5AR3A

Rip2 kinase catalytic domain (1 - 310) complex with amp-pcp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
305
structure length
279
Chain Sequence
ICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMGGTIIYMPPENYASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
total genus 87
structure length 279
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar3A00
1YKRA 3C0GA 4JQEA 4U5JA 4BBMA 4ENXA 3EZVA 3ZXTA 2XCHA 2ONLC 3LFBA 2UW3A 2FB8A 4RJ8A 3RPSA 4D4YA 5KO1A 3MBLA 4F64A 5KNJA 2O0UA 3V8SA 3ZO3A 5AUTA 2UZOA 4JOAA 3GGFA 3MY1A 4Q9ZA 4C62A 3DZOA 2OSCA 5IUGA 3HV5A 3WBLA 4KIKB 3WF7A 4D5KA 3O71A 3OROA 3ZMMA 5L8KA 2VO7A 3SV0A 2ITTA 3G33A 3QTZA 3KXZA 3W2CA 4A9RA 1WVYA 4M67A 3MTFA 3Q52A 4PTEA 5CI6A 5DOSA 3OOGA 3OXZA 2VD5A 2WQEA 2XNOA 3Q9XA 5DGZA 3R2YA 3VBVA 4D28A 4DH5A 1LPUA 3R7GA 4IDVA 5EDPA 2Y8OA 5A9UA 2WQNA 2WTKC 3BGPA 5JMSA 2OI4X 5CEKA 5AV2A 2WIPA 2F2UA 5L6PA 5T6KA 1BMKA 5IU2A 3Q9YA 4RX8A 5E1SA 5A14A 2F7ZE 1LR4A 4QP1A 4E4MA 3FI2A 4FZAB 4QYFA 5KHWA 4HJOA 1AQ1A 3DU8A 3QTRA 4BCMA 3T3UA 3KULB 4FV9A 3W8LA 3WZUA 4EYJA 4FV8A 4OTHA 3SRVB 3BX5A 3S0OA 3BQRA 3M42A 4E5WA 4KINA 3TKIA 2FA2A 3PVBA 4YP8A 2C5VA 4M15A 3TI1A 3DAKA 4ZSLA 3R7EA 3HV6A 3DK7A 2J2IB 2JKMA 3IKAA 1PXLA 1TKIA 1SM2A 1O6LA 2EXMA 2OO8X 3D7TB 3GC7A 2F4JA 2YIYA 1PKDA 5DLSA 5E8ZA 5AAEA 5HLWA 3DTWA 3BBTB 1UU3A 4C33A 1A06A 2J7TA 1KE7A 4FA2A 4FOCA 3ZDIA 3NGAA 5FTOA 5HTBA 4D9TA 4UEUA 5HD4A 3LXLA 4Y72A 3QLGA 4RVLA 3FZOA 4BDCA 1PMEA 4XH6A 2YWPA 3RAIA 3FHRA 3TNHA 4E4LA 3ZYAA 5LJJA 5HO6A 2WZJA 3P7CA 3UQGA 3VRZA 1WBNA 4NCTA 4UWYA 4F7NA 2VTHA 3HP2A 3CP9A 1AGWA 3H3CA 4FIJA 2CGXA 2QOHA 4WRSA 2VWZA 2YJRA 4PPAA 3GU6A 2O5KA 4DEAA 2J6MA 4QQ5A 3E87A 4OUCA 4FNYA 1CDKA 2FYSA 3AT3A 3ZBFA 5CAOA 4IB0A 4I6QA 4MNEA 4MXOA 5E7RA 3ZONA 2JDVA 3KRJA 1P2AA 2F7EE 3Q6WA 4W8EA 3EQBA 3V5LA 4DCEA 5ETAA 4RSSA 3F5GA 4PUZA 4UYNA 4X2KA 2R7BA 4IAZA 2WHBA 4K2RA 4IWPA 2EU9A 2XEZA 5I9VA 3NDMA 4FL3A 4EUTA 3BLQA 4EH6A 3EB0A 4FTCA 2C0OA 2VWUA 2XNNA 4BCHA 5CY3A 3PRFA 3MWUA 2W1EA 3WZJA 4EOIA 3ZO2A 4FKVA 3WZDA 3V04A 3VAPA 1Y8GA 1YOJA 2OJFE 3T9IA 2KTYA 3HA8A 3RAKA 4D55A 4DBNA 2WKMA 2R9SA 3FAAA 4QMYA 4RWLA 2E2BA 5ANOA 4U8ZA 4N6YA 3ENHA 4ACGA 4CCUA 4FSQA 4WKQA 1ZXEA 3R1YA 3ZTXA 5JFXA 1V0PA 1M14A 4H1MA 3QQHA 5LMAA 4GYIA 2W1IA 5TF9A 4F7JA 4BZDA 4AZVA 3OFMA 4GUBA 4NIFB 3F7WA 2ZVAA 1LUFA 2IVSA 3N9XA 3PXQA 4WHZA 2ZV8A 3T9TA 5BNJA 5M4IA 2XNPA 5IH6A 5D1JA 5HG9A 2Y9QA 1KE6A 4TYIA 3RALA 2WB8A 3SAYA 4JDIA 2NP8A 3BRBA 4O6EA 3VUHA 3WI6A 4QQCA 2C3JA 3GFEA 5E8XA 3QTWA 1K9AA 2OICA 2OF4A 2CSNA 3OCBA 4HYUA 5FEDA 4C0TA 5H2UA 2CGUA 3Q60A 3KKVA 3OWLA 1M7NA 3CGFA 3GNIB 4GMYA 4L3LA 4TNDA 3ZSHA 3A62A 5F4NA 3VNTA 2EB3A 3TTIA 4Q5EA 5J5SA 4IJPA 3V3VA 2G9XA 2BDWA 1OL6A 3HDMA 2IN6A 4JBOA 4QTDA 1YXXA 2P3GX 2W17A 5BVEA 5FXQA 2VWWA 2F2CB 1AD5A 4KAOA 4R7IA 4DGOA 4DEBA 2YABA 2UVXA 4HVGA 4UYAA 3VS6A 3NR9A 4DFZE 3Q53A 1YOMA 4OTGA 3BU6A 4FSZA 4B9DA 2IWIA 4B0GA 3QUEA 3DKGA 1Y6BA 4AZFA 3ANRA 1XHAA 2UVYA 5HVJA 3R00A 4JR7A 3E64A 3F66A 1XQZA 4MBJA 2OG8A 5ITAA 4MTAA 2VTNA 3QD4A 1G3NA 2ETKA 1YI6A 2A0CX 4XBRA 5AWMA 5B2KA 3Q4TA 4BVUA 5DVRA 3L1SA 4DH7A 1H01A 2OGVA 2H8HA 4FSWA 3SA0A 3BYOA 4R3CA 2GS2A 3EN6A 4EL9A 3OTUA 3KEXA 2QHMA 1DI8A 5C8NA 4RRVA 4BBFA 2QD9A 4JG8A 2QO7A 4JAIA 4BI2A 4DTKA 4YURA 3R0TA 4HPUE 3ORIA 3UMWA 5ICPA 3CTJA 3R7UA 2BTRA 4PPBA 2QOKA 1OB3A 4E5AX 2FUMA 5A4TA 5HU3A 4J53A 1V0BA 1E1VA 4O0RA 2OXXA 4OT6A 4RIOA 4AF3A 4M0YA 2XM8A 5KMJA 4O0SA 3P1AA 4FSUA 1H1WA 4BCFA 3D7ZA 3SLSA 2XEYA 1UKIA 5A4CA 4FIGA 3S1HA 3EHAA 2VWBA 3E93A 3NCGA 3POOA 3CBLA 4YZCA 4EK8A 1GOLA 4LG4A 4JG7A 3PJ2A 3FMLA 3CQEA 4QP8A 2XJ1A 1REKA 2VX0A 3KVWA 2W5HA 2X7GA 3D5VA 2EB2A 4KRCA 1NVRA 1U46A 2OIDA 2F9GA 2VU3A 3JVSA 2C3KA 3O0GA 4FVPA 4O38A 2I6LA 2RKUA 5F1ZA 2R3JA 4F6UA 3CKWA 4JRVA 4D1XA 1Q8TA 3CD3A 4KS7A 3Q2MA 4BCKA 4H36A 3MFSA 4TYGA 2QOBA 2WAJA 4JBVA 4NWMA 3PFQA 4AW5A 5HE2A 1P14A 3EN9A 3VUDA 2W1GA 5EI6A 1KOAA 2PZPA 3DAEA 4WNOA 4IM0A 2RIOA 3PJ1A 4EORA 1JPAA 2YN8A 2QLUA 3B2WA 4MXXA 2ZM3A 3KXMA 2BRGA 5K3YA 4TWNA 2A1AB 3LCOA 3V51A 4PL5A 4F0GA 3D4QA 5KBQA 3U9CA 4RJ4A 3MVMA 4YJSA 3V8WA 5K9IA 2OF2A 3ZUUA 5AAGA 3AC3A 4F63A 3OXTA 2W5BA 3IOKA 4XG2A 2J5FA 4LRMA 2YIRA 4RBLA 2UZEA 3QWKA 2WMQA 3EKKA 4YHJA 4Y95A 4YO4A 1KE9A 3F3VA 1JNKA 5CANA 4Y8DA 4C4FA 3RI1A 4F09A 1CMKE 3NUUA 4CRLA 4H58A 2E9VA 5HNGA 1S9JA 1WMKA 1SYKA 3GC9A 4O96A 4BI0A 3KMUA 2ERZE 3OUKA 1JLUE 3F5XA 3PXYA 2PTKA 3IS5A 4X2NA 3RBWA 1ZOGA 1PHKA 4IANA 4NM0A 4EUUA 5JRQA 3ZFXA 3GEQA 3AC8A 3PPKA 1OPLA 3RK7A 3VC4A 4DEHA 2GTNA 3DDPA 3G5DA 5DMZA 1H4LA 3NPCA 3THBA 1SMHA 4DHFA 3WYXA 1ZAOA 3ZO4A 4D2RA 3L9MA 2GMXA 2QONA 2WMWA 4U41A 5C1QB 2IZUA 3TV6A 4Z16A 2WMBA 3NUXA 1IR3A 1UNGA 3WF6A 4C58A 2WTVA 3AC5A 4USDA 3SW7A 2UZLA 4U81A 3KMWA 1DS5A 2V7AA 1XBBA 3DBQA 5AP5A 4RQVA 4DG2E 5J9YA 4OAVB 5EM8A 5KMNA 4A7CA 3ORNA 3QTXA 3ZRMA 1H08A 1XR1A 4L3PA 4LYNA 5IEXA 4FV1A 1H1SA 3OP5A 4G1WA 4AN9A 3HYHA 4ARKA 2C0TA 2OIQA 2H96A 2VRXA 3AD6A 4YC8A 4AU8A 1H8FA 4XG3A 4V0GB 3ORKA 4HCVA 2ONLA 4ANSA 3UQCA 1OMWA 2OXDA 4YPSA 4J96A 4HVDA 5JFSA 3V8TA 3PG3A 