2X7FA

Crystal structure of the kinase domain of human traf2- and nck- interacting kinase with wee1chk1 inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
299
structure length
276
Chain Sequence
LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAGTPYWMAPEVIAYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TRAF2 AND NCK-INTERACTING PROTEIN KINASE
publication title Crystal Structure of the Kinase Domain of Human Traf2- and Nck-Interacting Kinase with Wee1Chk1 Inhibitor
rcsb
source organism Homo sapiens
total genus 80
structure length 276
sequence length 299
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2x7fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2x7fA01
4GIIA 4O21A 4O0YA 3BU3A 3WOWA 4PNIA 4C37A 4RQKA 1UWJA 3T3UA 1ZZ2A 2XNEA 4NWMA 4V05A 4F7JA 4HNFA 2ITXA 4R5YA 4BWKA 3IW6A 1GIHA 5CEPA 4ZSEA 3NDMA 4PQNA 5EYKA 1PXOA 1W98A 4HYSA 4F1MA 3BELA 1SYKA 2G15A 4FZAB 3LFBA 1UU3A 4O27B 1GNGA 3DTWA 3GCVA 3S4QA 3TZ8A 4DN5A 4DHFA 4LOQA 5FBOA 3HRCA 2ZM3A 3C9WA 4TYJA 5CU3A 5ETIA 4CKJA 3UQFA 2HY0A 3OWKA 5BYLA 3Q9YA 5EM6A 4MTAA 4CT1A 1Q8ZA 2PMIA 1IA9A 4I5PA 4CZUA 4UZDA 2W9FB 5IDNA 5EH0A 4JL9A 3QQGA 3WYXA 4BGGA 2V7OA 4K33A 4YZCA 4D9UA 1WVWA 3NW6A 5JQ5A 1WCCA 3BCEA 4JDKA 3KULA 2J0IA 3NVMB 4BC6A 4F0GA 3EL8A 4A9TA 5IH5A 1M14A 5KZ0A 3JUHA 2VO6A 4MXCA 2CKOA 1YWRA 2ZB1A 3D94A 4U3YA 1MQBA 4X0MA 4FKTA 1VEBA 5DRBA 5CALA 4O38A 5BYYA 4II5A 2BDJA 5EK7A 4GRBA 4Q2AA 3VS1A 4IJ9A 4B8MA 4EZ3A 2VNYA 3R02A 4EJ7A 4Q9ZA 3II5A 1BKXA 1WBWA 2YM3A 3F61A 3PXZA 3EZVA 2EUFB 4FKIA 5LVNA 2XKDA 2JFLA 2OJ9A 4ALWA 5IUIA 3UZTA 4U9AA 3F3WA 3H4JA 5M51A 1UU7A 2VAGA 2XNBA 5HLWA 2X81A 2PZRA 1PMEA 4NFMA 4KIPA 4L53A 1VJYA 3LFCA 4BTKA 5A4CA 3W32A 2PUNA 2IJMA 3QCXA 1OL6A 1OZ1A 2CSNA 4H3PA 4WIHA 3CLYA 5BPYA 4D4VA 3QTIA 5JEBA 4XBRA 3CIKA 1GOLA 2J51A 2XF0A 5AP0A 2OXXA 1Q8UA 4JBVA 4ALUA 5IA1A 4O0UA 3FZOA 4HJOA 4ANSA 2OO8X 5ITAA 3D2IA 5EQEA 1ZY5A 4HNIA 4C0TA 1P14A 4ZTQA 5KZIA 3M1SA 4AFJA 3QA0A 4EORA 3QGYA 3EN5A 4FKWA 4G1WA 2X7OA 5FWKK 2VWVA 5T68A 3TNWA 4OBPA 3FI8A 3LIJA 2W96B 5EI6A 5LVLA 4MQ1A 3BGZA 1XKKA 3QCYA 2VWIA 2QONA 3DKOA 3Q6UA 4JBOA 3UZRA 4AT5A 4C2WA 1S9IA 1H07A 4GVAA 2OK1A 3OZ6A 4TYIA 3DB8A 2WMQA 3S0OA 2VRXA 2C3LA 2WIPA 2QOQA 4S31A 2XMYA 2AUHA 4PL5A 2C5OA 4I6BA 1AGWA 2ITYA 3BE2A 2ITVA 4IB5A 3UNKA 2WXVA 2UVYA 2WO6A 4TYHA 3C5UA 1TVOA 4UWYA 3TZ7A 2I0HA 2CMWA 5A6NA 2ZMDA 5CAQA 2HZ4A 1ZRZA 2XJ1A 1J7UA 5FEDA 3UO5A 3RHXA 2DQ7X 5HESA 3RPYA 3WBLA 3SA0A 4AZTA 4L46A 3A62A 3PIZA 2VD5A 3LPBA 4YC3A 3EMGA 4R8QA 4U40A 4QNAA 4K11A 4F1OA 3KVWA 2YM4A 1OIQA 5IA5A 4O7TA 3GB2A 4KSQA 3NRMA 2JAMA 2YAKA 5JRSA 4E1ZA 3EN6A 3FC2A 2FH9A 4O7LA 4V0GA 1F5QA 5EKNA 1YDRE 3MVHA 4RWLA 2YCQA 3AC3A 3VNTA 4E4MA 4FKPA 2BCJA 3B8QA 1DAWA 3TUCA 4D0WA 4MNFA 3O17A 4FZ7A 4UV0A 4YJRA 1YDSE 4ZS4A 3QU0A 5IMXA 5M08A 2F7XE 2YCFA 3KU2A 4OTRA 4FV4A 4G17A 5DR6A 2VUWA 5LVMA 3MY5A 4YPDA 1Q3WA 1IG1A 3A60A 3ZSHA 5AAGA 4ANBA 3KXNA 5M4UA 4DLIA 4CFWA 3FWQA 4IAYA 4R5SA 4IWDA 4FV6A 3W2OA 2QU6A 1OKZA 5AP5A 3UIMA 4NW6A 3CXWA 4O0WA 2PMOX 4IZAA 3BLQA 4A9YA 3Q04A 4B8LA 4X7QA 2ITUA 3MW1A 2YCSA 2PWLA 2W4OA 2YDJA 3NUUA 5AP6A 1JLUE 4G6NA 3ZHPC 2JIUA 4AA0A 3O51A 2XRWA 3DNEA 2QCSA 4UWBA 4FIHA 3RZBA 4LRJA 4Y85A 3NX8A 5AUUA 5IF1A 4G3FA 5CXHA 4F6UA 1XH4A 4TPTA 4CV8A 2YIYA 3U6IA 3N51A 2I0YA 5HCXA 1DM2A 2QO9A 3ID6C 5EYDA 3QUPA 2QLUA 4JRNA 5CY3A 5AMNA 4A4OA 4FEVA 1OKVA 3GU7A 3UMWA 1ZLTA 2FYSA 2R7BA 5F20A 3FXZA 4F65A 4CTCA 2YITA 2CGWA 1KSWA 2CGXA 4ZTNA 4E5WA 3TKHA 5EQPA 2HZ0A 4XV1A 4YHTA 1LEWA 3ORKA 3H3CA 5AWMA 4BHNA 3C0HA 4NH1A 3ZSIA 2ONLC 3Q53A 3IGOA 3DJ6A 3FZRA 3VBYA 4Q5HA 4O7RA 3ALNA 3EIDA 3A7JA 4YMJA 2VN9A 1Q97A 2VV9A 1WBSA 3THBA 1ZYCA 2R3KA 3G6GA 4M68A 4FGBA 3QLGA 1PY5A 4X3JA 2UW9A 5I4NA 1ZYSA 3E62A 2B55A 4IX3A 1WBNA 2W17A 2W1EA 2WTKB 4O6LA 2YERA 4S32A 3KREA 4A7CA 4DH8A 4ZY4A 2WMAA 2WEVA 2YAAA 3OOMA 5LOHA 3F2AA 3FY0A 5DGZA 1JPAA 2PY3A 2RGPA 4R7BA 2X7GA 3CPCA 2GU8A 1G5SA 1PXMA 1XH5A 2IVVA 3D4QA 3HMNA 3LXLA 3NYXA 4MWIA 2CCIA 4LUEA 3RK5A 4UN0C 