHA 3UOJA 3FYKX 4FKOA 1S9IA 4L8MA 3HV5A 4UN0C 2C1BA 4JQ7A 1OL6A 3OT3A 4WUNA 3AMBA 3WZUA 3L8SA 1XJDA 4FZ7A 5D1JA 3L8PA 5T3QA 5M44A 2XNEA 1R0PA 5CU0A 5CI7A 3U6HA 2CDZA 3KMUA 5E8WA 1W82A 4OTFA 5HG7A 4MD8E 4S2ZA 1FVRA 5AP7A 3ET7A 4DH1A 5M51A 5L2IA 2VX1A 2AQXA 2YIXA 3DAJA 4ZK5A 1JWHA 3CPBA 1PJKA 3KU2A 4PTGA 2BROA 1FGIA 2CN5A 5BVNA 2GS2A 4ANOA 4EOQA 3FMDA 3Q5ZA 4F1OA 3AG9A 3QGYA 4IWDA 2BILB 2RSVA 3O96A 4ASDA 2BALA 1QMZA 2W1DA 3MS9A 3GI3A 2WAJA 1Y6BA 2R3KA 3QLFA 2X0PA 4L44A 1BMKA 5M57A 2B9IA 4ANMA 4AOJA 5J9ZA 2YEXA 2Y6OA 3NUSA 4I24A 2R3FA 3UTOA 3VUGA 5C27A 5DLSA 4BI0A 5GJDA 5A4LA 4P5ZA 3V5TA 4ACHA 1H01A 2YACA 4NJ3A 2HWPA 4HNFA 4TYHA 3FLZA 4HOKA 4RC3A 4AZWA 2DQ7X 5HTBA 2BPMA 5TKDA 4PY1A 3WI6A 2YIWA 4O0TA 4CTCA 4PDPA 5D41A 3H30A 4G5PA 2GS6A 4EQMA 3EL7A 4QTDA 3E62A 3QRJA 4MNEA 4YBKA 1GOLA 1M14A 4TW9A 2PMIA 5A4QA 5I4NA 2VO0A 4FVPA 4JRNA 2UVYA 4KSPA 2YIQA 4ZTRA 2CHLA 4M84A 3RHKA 1W84A 4XBUA 5BVOA 2BKZA 4B7TA 5FLFA 4DG0E 3EL8A 3AXWA 2PVRA 5TO8A 3PG3A 3VBVA 2IEWA 2VTNA 4AAAA 3P86A 1YHWA 3NUPA 3Q6UA 2QOQA 3BEAA 1OGUA 3C4CA 4FTIA 4BIEA 3WF8A 4Z7HA 4CRSA 4AF3A 3R8ZA 4MXYA 3NUYA 3ZHPC 5D11A 4J95A 4NKAA 1PW2A 1ZOEA 3DKCA 4YHJA 2XK8A 1MRYA 4KINA 3DXNA 4J1RA 5T68A 5I3OA 3L9PA 1E9HA 4U7ZA 2XJ1A 4F0IA 2JIUA 2R3LA 4IAZA 3RZBA 2CLQA 2A27A 5EG3A 4XLIA 1ZY4A 1M2PA 2FUMA 5CT7A 1UNHA 4RIXB 3IPHA 3PUPA 2I40A 2UW4A 3C51A 4IWQA 3R1NA 1TQIA 4NM0A 1ZZ2A 5CEQA 4CYIA 2XYNA 3WIGA 3T9TA 4D2SA 1JVPP 4OTGA 4FV2A 3BE2A 5CVFA 2QU5A 2R3IA 2OFUA 1WBNA 2CGVA 2PE1A 3LCKA 3PIZA 3QAME 4ZTQA 3ZLSA 3BZ3A 3AGMA 5AM6A 2VZ6A 4JAIA 2W1GA 3F5UA 2ZMDA 2P2IA 3QD4A 3WZJA 3HA6A 3NSZA 2ONLA 4LV8A 5AMNA 3V04A 2PVNA 4LMNA 3KB7A 3WF7A 4FZAB 4I6FA 4E73A 1Z9XA 2BR1A 2EUFB 4FMQA 4ZY5A 5HNGA 3CQUA 4NFNA 4AT5A 2I6LA 3FMEA 4L9IA 3OVVA 1FGKA 4R3RA 5LWMA 1GZNA 4YC8A 1SZMA 3CQEA 4IANA 2CMWA 1ZAOA 3PA4A 3RMFA 4F64A 5IUHA 3M2WA 1HCLA 3RNYA 3UNJA 5IDPA 2VO7A 