4IMYA 3TKUA 1MUOA 1ZLTA 1H24A 2GS7A 4I3ZA 3OBGA 4YJPA 4CFXA 4IH8A 4Y83A 3KRLA 3TZMA 3HKOA 2O64A 3CCNA 4GYGA 2BDJA 1JBPE 5H8EA 4FIEA 5CF4A 3NSZA 3NYVA 3VUTA 3NS9A 2OK1A 4LGHA 1PXPA 4ALVA 4CFWA 2ETRA 2GHLA 3REPA 4V0GA 4BDHA 3EQHA 4TL0A 4YZBA 1OIQA 3FKOA 5I9ZA 5J1VA 5AP2A 2PSQA 5CU2A 3IW4A 2OZAA 2CKEA 3AOXA 1W8CA 1XWSA 1Q5KA 4GG7A 2C69A 4AG8A 5CWZA 3TUBA 2PVFA 4PDPA 2EWAA 4IB3A 3IDPA 4AAAA 2J0MB 4F1OA 5HLNA 2ITXA 3AD5A 4ONAA 3H0ZA 4TYEA 3EKNA 4UXQA 4RVTA 2HWPA 4UWCA 2W96B 4NU1A 4OBQA 4R1VA 5JFWA 5FXSA 4K8AA 3S95A 5EKNA 4IX4A 4P5QA 4YR8A 3DNDA 2JAMA 2VWYA 1QPEA 3CIKA 2QOQA 2WMTA 3QHRA 2C5NA 4YO6A 5AX3A 5EM7A 1J1CA 2JKQA 4MCVA 5HE3A 3UYTA 1ZZLA 3BELA 5F9EA 2ZV2A 1KV2A 4PMPA 4RC4A 4C36A 5AM7A 4DFXE 2RSVA 2C6IA 3DAJA 3TWJA 4UN0C 5FM3A 2GNFA 4E6DA 4MEDA 1R39A 4PL3A 2O65A 3HV4A 4NM3A 3DA6A 3PE2A 5C27A 3GU5A 2I0YA 3ORMA 4LOPA 2C3IB 3QRIA 4LL0A 4DN5A 2JC6A 2ZB0A 3OG7A 4FV3A 4EOKA 3LAUA 3KXHA 4R5YA 3JPVA 4XBUA 4UZHA 2JDTA 1H00A 4ITIA 3VRYA 1JAMA 4QMQA 5HI2A 4CT2A 1PKGA 4R6VA 4G31A 3I0OA 4QOXA 5H9BA 4M14A 4I93A 4S34A 5EYMA 3R8PA 4IDTA 2H9VA 1ZY5A 4GJ2A 2WQOA 2ZMDA 2RFNA 2WMXA 1MRUA 5ACBC 3D0EA 3K3IA 5AUYA 3BLHA 3EMGA 4C2VA 5LWNA 2E9OA 3Q9ZA 4QP2A 2AC3A 3QQUA 4F6WA 5IISA 2XYNA 3R02A 4ZP5A 3MPAA 5EYCA 1WVXA 5C26A 4U6RA 1H27A 1PF8A 3DBCA 3HZTA 4FKTA 2UW7A 3A4OX 2CGWA 4JDJA 4X3FB 4X3FA 4FT5A 4MKCA 2ZJWA 3VS1A 2XP2A 3HRFA 3CQWA 1VR2A 3IECA 4I4EA 1PMUA 5BVDA 4O91A 1F3MC 1P4OA 4WBBB 4BCOA 5EW3A 1BYGA 4M69A 4QYGA 3UOJA 4KBKA 2BIYA 2ZAZA 3LPBA 2ZB1A 3C5UA 4XLVA 2DS1A 4FKGA 1K3AA 2OH4A 4I5HA 5B0XA 5IA2A 5D7VA 2XKEA 4IVAA 4NJDA 5AUZA 4A4XA 3TG1A 4AGCA 4RA5A 5EG3A 3UVPA 4RX9A 4FZFB 5I9XA 3S00A 2RF9A 4A9TA 4AGUA 4G3GA 1ZYDA 4RVMA 3UODA 3ETAA 3FZ1A 2LGCA 2W1FA 4HGTA 3FMKA 3Q4CA 4AUAA 3IG7A 5ETIA 3UG2A 2Z7QA 2C47A 3RP9A 3HECA 5CQUA 1FOTA 5AX9A 2AC5A 2QKWB 1RE8A 4GUEA 4E73A 4RZVA 3VF8A 4QTBA 4FTQA 4BWXA 4A06A 3ZS5A 4BWKA 4WSQA 2GNGA 2HZNA 2PMOX 4O0XA 5FG8A 2R3OA 5K4JA 3R1SA 1YHSA 5DR9A 1L3RE 2HY81 4GU6A 4E6CA 3ZLWA 3E7VA 2QODA 5B7VA 4FSNA 5CEMA 3HX4A 1WFCA 2C6TA 2BRNA 3AMAA 4ACMA 4L3JA 2YM5A 2WTCA 3WOWA 3DGKA 3F5UA 1P4FA 2ITYA 2B9IA 2HW6A 3C1XA 4FI1A 3FLWA 3SX9A 3ROCA 2VX1A 3RKBA 3UVRA 3KN6A 4FKOA 4RIWA 3LJ1A 5CT7A 3MVLA 2GNHA 1ZMUA 4U42A 5EDQA 4ZAUA 4LGDA 4XX9A 5FEEA 1YI4A 2UW0A 4CSVA 1PMVA 4WT6A 3NUNA 3Q4UA 3GQIA 5EKOA 1Q41A 3LFEA 1BX6A 3RAWA 3H9OA 3QHWA 3V5JA 3KXNA 4FKQA 3BYVA 3TL8A 3VBQA 3F82A 4OLIA 5FBNC 4CTCA 4YSJA 5I0BA 3NAXA 4YZ9A 3SC1A 3PWDA 4M8TA 4K1BA 1XBAA 4L01A 4A4LA 3NIZA 2R3NA 3PY3A 3LFQA 4EKLA 3E62A 3R8MA 4MWHA 4N70A 1U54A 3TXOA 3LFCA 4L67A 2UZWE 3QLFA 4AGDA 1NY3A 3ODYX 4H1JA 3HV7A 4AFEA 2XK4A 3OY3A 3EWHA 5I9WA 4RIYA 5TT7A 1P5EA 3PG1A 3QU0A 2ERKA 1IEPA 5HCYA 3T8OA 5DT3A 5FP5A 3ZFMA 3VBXA 5L8LA 4HCTA 2UZVA 3OWJA 4GCJA 4XG8A 3UDBA 4RA4A 4MVFA 4CNHA 4XEYA 3ZC6A 4KNBA 3VUIA 2BZKB 4YZMA 4DLIA 4QO9A 3UQFA 4EJNA 2Y4IB 4MXZA 3DLZA 4KIKA 4PMTA 4D4VA 5CU6A 4LL5A 4BN1A 2PY3A 4L53A 2RG6A 2WMAA 1R0EA 2J0IA 4YJVA 4KD1A 5FP6A 3JYAA 5DIAA 2R5TA 5EFQA 4ZY6A 5A54A 4UX9A 2WMSA 2R3IA 1ZYJA 4G5PA 3DB6A 5CZHA 5CVFA 3PUPA 2B9FA 3MB6A 4E3CA 1JVPP 4EH7A 5L2WA 2XBAA 3EYGA 3MW1A 4CFVA 4XMOA 1TQPA 3HVCA 2W9ZB 4QMPA 3NZ0A 2YLFA 4NFMA 5JQ5A 5IG1A 4UMUA 3SQQA 4IWOA 5E8WA 3QKMA 1UNHA 1JKKA 2VTOA 3OY1A 3G0FA 4FICA 5AP4A 5CEIA 3M1SA 5I4NA 1F0QA 2CCHA 5KZ0A 2J0LA 4PPCA 4MXYA 1JWHA 3ZFYA 5HTIA 2OWBA 1YW2A 3QA8A 4NTSA 3IQ7A 4RIWB 4PTGA 2BAKA 2O2UA 5AIKA 3PIXA 3QKKA 3NNVA 4WUNA 2IJMA 4BI1A 2ITVA 2WMUA 4ANQA 1U4DA 2QG5A 4EOLA 4Y5HA 4E20A 5AR4A 3DFAA 4CFMA 3HMMA 2C1AA 3D9VA 1B39A 3QA0A 2VTAA 2VZ6A 4HNFA 5LMKC 2BZHB 5IZFA 2Y0AA 4FX3A 4HZSA 2WOUA 4HGLA 3DLSA 4YSMA 2YAKA 4F6SA 4U80A 3UZTA 4IVCA 3RCJA 1GZ8A 4JBQA 4FV4A 2I40A 3LFFA 5C01A 4PDSA 3N51A 5L2IA 1CKPA 4K11A 3DJ6A 2R64A 3FYJX 3PZEA 3SXRA 4BHNA 4EHVA 3COKA 2J51A 4O0YA 4JL9A 5HNBA 3OZ6A 2PVLA 3ZDUA 4D4SA 3LOKA 1Q8WA 3FZTA 4CYIA 4CFFA 3Q04A 1OUKA 3W33A 3OHTA 2QO9A 4QMZA 4FK6A 3RZBA 5L4QA 1R78A 4C8BA 4S30A 3AXWA 4WSYA 3LHJA 3FMJA 3SW4A 3A7JA 4E93A 3PXZA 4L6QA 4ASDA 4EI4A 3RMFA 3O8UA 4QYYA 4JX7A 2VWIA 2PE0A 3WF5A 3CEKA 5J9LA 3EFLA 1ZWSA 3MIYA 1OPJA 3DQXA 4IAKA 4DGNA 3O51A 3UIBA 3FY2A 2OJGA 5I9YA 3DS6A 3UYSA 2BPMA 4FODA 5HIDA 4D2PA 4CKJA 3MH0A 3VJOA 4YTCA 4M3QA 4PL4A 3RJCA 1SNUA 5JKGA 5K0XA 3ZCLA 4P7EA 3UO5A 2VV9A 1PXJA 4FV7A 4YNOA 5LWMA 1RDQE 1ZYLA 5EI8A 2QQ7A 4ZZMA 3CTHA 3MFTA 4YGAA 4GFMA 2PZYA 4BB4A 1H28A 2WTKB 3FC1X 5HO7A 3UZPA 4FTTA 5FDPA 3L8PA 2H34A 3U6JA 4QD6A 5JK3A 4J95A 5KMIA 3KVXA 3MB7A 3TT0A 5EOBA 4FYOA 3UE4A 3RPYA 4BDDA 4F9WA 5AIRA 4U3YA 4IM3A 4EZ7A 5DN3A 3AC2A 3EQRA 3E3PA 4NM7A 4TXCA 3D5UA 1Y8YA 4LMUA 2XKCA 5A4LA 5ANGA 3PJCA 5ACKA 3UC4A 2HZ0A 2YCRA 4UMRA 2QC6A 3CGOA 3PLSA 5LVLA 3P0MA 2WTWA 4D5HA 2KULA 4E8AA 4JDKA 4V04A 4W9WA 3ACKA 3C4FA 3Q5IA 5ETCA 3RM7A 4Y46A 4G3DA 4NSTA 4I94A 1CKIA 2Q0BA 3M11A 3OEFX 4ZTRA 2QLQA 3P7BA 3S4QA 5FD2A 3RNIA 1V1KA 3GCVA 3O23A 3R1NA 3S2PA 3C7QA 1BL6A 4FTAA 4DGLC 3G9NA 3R1QA 3ZZWA 5D41A 4BKZA 2YM3A 4FTNA 4L46A 1SVGA 3KU2A 1ATPE 4HPTE 3OS3A 5HNIX 5CSWA 1YXSA 4OTQA 3SXSA 