2QOOA 4RC2A 4C36A 3CE3A 4G3CA 3QWJA 2WHBA 4H36A 3WF6A 3FKLA 4FSZA 3QRUA 3FLQA 4XG6A 2Y8OA 3T9IA 4EH8A 3A61A 2GNLA 2OXYA 4O7VA 4D4RA 5DE2A 5AAEA 4UMQA 4D1SA 3H9OA 2JKQA 3MESA 5LARA 3IONA 2ZOQA 3F9NA 4IVCA 3U8WA 1Q8YA 4FT3A 3FLYA 4H39A 4QP1A 5H2UA 1URWA 2NRUA 5EHYA 5E8VA 3HV4A 4JLCA 5HTIA 3OCBA 4DG2E 2YLFA 4Z55A 2JDVA 3MJ1A 1UKHA 2R5TA 4FSYA 4EH4A 4YURA 5IQEA 1V0OA 4WNKA 4ASXA 1H24A 1L8TA 4DCAA 3AD6A 3KGAA 4NUSA 4ZTSA 3JY0A 4AN9A 5IH4A 3GBZA 3QRTA 2C6KA 3HP5A 3E8CA 4Y95A 5CEQA 5JZJA 2CNUA 3Q4ZA 2ZDUA 4C58A 4P90A 1BX6A 1PJKA 5HD7A 3U55A 3HV7A 4FTQA 4E8AA 5AUTA 4TNDA 3EFJA 1OIRA 4QP8A 5AFVA 4JDHA 3BV2A 1PXLA 2VTAA 3NUXA 5BVKA 1IR3A 5ACBC 4QMSA 4UYNA 4YZ9A 4LRKA 2W1IA 2GFSA 5K9IA 2OH4A 4KRDA 5A46A 1YHSA 5JRQA 1B38A 5G6VA 1H0VA 2GNGA 4TWPA 5F1ZA 4U80A 2IPXA 4YJOA 5LWMA 3DKGA 3Q6WA 3HECA 3TIZA 1IRKA 2W5AA 4QMXA 5E8UA 2I6LA 3QUDA 3BU6A 4PTEA 1OPLA 2VO7A 4M8TA 4O91A 4IVDA 5AR8A 3PSCA 3KA0A 3IO7A 2BTSA 5EFQA 3BX5A 4W4XA 3S95A 4Z3VA 4U0IA 4X6QC 4HVGA 4FV0A 5CTPA 3RAHA 3TWJA 3ETAA 5HQ0A 3RI1A 3RCJA 4EHVA 2VTPA 4FC0A 3MH3A 2J0KA 2X8IA 3NUAA 3MYGA 3F7WA 3PIXA 3DS6A 3MN3A 4YTFA 1RW8A 3ORPA 4F7NA 3F2NA 3OC1A 1NY3A 3TNPC 4ERKA 4F9BA 3CSVA 3TIYA 3DKFA 3NNVA 3JY9A 3ZUTA 4WG4A 5FD2A 1WBOA 4BTFA 5FXSA 2I7QA 3ODZX 4EL9A 2O64A 3L8PA 4HZRA 1PXIA 5F4NA 3TNIA 4MF1A 3RKBA 5JGAA 2IWIA 4TKSA 4FKQA 1REKA 1WFCA 4DEEA 5M06A 1TQMA 4IAKA 3NZ0A 3TDVA 4E93A 2ESMA 5IG1A 1FOTA 4WUNA 5B2MA 3DV3A 5D12A 5HU3A 4E6DA 2PVJA 3ORTA 2RFSA 5H8BA 3LJ1A 5M07A 3ORLA 4OTHA 4IWOA 4LFIA 4S30A 1ZY4A 5DLSA 3WZEA 5HCYA 3E63A 3QX4A 2WNTA 4YJVA 4JAIA 4C33A 3FQSA 2XA4A 2Y4IC 5AAFA 5KNJA 3N4VA 4QTBA 3GP0A 3OXZA 3PDTA 5L3AA 3NWWA 2J5EA 4FI1A 3LFQA 3VS4A 4FG9A 1LR4A 3W8QA 2OBJA 3V5WA 4EOOA 3BKBA 5CU4A 4BDFA 4BCOA 4QP9A 4IC8A 2WTDA 3BZ3A 4MD8E 3F3TA 4ZIMA 4DTBA 4ANQA 4PTCA 2WIHA 4BN1A 2Y0AA 3BYMA 4YJTA 5ANKA 1O6YA 4D1ZA 4ARKA 3CY2A 4FTKA 2XP2A 3UP2A 4AT4A 4YBKA 4BICA 4E6AA 4IACA 1GZOA 2XCHA 4OTWA 5CAOA 4GK4A 3ZMMA 2YM8A 3GOPA 3A7GA 2OXDA 4D4YA 5HOAA 1J7LA 3CR0A 2YA9A 3BI6A 4TXCA 4CZYB 4BCNA 2C0TA 2WQNA 4FIJA 4ZSAA 4LRMA 2PHKA 4GT3A 3UVPA 3DFCB 2OF4A 3ZRKA 3UG2A 4EK8A 5DT0A 4BI1A 4N4SA 3LHJA 4E5AX 2XEZA 3R83A 4HOKA 4RFMA 3KL8A 2Y9QA 4E6QA 1PYEA 2W1DA 4C35A 2QG5A 4D9TA 4NU1A 4LGGA 3RHKA 5BQ0A 4QMMA 4XNEA 4DH1A 3D5XA 4EQMA 4I0TA 3R7YA 4MQ2A 3P86A 3VF9A 4QQTA 3D2KA 4NCTA 4MK0A 4IX6A 4IM2A 5EDRA 4YSJA 5AV3A 5HO6A 2Z2WA 2HWOA 3R1NA 3VBTA 3WE8A 4I24A 3JYAA 3UIBA 2E2BA 3FL4A 3GXLA 4M7IA 3Q60A 3R73A 3QX2A 5HX6A 3R9RA 1W0XC 5KMMA 2JDTA 3VS5A 5M56A 4O96A 4E4NA 2QVSE 4LOPA 5HCZA 1H27A 2QQ7A 4NSTA 1BMKA 1BL7A 4XS2A 3OT8A 5IA3A 3OBGA 4MNEB 2BRGA 3FXXA 5JFXA 4TYHB 5AX9A 2PUIA 2I0EA 2XK8A 3COHA 3R9OA 5CF4A 5CSPA 2UZTA 2GQSA 2CCHA 3B8RA 4UALA 3ZO3A 4S34A 3S00A 3G33A 2XIRA 1OVEA 3NYNA 4IC7A 3CQUA 4XLVA 3FSKA 2BRHA 3GFWA 1HOWA 4YJUA 2PZYA 3ZLWA 4CZTA 3UOHA 4EZ7A 5TR6A 4R78A 5HIEA 2VTNA 3P79A 4GJ2A 2XK6A 1B39A 3SOCA 4C7TA 5TOZA 2UZEA 3BV3A 2QO7A 2IZUA 3Q4UA 2WPAA 4IWQA 4YP8A 2O65A 3ALOA 3LCSA 5FEQA 4YJPA 1Q99A 3MY1A 5F94A 5CWZA 2GS7A 3HMMA 4E5BA 4CG9A 3ZDIA 3VBQA 4FYOA 4DEIA 4E6CA 2OWBA 3K3JA 4ENXA 1GZKA 3MTLA 2X2KA 5CQUA 2HZIA 4APCA 4QTEA 2ZM4A 2WMWA 1CKJA 5HBHA 1WBTA 4DF3A 2P0CA 3I7CA 4EWHA 1ERKA 4GKHA 5I9ZA 1MP8A 3AOXA 2J0JA 4UXQA 5FTOA 4ACDA 4M3QA 2ZJWA 4HVSA 3IOKA 1H26A 5EM5A 5DI1A 1DAYA 5LWNA 2X0GA 3E7VA 2W9ZB 2C30A 4I6HA 2R3RA 5AP7A 3QF9A 3OVVA 1FVVA 2ZAZA 4UXLA 5DRDA 4NEUA 4KIQA 4DH3A 3UOKA 1ZXEA 3EQPA 1H08A 3K54A 5HEZA 4YC8A 5HHWA 3SQQA 4EK4A 3HAVA 3MIAA 4AFEA 3ELJA 3CGFA 1R3CA 3DPKA 4I1ZA 4RBLA 5AV0A 3DQXA 3QKKA 4XH6A 1U4DA 5D7AA 4FA2A 1KE7A 3IG7A 5A9UA 3E8DA 4C4FA 3QQHA 4M0YA 4CFNA 2CNQA 3DLSA 4MYGA 3WZDA 3PWDA 2B1PA 3UC4A 4IZ5A 1Q41A 2UZUE 3RM6A 4YPSA 3VBVA 1APME 2JC6A 2C6LA 3BYVA 3NYOA 4FKOA 3REPA 4D0XA 4ZP5A 4DTKA 4GW8A 2CKEA 3SG8A 2XYNA 3HUCA 3C0IA 2Z7RA 5DT3A 3C4CA 3R0TA 1GIJA 4PDYA 3Q32A 5FEEA 1O6LA 3V04A 4AOTA 1WBVA 1OGUA 2X4FA 2QHNA 3B2WA 3FAAA 3GGFA 4CMTA 2ACXA 3DY7A 4DG3E 5I3RA 2C6OA 4R1VA 5FGKA 4LMNA 