2X2KA 3IOPA 3R7IA 4R1VA 2WMUA 4CZYB 3S4QA 4G3CA 4BICA 1H8FA 4BGHA 4RJ6A 5AP0A 5HBEA 3S2PA 1MQ4A 5IA3A 3LXPA 2XRWA 3O17A 1PXOA 4I6HA 2XEYA 1ZOHA 4JXFA 3GNIB 3TNWA 2FSLX 4EEVA 2C5YA 1SVHA 4XV9A 1TQMA 4D1ZA 2OXDA 3NNUA 5FTQA 5ICPA 1YI4A 2Y8OA 4FL1A 4M14A 4U42A 2R3PA 3IDPA 4Y8DA 1YDTE 4L3PA 4UY9A 1SYKA 4BGQA 1V0BA 4FT0A 2ZOQA 5JRSA 1H07A 2X0OA 2X9FA 2B54A 3D5UA 2F2CB 2VN9A 2YFXA 3MFTA 3R22A 4DFLA 1K3AA 2R0IA 5I9ZA 2OW3A 4FV5A 3BCEA 3ZM4A 3F69A 3QTXA 3S00A 3W18A 4FKPA 4C57A 2RG5A 2YM5A 5CQUA 4YZDA 4FV9A 1H00A 2YLEA 5IH5A 4IIRA 4YLKA 5HI2A 3FMLA 5HNBA 5JQ5A 4MKCA 3UVRA 3H0YA 3MTLA 2ACXA 4D1SA 5LWNA 2V0DA 4ANNA 4PUZA 4KA3A 3ZUUA 5CAVA 3A7FA 3OZ6A 4O91A 4YTFA 3EYGA 3GU7A 1UKIA 2IO6A 4LOPA 3ZO2A 1NXKA 4C3RA 4DGLC 3ZBFA 5LMAA 4P2KA 5E8YA 3UIUA 1NVSA 3EQCA 5BVFA 4FG8A 4ZOGA 5IEXA 2C0TA 4BCNA 2XA4A 3UYTA 4JOAA 1YWRA 4UWBA 3WZEA 3KULA 5TR6A 5DI1A 1OUYA 1FINA 2VUWA 4I92A 2J9MA 3SXFA 4EOLA 1FOTA 2GNFA 4N6ZA 4RA4A 4XUFA 4EC9A 1GY3A 1LEZA 2BAKA 3FLSA 4HCUA 4APPA 5K5XA 3F2NA 2J6MA 4V0GA 5D12A 4DYMA 4KBAA 4E4XA 2EXCX 4ZTNA 1H1PA 4O0YA 4C62A 3BELA 3CR0A 3G9LX 4QMNA 2BAJA 3PP1A 3QZIA 2F2UA 3ROYA 5IISA 1Q62A 3TNPC 4FIEA 3E7VA 4YLLA 5CEKA 2BTSA 4W4XA 4M69A 5F9EA 4FKTA 2YDIA 5J5TA 3EJ1A 5L2SA 5CASA 3FLYA 3GCVA 5HCYA 2WTVA 4F7JA 2QOIA 5L3AA 4TL0A 3UIBA 3NS9A 4FTNA 5M4CA 3AD4A 3VF8A 5DR9A 5GJFA 3LFQA 4FICA 5HG5A 3NW5A 1MP8A 5IA4A 4FKUA 4DFYA 4GU6A 1X8BA 3REPA 4MF0A 5HE0A 2BZIB 3BX5A 4OT6A 3ZMMA 2OWBA 4C33A 4RVLA 4Y85A 4ZSEA 3LCDA 3PE1A 4W4WA 5KZIA 4CFFA 2X8EA 4D28A 3E93A 1T46A 4WG4A 5CENA 3VF9A 4FVRA 4ITHA 2C0OA 3EQFA 4AA5A 2VU3A 2HZ4A 4ARKA 3TZMA 2XIZA 4CXAA 1ZOGA 4RGJA 4D9TA 2IVUA 3IO7A 3PA5A 5LVNA 4FIFA 4YC6A 4EK5A 4MEDA 4CFMA 4J98A 5J9YA 1DM2A 5EM5A 4TPTA 4L45A 4GK4A 4F6UA 3OXTA 2JIVA 3LZBA 3GU5A 4TTHB 4WBOA 5AIRA 2GNLA 2VTJA 4R8QA 4JL9A 4AN3A 5JFWA 5LMBA 3V5QA 2GSFA 3VRZA 3AC8A 3ZH8A 4XHKB 2VNYA 5HLPA 