1PYEA 4XV3A 3R01A 4FUXA 5L2QA 4XG9A 4I6HA 4K77A 3O96A 4G34A 3V01A 2GFSA 4IW0A 3R7VA 3PIZA 2JBOA 5I3RA 4JVGA 5HICA 2XH5A 4D2SA 2HAKA 3QRJA 3SHEA 4U40A 5F94A 1E1XA 3LE6A 3NYOA 3D5WA 3NUYA 3OW3A 4U9AA 4I5MA 5E92A 4GVJA 3C4EA 4JG6A 2X81A 4YJTA 1ERKA 2JAVA 2W9FB 4TPTA 1ZARA 4MWIA 2OJIA 3U6HA 3C4ZA 4ANNA 5HBJA 3FXZA 3DOGA 3CTQA 3PSBA 4RFMA 5KZIA 4ZY5A 3VQUA 3NW7A 1LEZA 3KCFA 4AA4A 4C4EA 3QC4A 3EQDA 5LMKA 1RJBA 1BUHA 1CSNA 5HKMA 5JGBA 5IH5A 1DI9A 1FGIA 3R7OA 1OUYA 2DWBA 4QMUA 3UIMA 1BL7A 4L43A 2OJ9A 3FV8A 4BDBA 3F61A 3IGOA 2I0VA 3DB8A 5DE2A 3KF4A 4TWCA 4YJQA 1Y6AA 3A7HA 4XV9A 3SRVA 4F99A 3MIAA 1TVOA 3TZ7A 1ZZ2A 5GJFA 2VWXA 3CJGA 5EYDA 3F2NA 2QOFA 5DWRA 3WZKA 4G3CA 2BFYA 3TEIA 1J3HA 2RFSA 5LXMA 2I0EA 2X8DA 4KKHA 2W1HA 2UW9A 4D9UA 5AR2A 4G6OA 2BAJA 1STCE 3OEZA 3OW4A 4R8QA 3PY1A 1M2RA 2PE2A 2WELA 2XJ2A 2FSMX 4CMUA 4F7SA 1WAKA 4GT5A 3FPQA 3RPVA 3U51A 1S9IA 3DKOA 3TNIA 2YFXA 2G2IA 1VEBA 4EK5A 2JDOA 4R7HA 4MBIA 3R73A 4JNWA 5DEYA 5EW8A 4AW1A 4AZSA 4A4OA 4AN3A 4RLKA 3PA3A 4AN2A 4F0FA 3FZPA 4JBPA 4LRKA 3TV7A 5DRDA 4TT7A 5ANJA 3BHVA 3OTVA 5KKRB 4MD8E 1MQBA 1NXKA 4FEQA 4BDJA 4MYGA 1WBOA 2IW6A 5FEQA 2W4KA 4GEOA 4QTCA 3LFNA 5FTQA 2WU7A 5HTCA 4FT7A 4QPSA 3V5PA 4QT1A 3G2FA 3DJ7A 5CF8A 4ZSEA 4UBAA 3L8SA 5AADA 4BIEA 1JQHA 4BYIA 2WXVA 2JIUA 3C50A 5G1XA 5IA4A 2GCDA 3ELJA 2YDIA 5KE0A 3VHEA 1GIHA 4KWPA 3U4UA 2O8YA 4BTKA 2X9FA 2C1BA 3G6GA 5CENA 3OOMA 4BC6A 4M68A 4EOPA 3GCQA 1OKVA 3GC8A 3R8LA 4CV8A 3ZSIA 1Z9XA 3QQKA 4FIIA 4CLJA 1KV1A 3LCTA 4W9XA 4QYEA 4RQKA 2FGIA 4QP9A 1OL7A 2R0UA 4ZSAA 2XM9A 4KIQA 4NCTC 4YBKA 4BZNA 3BZ3A 2X4ZA 3P08A 4F08A 4I5PA 5GJGA 4PWNA 4ZSJA 2JBPA 4YZNA 2AUHA 4XS2A 2HXLA 2BCJA 2ZOQA 2VTRA 3LLTA 3QX4A 3VO3A 3PRIA 5L6OA 3CS9A 4K6ZA 2HW7A 3ORPA 1MQ4A 2BRBA 3VBTA 2C6MA 3V5WA 4FVRA 5AA9A 4MXCA 2BR1A 1XJDA 2EXEA 3ZLYA 5A4EA 5AV4A 3TZ8A 3FXXA 4BKJA 1EH4A 3I81A 3Q9WA 5I3OA 4CEGA 1XH8A 5AA8A 1Y91A 3MYGA 3ZEWA 3EN5A 3COHA 4M84A 4R3PA 2W1DA 3RPRA 5HX6A 2EXCX 4XP3A 3O8TA 2VAGA 5HG7A 3UO6A 4CXAA 4XYFA 3B2TA 3BYUA 2YIXA 1NVSA 2J0KA 3II5A 4QMOA 2UW5A 1YDSE 2C6KA 5CVGA 3IDCA 4U3ZA 4ANOA 4AX8A 2X4FA 4C38A 2QOCA 4LV8A 4F4PA 4BGHA 3LFSA 5CEPA 5HORA 4CKIA 2OW3A 3R9NA 2EVAA 4YNEA 4KSPA 5AR7A 4C35A 3JVRA 1APME 4FZDB 4P2KA 5L2TA 3UC3A 4OTPA 3FY0A 1OL2A 3KY2A 5HG8A 5HVKA 3QZFA 4USEA 4DLJA 1H0WA 4CRSA 3FSFA 3QRUA 3EQCA 4DH3A 2VNYA 2GU8A 3E88A 3GU7A 5FGKA 1WBWA 3KXXA 3FWQA 2PK9A 3A7FA 4QMMA 4MF0A 4C37A 3FQHA 4LMNA 4APPA 1U5RA 3RPOA 4C7TA 1FVTA 4EOJA 4AOIA 4EQCA 3QRTA 4FOBA 3UNKA 4U44A 4D1SA 3U9NA 3DBEA 3A7IA 3R9DA 3UO4A 3ZU7A 5E8SA 3W1FA 4ZLZA 4QP6A 3R63A 4MF1A 1YI3A 3QC9A 5CX9A 4PMMA 1BLXA 4E4NA 4YUQA 4BRXA 2HELA 5BYZA 4BDKA 4OR5A 4KBCA 4HZRA 2CMWA 3AGLA 5E1EA 3LZBA 5K5NA 3FZSA 1YRPA 1HCKA 4DINA 3DY7A 5JT2A 4FF8A 4O0VA 5CAPA 2JD5A 2Q0NA 5GZAA 3TNPC 2UZUE 3POZA 3QQLA 4FT0A 1O9UA 3ANQA 3ITZA 4FR4A 4XLIA 4FUYA 3UOLA 5IDNA 4MHAA 1ZY4A 4D0XA 4ZTMA 3PP0A 3KF7A 2CHLA 4Y85A 3VF9A 4MD7E 4FVQA 3DNEA 5EI2A 3PA4A 1YQJA 1JKLA 3PA5A 4W8DA 5CYIA 3EYHA 4RIXA 3HDNA 3ZO1A 4I21A 3Q3BA 4OTFA 1ZMVA 2OBJA 3PPZA 4X0MA 4RG0A 1W82A 3QCXA 5CNNA 2WU6A 4FV0A 3WE8A 3PJ8A 2XMYA 3UJGA 3RM6A 4WRGA 3QTIA 4V05A 4AT3A 4DGMA 5TO8A 2VO3A 3RK9A 2QOIA 1F5QA 1GJOA 2F57A 3FPMA 2VUWA 2YIQA 3D94A 4FKSA 4Z3VA 4FIHA 2IZSA 3PJ3A 5GNKA 5HE0A 4F7LA 4UY9A 5DHJA 4X21A 5AAFA 3DZQA 4KBAA 3FLYA 5HIBA 5BQ0A 3I5NA 1E9HA 4G6NA 5C9CA 3R21A 4I92A 3MSSA 5LCKA 4PMSA 3U4WA 3AD4A 3MJ2A 4Q2AA 4NT4A 4XRLA 5IH4A 5CAQA 3ZC5A 4MAOA 4XNEA 1U59A 2J50A 2ZDUA 4QMTA 5CSPA 5I9UA 4F9BA 2GS6A 1CTPE 4PP9A 2J4ZA 3ZRKA 5L3AA 3NX8A 4EH9A 5IUIA 2JITA 1JKTA 2VTIA 4ASEA 2WNTA 3HGKA 3IW5A 2QURA 4EKKA 5CAVA 5BUJA 1IASA 5K0KA 2W4JA 4XV1A 4TZRA 5M53A 2V7OA 2UZNA 3BIZA 3C9WA 4JIAA 1VYWA 1VJYA 3QRKA 1H07A 4UALA 2BFXA 1GNGA 4EC8A 4ZJJA 4ALUA 3QCYA 3TV4A 4JT3A 5EK7A 4FTOA 5HX8A 2J9MA 4HYSA 4X6QC 5M4FA 2B9JA 3GVUA 2W4OA 4TWOA 1XH4A 1OPKA 5HBEA 1YWRA 3OT8A 3P7AA 4QMVA 3IW7A 4NEUA 4EZ3A 2G01A 3MPTA 4QQJA 2VTMA 3HMPA 3NLBA 4D4RA 4AZEA 4XG6A 3E3BX 3LVPA 3BGQA 2VWVA 3W18A 5EM6A 5BMMA 4C3RA 1URWA 3MV5A 3NW5A 4S32A 3E92A 3DQWA 3PYYA 4PRJA 4AGWA 4AWIA 1K2PA 4ASZA 2E9UA 2B1PA 3D5XA 2JEDA 3TN8A 4AE6A 4ID7A 4PX6A 3MDYA 3LCKA 4OTRA 3QTUA 5JGDA 1W98A 1OI9A 2PZIA 3P78A 4GK4A 3IDBA 1GZNA 5CEQA 1FPUA 2NRYA 1Q62A 2C68A 3UNJA 3LXKA 4EOQA 4IE9A 2Z60A 4MH7A 4X3JA 5CLPA 3W2OA 4GSBA 3FC2A 4BCNA 4I1ZA 3HNGA 3QZGA 1UWJA 4FSMA 5FRIA 4G5JA 3OD6X 4EWHA 2WFYA 5HCXA 3VBYA 2X8EA 3PVUA 4UV0A 2R4BA 2V55A 4APCA 5BUEA 4KA3A 2GNLA 2GSFA 3C0HA 3LXNA 4GFOA 4IACA 2PVYA 3DV3A 3GBZA 4L9IA 4X3FC 3BWFA 1IA8A 4WNKA 5CVHA 3VIDA 3TUCA 1PMNA 2DQ7X 5JSMA 4EQUA 4QYHA 5FDXA 4PP7A 3GB2A 2XRUA 3AMBA 4D2VA 3ROYA 4GK3A 4ZXTA 2NPQA 4ANLA 2PMIA 3BHHA 3PTGA 4V01A 4QNAA 5LCJA 4HYHA 3QD3A 2UV2A 4LUDA 2XK6A 4RJ5A 2VX3A 3SOCA 4X2FA 1O6KA 3W10A 4C2WA 2C5OA 2Y4IC 4I22A 2QHNA 4C4HA 3D83A 3MFRA 2Z7LA 4FG8A 4CVAA 3R8ZA 4QPAA 4BIDA 5JQ8A 5LMBA 3QQFA 3WILA 4C61A 3NWWA 4DAWA 4YBJA 3JUHA 4OBOA 4KKGA 3GXLA 4ACHA 4ZSGA 1JSUA 3P4KA 3F5PA 2PHKA 2RGPA 5HESA 4DFYA 3P5KA 2ZV9A 4GU9A 2JLDA 1Z57A 4FTLA 