5FG8A 5KMIA 5DH3A 2QOCA 3SC1A 4ZOGA 4AN2A 3PPJA 2QC6A 5BVEA 2WQBA 5J7BA 2ZV9A 2WZJA 4Y72A 4TY1A 4YR8A 4B99A 4ALVA 5DR9A 4IX4A 2B9IA 2QI8A 2VGOA 4L44A 4L6QA 4DFLA 3DXQA 2QHMA 2W1FA 4MXYA 1W84A 5M44A 2KULA 3V51A 5L2SA 4QMTA 4JJRA 2ITQA 1M17A 2ZV8A 4MHAA 4B0GA 2OJGA 5KMJA 3ULZA 3P23A 4XRLA 4BCQA 4ZLYA 5DFPA 2XBJA 2PE2A 3U9CA 5J1WA 4GK3A 3POOA 4TW9A 1V0BA 2W1HA 4OTQA 3C4FA 1R0PA 3EJ1A 3F66A 4GK2A 4FNZA 4AW2A 5IEXA 3LLAA 4G6OA 5I9XA 4IFCA 1PMVA 2VTMA 2W5BA 4JS8A 2ZM1A 4CXAA 1U5RA 3DQWA 5AR5A 2BDWA 3MH1A 1LEZA 4M84A 4XUFA 4XYFA 4IQ6A 4RVTA 3CGOA 4JX3A 2GNHA 2PVMA 2VTSA 3KRJA 3LOKA 2OKRA 3Q9XA 4BBMA 4DFBA 2JLDA 4AN3A 4GUBA 3SW4A 5B7VA 3DXPA 5JMSA 2VO0A 4FTJA 4YHFA 3KCKA 3O8UA 5ETCA 4HW7A 1P2AA 4K6ZA 3QYZA 3F69A 1RE8A 4DITA 2UW3A 4IAFA 4JOAA 4NM0A 3COMA 4G6LA 3QZFA 4DGNA 4FEQA 2Y7JA 4FT0A 4WD5A 2C5VA 3QQKA 3NMUF 2R4BA 3ANQA 4ZZMA 3ZM4A 3QD4A 4O0TA 5D9HA 4W8EA 4FSWA 3MB7A 2SRCA 4HVIA 5CXZA 5E4HA 4FUXA 4ONAA 3PJCA 3W2CA 4I93A 3R7UA 4D2RA 5IZFA 2HW7A 2QNJA 4DGMA 4QO9A 4RQVA 5AADA 3QGWA 4HGEA 4ZMFA 4BBFA 4PP9A 5E90A 4BWPA 5HKMA 5AM7A 4RX5A 2XIZA 2F49A 4EC8A 3KXXA 5A4LA 3P7BA 4BRXA 2WTWA 3PVGA 2R3PA 1IA8A 1U46A 3F5UA 3BHVA 4AS0A 4GVJA 5L2WA 4CKIA 4JG7A 2GS2A 3TEIA 4IW0A 3ZH8A 3LM5A 5CVFA 4A4XA 4A9RA 1VYWA 1XQZA 4DT9A 2W5HA 4QP6A 5D7VA 4H1MA 5HBEA 4L42A 4BDJA 4O7YA 2ZMCA 4Y5HA 2J5FA 4J8NA 5E92A 4DGLC 3NNXA 4BR3A 3ACJA 4BI2A 4ACCA 4G9RA 2ZV2A 1YI4A 5J79A 3FV8A 2F2UA 5KBRA 2I40A 2PE0A 3VW8A 4AZSA 2R0IA 5DMZA 3R7GA 5HG5A 5LXMA 1OBDA 5CX9A 1UV5A 3F3UA 2C3KA 3UODA 5EW8A 4O86A 4I4FA 3PY0A 4BCFA 1Y57A 3CKXA 4X2JA 3IECA 3NNUA 4FV2A 1Y6AA 4CMOA 1F0QA 3IS5A 3AC2A 5DYJA 1AD5A 3OWLA 4FGRA 2PUUA 3VUMA 2QR8A 2C5XA 5CLPA 5CT7A 4DAWA 2VX1A 3QA8A 2C6IA 4O0VA 4DH7A 3F3ZA 3KRRA 5CSVA 4CRLA 2ITZA 5GZAA 4I5CA 5M4CA 3NUYA 3QZGA 4L52A 4AGDA 5CEOA 3DZQA 3QRJA 3ZUVA 4AW5A 3O7LD 1JSTA 1OUKA 2R7IA 5ANIA 5DG5A 4EYMA 3U6JA 5LVOA 3VC4A 1YOMA 3Q9ZA 5IQHA 4A9SA 2EB2A 2OICA 5CASA 2C4GA 4EYJA 4ACHA 4BVUA 2BALA 4YZMA 4EQUA 4F08A 2VTRA 2A4LA 5I9UA 3V5TA 5LMBA 2WGJA 2ITPA 4GJ3A 3ZO2A 1OITA 3W2SA 1SMHA 3OW4A 4O7SA 1E9HA 3F5XA 1J1CA 2XCKA 3CD3A 3EL7A 4HYIA 5AM6A 3CD8A 3DK3A 5I9VA 4GS6A 3C50A 4P7EA 3PA3A 3RPOA 3L8VA 4O1OA 4BTJA 3HV6A 2W05A 4ITHA 3GEQA 3QTZA 1FVRA 1Q4LA 2FVDA 4ANNA 3G51A 1W7HA 4UMPA 1R0EA 3IDCA 5F95A 3ZS5A 2OGVA 3JVRA 3HVCA 3TKUA 4ANLA 4F9AA 3QKMA 4CD0A 5HNGA 5BUEA 1FVTA 3KXHA 1IEPA 3OY1A 4IM3A 4QMUA 3LQ8A 4YJQA 3BEGA 3UO4A 4PNKA 1LUFA 1ZWSA 3TM0A 4N6ZA 3W33A 5CENA 4L67A 4NCTC 4MAOA 3BHYA 4XG2A 4ASEA 2QG7A 3EFWA 2OIBA 5CAVA 3VUTA 2QR7A 4H3QA 1XH7A 4ZSLA 4O22A 3E8NA 4NK9A 2GNIA 2Z7QA 3NLBA 4EKLA 4JNWA 4E20A 5T6KA 2BIYA 4WHZA 3V6SA 3G5DA 3FE3A 3FXWA 4QP4A 1GZNA 3EQCA 2IW8A 1XJDA 3C51A 3SGCA 3KQ7A 2O2UA 4FKUA 3ZC6A 2IZRA 3FMEA 2VTOA 4PY1A 5ANEA 3VRYA 4DFXE 3ORXA 4CLIA 4IIRA 4WT6A 5IA0A 3C1XA 4O0RA 4UZHA 2V0DA 4AGCA 5CEKA 5ICPA 4J71A 4EI4A 2HOGA 3IW8A 4XG7A 3LXNA 4B4LA 5LCJA 3LQ3A 3LXPA 2G2FA 3HRFA 4OTDA 4UYAA 2YDIA 2B9FA 4BCGA 1PKGA 3O7LB 3CQWA 3VS7A 1NVSA 3DK7A 3UYTA 3H0YA 2FO0A 3EYHA 1M52A 3QLFA 1PXNA 4FV7A 4R7HA 3WZKA 3O8PA 4U44A 4YZDA 5C1QB 3OP5A 4NZWB 2FSTX 4HVDA 4FL2A 4MNEA 5L6WL 4F9WA 5J7HA 4ZZOA 3I7BA 4FTNA 3D5VA 3DBQA 4F63A 1ZMUA 3U51A 5CZIA 4YU2A 3PG1A 2OLCA 3AC4A 2HAKA 3I0OA 2VWBA 3CJFA 5E8TA 3L9LA 3LKMA 3FMHA 1OIYA 2B53A 3PJ1A 3D83A 1B6CB 3R9DA 4GYGA 4KABA 4RA4A 4MWHA 3F88A 2YFXA 4IDTA 3TG1A 3UP7A 4C02A 3A8XA 5L2QA 3WF5A 3D14A 1J3HA 3C13A 4KNBA 4USFA 4XHKB 3QXOA 5DN3A 4I22A 4XG8A 4EEVA 1BYGA 4W9XA 2JDSA 4EOPA 1ZYJA 2VTTA 5JKGA 3C0GA 1QPDA 1U59A 3AD4A 4FZ6A 4IWPA 4QP3A 5E8XA 3KXGA 4DEHA 3SLSA 5FXRA 4OAVB 1DI9A 4OUCA 3R7IA 4DFZE 5FM3A 3P78A 1AQ1A 2X2MA 3P5KA 4G3GA 3MTFA 3GUBA 3BPRA 4QQCA 3FDNA 5J8IA 5IA2A 4F6SA 2VTQA 3COKA 3FSFA 3MGYA 4RVMA 4DBXA 4R77A 4ZXTA 4I4EA 2XKFA 3NUPA 5A54A 4EOJA 2EXCX 5J5TA 5E1SA 4YNOA 2BVAA 5A4EA 5LMAA 5J1VA 5KO1A 2GHLA 2VWYA 2XB7A 2XRUA 1GIIA 5JFSA 4FL1A 4NFNA 3IW7A 1MRVA 3F5PA 4PUZA 3S3IA 2F57A 5CI6A 4QYHA 4O2PA 3WF9A 3EN7A 4IAZA 2F7EE 4KS8A 