3I7BA 4E5WA 4Z3VA 5KBRA 2X7GA 4YPSA 2W06A 3NUNA 5IMXA 5ANKA 3VHKA 2CKEA 3VBQA 2X2MA 4E7WA 4WNKA 2RIOA 4BDIA 2ZM4A 1KE6A 1UU9A 4JX7A 3R1SA 2CPKE 4F70A 2R3OA 3CJGA 2IW6A 5AV3A 4B8MA 3I4BA 5KKRC 3MY0A 4FTKA 3LMGA 4IZYA 3E3BX 3KRRA 2WFYA 1JLUE 2UZOA 1I09A 3BRBA 4MQ1A 3R1QA 4AG8A 1P4FA 3E8EA 2RFNA 3FPQA 4AE6A 2J7TA 4MHAA 4FTOA 5H8EA 2XH5A 2YCFA 3AC5A 3HV4A 5CEMA 4FSQA 4XLVA 3G9NA 5K3YA 4XEYA 1BL6A 1XH8A 2I0YA 3LIJA 4L53A 2XNGA 3UIXA 2NRYA 2QLQA 3LOKA 3R00A 5ANJA 4HNIA 2BZKB 3FUPA 2OZOA 2GNHA 3BPRA 3BGZA 3H9RA 3FXZA 2R9SA 3A7GA 2OXYA 5I3RA 3F88A 2YIYA 1WAKA 4I93A 3BLQA 2EXMA 5CF8A 4QTAA 2WU7A 2YCRA 3LCOA 5JSMA 4U80A 3ORZA 2VTSA 1B6CB 3A4PA 2PMLX 3QUPA 3SW7A 3W32A 4EONA 4N6YA 4PMPA 3FLNC 5IUGA 1OECA 2Z7RA 3FC2A 2XNOA 4IZ5A 5FGKA 1OKVA 5CWZA 3UYSA 1H1WA 5L6WL 3EQBA 3RAWA 3QXOA 1WVXA 2UW7A 3GC9A 1P5EA 4R7HA 4C37A 1XQZA 2JDSA 3F2AA 4FK6A 3QKMA 5FM2A 5AUYA 4DCEA 4FSZA 2JDOA 3ZTXA 5IA1A 5HIBA 4BDEA 4ZJJA 3A7JA 4X2FA 2JKQA 4L67A 1E1VA 3OW3A 3P7AA 4RFMA 3W2SA 2B9JA 3HV7A 4AXAA 4J8MA 1OL5A 3CC6A 1WBTA 5ETAA 2R3RA 4KKHA 2IW8A 2PL0A 4J53A 1OPJA 3E7OA 3CGOA 3PSCA 3QRKA 2HOGA 5C01A 4PRJA 3QALE 4L52A 2OI4X 3DLSA 4EH2A 3U9CA 3CQWA 2PVHA 5B0XA 1GZOA 5EW3A 5FG8A 4JG7A 3TEIA 2W4JA 3ETAA 4X3JA 3C0IA 3IGGA 5LCJA 5DPVA 3Q96A 5J87A 2FSOX 3ULZA 4DG2E 4YMJA 3ZYAA 1PKGA 4IVDA 4OTWA 3NGAA 4P4CA 4U8ZA 5HOAA 1XBCA 1O6YA 2HAKA 5JFVA 4M12A 4MXCA 2ZVAA 2W1HA 5EM6A 3IDBA 1OKYA 4RJ7A 4FTUA 3LCTA 3OY3A 3W8QA 2XJ0A 2ERKA 2J51A 3DCVA 1UVRA 3I0OA 4RWLA 3RINA 4AGWA 3BQRA 4AZVA 1ZY5A 3MVHA 5DN3A 3VWAA 4QQTA 2J0IA 2DUVA 4W9WA 2ZDTA 2UVXA 4GCJA 1H28A 2OFVA 4AN2A 5DNRA 4EOJA 4APCA 3V8SA 4A9TA 4GW8A 3UNZA 2JD5A 3FJQE 2R2PA 4QP6A 3OCBA 2XMYA 4P90A 4OBOA 5AP5A 2G9XA 4FI1A 3R8LA 3R63A 1HOWA 3R04A 2HZ0A 5AUTA 1ZMUA 2J0JA 3Q60A 4S34A 4XP3A 2WTKC 2W05A 4E6CA 4X3FB 1LEWA 2PY3A 3I60A 3ENMA 3QBNA 1ZYSA 4KBCA 4QP7A 5G1XA 5F95A 2OZAA 3VJNA 5JGDA 