4MBLA 2FSLX 4ZZNA 4P5ZA 1PXNA 2FO0A 2ETMA 4NK9A 1ZOHA 3CPCA 3ZHPC 3SD0A 2OH0E 2X6EA 3PSDA 4I41A 3SOAA 4EK4A 3DK6A 4JI9A 2Y6OA 3MN3A 1JKSA 3F7ZA 3G9LX 2WGJA 3MTLA 3AQVA 1DM2A 1PXKA 1WZYA 2CJMA 5DEWA 1Q8UA 4O0UA 4W4XA 2VGPA 3NNXA 3UPXA 4I0RA 3FLZA 3WIKA 1B6CB 1Q99A 4MNEB 3WZEA 1OL1A 1QPJA 4W4WA 3VQHA 4HNIA 4BFMA 1GY3A 5IA5A 3ZBXA 4GW8A 3S3IA 4IZAA 3MGYA 2GNJA 4CQEA 4QNYA 5AV0A 3KGAA 4MXAA 3W8QA 5DR2A 2E9NA 3UTOA 4BYJA 1OKYA 2AYPA 4S33A 4A9SA 5BVFA 2R3MA 2OXYA 5ETFA 1QPDA 4OT5A 1YHWA 4RT7A 4LOOA 3SDJA 2PZRA 4YLJA 1T45A 3FKLA 3KQ7A 1JOWB 4XOYA 1UVRA 4HW7A 3LCSA 4RLLA 4XJ0A 1NVQA 3HMIA 2C6DA 2UUEA 4QPMA 4YJUA 3CQUA 4ZLOA 2IVVA 2YITA 4ITJA 4U97A 3UOHA 2BAQA 3TIYA 1REJA 3ALOA 4O2PA 4WBOA 5AP0A 3DXNA 4OTWA 2XKDA 3L9LA 3JY9A 3LQ5A 2V22A 4FL1A 5FXRA 2DYLA 4CLIA 3OCSA 4H3BA 4FC0A 3NAYA 2WTIA 2ZYBA 4ACCA 1SZMA 3DBDA 4LM5A 3K5UA 3I6UA 3W2SA 1PXIA 4C3FA 3KA0A 4PY1A 5LVNA 3LMGA 2W7XA 3FBVA 2BVAA 4EK3A 5M56A 3E5AA 5GHVA 2QR7A 4JQ7A 4WG3A 4GIIA 4Y73A 4C4IA 2XK3A 4CZTA 3DBFA 3GP0A 3ORXA 3E7OA 4G6LA 3GCPA 2G2HA 2V0DA 3FL4A 2YZAA 4IC8A 4EYMA 2W99B 3PXFA 3F3WA 2X2KA 5AUUA 2VTQA 4TY1A 3OCTA 5JZJA 4FYNA 5L6WL 4BDIA 3Q6UA 4BZOA 4BL1A 2XK7A 3HLLA 3IPHA 1QL6A 3RINA 3WF9A 3BCEA 3QXPA 3CR0A 4RJ6A 2ITWA 1U5QA 4O1OA 2IW9A 4IBMA 3QFVA 4AOTA 5BVOA 3QCSA 3BE9A 4CKRA 2BROA 4RZWA 4USFA 4O1PA 3TNWA 3PPJA 4M97A 3UBDA 4B99A 1IG1A 1H0VA 4NKSA 3HP5A 4D1ZA 4O0TA 4B4LA 3R8VA 4IVDA 5FM2A 3AMYA 5DRBA 1M2PA 3OC1A 2BILB 5HCZA 3BLRA 4FBXA 4QMSA 2QR8A 3PVWA 5AP1A 3MH1A 4Z7GA 5LVMA 2FVDA 3PP1A 3EQGA 4L42A 3I79A 4UMPA 1FGKA 4WO5A 2RFEA 1LEWA 2HYYA 2W06A 4BWPA 5IMXA 2Y4PA 4UWBA 5DA3A 4DEGA 2XA4A 1JSVA 2PVRA 4J7BA 4M7IA 3NW6A 4FTRA 3R7YA 3VUGA 1QCFA 3OT3A 4FKJA 3W16A 3UOKA 3VS2A 4JX3A 2SRCA 4BDFA 1XKKA 2NRUA 2WMRA 3F3TA 4W4VA 3ZH8A 4ALWA 1ZYCA 4B7TA 4YLLA 3RTPA 2YLEA 2W05A 2HK5A 2YHVA 2JDSA 4YC3A 1PJKA 3HMNA 2GQGA 3P79A 5DPVA 4K0YA 2ZM4A 5B2LA 4TYJA 3NRMA 5F20A 4TNBA 3EFKA 3ET7A 1PXMA 1H25A 2B7AA 2WEVA 3AGMA 4B6LA 3ZUTA 4F9YA 4IAFA 3QL8A 1OL5A 3R8UA 2H6DA 4ZY4A 4LFIA 3PWYA 3QTQA 3FUPA 2R0IA 3HUCA 4LRJA 1YWNA 4C4JA 3C51A 4F65A 4G2FA 4ZTNA 3EQFA 2XUUA 4DFNA 1KOBA 2P2IA 4NJ3A 2W5AA 4RX5A 4YPDA 2GHGA 1X8BA 3MVJA 4HVHA 2VNWA 5GZ9A 1ZMWA 3IGGA 4IX5A 4ASXA 2PMLX 4L52A 3K54A 4KS8A 4H3PA 3D14A 4AW2A 4EH2A 3W55A 3IO7A 5M4CA 4IADA 5HU9A 3G0EA 3PXKA 3TIZA 2GHMA 1Q3WA 1YXUA 4FKUA 5TKDA 4DGGA 4PDOA 3R9HA 3DPKA 1WCCA 3KMMA 3FE3A 5J79A 4X7QA 5J1WA 5CF6A 3MA6A 2XS0A 4CMOA 3OXIA 3A99A 4PQNA 3ORZA 5HQ0A 1OIUA 1J91A 4YC6A 4YZDA 4YTHA 1HOWA 4FTKA 5IMEA 4BHZA 5HD7A 5DH3A 5A4QA 4RFYA 4QTEA 1Q24A 5KX8A 4MQ1A 3ZLXA 5LARA 1XH9A 4BIBA 3OF0A 3LQ8A 3TJDA 1H1PA 4E6QA 5AM6A 2CLQA 3G6HA 2X6DA 3F2AA 4C34A 3TCPA 4J8NA 3JY0A 5IA0A 2JKOA 3E63A 3QD2B 3R04A 4GVAA 4AW0A 3V6RA 4FSRA 4FZ6A 4PTCA 4CZYB 2GDOA 2R2PA 1RW8A 2NO3A 3C13A 4UMTA 2UW8A 4E7WA 4U45A 5AP7A 4ERKA 3ULIA 4BCPA 2J0JA 4L44A 4X2GA 2C6LA 4A9UA 4C59A 3BPRA 3L9NA 5I5ZA 3A8XA 3BWJA 3D2IA 5HHWA 1M52A 4TRLA 4EH5A 4FKLA 1H26A 4PV0A 5KUPA 3CPBA 5A6NA 4MD9E 1SNXA 4XV2A 5EW9A 3ZXZA 4I23A 4FKRA 4GS6A 3VS7A 4BGQA 1PW2A 4IAIA 2XB7A 2FH9A 1MRVA 1VZOA 2HENA 4JS8A 3U6IA 2OFVA 3FLSA 3DK3A 3D7TA 2OJJA 4BCGA 5CI7A 2X2MA 3AC1A 1FINA 4MQ2A 3GU4A 4WG4A 4WNPA 5JZNA 4LV5A 4BDEA 4U79A 3QYWA 3KFAA 4GV1A 3RHXA 5D12A 3CXWA 3DTCA 3BYMA 3Q32A 3I1AA 2BHHA 3PZHA 2DUVA 4M66A 2B55A 3V5QA 3I7CA 4DYMA 3FMMA 4P4CA 2OIBA 1CKJA 3UP2A 1KE8A 2Y7JA 2UW6A 3OWPA 4CTBA 5CS6A 5HGIA 4AA5A 1M7QA 3VS5A 1Y57A 3A7GA 3EQIA 4UMQA 3ZUVA 2Z8CA 4I5CA 4P90A 5AV3A 3KN5A 3G51A 4WNMA 5G6VA 3LW0A 3GQLA 4OTDA 5CZIA 4HVIA 2JDRA 4AT5A 5T3QA 4FSYA 2PVJA 3FMHA 4AACA 4D2WA 4EWQA 4ZEGA 4ZK5A 3P86A 4FV6A 4RC2A 2C30A 5H3QA 5CEOA 4IEBA 4N0SA 3QZHA 1Z5MA 4MNFA 4RX7A 5TR6A 4Q5HA 1XH6A 3WF8A 3PIYA 4L00A 2WD1A 3FI4A 2QU5A 3F69A 4LI5A 2XCKA 3L9PA 4FGBA 4TTHB 4IVBA 5D10A 3AC4A 3ZOSA 4DFLA 2WO6A 3FJQE 4ZTHA 4FTMA 1A9UA 5GZ8A 5ANEA 4RIYB 3A2CA 3G90X 3QZIA 4L45A 4RPVA 4TWPA 1OM1A 3LXPA 2J5EA 5CQWA 1W83A 4LOQA 4UXLA 2VTTA 4G3EA 3P9JA 3BHUA 5CNOA 4EC9A 4YTFA 3E8CA 4BTFA 4JQ8A 3VUMA 3EN7A 2YA9A 3PVGA 2Z7RA 3EL7A 3Q96A 3NYNA 4CFUA 4F0IA 3H30A 2REIA 3FDNA 1V0OA 3PE1A 4HOKA 5A3XA 2HCKA 3O8PA 3ULZA 1OECA 4EK6A 5JRSA 3GUBA 4BTMA 2C0IA 5DG5A 5T68A 4Z55A 2WTJA 1KSWA 2CCIA 1OIYA 2VTJA 4G9RA 4G17A 3BHYA 3R9OA 4BCQA 2O63A 2BMCA 3EH9A 2ZMCA 3FSKA 4WUAA 4FKPA 4KKEA 3C4CA 1UU9A 2IZTA 2VO0A 4XP2A 4ITHA 3COMA 4C4GA 5GJDA 3FQSA 3MI9A 5TE0A 5K4IA 1Q8ZA 5HEZA 4BDGA 4YHTA 2BTSA 2XIYA 3BBWA 3MY0A 2JIVA 4F1TA 1GAGA 3FHIA 1PXOA 4Z7HA 3QX2A 3KRWA 4FNZA 4GG5A 2JIIA 2YDKA 5J87A 5KMLA 4AZWA 1BI8A 2Z7SA 3MH3A 4DEIA 5BPYA 2CPKE 3B8QA 3VN9A 5KHXA 2QI8A 2XK9A 3VS3A 4E4XA 2JKKA 2WQMA 3F88A 4NKAA 4RWIA 4YJOA 3R28A 4E26A 2ITNA 5CU3A 5HBHA 2I0HA 4ACDA 5CU4A 4XG4A 1DAYA 2P33A 3UMXA 4GK2A 2X1NA 2YCSA 3E8EA 4FT3A 4TKSA 4GL9A 3L8VA 4GFGA 3DKFA 4J99A 4RIXB 3QWJA 4AA0A 3O2MA 2X39A 3EZRA 3RGFA 2YCQA 3DT1A 5AP6A 4CFNA 5M57A 2X8IA 4JLCA 5KMMA 1GZOA 2P55A 2X7FA 4GJ3A 5AUXA 3QBNA 4OBPA 5H8BA 5AR5A 2ZV7A 3NUSA 5FLFA 4L68A 5DFPA 3FLNC 4I0TA 2X9EA 3FMDA 3BE2A 