5TT7A 2BDFA 4OTFA 2R3FA 1R39A 4KKGA 3ENMA 2HWPA 3UIUA 5HVYA 3GC9A 3UBDA 2X6EA 4BKZA 1H4LA 4C61A 2BAJA 1XO2B 4Z9LA 3LXKA 3Q5IA 4NJDA 4BDIA 2GSFA 3OHTA 1RJBA 3IW5A 4L68A 4O7ZA 3P4KA 4DEGA 5HICA 3ZZEA 5AP1A 2QOBA 4I92A 5HTCA 3OS3A 2CN5A 3VAPA 2C69A 4BI0A 4D4SA 5DR2A 3VS6A 4D2VA 3LAUA 4UB7A 4J98A 3DZOA 3L9MA 4FBXA 4C4JA 2RFNA 2WMVA 2GCDA 2VZ6A 3LVPA 1H8FA 4L7SA 4AW1A 3NCZA 1XBAA 4L9IA 4RSSA 2C3IB 3D15A 2WTKC 1LP4A 3PPZA 4IHPA 2G2IA 3R04A 2W4JA 4ZJJA 1V1KA 3E88A 5E8ZA 4PMSA 4FIFA 4FSTA 4FV1A 2A19B 4XP0A 3WF7A 3VHEA 4E73A 2VWXA 3QYWA 3FZPA 4CVAA 4FK6A 3AMYA 5CNOA 5ANOA 4I0RA 4AUAA 3E5AA 1R78A 2R3NA 4ZK5A 2EXMA 3ZEPA 3EQRA 3I5ZA 4GKIA 4BIBA 4C59A 2W06A 1H0WA 4W4VA 5J9YA 2WTVA 3W8LA 1UWHA 1OI9A 2R3JA 4RIWB 3HMOA 2FA2A 3QTUA 4I6QA 4XBUA 3UGCA 3KY2A 4IE9A 2YM7A 2CJMA 4EJNA 4FKRA 4J99A 2GHMA 3KN6A 4EK6A 2I1MA 1DS5A 3NAXA 4MXXA 4UEUA 3OMVA 5EKOA 3DOGA 3R7EA 1FGKA 2Y6MA 3OG7A 3W1FA 2E9OA 3KFAA 4WG3A 2CHLA 3TV4A 3UNZA 4BDCA 5HVKA 1PMNA 3W2PA 4IANA 5J95A 5IQAA 3EN4A 5BVNA 2BRBA 3DFAA 1SZMA 3ROCA 4CFVA 3FI4A 3MY0A 3UMXA 2IG7A 5TE0A 4W4YA 4RZVA 5IISA 3DAKA 1TQIA 4FTAA 4QTCA 5C27A 2YABA 3VS2A 5K4IA 4QMVA 4O0SA 4BDEA 4XOZA 3FQEA 4U79A 3TTIA 3PFQA 1VR2A 4FX3A 2JIVA 4EUUA 3TNQB 4PDOA 5IQFA 4BZNA 3WIKA 4KS7A 5IQDA 2XNPA 3BQRA 4D5HA 3PA4A 5E8WA 3R8VA 2UVZA 3COIA 2CGUA 1VZOA 2J2IB 5GNKA 1UKIA 3BYOA 3UC3A 3LFDA 2C0OA 3RPRA 3DLZA 2X6DA 3QQLA 4BKJA 5IQIA 3E64A 5HNIX 3I6UA 5HO8A 4M67A 4EONA 4QP7A 3NW5A 2O0UA 4K18A 4BZOA 2BAKA 2XBAA 3OUNB 2EU9A 3QD3A 2F7ZE 3CBLA 3KK9A 3MJ2A 1SNUA 3P0MA 4KAOA 4QTAA 3G0FA 3N4UA 3JVSA 1YOLA 5FTGA 2JITA 3QTSA 2QOFA 5C26A 3NIEA 3L1SA 4BCIA 4BL1A 4TWOA 4X2NA 4AZEA 2VWUA 4YZBA 5FRIA 3GVUA 2P2HA 4H3BA 2JD5A 2B4SB 3CTQA 3FMDA 3Q3BA 3CTJA 3ZO4A 4DT8A 4AT3A 4AWIA 2EVAA 3HDMA 4K8AA 2GTNA 5BNJA 3QZIA 1Q61A 1IASA 1OM1A 1E1XA 2XJ0A 4QPMA 1OL2A 4FK3A 1U5QA 3ZLXA 4YLJA 3ULIA 1ZOHA 3UPXA 2XM9A 3BBWA 3P08A 2ETKA 3UYSA 3NUNA 4G5JA 3DU8A 3QTXA 2H34A 3GC7A 2EWAA 3NVKI 4IJPA 2F9GA 4WA9A 4KBKA 5H3QA 4U45A 3RAIA 5AEPA 5FDXA 2NPQA 4OTPA 4AU8A 4TWCA 4MX9A 4JBPA 2BKKA 3HA6A 3O71A 4I41A 5EDPA 4DEAA 5IUHA 2YWPA 3UIXA 4IZ7A 4RWIA 3RWQA 4FTOA 2Z7LA 3QKLA 2IVSA 2OJJA 4OR5A 1YQJA 4BDGA 2RG6A 2VWWA 5K0XA 4DGOA 2YEXA 4IAIA 3R28A 4TNBA 3ZBXA 1URCA 1H28A 2J0LA 3M2WA 3VUKA 2IN6A 3HV3A 1M2PA 1H1SA 3W16A 3ZXZA 4Z16A 1YXTA 5L8LA 1FGIA 4L3LA 4PV0A 2OZAB 3BRBA 4F70A 3R1QA 2GTMA 4GH2A 5JH6A 4F99A 3D7TB 1M2RA 5IKWA 3LFNA 3PSDA 4X2KA 2XIXA 3VHKA 4CQGA 2WB8A 2GS6A 3UVRA 3ZBFA 2CPKE 3FKNA 3TUDA 3R1SA 3E92A 4TYEA 1GAGA 3UO6A 3LM0A 4LMUA 4FVRA 5C01A 4QPAA 4FSMA 3MPTA 1K2PA 3AGLA 3H9RA 4XV9A 5A3XA 3ZC5A 4BZDA 2BFYA 5H8GA 4GFGA 2OZOA 3RZFA 3Q5ZA 4ENYA 4XOYA 5L8KA 4ZAUA 2HIWA 3MI9A 2CNVA 4AX8A 3JR1A 4WBBB 4YTCA 1XHAA 4QRCA 2BZIB 3GCQA 3H9FA 5C4KA 1XH8A 4NIFB 3UZPA 4D5KA 4N6YA 4F09A 4CFMA 3V5LA 3BHHA 3ZU7A 4AQCA 3QC4A 3EQFA 2ZV7A 3O0GA 3C5IA 4AP7A 2QU5A 4XG3A 3HX4A 2V62A 4C62A 3MA6A 4F6WA 5K5NA 4FIIA 2DS1A 3KXZA 3PY1A 4LUDA 3UNJA 4EHGA 5T3QA 3UPZA 4U7ZA 2VU3A 2WD1A 3C4XA 4DCEA 1E1VA 5DOSA 1KE8A 4O7NA 1Z57A 2O8YA 2HXQA 2ERKA 3ZSGA 4EBWA 5BUJA 4HGSA 4OTGA 4ZJIA 3R7VA 4GMYA 3NIZA 4NTTA 2PK9A 3EOCA 3IQ7A 2WTJA 5CU2A 3ZCLA 3BYUA 1OL1A 3IK3A 3V01A 4EOLA 3CC6A 4IXPA 4RJ7A 1G8SA 3I0QA 3C4ZA 2B9HA 2BHEA 4R3PA 4U97A 5KBQA 3IDPA 4OBQA 4IFGA 2HELA 3UTOA 5HBJA 2UZDA 3SHEA 1SVHA 2IO6A 5GJFA 5JQ8A 2PZPA 4LOOA 1KV1A 4F7LA 3FMLA 4QTDA 4FYNA 4I21A 3PYYA 3D7ZA 4I94A 5AV1A 3CP9A 1MRUA 2GQRA 2UZWE 3OROA 1O9UA 4X6RA 4A4LA 4WUAA 3U4UA 5EI8A 4RT7A 4F64A 1UU9A 3KRXA 5G1XA 2JAVA 1MRYA 3BIZA 2PMLX 4LYNA 3RAWA 3PZHA 4RWJA 1L3RE 3KRWA 4OT5A 4JRVA 4M0ZA 4RX7A 5KHWA 4AW0A 4TN6A 4FT9A 3HMIA 4CYIA 3PA5A 2QKWB 3FMNA 1CKIA 2R3QA 5B2LA 5KHXA 2OG8A 3U87A 1HCLA 3LFFA 4I6FA 4P5ZA 4MBLA 3Q2MA 3VRZA 3OCTA 5JK3A 2UZNA 5DA3A 4WSQA 3T9TA 4KBCA 3VN9A 4L3PA 3UE4A 1S9JA 2W99B 3EFLA 1H1RA 1ZYDA 2CDZA 3FZSA 4E3CA 4DE4A 3S2PA 2B0QA 2ETMA 3PXFA 3A2CA 3SOAA 3LJ2A 4AOIA 1ND4A 1YI3A 5FP6A 3HA8A 4EZ5A 5EW3A 3EHAA 5C8KA 3GCSA 5K4JA 2PZ5A 2OFVA 