4QP9A 3EKNA 4LGHA 3TKIA 4PMTA 4QYGA 4HVGA 2HYYA 4ZSGA 2X8IA 4XG3A 3QTWA 2XRUA 1RDQE 4QMTA 3UZPA 3FWQA 1H08A 3NYVA 3F3VA 5L8JA 3CTHA 4AT4A 4JS8A 2R0UA 4EKKA 4LOOA 3HMNA 2UZEA 3C4ZA 3BV2A 3QTQA 3WILA 4Y73A 3DDPA 4TN6A 3F7ZA 5HE3A 2OJGA 4U0IA 3TACA 5I9XA 4CFUA 3NX8A 4EK3A 1PMEA 4O1OA 4BBEA 5EDRA 3OTVA 1R3CA 5H8GA 2OSCA 1PXNA 2GFSA 3NZ0A 5CVGA 4LGDA 4UYNA 4NZWB 4JAJA 1W7HA 2AYPA 3T9IA 5K4IA 4FKGA 4XG6A 3WOWA 4R3PA 3RCJA 5HX8A 3VRYA 2B7AA 3TN8A 4AZSA 3A62A 4F7LA 4P7EA 5FP6A 3QQUA 5HVYA 4HVIA 3R83A 4XJ0A 5HZNA 3OOGA 4R3CA 2ETRA 5E8UA 3OC1A 4LRMA 5FD2A 4WNMA 3R2YA 4FR4A 3GCPA 4HVSA 1VR2A 3LLTA 2ITTA 2JKMA 4D4RA 3LXNA 4NFMA 4PPBA 3G51A 4QPAA 5CU4A 3U87A 4AE9A 4BWXA 3SAYA 3MW1A 4NK9A 2R3NA 5CEIA 3BYMA 3KF4A 4FSRA 4UYAA 4AN9A 2OGVA 2QODA 2GU8A 4AW2A 1PKDA 4F08A 2PZ5A 3ORIA 1RQQA 3QQKA 4YNOA 3AC1A 2NO3A 4O0VA 3UMXA 2G01A 4MVFA 3VS1A 3GC8A 1NY3A 2C5NA 4Z16A 1YWVA 1VZOA 1W2DA 4BIDA 3FKOA 3KMMA 3PE2A 3ZO4A 2XF0A 4ZLOA 2A98A 3JS2A 4G5JA 2ITNA 2HY0A 3EKKA 2QU6A 2E9OA 2XS0A 3NEWA 4U41A 3V3VA 4DEEA 3PY3A 4QP4A 5DMZA 3KKVA 1XBAA 2VWZA 3JPVA 3G2FA 4UBAA 2WMTA 3ZOSA 3ZEWA 4FKJA 3MB7A 3RZFA 3PJ3A 4R5SA 2ZAZA 3G0EA 3GQLA 2GMXA 2YDKA 1H0VA 4TWPA 2WQEA 4R5YA 4ZLYA 3WYYA 2ZJWA 2QO2A 4W9XA 5EHOA 4HPUE 1Q41A 4YJPA 4LRJA 3UOKA 4E4LA 4QMSA 2X8DA 3FLQA 4S31A 4BCOA 5CAOA 3PVWA 3DGKA 3UZTA 4XH6A 2OKRA 4HZRA 1RJBA 4IJ9A 1Q24A 3KRXA 4CVAA 4GG5A 5DG5A 4ACMA 4RRVA 4LRKA 4GIHA 2ZYBA 1URWA 3UG1A 2IZUA 4RG0A 3N9XA 5LXMA 3EQIA 3NDMA 3PYYA 4JIKA 4EI4A 3UE4A 3C50A 4RIOA 3HRFA 2ZB0A 4IH8A 3WBLA 3ZRKA 3CLYA 3KN6A 2P55A 3RPYA 4ZEGA 2YAAA 4WNPA 4WKQA 3MGYA 4XOZA 3EN6A 5IEYA 3WE8A 4IX3A 4BZOA 3FC1X 2XKEA 3FHRA 2J5EA 4RIWA 2KULA 3BKBA 1PMVA 3P78A 4EK6A 5EKNA 5KHXA 4QMOA 2P33A 5LVMA 5LARA 4UMTA 3RP9A 3R7EA 3RPOA 5CSPA 5IH6A 3GU6A 5L8KA 5E8ZA 3G33A 2C5VA 5HO8A 4EOIA 3PRIA 2YITA 4R7IA 4FKQA 5IMEA 2ZM3A 3MB6A 5HIDA 2C6MA 2OO8X 2PE2A 