4RVKA 3IW6A 3FQEA 1UA2A 4FV2A 2F7XE 1YOLA 4I20A 5EDRA 1TQMA 2IVTA 2WMVA 2XVDA 4DEDA 3OUNB 2XNBA 4NIFA 1SVHA 4IAYA 5DNRA 4O22A 3SKCA 3UP7A 3MY5A 2IW8A 4BCIA 4XG7A 3RNYA 3QCQA 5J7BA 1YXVA 2OFUA 2PL0A 4II5A 4IJ9A 3BKBA 3I5ZA 3PSCA 3BU3A 4A9YA 3R6XA 3OVVA 4DG3E 2BIKB 1XH5A 5ANIA 3VS4A 1OVEA 2HWOA 2HIWA 4EZ5A 4RWJA 2R3FA 3NYXA 3QUPA 1UU7A 3ACJA 4RMZA 2RG5A 1NA7A 5KMKA 2R7IA 3R71A 4BGGA 5AUVA 4U0IA 5L8JA 3TNQB 2A27A 3HUBA 4TYHA 3QALE 5DBXA 1WBVA 2BRHA 4O27B 4KIOA 4J52A 4F9CA 3ZEPA 2V5QA 1GZKA 5J95A 5C8MA 5JEBA 5CXHA 1R1WA 2YISA 4X6RA 3NEWA 3I4BA 4G9CA 3A8WA 3CY3A 3H0YA 5CSVA 4B8LA 2YIWA 5JGAA 5CXZA 3NCZA 3WIGA 3QGWA 3TUDA 1W84A 3ZZEA 2CN8A 4CT1A 4XUFA 3UIXA 3CD8A 2FSTX 5HLPA 4BICA 4R3RA 3UGCA 1FMOE 4D2TA 1ZOEA 2C6OA 4Z9LA 4CYJA 4QP3A 2A4LA 2XKFA 3QD0A 5AMNA 3FXWA 4I6BA 4XRJA 2V62A 4MX9A 3DJ5A 2ACXA 1FMKA 4IB5A 1W7HA 2R3PA 3VS0A 3FYKX 2QOLA 1OZ1A 5KMOA 3KB7A 3GCSA 5AJQA 3Q5ZA 3EL8A 2YM6A 4AT4A 3CE3A 3F6XA 3QQJA 4O6LA 3VBWA 2UZTA 5J5TA 4YMJA 5BUIA 2QNJA 4O0WA 4BF2A 2BUJA 5AR8A 4DH1A 5E91A 3UPZA 3GCUA 4LGGA 5TOZA 4BCJA 5LVOA 3A61A 3QF9A 2HZIA 5EHLA 4ZTQA 5HE1A 1J1BA 3KK9A 4IZ7A 4M13A 2VTSA 3GT8A 3MJ1A 2R3KA 1M17A 3CKXA 4TW9A 4B8MA 1URCA 4NH1A 3RVGA 4EBVA 4FNWA 4S2ZA 4BDAA 2Z2WA 3H9RA 2YAAA 1QMZA 3HL7A 3COIA 3PXRA 4GH2A 1XO2B 2IO6A 5M4UA 3GI3A 3LM0A 3OBJA 2QCSA 3ALNA 3DCVA 2GPHA 4CV9A 4D58A 1WBPA 3BU5A 3CJFA 4FSTA 4I0SA 4KRDA 5D7AA 4BTJA 4ZLYA 3IK3A 2C3LA 4FTUA 4M12A 3VJNA 4EOOA 1Q3DA 3K3JA 1YHVA 3QXOA 3H10A 3KC3A 1M2QA 1MP8A 3KXGA 3NNWA 4J98A 5DT4A 3BEGA 3L8XA 3LFAA 4K33A 4ENYA 3C4XA 4QP4A 3MA3A 4IAAA 2X0GA 4S31A 5IKWA 4G3FA 4FTIA 3FLQA 2RL5A 3M2WA 3BV3A 1RQQA 3Q4ZA 3BHTA 2PVHA 5HOAA 4ZTLA 1R3CA 2R3QA 3KRRA 3VVHA 2XIKA 4E5BA 5JN2A 3AG9A 1WBTA 2JFMA 2ITUA 4NW5A 5K5XA 2B4SB 3NNUA 3UIUA 3VWAA 5HZNA 3UVQA 4YTIA 4EH4A 4EOSA 3FKNA 2WEIA 3ORLA 4J8MA 3IW8A 1BI7A 4I24A 4E1ZA 2OZOA 5IUHA 1DAWA 4KIPA 4FMQA 3ODZX 4IQ6A 4ZIMA 2XRWA 3I6WA 3V5TA 4ANBA 2XIZA 3MH2A 4AZTA 1WBSA 4L7SA 4NZWB 4YHFA 5BVKA 3WE4A 3VULA 4DG0E 5BX0A 4J97A 3OCGA 4XHKB 4GT3A 1XBCA 3LM5A 2PE1A 1SVEA 2QU6A 4W4YA 3FL5A 4I6FA 5AR3A 2W1ZA 3AT2A 1ZRZA 2YJSA 3R30A 2LAVA 3ZRLA 4XCUA 4FKWA 3JXWA 4LUEA 2CLXA 3V6SA 1LP4A 2C5YA 4JXFA 3RAHA 2VN9A 2YCFA 3KK8A 5BVWA 3I0QA 2WIHA 3TZ9A 1OGUA 3E8NA 2OKRA 2QOOA 2B54A 4CQGA 1G5SA 2C6EA 3R2BA 4F1MA 4NTTA 4C57A 4DC2A 3HA6A 3KULA 2VTLA 4J71A 3C4WA 3RHKA 3LJ2A 2ZM1A 2GFCA 1YVJA 3GFWA 4ZOGA 2G15A 2XJ0A 1QPCA 3LFDA 4FIFA 1YDRE 1VYZA 4U7ZA 3T3VA 2PVMA 3ENMA 4EOMA 3A4PA 4JR3A 3R22A 1GIIA 1OITA 5E8VA 3TKHA 5H8GA 4L7FA 3GOKA 3IONA 3LIJA 2UW4A 1Q8YA 2XK8A 5L2SA 3HV3A 4MK0A 4QMWA 5EYKA 2OU7A 5HG5A 2ESMA 1OKWA 2VO6A 3QGYA 4Q9SA 4EH3A 4F9AA 4FTJA 2XYUA 3ZSGA 1UWHA 2R3HA 5LQFA 4EONA 3ZM4A 4IX3A 1CM8A 3D15A 1W0XC 3ORTA 3QQGA 1PY5A 4ANMA 3W2PA 5M55A 3EIDA 3KRXA 4AQCA 5IEYA 2B53A 2YACA 4WD5A 4IC7A 4NUSA 3TJCA 4EHEA 5J8IA 4O21A 4HGSA 3CY2A 4JDHA 3O50A 5D11A 4QRCA 4C02A 3K2LA 2P0CA 5CSXA 2IVUA 4RFZA 3TACA 4IM2A 2EUFB 5E8YA 3KL8A 3B8RA 4CD0A 4Y5QA 3SVVA 3EFWA 5FBOA 2UZBA 2E9PA 3BGZA 3MVHA 1I09A 4KSQA 2B9HA 4X2JA 5CASA 3VW8A 2HOGA 4G16A 4L8MA 3EN4A 3WARA 4PNKA 5ANKA 5EH0A 4EBWA 4OAUC 3PY0A 1PYXA 3VUKA 4A07A 3H4JA 4IZYA 4EHGA 4QMNA 1TQIA 2R3GA 3KCKA 1YXTA 5M44A 4JIKA 5IA3A 3QUDA 2GNIA 1FVVA 4YJRA 4AS0A 5EHOA 4BKYA 4EQMA 5CTPA 1FVRA 4IX6A 4CCBA 3RK5A 5EHYA 5ANDA 2CGVA 3BYSA 2A2AA 3FMEA 3F3UA 2OZAB 3IOPA 3O17A 4XOZA 3TTJA 4IB1A 4FZ7A 4AP7A 4K9YA 3QTSA 5AEPA 2X7OA 2CN5A 2PVKA 3GU8A 5E8UA 2G1TA 2WTDA 5KBRA 4DITA 3HMOA 3QAME 3MS9A 2J90A 4FKIA 4IFGA 3P23A 4TN6A 1OIRA 3DKCA 3NUPA 3W2RA 2XNGA 5LVPA 2O3PA 4ZS0A 3ERKA 3FI3A 3OWKA 3RZFA 5LOHA 1WVWA 4QP7A 2BALA 4JJRA 2QO2A 2P4IA 2YDJA 4AOJA 3E8DA 3H9FA 1Q61A 3C0IA 3FMNA 4IXPA 2HXQA 2FSOX 1JSTA 1UV5A 4NW6A 2BHEA 1UU8A 1OKZA 3D2KA 3LJ0A 1H1RA 2XBJA 4R5SA 5AP3A 4GT4A 4CMTA 5IPJA 2W1CA 4EH8A 3NIEA 4RJ7A 2I1MA 4IZ5A 3DFCB 5FWKK 2VTPA 4TYHB 5BVNA 2WPAA 4HGEA 2PUUA 5AV1A 2WQBA 3R7IA 3O7LB 4FV5A 2HY0A 4PF4A 3UNZA 4R1YA 1FQ1B 1IRKA 5KKRC 4J1RA 2YM8A 4FG9A 2ITOA 5C8KA 3K5VA 5DT0A 2RFDA 2X2LA 5JH6A 5BYYA 2G2FA 5J7HA 4IWQA 1O6YA 3EQPA 3SXFA 4ZJIA 4ZJVA 4DEEA 3MPMA 4IIRA 4OTIA 5E90A 3W32A 4GIHA 2PVNA 2XIXA 2YEXA 4NFNA 4AE9A 5IDPA 4C3PA 1HCLA 2PWLA 2XNMA 1H1QA 2ITQA 4OW8A 1Q4LA 5CT0A 4U43A 1KWPA 2ITZA 3FZRA 2C4GA 4M0ZA 3EFJA 5DR6A 5HVYA 5BMSA 5KCVA 3HRBA 4KB8A 2F49A 4WIHA 3EJ1A 3VW6A 4ERWA 4FT9A 2W0JA 4QQTA 2XF0A 5M51A 1T46A 2VGOA 2XIRA 3F9NA 4GRBA 4WA9A 5C03A 2GTMA 4D0WA 2P2HA 3AT4A 4XP0A 2HZ4A 4QMXA 2IZRA 3GC0A 2JGZA 5DI1A 2C5XA 2Y6MA 4IWDA 3LCDA 2CDZA 4QTAA 4UZDA 4YU2A 5J9ZA 2YM7A 4AFJA 4ZTSA 3BI6A 1Q97A 4IHPA 3JS2A 4H39A 1KE5A 2QKRA 3WYYA 5FQDC 3U87A 3A60A 2BKZA 4UB7A 4HYIA 4BBEA 3O7LD 2WOTA 2JFLA 3F3ZA 4NM5A 4M69B 4FL2A 5CALA 5A6OA 5E8TA 5IEVA 2B52A 2YM4A 4F70A 4QMLA 4FNXA 4K18A 3I7BA 4RJ3A 2A19B 5IF1A 2R3LA 3BQCA 3QKLA 3RWPA 4ZZOA 5F95A 4FG7A 1YWVA 2ZDTA 4LQMA 5D9HA 4I4FA 3GENA 5CU0A 3HRCA 3R83A 1R0PA 2UVZA 3MFUA 4KABA 4JRNA 1I44A 5EOLA 2PMNX 5JFVA 3BV2A 4PNIA 4E6AA 1BKXA 3BEAA 3RWQA 3U8WA 1YDTE 2ITPA 5B2MA 1ZYSA 2XZSA 2BZJA 4H3QA 5AUWA 5HO8A 4CZUA 2PZ5A 3ZLSA 5CAUA 4O2ZA 3OMVA 3QYZA 4N4SA 4EHZA 2YERA 4OGRA 1B38A 3EOCA 3VHKA 5CF5A 4IFCA 5IA1A 2BRMA 4RWKA 4YJNA 1UNLA 3DDQA 3GOPA 2R3RA 5CSHA 4RC3A 1UKHA 5EM5A 3UG1A 4HVSA 5HIEA 3HEGA 3I60A 3CC6A 4FK3A 3CLYA 4HCUA 4WG5A 4YLKA 4DH8A 4AXAA 5A46A 1GIJA 2XNEA 1XH7A 2QVSE 1U54B 4N6ZA 1MRYA 2BDFA 4JAJA 4RGJA 4EEVA 2BZIB 2UZDA 3RCDA 4WOVA 3W2QA