4J95A 5JZNA 1JSVA 2AC5A 3CY3A 4MH7A 4Y8DA 2JKOA 3V5PA 5J9ZA 2FSMX 4O0XA 1OL5A 4FNYA 2PVRA 1FPUA 2UV2A 4QMOA 4XMOA 2XKCA 4Y5QA 3SRVB 5ETFA 5L8JA 4HYHA 5TF9A 4U81A 2OW3A 4D55A 1SVEA 1IAHA 5D41A 1SNXA 3A4PA 4FEWA 2UW8A 3NGAA 5AIKA 5KUPA 2UZVA 3R22A 4G3DA 3RK9A 3NW7A 3EWHA 4M14A 3AMBA 1JAMA 4R7IA 3PWYA 3GU4A 4L3JA 3KMMA 2E9UA 4I20A 3LZBA 2V7AA 4F0FA 3MH0A 3MSSA 4UMRA 4BCHA 1M2QA 2CN8A 4M15A 3TUBA 1JNKA 2YISA 3ATSA 3K5VA 4HYUA 3VQUA 4KKEA 4AGUA 3FEGA 4O6EA 3CS9A 4GU9A 4JIAA 2PMNX 4WBOA 2XNNA 3EZRA 5J5SA 4WO5A 4WG5A 4R3RA 1A06A 1IAJA 2WU7A 2GNJA 3PRFA 4EC9A 5HX8A 4J1RA 4NJ3A 1BI8A 4GG5A 3POZA 2EXEA 4IEBA 4JG8A 4CMUA 4E7WA 3C4EA 3M42A 5IU2A 3K2LA 2PSQA 4G5PA 4RZWA 5C8MA 2ZDTA 4FVQA 4PX6A 5CS6A 4CFXA 1YXUA 3GC0A 1UNHA 3PSBA 2YDKA 2YHVA 1ATPE 2UW7A 2RFEA 2BHHA 3RBWA 4QT1A 3RPSA 5IA4A 2XVDA 1JVPP 4KIKB 4LGHA 2WQOA 4C4EA 2PVKA 3EQHA 5M53A 3C7QA 1H1QA 1JSUA 2NP8A 3OD6X 3DT1A 3NUSA 1MQ4A 2YM5A 3DBCA 3I1AA 1REJA 4XV2A 2C3JA 2EB3A 4BGQA 2YIQA 4IBMA 2FUMA 2RFDA 3PVBA 3OEFX 4C57A 4EQCA 5HLNA 4DLJA 4IM0A 4CEGA 3MB6A 2VTLA 4X3FB 4XLIA 4FTIA 4F0IA 2UW5A 3W55A 5TKDA 4L43A 4RIWA 4G31A 4EK3A 3FLWA 5CQWA 3WF8A 3P7CA 4RIYB 3UDBA 4P2KA 5I3OA 2WMSA 3GNIB 3R9NA 3ZFYA 3ZUUA 3RWPA 2OIQA 4QMPA 3MVJA 1XH6A 1ZZLA 3DTCA 3KMUA 3L8SA 4L45A 2VO3A 2REIA 3CJGA 4BB4A 3C4WA 1PRYA 2RIOA 4ZMEA 5HU9A 1YWVA 3FHRA 4ZY6A 3OOGA 1Y8YA 3PXKA 2RL5A 3LCKA 3OUKA 2AYPA 2BZKB 3K3IA 3QQFA 4PRJA 5LJJA 5CF8A 5JN2A 3F7ZA 2WTIA 4UX9A 1YXVA 4FEXA 4RG0A 3G15A 4KRCA 3NEWA 4BIDA 5K0KA 4FKVA 3A7IA 4DINA 3A7HA 2HXLA 2ITTA 3V5JA 3VVHA 5GIOE 4IVAA 4KA3A 4LL5A 5AJQA 3F2RA 1WBPA 4ZTRA 2PVFA 1TKIA 5E7RA 3G6HA 3TZMA 3ZFXA 5IEVA 2YIRA 4RFZA 3S1HA 4C4IA 1HCKA 2YJSA 1CMKE 2PL0A 4N70A 3LCTA 3VBXA 4X2FA 1Q8WA 4O2ZA 2AC3A 2XM8A 4FSUA 3R8ZA 4FSNA 2PTKA 2V55A 4YBJA 2GMXA 5FUTA 5DEYA 5GZ9A 2Z60A 1OUYA 1PXPA 2P2IA 5KKRB 3I79A 5DBXA 4CKRA 5L4QA 3TJCA 4CCUA 4W9WA 3FHIA 4FT5A 3DXNA 3KRLA 4BFMA 4FICA 1KE9A 1XR1A 1ZMVA 4V04A 4EHEA 4JG6A 3G90X 5DHJA 3ZLSA 1BL6A 3BGQA 5FBNC 1H1PA 4BCJA 4M66A 3O23A 3F82A 1YOJA 3QFVA 1RDQE 4HPTE 2G9XA 4WRGA 2Z7SA 2GQGA 5CEMA 5EG3A 3HKOA 1KUTA 4GCJA 4GUEA 3R71A 3EQIA 5HD4A 5LMKA 3UQCA 3RCDA 3E3BX 4C38A 2Q0NA 2XIKA 2XYUA 4EH9A 5JT2A 3FQHA 5AUYA 5HLPA 3MVMA 3IPHA 5AR4A 4DGGA 2OFUA 4ZZNA 2YCRA 4WNPA 2YLEA 3D5UA 3UQGA 5HTBA 3B2TA 3A7FA 2W1ZA 2OJFE 3BU5A 2B54A 1KWPA 2IVUA 3VS3A 4IB0A 2OSCA 2ZB0A 1OL7A 4FNXA 3RJCA 4F9YA 4LM5A 4IH8A 4OBOA 5EDQA 3AC8A 3KC3A 3LFSA 3ORZA 3RNIA 4DC2A 4B9DA 5EHOA 3SV0A 1NA7A 4A07A 2QOKA 3PTGA 2HENA 2CGVA 4C2VA 4BYIA 4O81A 3QCQA 2H8HA 4UMTA 4G34A 3BHUA 3DK6A 4JXFA 4QMYA 4GFMA 1WZYA 5J9LA 2HY81 2O3PA 4EKKA 3QTWA 2OZAA 1UA2A 4EWQA 4KB8A 3ODYX 5HG9A 5CI7A 3D7TA 5BYZA 3AQVA 2OJIA 4U43A 3NNWA 2XIYA 5DVRA 3GENA 3AC5A 3SXRA 5L2TA 3RPVA 1UNLA 4PMTA 4FR4A 5HIDA 4PMPA 4EHZA 4AOJA 4MEDA 5GJGA 4W4WA 3GT8A 3HUBA 3PPKA 2YACA 1H1WA 1NT2A 2WU6A 3SXSA 5DPVA 4W8DA 3R30A 4QYGA 3OEZA 2PULA 4ITJA 5EM8A 5AA8A 4NIFA 4N57A 2GFCA 4CQEA 1Q24A 3I81A 3QHWA 4AGWA 2XEYA 3MWUA 4BYJA 3PZEA 3A99A 4J96A 3V5QA 5CEIA 4HPUE 3EYGA 1SVGA 2XK9A 3TN8A 4CLJA 4L01A 5HE1A 4USEA 3MPMA 3TJDA 3U9NA 2E9PA 2X7FA 4AZWA 3HRBA 3Q52A 2UW6A 2BFXA 3ZEWA 5L6PA 3ORIA 2B7AA 4IZYA 3TCPA 1WVXA 1JKSA 4RIXB 5ANJA 4U42A 4F1TA 2UVXA 2VGPA 5LQFA 3WE4A 1RQQA 1W83A 4QMWA 5DT4A 4AA5A 5AA9A 5L2IA 4TYGA 4U5JA 4XG9A 1OPJA 3DGKA 4A06A 5HE3A 4PPCA 3QBNA 4Q5EA 3SKCA 1SM2A 4JBQA 3E87A 4ORKA 3LCOA 2HCKA 1GY3A 1Y8GA 4PMMA 3V8WA 5CAUA 3R9HA 3AC1A 4LGDA 3ACKA 3D5WA 4ZY5A 2I0VA 3MVLA 5EM7A 5FQDC 5EYCA 1PHKA 1ZARA 5EOLA 4E26A 3RMFA 3ANRA 4BIEA 4CTBA 2R2PA 4UWCA 3EQGA 3NPCA 1QPCA 2UUEA 3GCPA 3F5GA 4QNYA 3GCUA 5BMSA 5HVJA 4JAJA 3Q4CA 4IADA 4XJ0A 5KX8A 1G8AA 4CGAA 3WZJA 4J53A 4I23A 3AT3A 3G9NA 3FYKX 1U54B 2NO3A 3VS0A 4RJ8A 3G2FA 3W10A 4KWPA 1P5EA 3FLNC 3QALE 1H25A 2E9VA 4Y73A 3E7OA 2R3HA 3DDQA 5DWRA 4D2SA 1WVYA 3IOPA 3IDBA 3CCNA 4L00A 3PRIA 1XBCA 3R2YA 2BZJA 4HCVA 5CVGA 3RGFA 3BHTA 4J52A 1OPKA 1YHWA 2E9NA 3K5UA 3VUHA 1X8BA 4FODA 4QYEA 5H8EA 4ANMA 2X9EA 3OF0A 