2C6EA 4X3FA 5AAEA 4FSTA 4ENYA 3A8WA 4EH7A 4II5A 5DH3A 2RFDA 4EC8A 3ELJA 1BYGA 4FTRA 4K33A 3PIXA 4RBLA 1IA8A 1QL6A 3Q9WA 4FTJA 1UA2A 3V5WA 4IC8A 4KIQA 1DS5A 4HGEA 4XRJA 3TJDA 4RQKA 4C38A 4JDHA 2X2LA 3FZ1A 3PSBA 3MH3A 3UMWA 3AMAA 3SOAA 4NW5A 3NW6A 4ZZMA 3IK3A 1WBPA 3Q4CA 4GJ2A 4QYYA 2YN8A 3KXMA 4RZWA 2YZAA 1U5RA 3VS6A 5I9WA 3EQHA 4O2PA 3TNIA 2WU6A 3C7QA 3AOXA 4C3FA 4ACGA 4FKVA 5H8BA 2YM8A 4GK2A 4NM7A 4G3FA 3QXPA 5CSHA 4EQUA 3ITZA 4ZY6A 3TL8A 2F49A 4O0WA 4F1MA 4V04A 4XV2A 2WO6A 4Z9LA 1YOMA 4WBBB 4CFWA 5J79A 4MXXA 4PDSA 3UGCA 3W2RA 3BYSA 4GSBA 4BCGA 4F63A 3NAYA 4HYHA 4FEQA 3MVJA 3C4EA 3LFCA 3ULIA 4AW1A 4UMPA 1LUFA 5HO7A 1QPDA 3O2MA 5TE0A 5L4QA 4FSNA 5E8VA 2QLUA 2JEDA 2XCKA 3U6JA 3EHAA 1UNLA 4Q9ZA 4E20A 4X6QC 4NTTA 4AUAA 3R7GA 3TWJA 3ZU7A 4AA0A 2W1CA 2XNMA 2P0CA 3HRBA 3QHWA 3K3JA 2RKUA 3DJ6A 2C6LA 2ITOA 3MH0A 4UZHA 1CKJA 4TWCA 4JBPA 3M11A 3KVXA 4K6ZA 1Q8UA 2WMSA 2X9EA 3PPZA 2WZJA 4YZNA 3DFCB 4CNHA 3DNDA 3BWFA 5IZFA 1YXVA 5EW8A 2ZMCA 5FDXA 2Y9QA 2AC3A 3LFDA 5DIAA 4CMOA 3R28A 1UKHA 1VYZA 4JDIA 4HGTA 1RE8A 3ZLYA 4YPDA 1ZARA 2BUJA 2VWYA 4KNBA 3V5JA 3HL7A 4GUEA 1JKSA 2WXVA 3GEQA 5CI6A 3IECA 5KMOA 3VS7A 3VVHA 2ITVA 4G9RA 4D2PA 4EOKA 1KV1A 3JYAA 4XX9A 2QOLA 3A4OX 3S1HA 3R6XA 2BHHA 2HZIA 2Z7LA 4FVQA 3CD8A 3ZXZA 4PNKA 2FA2A 2QOKA 2X81A 1Q8WA 4FRFA 2XIKA 4AWIA 2BZJA 3EQRA 2P3GX 4IACA 3RCDA 3GVUA 3OROA 3VQHA 1U5QA 1BLXA 4OAUC 3A8XA 3BHYA 3PG1A 5CAQA 3QUEA 2B9HA 5CF5A 4X3FC 5A9UA 2PZYA 4N4SA 4E6AA 3QRUA 4CV9A 1KOAA 4CT2A 4GVJA 1YHVA 1UU3A 4M8TA 4DN5A 1YXUA 3I79A 3O23A 4K0YA 4EYJA 1ZMVA 4AGUA 4JVGA 3UOLA 4YZCA 5DFPA 4RIXA 1ZXEA 4FSWA 4FZ6A 2UUEA 4F1TA 4TYIA 2IZSA 3II5A 5CSXA 3OCTA 3KA0A 1J91A 4U5JA 3WARA 2PVYA 3KF7A 5AUXA 4EK4A 1CTPE 4G3DA 4TNDA 3OHTA 4I0SA 3D83A 3WF9A 1PMNA 4GVAA 2CGWA 3VS5A 3HRCA 3LFBA 1XH7A 4CMTA 3BV3A 4FT9A 3RI1A 3KULB 3R8MA 4EOPA 4BKYA 1Z57A 1OIUA 4J52A 3NAXA 1GZ8A 3QQGA 4IE9A 5T6KA