chains in the Genus database with same CATH superfamily
1YKRA 3C0GA 4JQEA 4U5JA 4BBMA 4ENXA 3EZVA 3ZXTA 2XCHA 2ONLC 3LFBA 2UW3A 2FB8A 4RJ8A 3RPSA 4D4YA 5KO1A 3MBLA 4F64A 5KNJA 2O0UA 3V8SA 3ZO3A 5AUTA 2UZOA 4JOAA 3GGFA 3MY1A 4Q9ZA 4C62A 3DZOA 2OSCA 5IUGA 3HV5A 3WBLA 4KIKB 3WF7A 4D5KA 3O71A 3OROA 3ZMMA 5L8KA 2VO7A 3SV0A 2ITTA 3G33A 3QTZA 3KXZA 3W2CA 4A9RA 1WVYA 4M67A 3MTFA 3Q52A 4PTEA 5CI6A 5DOSA 3OOGA 3OXZA 2VD5A 2WQEA 2XNOA 3Q9XA 5DGZA 3R2YA 3VBVA 4D28A 4DH5A 1LPUA 3R7GA 4IDVA 5EDPA 2Y8OA 5A9UA 2WQNA 2WTKC 3BGPA 5JMSA 2OI4X 5CEKA 5AV2A 2WIPA 2F2UA 5L6PA 5T6KA 1BMKA 5IU2A 3Q9YA 4RX8A 5E1SA 5A14A 2F7ZE 1LR4A 4QP1A 4E4MA 3FI2A 4FZAB 4QYFA 5KHWA 4HJOA 1AQ1A 3DU8A 3QTRA 4BCMA 3T3UA 3KULB 4FV9A 3W8LA 3WZUA 4EYJA 4FV8A 4OTHA 3SRVB 3BX5A 3S0OA 3BQRA 3M42A 4E5WA 4KINA 3TKIA 2FA2A 3PVBA 4YP8A 2C5VA 4M15A 3TI1A 3DAKA 4ZSLA 3R7EA 3HV6A 3DK7A 2J2IB 2JKMA 3IKAA 1PXLA 1TKIA 1SM2A 1O6LA 2EXMA 2OO8X 3D7TB 3GC7A 2F4JA 2YIYA 1PKDA 5DLSA 5E8ZA 5AAEA 5HLWA 3DTWA 3BBTB 1UU3A 4C33A 1A06A 2J7TA 1KE7A 4FA2A 4FOCA 3ZDIA 3NGAA 5FTOA 5HTBA 4D9TA 4UEUA 5HD4A 3LXLA 4Y72A 3QLGA 4RVLA 3FZOA 4BDCA 1PMEA 4XH6A 2YWPA 3RAIA 3FHRA 3TNHA 4E4LA 3ZYAA 5LJJA 5HO6A 2WZJA 3P7CA 3UQGA 3VRZA 1WBNA 4NCTA 4UWYA 4F7NA 2VTHA 3HP2A 3CP9A 1AGWA 3H3CA 4FIJA 2CGXA 2QOHA 4WRSA 2VWZA 2YJRA 4PPAA 3GU6A 2O5KA 4DEAA 2J6MA 4QQ5A 3E87A 4OUCA 4FNYA 1CDKA 2FYSA 3AT3A 3ZBFA 5CAOA 4IB0A 4I6QA 4MNEA 4MXOA 5E7RA 3ZONA 2JDVA 3KRJA 1P2AA 2F7EE 3Q6WA 4W8EA 3EQBA 3V5LA 4DCEA 5ETAA 4RSSA 3F5GA 4PUZA 4UYNA 4X2KA 2R7BA 4IAZA 2WHBA 4K2RA 4IWPA 2EU9A 2XEZA 5I9VA 3NDMA 4FL3A 4EUTA 3BLQA 4EH6A 3EB0A 4FTCA 2C0OA 2VWUA 2XNNA 4BCHA 5CY3A 3PRFA 3MWUA 2W1EA 3WZJA 4EOIA 3ZO2A 4FKVA 3WZDA 3V04A 3VAPA 1Y8GA 1YOJA 2OJFE 3T9IA 2KTYA 3HA8A 3RAKA 4D55A 4DBNA 2WKMA 2R9SA 3FAAA 4QMYA 4RWLA 2E2BA 5ANOA 4U8ZA 4N6YA 3ENHA 4ACGA 4CCUA 4FSQA 4WKQA 1ZXEA 3R1YA 3ZTXA 5JFXA 1V0PA 1M14A 4H1MA 3QQHA 5LMAA 4GYIA 2W1IA 5TF9A 4F7JA 4BZDA 4AZVA 3OFMA 4GUBA 4NIFB 3F7WA 2ZVAA 1LUFA 2IVSA 3N9XA 3PXQA 4WHZA 1W2FA 2ZV8A 3T9TA 5BNJA 5M4IA 2XNPA 5IH6A 5D1JA 5HG9A 2Y9QA 1KE6A 4TYIA 3RALA 2WB8A 3SAYA 4JDIA 2NP8A 3BRBA 4O6EA 3VUHA 3WI6A 4QQCA 2C3JA 3GFEA 5E8XA 3QTWA 1K9AA 2OICA 2OF4A 2CSNA 3OCBA 4HYUA 5FEDA 4C0TA 5H2UA 2CGUA 3Q60A 3KKVA 3OWLA 1M7NA 3CGFA 3GNIB 4GMYA 4L3LA 4TNDA 3ZSHA 3A62A 5F4NA 3VNTA 2EB3A 3TTIA 4Q5EA 5J5SA 4IJPA 3V3VA 2G9XA 2BDWA 1OL6A 3HDMA 2IN6A 4JBOA 4QTDA 1YXXA 2P3GX 2W17A 5BVEA 5FXQA 2VWWA 2F2CB 1AD5A 4KAOA 4R7IA 4DGOA 4DEBA 2YABA 2UVXA 4HVGA 4UYAA 3VS6A 3NR9A 4DFZE 3Q53A 1YOMA 4OTGA 3BU6A 4FSZA 4B9DA 2IWIA 4B0GA 3QUEA 3DKGA 1Y6BA 4AZFA 3ANRA 1XHAA 2UVYA 5HVJA 3R00A 4JR7A 3E64A 3F66A 1XQZA 4MBJA 2OG8A 5ITAA 4MTAA 2VTNA 3QD4A 1G3NA 2ETKA 1YI6A 2A0CX 4XBRA 5AWMA 5B2KA 3Q4TA 4BVUA 5DVRA 3L1SA 4DH7A 1H01A 2OGVA 2H8HA 4FSWA 3SA0A 3BYOA 4R3CA 2GS2A 3EN6A 4EL9A 3OTUA 3KEXA 2QHMA 1DI8A 5C8NA 4RRVA 4BBFA 2QD9A 4JG8A 2QO7A 4JAIA 4BI2A 4DTKA 4YURA 3R0TA 4HPUE 3ORIA 3UMWA 5ICPA 3CTJA 3R7UA 2BTRA 4PPBA 2QOKA 1OB3A 4E5AX 2FUMA 5A4TA 5HU3A 4J53A 1V0BA 1E1VA 4O0RA 2OXXA 4OT6A 4RIOA 4AF3A 4M0YA 2XM8A 5KMJA 4O0SA 3P1AA 4FSUA 1H1WA 4BCFA 3D7ZA 3SLSA 2XEYA 1UKIA 5A4CA 4FIGA 3S1HA 3EHAA 2VWBA 3E93A 3NCGA 3POOA 3CBLA 4YZCA 4EK8A 1GOLA 4LG4A 4JG7A 3PJ2A 3FMLA 2X0OA 3CQEA 4QP8A 2XJ1A 1REKA 2VX0A 3KVWA 2W5HA 2X7GA 3D5VA 2EB2A 4KRCA 1NVRA 1U46A 2OIDA 2F9GA 2VU3A 3JVSA 2C3KA 3O0GA 4FVPA 4O38A 2I6LA 2RKUA 5F1ZA 2R3JA 4F6UA 3CKWA 4JRVA 4D1XA 1Q8TA 3CD3A 4KS7A 3Q2MA 4BCKA 4H36A 3MFSA 4TYGA 2QOBA 2WAJA 4JBVA 4NWMA 3PFQA 4AW5A 5HE2A 1P14A 3EN9A 3VUDA 2W1GA 5EI6A 1KOAA 2PZPA 3DAEA 4WNOA 4IM0A 2RIOA 3PJ1A 4EORA 1JPAA 2YN8A 2QLUA 3B2WA 4MXXA 2ZM3A 3KXMA 2BRGA 5K3YA 4TWNA 2A1AB 3LCOA 3V51A 4PL5A 4F0GA 3D4QA 5KBQA 3U9CA 4RJ4A 3MVMA 4YJSA 3V8WA 5K9IA 2OF2A 3ZUUA 5AAGA 3AC3A 4F63A 3OXTA 2W5BA 3IOKA 4XG2A 2J5FA 4LRMA 2YIRA 4RBLA 2UZEA 3QWKA 2WMQA 3EKKA 4YHJA 4Y95A 4YO4A 1KE9A 3F3VA 1JNKA 5CANA 4Y8DA 4C4FA 3RI1A 4F09A 1CMKE 3NUUA 4CRLA 4H58A 2E9VA 5HNGA 1S9JA 1WMKA 1SYKA 3GC9A 4O96A 4BI0A 3KMUA 2ERZE 3OUKA 1JLUE 3F5XA 3PXYA 2PTKA 3IS5A 4X2NA 3RBWA 1ZOGA 1PHKA 4IANA 4NM0A 4EUUA 5JRQA 3ZFXA 3GEQA 3AC8A 3PPKA 1OPLA 3RK7A 3VC4A 4DEHA 2GTNA 3DDPA 3G5DA 5DMZA 1H4LA 3NPCA 3THBA 1SMHA 4DHFA 3WYXA 1ZAOA 3ZO4A 4D2RA 3L9MA 2GMXA 2QONA 2WMWA 4U41A 5C1QB 2IZUA 3TV6A 4Z16A 2WMBA 3NUXA 1IR3A 1UNGA 3WF6A 4C58A 2WTVA 3AC5A 4USDA 3SW7A 2UZLA 4U81A 3KMWA 1DS5A 2V7AA 1XBBA 3DBQA 5AP5A 4RQVA 4DG2E 5J9YA 4OAVB 5EM8A 5KMNA 4A7CA 3ORNA 3QTXA 3ZRMA 1H08A 1XR1A 4L3PA 4LYNA 5IEXA 4FV1A 1H1SA 3OP5A 4G1WA 4AN9A 3HYHA 4ARKA 2C0TA 2OIQA 2H96A 2VRXA 3AD6A 4YC8A 4AU8A 1H8FA 4XG3A 4V0GB 3ORKA 4HCVA 2ONLA 