1STCE 2C1BA 4MXZA 5GHVA 4BDDA 4CCBA 2WMRA 5FTQA 3MBLA 3W2QA 4UMUA 2YIWA 5I9WA 2FB8A 5M57A 1J91A 2X1NA 2UW4A 4UBAA 4M69B 3SRVA 3KXMA 4RJ4A 3RTPA 5BVWA 2BRNA 2WOTA 3D0EA 4XCUA 3DBDA 3DBEA 3GI3A 4RFYA 2XH5A 5JSMA 1NXKA 5JGBA 4YO6A 4R6VA 2C6EA 3NYVA 4FV8A 5L6OA 3GQLA 3QHRA 4RGJA 3R1YA 4BDAA 2VTIA 3BEAA 5KMKA 5AUVA 5K5XA 5BMMA 2XK4A 3AT2A 3EQDA 1YDTE 1OIUA 3QAME 4F7SA 5CT0A 4DFYA 4QD6A 4AAAA 5KE0A 4EH3A 4AE9A 1ZOEA 3AG9A 3FZTA 4EOQA 4XRJA 4MVFA 1K9AA 2IVTA 4JX7A 5HG7A 3MFRA 4MBIA 3HZTA 3FI3A 2YWVA 2XZSA 4FTCA 2W4KA 4PF4A 5EYMA 5IEYA 1ZAOA 3ZZWA 4J7BA 3PJ2A 3QQUA 3DJ5A 4GEOA 5ANDA 5CSWA 4KUJA 3TL8A 1KOBA 3R2BA 3EQBA 5CZHA 4BDHA 4BTMA 3OXTA 2DYLA 4N0SA 4NT4A 4U8ZA 4RLLA 4J8MA 4MCVA 2P3GX 3GOKA 3QD0A 4RC3A 5A14A 4EOMA 5EQYA 4NKSA 3GC8A 1K3AA 3GFEA 3HLLA 5E91A 2UW0A 4OLIA 2BROA 2OH0E 4LV8A 4XX9A 1W8CA 5CU6A 4ZTHA 3TV7A 2A0CX 3N4TA 3FMMA 3ZOSA 4R1YA 3FUPA 1OBGA 4KIKA 3G9LX 4HCUA 3EB0A 3IKAA 2J4ZA 4HZSA 4YNEA 5D11A 2C5YA 4G3EA 2WTCA 2G01A 3JPVA 4HGTA 4JVGA 4NL0A 4ZSJA 1UVRA 2ETRA 2RSVA 2PVYA 4RWKA 4Y46A 4YLLA 3UOLA 3O50A 5HG8A 3PG3A 3TTJA 3KMWA 3PLAE 5KMOA 4EH7A 2PUPA 2C1AA 2A1AB 1PYXA 3VQHA 3FMKA 5AR7A 2G1TA 3E8EA 4C3FA 4YUQA 3PVUA 1JOWB 4X3FA 2QD9A 4FSQA 5I9YA 1YKRA 2JDOA 5AUZA 1PXKA 5HGIA 3TT0A 3A4OX 4C8BA 4RIYA 5GZ8A 5KMLA 3H30A 5IH6A 4E4LA 3R63A 4PWNA 2OU7A 5JFVA 2JBPA 3R7OA 3MFSA 4A9UA 4RX9A 4YLKA 4YC6A 3F3VA 3SDJA 5M4FA 3U54A 3VULA 3F6XA 5I0BA 2X2LA 3NSZA 4IAAA 4FL3A 4NM5A 3QTRA 3SX9A 2UZBA 3H0ZA 2WEIA 5CYIA 4C34A 4PPBA 3KKVA 3QRKA 4FIEA 3HAMA 2NNWB 4AZFA 4JIKA 1FQ1B 3WARA 4PTGA 1MUOA 4JQ7A 4KINA 3SXFA 4AF3A 4EOIA 4WNOA 1M7NA 3VF8A 2PPQA 3R8LA 4K9YA 4M13A 3BQCA 4RVLA 3ZRLA 2GDOA 3LQ5A 4FKJA 3NCGA 4RVKA 2R3GA 2LAVA 3LFEA 3CQEA 4EK5A 3OFMA 4JT3A 3QC9A 4TRLA 4ASDA 3BE9A 2X8DA 5HO7A 4YTIA 4EOSA 5E9EA 2H9VA 5I5ZA 2IW6A 2ITNA 3KK8A 2BPMA 5AUWA 3V8SA 4BWXA 2H96A 5LVPA 2JBOA 3FZ1A 4RC4A 3ORNA 3EKKA 3MPAA 5AP4A 3RNYA 3VW6A 4RJ6A 1OB3A 5FLFA 2J0MB 3GU5A 4QP2A 4GU6A 2JEDA 4NYEA 2F2CB 3I4BA 3TDWA 4DTAA 3P9JA 1KOAA 1A9UA 2OI4X 2XNGA 4MD7E 3ROYA 3AD5A 2FSOX 1CM8A 2JFMA 3AGMA 2R0UA 4FTUA 3DBFA 5E1EA 3DNDA 2JIIA 4IDVA 2RF9A 3BLHA 4G2FA 4LI5A 3I6WA 5LMKC 3LFAA 2XNMA 3ZRMA 5FXQA 4YHJA 2WMBA 2RG5A 5M55A 4DBNA 3U6HA 3FMJA 3N9XA 3OTVA 5LCKA 2R3LA 4RA5A 5HE0A 4DFNA 5EHLA 4G16A 1FINA 5HIBA 5CSXA 4AA4A 1NW1A 3IGGA 5AR3A 2PYWA 3L9PA 3PVWA 5ACKA 3KF7A 3H10A 4D2TA 5DNRA 2CKQA 3DAJA 5CNNA 1Q8TA 4V01A 5B0XA 1DI8A 2PVLA 3FY2A 1CDKA 3OTUA 4IB1A 3DKCA 1JKKA 4P4CA 3TZ9A 3PLSA 5AV4A 4PP7A 3LE6A 4FKGA 4AZVA 3WIGA 3MFUA 3PP1A 2LGCA 3AXWA 1F3MC 1YHVA 4RIOA 3PJ8A 4NW5A 4BCPA 3CPBA 4ITIA 1QCFA 3LMHA 2BILB 4EOKA 1Z5MA 2J6MA 3O2MA 4ZLZA 2R3OA 4I0SA 5K3YA 4BGHA 4K0YA 4MBJA 2WAJA 4ZLOA 2WMTA 2NRYA 3BWJA 5ANGA 2WMXA 4KKHA 3BYSA 1M7QA 3UG1A 3PXRA 3QTQA 5DIAA 4H1JA 2KTYA 3CEKA 2VTJA 5EW9A 2IW9A 3PE1A 4JDIA 4KD1A 5IPJA 4E4XA 2C6DA 3NS9A 4K77A 2R9SA 4YJNA 4ACMA 4EBVA 5FDPA 2Y4IB 2J7TA 3VJNA 3ERKA 4D2WA 4BCKA 4PPAA 1NVQA 3KULB 4R3CA 4C4GA 4CNHA 4CSVA 1Q3DA 5KCVA 4DG0E 2GPHA 1XH9A 3ENHA 3EH9A 3ZYAA 5CU0A 1ZYLA 4U3ZA 2RKUA 1KE5A 2OIDA 2G2HA 5ETAA 4D2PA 1O6KA 3TV6A 3EN9A 1XBBA 3Q9WA 3HYHA 2DWBA 4ZJVA 2ITOA 2UZLA 4QMNA 2P4IA 4PDSA 5AR2A 4IX5A 2PZIA 4XEYA 2QO2A 4I3ZA 5H9BA 4FT7A 2XKEA 3FYJX 4KSPA 3SAYA 2BMCA 5E8SA 4JR3A 3NAYA 1UU8A 3PY3A 4RLKA 2Z02A 2BZHB 4FNWA 4OGRA 3V8TA 1JKLA 3BWFA 3KN5A 4GG7A 2PVNA 3ZFMA 4APPA 2W1GA 5CAPA 2C6MA 3GQIA 1QL6A 3VBWA 4EUTA 1A48A 4MXAA 2XK7A 3OY3A 4FTTA 3TKIA 3FJQE 2Z8CA 5B2KA 5AP2A 3VUDA 3OCSA 5HI2A 4BDBA 4WNMA 4GIHA 4YGAA 4RIXA 4MKCA 5JFWA 4YO4A 1KV2A 4ZSGA 5AUXA 3AT4A 4JR7A 5IMEA 2X9FA 1T46A 3DJ7A 2BRMA 4RJ5A 1I44A 2ZYBA 2BR1A 2PU8A 5C4LA 3RAKA 1JWHA 3LLTA 2WKMA 4KIOA 3HP2A 2O63A 1QPJA 2C47A 4ANOA 3EKNA 2QURA 4C3PA 5AV2A 4FOCA 4LV5A 2JKKA 4S2ZA 4YSMA 5E8YA 3U4WA 4CV9A 4DA5A 2ZVAA 5CANA 4MF0A 5GJDA 1BUHA 1I09A 3L9NA 4FV9A 3WZUA 3SD0A 3A8WA 3BGPA 4H58A 4IVBA 3GU8A 3QD2B 3WYYA 4C4HA 3KCFA 4QMZA 3HEGA 4FTMA 1Q62A 4J97A 4M97A 4NM3A 4RX8A 3MS9A 4DEBA 4DH5A 1JQHA 2Y6OA 4O84A 1YRPA 2WMUA 3PXQA 4D28A 3DDPA 3LJ0A 3KF4A 3QRIA 4D1XA 3FI2A 2QKRA 3HGKA 1H00A 3P1AA 4QQ5A 4RMZA 4QYFA 4XP3A 2C0IA 4FG8A 3DB6A 4OTIA 3PJ3A 2X4ZA 3Q96A 5AP3A 1U54A 2P33A 4Q9SA 4QMQA 3KB7A 5BUIA 3AMAA 4QMLA 4LG4A 4ZS0A 4FE2A 3CKWA 4P5QA 3TXOA 4AACA 2R3MA 3O96A 3MV5A 2UZOA 2QLQA 3FLZA 2CLXA 3VIDA 4V0GB 3M11A 1G3NA 4BY9E 4B6LA 2ERZE 3Q4TA 1QPEA 4FTLA 3FL5A 3VO3A 2FSLX 1YI6A 1CSNA 4MXOA 3VWAA 2A2AA 4GV1A 4NKAA 4O7WA 3QWKA 4CFFA 1FMOE 2IZSA 4QOXA 5FP5A 5JGDA 4FIGA 5C03A 3OBJA 4M69A 3HV5A 5CVHA 5AX3A 4D58A 1JBPE 2YN8A 5IUGA 3UOJA 1KE6A 1Y6BA 4M12A 5A4QA 5D1JA 3RK7A 2J90A 4BBEA 2VX0A 3KEXA 5BX0A 3R8UA 3O8TA 4I5HA 2Q83A 3FBVA 5F9EA 4DFUA 2W1CA 2F4JA 2O5KA 3BBTB 3MA3A 4I5MA 2XK3A 2VWZA 2BTRA 3PE2A 4FKSA 3QL8A 5CSHA 3OW3A 4K2RA 4GYIA 3PP0A 2J9MA 2VNWA 3OWJA 4CFUA 4KBAA 3QXPA 1YXSA 4FZFB 4ID7A 4FUYA 4FEUA 3MIYA 5HZNA 1PF8A 3PXYA 1PXJA 5CF6A 4OW8A 3V6RA 1TQPA 2W0JA 3T3VA 1CTPE 3ZO1A 3SG9A 3JXWA 4GFOA 3RVGA 3R8MA 3LCDA 2V22A 4QQJA 3MFTA 2OF2A 2A27A 4FV5A 4AXAA 4BCMA 5IQBA 5DEWA 4EH5A 3RM7A 4EH2A 2JGZA 2YJRA 4NM7A 4QPSA 4XP2A 4EH6A 1YXXA 2PE1A 5TO8A 5J87A 2CKPA 3E3PA 4U6RA 4Z7GA 4PL3A 4GL9A 3SVVA 5EOBA 4IB3A 3EFKA 3VJOA 3IW4A 4FG7A 2HW6A 2P55A 2QOHA 4XV3A 3HMPA 4FF8A 4K1BA 5HNBA 5BVDA 2HYYA 3FLSA 4RRVA 1W82A 2VX3A 3I5NA 4ERWA 3MH2A 3DCVA 3ATTA 3TACA 1R1WA 2Q0BA 2Y4PA 2XJ2A 4WSYA 4FVPA 2HZNA 2X8EA 3OWPA 4X21A 2J50A 4FKLA 4Y83A 3ZTXA 1NVRA 2DUVA 4BF2A 4FTRA 4WOVA 4TTHB 4X3FC 3G0EA 2YZAA 3I60A 3WI6A 2H6DA 2ONLA 1PKDA 5C8NA 3WILA 4UY9A 3R21A 4GSBA 3HL7A 4L7FA 4QYYA 4X2GA 3R6XA 4FSRA 1BI7A 3JS2A 4TZRA 1WAKA 4MD9E 3BLRA 4YJSA 5HORA 4WRSA 2BKZA 3P7AA 4JQ8A 1P4FA 5C9CA 1V0PA 4CG8A 2HK5A 4F9CA 5IQGA 2WQMA 3ET7A 4U41A 1GZ8A 2FGIA 4YTHA 2R3IA 2YIXA 1PMUA 4F4PA 4HGLA 3UVQA 4RJ3A 5M09A 3OT3A 3MDYA 1Z9XA 4PL4A 3GU6A 3T8OA 3DAEA 4TL0A 3QZHA 2PVHA 1J1BA 4AG8A 4C3RA 2BIKB 3PIYA 4S33A 4WKQA 2B52A 1JKTA 2CLQA 2W7XA 3V3VA 3ZXTA 2XUUA 5M4IA 2WQEA 1FMKA 4OT6A 5FM2A 5CF5A 1OKWA 3RALA 4ASZA 1T45A 4TWNA 4CRSA 3R00A 4FMQA 3Q2JA 3LMIA 4G9CA 3ORMA 2JDRA 1WMKA 1YVJA 4LL0A 1LPUA 2C5NA 2QOLA 5D10A 3ZM9A 2QOIA 3W2RA 4FV3A 4JDJA 4TT7A 1Y91A 3QUEA 4ZEGA 1Q5KA 3LMGA 1GJOA 3E93A 4O1PA 3UJGA 2GHGA 2JKMA 3FKOA 4CT2A 5KKRC 2WFYA 3R01A 4JQEA 4JI9A 1ZOGA 5GIPE 3TI1A 2VTHA 4USDA 1FBNA 2QODA 4CYJA 4BDKA 3VUGA 1J7IA 5GINE 2R64A 3L8XA 4LQMA 3ITZA 1EH4A 2XNOA 5A6OA 4ZTLA 3R8PA 3RINA 1XWSA 4AE6A 5HE2A 1OKYA 2C68A 1YWNA 2WOUA 4HCTA 4DEDA 5BVOA 1CKPA 2C6TA 4ACGA 3DA6A 3KVXA 4Z7HA 3RP9A 2GNFA 4BKYA 3FC1X 2BAQA 4NTSA 3OCGA 5AIRA 3ZLYA 4XG4A 3PUPA 3D9VA 2X39A 3HDNA 3VUIA 1OMWA 4BHZA 1ZMWA 5BVFA 2V5QA 3FPMA 5IDPA 4H05A 2YM6A 1PW2A 3CTHA 4YZNA 5IQCA 2IZTA 3FPQA 5A4TA 4L8MA 1YW2A 4FOBA 4DYMA 5KMNA 4B7TA 2XS0A 3LW0A 1H01A 3OXIA 1P4OA 1OECA 2WELA 4GT5A 4O82A 4PDPA 4ZTMA 5EI2A 4RPVA 4IMYA 3ZDUA 3HNGA 3QCSA 3NR9A 3QQJA 4HVHA 3SW7A 4O83A 2YZLA 3TNHA 1VYZA 4FZDB 2B9JA 3ZONA 1BLXA 4OAUC 1QMZA 2BUJA 1UNGA 2ITWA 4GT4A 3W18A
chains in the Genus database with same CATH superfamily
4GIIA 4O21A 4O0YA 3BU3A 3WOWA 4PNIA 2XARA 4C37A 4RQKA 1UWJA 3T3UA 1ZZ2A 2XNEA 4NWMA 4V05A 4F7JA 4HNFA 2ITXA 4R5YA 4BWKA 3IW6A 1GIHA 5CEPA 4ZSEA 3NDMA 4PQNA 5EYKA 1PXOA 1W98A 4HYSA 4F1MA 3BELA 1SYKA 2G15A 4FZAB 3LFBA 1UU3A 4O27B 1GNGA 3DTWA 3GCVA 3S4QA 3TZ8A 4DN5A 4DHFA 4LOQA 5FBOA 3HRCA 2ZM3A 3C9WA 4TYJA 5CU3A 5ETIA 4CKJA 3UQFA 2HY0A 3OWKA 5BYLA 3Q9YA 5EM6A 4MTAA 4CT1A 1Q8ZA 2PMIA 1IA9A 4I5PA 4CZUA 3BL9A 4UZDA 2W9FB 5IDNA 5EH0A 4JL9A 3QQGA 3WYXA 4BGGA 2V7OA 4K33A 4YZCA 4D9UA 1WVWA 3NW6A 5JQ5A 1WCCA 3BCEA 4JDKA 3TYKA 3KULA 2J0IA 3NVMB 4BC6A 4F0GA 3EL8A 4A9TA 5IH5A 1M14A 5KZ0A 3JUHA 2VO6A 4MXCA 2CKOA 1YWRA 2ZB1A 3D94A 4U3YA 1MQBA 4X0MA 4FKTA 1VEBA 5DRBA 5CALA 4O38A 5BYYA 4II5A 2BDJA 5EK7A 4GRBA 4Q2AA 3VS1A 4IJ9A 4B8MA 4EZ3A 2VNYA 3R02A 4EJ7A 4Q9ZA 3II5A 1BKXA 1WBWA 2YM3A 3F61A 3PXZA 3EZVA 2EUFB 4FKIA 5LVNA 2XKDA 2JFLA 2OJ9A 4ALWA 5IUIA 3UZTA 4U9AA 3F3WA 3H4JA 5M51A 1UU7A 2VAGA 2XNBA 5HLWA 2X81A 2PZRA 1PMEA 4NFMA 4KIPA 4L53A 1VJYA 3LFCA 