4ANSA 3UQCA 1OMWA 2OXDA 4YPSA 4J96A 4HVDA 5JFSA 3V8TA 3PG3A 4IMYA 3TKUA 1MUOA 1ZLTA 1H24A 2GS7A 4I3ZA 4O4BB 3OBGA 4YJPA 4CFXA 4IH8A 4Y83A 3KRLA 3TZMA 3HKOA 2O64A 3CCNA 4GYGA 2BDJA 1JBPE 5H8EA 4FIEA 5CF4A 3NSZA 3NYVA 3VUTA 3NS9A 2OK1A 4LGHA 1PXPA 4ALVA 4CFWA 2ETRA 2GHLA 3REPA 4V0GA 4BDHA 3EQHA 4TL0A 4YZBA 1OIQA 3FKOA 5I9ZA 5J1VA 5AP2A 2PSQA 5CU2A 3IW4A 2OZAA 2CKEA 3AOXA 1W8CA 1XWSA 1Q5KA 4GG7A 2C69A 4AG8A 5CWZA 3TUBA 2PVFA 4PDPA 2EWAA 4IB3A 3IDPA 4AAAA 2J0MB 4F1OA 5HLNA 2ITXA 3AD5A 4ONAA 3H0ZA 4TYEA 3EKNA 4UXQA 4RVTA 2HWPA 4UWCA 2W96B 4NU1A 4OBQA 4R1VA 5JFWA 5FXSA 4K8AA 3S95A 5EKNA 4IX4A 4P5QA 4YR8A 3DNDA 2JAMA 2VWYA 1QPEA 3CIKA 2QOQA 2WMTA 3QHRA 2C5NA 4YO6A 5AX3A 5EM7A 1J1CA 2JKQA 4MCVA 5HE3A 3UYTA 1ZZLA 3BELA 5F9EA 2ZV2A 1KV2A 4PMPA 4RC4A 4C36A 5AM7A 4DFXE 2RSVA 2C6IA 3DAJA 3TWJA 4UN0C 5FM3A 2GNFA 4E6DA 4MEDA 1R39A 4PL3A 2O65A 3HV4A 4NM3A 3DA6A 3PE2A 5C27A 3GU5A 2I0YA 3ORMA 4LOPA 2C3IB 3QRIA 4LL0A 4DN5A 2JC6A 2ZB0A 3OG7A 4FV3A 4EOKA 3LAUA 3KXHA 4R5YA 3JPVA 4XBUA 4UZHA 2JDTA 1H00A 4ITIA 3VRYA 1JAMA 4QMQA 5HI2A 4CT2A 1PKGA 4R6VA 4G31A 3I0OA 4QOXA 5H9BA 4M14A 4I93A 4S34A 5EYMA 3R8PA 4IDTA 2H9VA 1ZY5A 4GJ2A 2WQOA 2ZMDA 2RFNA 2WMXA 1MRUA 5ACBC 3D0EA 3K3IA 5AUYA 3BLHA 3EMGA 4C2VA 5LWNA 2E9OA 3Q9ZA 4QP2A 2AC3A 3QQUA 4F6WA 5IISA 2XYNA 3R02A 4ZP5A 3MPAA 5EYCA 1WVXA 5C26A 4U6RA 1H27A 1PF8A 3DBCA 3HZTA 4FKTA 2UW7A 3A4OX 2CGWA 4JDJA 4X3FB 4X3FA 4FT5A 4MKCA 2ZJWA 3VS1A 2XP2A 3HRFA 3CQWA 1VR2A 3IECA 4I4EA 1PMUA 5BVDA 4O91A 1F3MC 1P4OA 4WBBB 4BCOA 5EW3A 1BYGA 4M69A 4QYGA 3UOJA 4KBKA 2BIYA 2ZAZA 3LPBA 2ZB1A 3C5UA 4XLVA 2DS1A 4FKGA 1K3AA 2OH4A 4I5HA 5B0XA 5IA2A 5D7VA 2XKEA 4IVAA 4NJDA 5AUZA 4A4XA 3TG1A 4AGCA 4RA5A 5EG3A 3UVPA 4RX9A 4FZFB 5I9XA 3S00A 2RF9A 4A9TA 4AGUA 4G3GA 1ZYDA 4RVMA 3UODA 3ETAA 3FZ1A 2LGCA 2W1FA 4HGTA 3FMKA 3Q4CA 4AUAA 3IG7A 5ETIA 3UG2A 2Z7QA 2C47A 3RP9A 3HECA 5CQUA 1FOTA 5AX9A 2AC5A 2QKWB 1RE8A 4GUEA 4E73A 4RZVA 3VF8A 4QTBA 4FTQA 4BWXA 4A06A 3ZS5A 4BWKA 4WSQA 2GNGA 2HZNA 2PMOX 4O0XA 5FG8A 2R3OA 5K4JA 3R1SA 1YHSA 5DR9A 1L3RE 2HY81 4GU6A 4O4CA 3ZLWA 3E7VA 2QODA 4E6CA 4FSNA 5B7VA 5CEMA 3HX4A 2AQXA 1WFCA 2C6TA 2BRNA 3AMAA 4ACMA 4L3JA 2YM5A 2WTCA 3WOWA 3DGKA 3F5UA 1P4FA 2ITYA 2B9IA 2HW6A 3C1XA 4FI1A 3FLWA 3SX9A 3ROCA 2VX1A 3RKBA 3UVRA 3KN6A 4FKOA 4RIWA 3LJ1A 5CT7A 3MVLA 2GNHA 1ZMUA 4U42A 5EDQA 4ZAUA 4LGDA 4XX9A 5FEEA 1YI4A 2UW0A 4CSVA 1PMVA 4WT6A 3NUNA 3Q4UA 3GQIA 5EKOA 1Q41A 3LFEA 1BX6A 3RAWA 3H9OA 3QHWA 3V5JA 3KXNA 4FKQA 3BYVA 3TL8A 3VBQA 3F82A 4OLIA 5FBNC 4CTCA 4YSJA 5I0BA 3NAXA 4YZ9A 3SC1A 3PWDA 4M8TA 4K1BA 1XBAA 4L01A 4A4LA 3NIZA 2R3NA 3PY3A 3LFQA 4EKLA 3E62A 3R8MA 4MWHA 4N70A 1U54A 3TXOA 3LFCA 4L67A 2UZWE 3QLFA 4AGDA 1NY3A 3ODYX 4H1JA 3HV7A 4AFEA 2XK4A 3OY3A 3EWHA 5I9WA 4RIYA 5TT7A 1P5EA 3PG1A 3QU0A 2ERKA 1IEPA 5HCYA 3T8OA 5DT3A 5FP5A 3ZFMA 3VBXA 5L8LA 4HCTA 2UZVA 3OWJA 4GCJA 4XG8A 3UDBA 4RA4A 4MVFA 4CNHA 4XEYA 3ZC6A 4KNBA 3VUIA 2BZKB 4YZMA 4DLIA 4QO9A 3UQFA 4EJNA 2Y4IB 4MXZA 3DLZA 4KIKA 4PMTA 4D4VA 5CU6A 4LL5A 4BN1A 2PY3A 4L53A 2RG6A 2WMAA 1R0EA 2J0IA 4YJVA 4KD1A 5FP6A 3JYAA 5DIAA 2R5TA 5EFQA 4ZY6A 5A54A 4UX9A 2WMSA 2R3IA 1ZYJA 4G5PA 3DB6A 5CZHA 5CVFA 3PUPA 2B9FA 3MB6A 4E3CA 1JVPP 4EH7A 5L2WA 2XBAA 3EYGA 3MW1A 4CFVA 4XMOA 1TQPA 3HVCA 2W9ZB 4QMPA 3NZ0A 2YLFA 4NFMA 5JQ5A 5IG1A 4UMUA 3SQQA 4IWOA 5E8WA 3QKMA 1UNHA 1JKKA 2VTOA 3OY1A 1W2CA 3G0FA 4FICA 5AP4A 5CEIA 3M1SA 5I4NA 1F0QA 2CCHA 5KZ0A 2J0LA 4PPCA 4MXYA 1JWHA 3ZFYA 5HTIA 2OWBA 1YW2A 3QA8A 4NTSA 3IQ7A 4RIWB 4PTGA 2BAKA 2O2UA 5AIKA 3PIXA 3QKKA 3NNVA 4WUNA 2IJMA 4BI1A 2ITVA 2WMUA 4ANQA 1U4DA 2QG5A 4EOLA 4Y5HA 4E20A 5AR4A 3DFAA 4CFMA 3HMMA 2C1AA 3D9VA 1B39A 3QA0A 2VTAA 2VZ6A 4HNFA 5LMKC 2BZHB 5IZFA 2Y0AA 4FX3A 4HZSA 2WOUA 4HGLA 3DLSA 4YSMA 2YAKA 4F6SA 4U80A 3UZTA 4IVCA 3RCJA 1GZ8A 4JBQA 4FV4A 2I40A 3LFFA 5C01A 4PDSA 3N51A 5L2IA 1CKPA 4K11A 3DJ6A 2R64A 3FYJX 3PZEA 3SXRA 4BHNA 4EHVA 3COKA 2J51A 4O0YA 4JL9A 5HNBA 3OZ6A 2PVLA 3ZDUA 4D4SA 3LOKA 1Q8WA 3FZTA 4CYIA 4CFFA 3Q04A 1OUKA 3W33A 3OHTA 2QO9A 4QMZA 4FK6A 3RZBA 5L4QA 1R78A 4C8BA 2IEWA 4S30A 3AXWA 4WSYA 3LHJA 3FMJA 3SW4A 3A7JA 4E93A 3PXZA 4L6QA 4ASDA 4EI4A 3RMFA 3O8UA 4QYYA 4JX7A 2VWIA 2PE0A 3WF5A 3CEKA 5J9LA 3EFLA 1ZWSA 3MIYA 1OPJA 3DQXA 4IAKA 4DGNA 3O51A 3UIBA 3FY2A 2OJGA 5I9YA 3DS6A 3UYSA 2BPMA 4FODA 5HIDA 4D2PA 4CKJA 3MH0A 3VJOA 4YTCA 4M3QA 4PL4A 3RJCA 1SNUA 5JKGA 5K0XA 3ZCLA 4P7EA 3UO5A 2VV9A 1PXJA 4FV7A 4YNOA 5LWMA 1RDQE 1ZYLA 5EI8A 2QQ7A 4ZZMA 3CTHA 3MFTA 4YGAA 4GFMA 2PZYA 4BB4A 1H28A 2WTKB 3FC1X 5HO7A 3UZPA 4FTTA 5FDPA 3L8PA 2H34A 3U6JA 4QD6A 5JK3A 4J95A 5KMIA 3KVXA 3MB7A 3TT0A 5EOBA 4FYOA 3UE4A 3RPYA 4BDDA 4F9WA 5AIRA 4U3YA 4IM3A 4EZ7A 5DN3A 3AC2A 3EQRA 3E3PA 4NM7A 4TXCA 3D5UA 1Y8YA 4LMUA 2XKCA 5A4LA 5ANGA 3PJCA 5ACKA 3UC4A 2HZ0A 2YCRA 4UMRA 2QC6A 3CGOA 3PLSA 5LVLA 3P0MA 2WTWA 4D5HA 2KULA 4E8AA 4JDKA 4V04A 4W9WA 3ACKA 3C4FA 3Q5IA 5ETCA 3RM7A 4Y46A 4G3DA 4NSTA 4I94A 1CKIA 2Q0BA 3M11A 3OEFX 4ZTRA 2QLQA 3P7BA 3S4QA 5FD2A 3RNIA 1V1KA 3GCVA 3O23A 3R1NA 3S2PA 3C7QA 1BL6A 4FTAA 4DGLC 3G9NA 3R1QA 3ZZWA 5D41A 4BKZA 2YM3A 4FTNA 4L46A 1SVGA 3KU2A 1ATPE 4HPTE 3OS3A 5HNIX 5CSWA 1YXSA 4OTQA 3SXSA 1PYEA 4XV3A 3R01A 4FUXA 5L2QA 4XG9A 4I6HA 4K77A 3O96A 4G34A 3V01A 2GFSA 4IW0A 3R7VA 3PIZA 2JBOA 5I3RA 4JVGA 5HICA 2XH5A 4D2SA 2HAKA 3QRJA 3SHEA 4U40A 5F94A 1E1XA 3LE6A 3NYOA 3D5WA 3NUYA 3OW3A 4U9AA 4I5MA 5E92A 4GVJA 3C4EA 4JG6A 2X81A 4YJTA 1ERKA 2JAVA 2W9FB 4TPTA 1ZARA 4MWIA 2OJIA 3U6HA 3C4ZA 4ANNA 5HBJA 3FXZA 3DOGA 3CTQA 3PSBA 4RFMA 5KZIA 4ZY5A 3VQUA 3NW7A 1LEZA 3KCFA 4AA4A 4C4EA 3QC4A 3EQDA 5LMKA 1RJBA 1BUHA 1CSNA 5HKMA 5JGBA 5IH5A 1DI9A 1FGIA 3R7OA 1OUYA 2DWBA 4QMUA 3UIMA 1BL7A 4L43A 2OJ9A 3FV8A 4BDBA 3F61A 3IGOA 2I0VA 3DB8A 5DE2A 3KF4A 4TWCA 4YJQA 1Y6AA 3A7HA 4XV9A 3SRVA 4F99A 3MIAA 1TVOA 3TZ7A 1ZZ2A 5GJFA 2VWXA 3CJGA 5EYDA 3F2NA 2QOFA 5DWRA 3WZKA 4G3CA 2BFYA 3TEIA 1J3HA 2RFSA 5LXMA 2I0EA 2X8DA 4KKHA 2W1HA 2UW9A 4D9UA 5AR2A 4G6OA 2BAJA 1STCE 3OEZA 2IF8A 3OW4A 4R8QA 3PY1A 1M2RA 2PE2A 2WELA 2XJ2A 2FSMX 4CMUA 4F7SA 1WAKA 4GT5A 3FPQA 3RPVA 3U51A 1S9IA 3DKOA 3TNIA 2YFXA 2G2IA 1VEBA 4EK5A 2JDOA 4R7HA 4MBIA 3R73A 4JNWA 5DEYA 5EW8A 4AW1A 4AZSA 4A4OA 4AN3A 4RLKA 3PA3A 4AN2A 4F0FA 3FZPA 4JBPA 4LRKA 3TV7A 5DRDA 4TT7A 5ANJA 3BHVA 3OTVA 5KKRB 4MD8E 1MQBA 1NXKA 4FEQA 4BDJA 4MYGA 1WBOA 2IW6A 5FEQA 2W4KA 4GEOA 4QTCA 3LFNA 5FTQA 2WU7A 5HTCA 4FT7A 4QPSA 3V5PA 4QT1A 3G2FA 3DJ7A 5CF8A 4ZSEA 4UBAA 3L8SA 5AADA 4BIEA 1JQHA 4BYIA 2WXVA 2JIUA 3C50A 5G1XA 5IA4A 2GCDA 3ELJA 2YDIA 5KE0A 3VHEA 1GIHA 4O4EA 4KWPA 3U4UA 2O8YA 4BTKA 2X9FA 2C1BA 3G6GA 5CENA 3OOMA 4BC6A 4M68A 4EOPA 3GCQA 1OKVA 3GC8A 3R8LA 4CV8A 3ZSIA 1Z9XA 3QQKA 4FIIA 4CLJA 1KV1A 3LCTA 4W9XA 4QYEA 4RQKA 2FGIA 4QP9A 1OL7A 2R0UA 4ZSAA 2XM9A 4KIQA 4NCTC 4YBKA 4BZNA 3BZ3A 2X4ZA 3P08A 4F08A 4I5PA 5GJGA 4PWNA 4ZSJA 2JBPA 4YZNA 2AUHA 4XS2A 2HXLA 2BCJA 2ZOQA 2VTRA 3LLTA 3QX4A 3VO3A 3PRIA 5L6OA 3CS9A 4K6ZA 2HW7A 3ORPA 1MQ4A 2BRBA 3VBTA 2C6MA 3V5WA 4FVRA 5AA9A 4MXCA 2BR1A 1XJDA 2EXEA 3ZLYA 5A4EA 5AV4A 3TZ8A 3FXXA 4BKJA 1EH4A 3I81A 3Q9WA 5I3OA 4CEGA 1XH8A 5AA8A 1Y91A 3MYGA 3ZEWA 3EN5A 3COHA 4M84A 4R3PA 2W1DA 3RPRA 5HX6A 2EXCX 4XP3A 3O8TA 2VAGA 5HG7A 3UO6A 4CXAA 4XYFA 3B2TA 3BYUA 2YIXA 1NVSA 2J0KA 3II5A 4QMOA 2UW5A 1YDSE 2C6KA 5CVGA 3IDCA 4U3ZA 4ANOA 4AX8A 2X4FA 4C38A 2QOCA 4LV8A 4F4PA 4BGHA 3LFSA 5CEPA 5HORA 4CKIA 2OW3A 3R9NA 2EVAA 4YNEA 4KSPA 5AR7A 4C35A 3JVRA 1APME 4FZDB 4P2KA 5L2TA 3UC3A 4OTPA 3FY0A 1OL2A 3KY2A 5HG8A 5HVKA 3QZFA 4USEA 4DLJA 1H0WA 4CRSA 3FSFA 3QRUA 3EQCA 4DH3A 2VNYA 2GU8A 3E88A 3GU7A 5FGKA 1WBWA 3KXXA 3FWQA 2PK9A 3A7FA 4QMMA 4MF0A 4C37A 3FQHA 4LMNA 4APPA 1U5RA 3RPOA 4C7TA 1FVTA 4EOJA 4AOIA 4EQCA 3QRTA 4FOBA 3UNKA 4U44A 4D1SA 3U9NA 3DBEA 3A7IA 3R9DA 3UO4A 3ZU7A 5E8SA 3W1FA 4ZLZA 4QP6A 3R63A 4MF1A 1YI3A 3QC9A 5CX9A 4PMMA 1BLXA 4E4NA 4YUQA 4BRXA 2HELA 5BYZA 4BDKA 4OR5A 4KBCA 4HZRA 2CMWA 3AGLA 5E1EA 3LZBA 5K5NA 3FZSA 1YRPA 1HCKA 4DINA 3DY7A 5JT2A 4FF8A 4O0VA 5CAPA 2JD5A 2Q0NA 5GZAA 3TNPC 2UZUE 3POZA 3QQLA 4FT0A 1O9UA 3ANQA 3ITZA 4FR4A 4XLIA 4FUYA 3UOLA 5IDNA 4MHAA 1ZY4A 4D0XA 4ZTMA 3PP0A 3KF7A 2CHLA 4Y85A 3VF9A 4MD7E 4FVQA 3DNEA 5EI2A 3PA4A 1YQJA 1JKLA 3PA5A 4W8DA 5CYIA 3EYHA 4RIXA 3HDNA 3ZO1A 4I21A 3Q3BA 4OTFA 1ZMVA 2OBJA 3PPZA 4X0MA 4RG0A 1W82A 3QCXA 5CNNA 2WU6A 4FV0A 3WE8A 3PJ8A 2XMYA 3UJGA 3RM6A 4WRGA 3QTIA 4V05A 4AT3A 4DGMA 5TO8A 2VO3A 3RK9A 2QOIA 1F5QA 1GJOA 2F57A 3FPMA 2VUWA 2YIQA 3D94A 4FKSA 4Z3VA 4FIHA 2IZSA 3PJ3A 5GNKA 5HE0A 4F7LA 4UY9A 5DHJA 4X21A 5AAFA 3DZQA 4KBAA 3FLYA 5HIBA 5BQ0A 3I5NA 1E9HA 4G6NA 5C9CA 3R21A 4I92A 3MSSA 5LCKA 4PMSA 3U4WA 3AD4A 3MJ2A 4Q2AA 4NT4A 4XRLA 5IH4A 5CAQA 3ZC5A 4MAOA 4XNEA 1U59A 2J50A 2ZDUA 4QMTA 5CSPA 5I9UA 4F9BA 2GS6A 1CTPE 4PP9A 2J4ZA 3ZRKA 5L3AA 3NX8A 4EH9A 5IUIA 2JITA 1JKTA 2VTIA 4ASEA 2WNTA 3HGKA 3IW5A 2QURA 4EKKA 5CAVA 5BUJA 1IASA 5K0KA 2W4JA 4XV1A 4TZRA 5M53A 2V7OA 2UZNA 3BIZA 3C9WA 4JIAA 1VYWA 1VJYA 3QRKA 1H07A 4UALA 2BFXA 1GNGA 4EC8A 4ZJJA 4ALUA 3QCYA 3TV4A 4JT3A 5EK7A 4FTOA 5HX8A 2J9MA 4HYSA 4X6QC 5M4FA 2B9JA 3GVUA 2W4OA 4TWOA 1XH4A 1OPKA 5HBEA 1YWRA 3OT8A 3P7AA 4QMVA 3IW7A 4NEUA 4EZ3A 2G01A 3MPTA 4QQJA 2VTMA 3HMPA 3NLBA 4D4RA 4AZEA 4XG6A 3E3BX 3LVPA 3BGQA 2VWVA 3W18A 5EM6A 5BMMA 4C3RA 1URWA 3MV5A 3NW5A 4S32A 3E92A 3DQWA 3PYYA 4PRJA 4AGWA 4AWIA 1K2PA 4ASZA 2E9UA 2B1PA 3D5XA 2JEDA 3TN8A 4AE6A 4ID7A 4PX6A 3MDYA 3LCKA 4OTRA 3QTUA 5JGDA 1W98A 1OI9A 2PZIA 3P78A 4GK4A 3IDBA 1GZNA 5CEQA 1FPUA 2NRYA 1Q62A 2C68A 3UNJA 3LXKA 4EOQA 4IE9A 2Z60A 4MH7A 4X3JA 5CLPA 2X0QA 3W2OA 4GSBA 3FC2A 4BCNA 4I1ZA 3HNGA 3QZGA 1UWJA 4FSMA 5FRIA 4G5JA 3OD6X 4EWHA 2WFYA 5HCXA 3VBYA 2X8EA 3PVUA 4UV0A 2R4BA 2V55A 4APCA 5BUEA 4KA3A 2GNLA 2GSFA 3C0HA 3LXNA 4GFOA 4IACA 2PVYA 3DV3A 3GBZA 4L9IA 4X3FC 3BWFA 1IA8A 4WNKA 5CVHA 3VIDA 3TUCA 1PMNA 1TZDA 2DQ7X 5JSMA 4EQUA 4QYHA 5FDXA 4PP7A 3GB2A 2XRUA 3AMBA 4D2VA 3ROYA 4GK3A 4ZXTA 2NPQA 4ANLA 2PMIA 3BHHA 3PTGA 4V01A 4QNAA 5LCJA 4HYHA 3QD3A 2UV2A 4LUDA 2XK6A 4RJ5A 2VX3A 3SOCA 4X2FA 1O6KA 3W10A 4C2WA 2C5OA 2Y4IC 4I22A 2QHNA 4C4HA 3D83A 3MFRA 2Z7LA 4FG8A 4CVAA 3R8ZA 4QPAA 4BIDA 5JQ8A 5LMBA 3QQFA 3WILA 4C61A 3NWWA 4DAWA 4YBJA 3JUHA