4BTKA 5A4CA 3W32A 2PUNA 2IJMA 3QCXA 1OL6A 1OZ1A 2CSNA 4H3PA 4WIHA 3CLYA 5BPYA 4D4VA 3QTIA 5JEBA 4XBRA 3CIKA 1GOLA 2J51A 2XF0A 5AP0A 2OXXA 1Q8UA 4JBVA 4ALUA 5IA1A 4O0UA 3FZOA 4HJOA 4ANSA 2OO8X 5ITAA 3D2IA 5EQEA 1ZY5A 4HNIA 4C0TA 1P14A 4ZTQA 5KZIA 3M1SA 4AFJA 3QA0A 4EORA 3QGYA 3EN5A 4FKWA 4G1WA 2X7OA 5FWKK 2VWVA 5T68A 3TNWA 4OBPA 3FI8A 3LIJA 2W96B 5EI6A 5LVLA 4MQ1A 3BGZA 1XKKA 3QCYA 2VWIA 2QONA 3DKOA 3Q6UA 4JBOA 3UZRA 4AT5A 4C2WA 1S9IA 1H07A 4GVAA 2OK1A 3OZ6A 4TYIA 3DB8A 2WMQA 3S0OA 2VRXA 2C3LA 2WIPA 2QOQA 4S31A 2XMYA 2AUHA 4PL5A 2C5OA 4I6BA 1AGWA 1TFFA 2ITYA 3BE2A 2ITVA 4IB5A 3UNKA 2WXVA 2UVYA 2WO6A 4TYHA 3C5UA 1TVOA 4UWYA 3TZ7A 2I0HA 2CMWA 5A6NA 2ZMDA 5CAQA 2HZ4A 1ZRZA 2XJ1A 1J7UA 3KIOC 5FEDA 3UO5A 3RHXA 2DQ7X 5HESA 3RPYA 3WBLA 3SA0A 4AZTA 4L46A 3A62A 3PIZA 2VD5A 3LPBA 4YC3A 3EMGA 4R8QA 4U40A 4QNAA 4K11A 4F1OA 3KVWA 2YM4A 1OIQA 5IA5A 4O7TA 3GB2A 4KSQA 3NRMA 2JAMA 2YAKA 5JRSA 4E1ZA 3EN6A 3FC2A 2FH9A 4O7LA 4V0GA 1F5QA 5EKNA 1YDRE 3MVHA 4RWLA 2YCQA 3AC3A 3VNTA 4E4MA 4FKPA 2BCJA 3B8QA 1DAWA 3TUCA 4D0WA 3ML1A 4MNFA 3O17A 4FZ7A 4UV0A 4YJRA 3TMOA 1YDSE 4ZS4A 3QU0A 5IMXA 5M08A 2F7XE 2YCFA 3KU2A 4OTRA 1VLRA 4FV4A 4G17A 5DR6A 2VUWA 5LVMA 3MY5A 4YPDA 1Q3WA 1IG1A 1W2CA 3A60A 3ZSHA 5AAGA 4ANBA 3KXNA 5M4UA 4DLIA 4CFWA 3FWQA 4IAYA 4R5SA 4IWDA 4FV6A 3W2OA 2QU6A 1OKZA 5AP5A 3UIMA 4NW6A 3CXWA 4O0WA 2PMOX 4IZAA 3BLQA 4A9YA 3Q04A 4B8LA 4X7QA 2ITUA 3MW1A 2YCSA 2PWLA 2W4OA 2YDJA 3NUUA 5AP6A 1JLUE 4G6NA 3ZHPC 2JIUA 4AA0A 3O51A 2XRWA 3DNEA 2QCSA 4UWBA 4FIHA 3RZBA 4LRJA 4Y85A 3NX8A 5AUUA 5IF1A 4G3FA 5CXHA 4F6UA 1XH4A 4TPTA 4CV8A 2YIYA 3U6IA 3N51A 2I0YA 5HCXA 1DM2A 2QO9A 3ID6C 5EYDA 3QUPA 2QLUA 4JRNA 5CY3A 5AMNA 4A4OA 4FEVA 1OKVA 3GU7A 3UMWA 1ZLTA 2FYSA 2R7BA 5F20A 3FXZA 4F65A 4CTCA 2YITA 2CGWA 1KSWA 2CGXA 4ZTNA 4E5WA 3TKHA 5EQPA 2HZ0A 4XV1A 4YHTA 1LEWA 3ORKA 3H3CA 5AWMA 4BHNA 3C0HA 4NH1A 3ZSIA 2ONLC 3Q53A 3IGOA 3DJ6A 3FZRA 3VBYA 4Q5HA 4O7RA 3ALNA 3EIDA 3A7JA 4YMJA 2VN9A 1Q97A 2VV9A 1WBSA 3THBA 1ZYCA 2R3KA 3G6GA 4M68A 4FGBA 3QLGA 1PY5A 4X3JA 2UW9A 5I4NA 1ZYSA 3E62A 2XALA 2B55A 4IX3A 1WBNA 2W17A 2W1EA 2WTKB 4O6LA 2YERA 4S32A 3KREA 4A7CA 4DH8A 4ZY4A 2WMAA 2WEVA 2YAAA 3OOMA 5LOHA 3F2AA 3FY0A 5DGZA 1JPAA 2PY3A 2RGPA 4R7BA 2X7GA 3CPCA 2GU8A 1G5SA 1PXMA 1XH5A 2IVVA 3D4QA 3HMNA 3LXLA 3NYXA 4MWIA 2CCIA 4LUEA 3RK5A 4UN0C 2QOOA 4RC2A 4C36A 3CE3A 3AKKA 4G3CA 3QWJA 2WHBA 4H36A 3WF6A 3FKLA 4FSZA 3QRUA 3FLQA 4XG6A 2Y8OA 3T9IA 4EH8A 3A61A 2GNLA 2OXYA 4O7VA 4D4RA 5DE2A 5AAEA 4UMQA 4D1SA 3H9OA 2JKQA 3MESA 5LARA 3IONA 2ZOQA 3F9NA 4IVCA 3U8WA 1Q8YA 4FT3A 3FLYA 4H39A 4QP1A 5H2UA 1URWA 2NRUA 5EHYA 4QDEA 5E8VA 3HV4A 4JLCA 5HTIA 3OCBA 4DG2E 2YLFA 4Z55A 2JDVA 3MJ1A 1UKHA 2R5TA 4FSYA 3W0RA 4EH4A 4YURA 5IQEA 1V0OA 4WNKA 4ASXA 1H24A 1L8TA 4DCAA 3AD6A 3KGAA 4NUSA 4ZTSA 3JY0A 4AN9A 5IH4A 3GBZA 3QRTA 2C6KA 3HP5A 3E8CA 4Y95A 5CEQA 5JZJA 2CNUA 3Q4ZA 2ZDUA 4C58A 4P90A 1BX6A 1PJKA 5HD7A 3U55A 3HV7A 4FTQA 4E8AA 5AUTA 4TNDA 3EFJA 1OIRA 4QP8A 5AFVA 4JDHA 3BV2A 1PXLA 2VTAA 3NUXA 5BVKA 1IR3A 5ACBC 4QMSA 4UYNA 4YZ9A 4LRKA 2W1IA 2GFSA 5K9IA 2OH4A 4KRDA 5A46A 4BJJA 1YHSA 5JRQA 1B38A 5G6VA 1H0VA 2GNGA 4TWPA 5F1ZA 4U80A 2IPXA 4YJOA 5LWMA 3DKGA 3Q6WA 3HECA 3TIZA 1IRKA 2W5AA 4QMXA 5E8UA 2I6LA 3QUDA 3BU6A 4PTEA 1OPLA 2VO7A 4M8TA 4O91A 4IVDA 5AR8A 3PSCA 3KA0A 3IO7A 2BTSA 5EFQA 3BX5A 4W4XA 3S95A 4Z3VA 4U0IA 4X6QC 4HVGA 4FV0A 5CTPA 3RAHA 3TWJA 3ETAA 5HQ0A 3RI1A 3RCJA 4EHVA 2VTPA 4FC0A 3MH3A 2J0KA 2X8IA 3NUAA 3MYGA 3F7WA 3PIXA 3DS6A 3MN3A 4YTFA 1RW8A 3ORPA 4F7NA 3F2NA 3OC1A 1NY3A 3TNPC 4ERKA 4F9BA 3CSVA 3TIYA 3DKFA 3NNVA 3JY9A 3ZUTA 4WG4A 5FD2A 1WBOA 4BTFA 5FXSA 2I7QA 3ODZX 4EL9A 2O64A 3L8PA 4HZRA 1PXIA 5F4NA 3TNIA 4MF1A 3RKBA 5JGAA 2IWIA 4TKSA 4FKQA 1REKA 1WFCA 4DEEA 5M06A 1TQMA 4IAKA 3NZ0A 3TDVA 4E93A 2ESMA 5IG1A 1FOTA 4WUNA 5B2MA 3DV3A 5D12A 5HU3A 4E6DA 2PVJA 3ORTA 2RFSA 5H8BA 3LJ1A 5M07A 3ORLA 4OTHA 4IWOA 4LFIA 4S30A 1ZY4A 5DLSA 3WZEA 5HCYA 3E63A 3QX4A 2WNTA 4YJVA 4JAIA 4C33A 3FQSA 2XA4A 2Y4IC 5AAFA 5KNJA 3N4VA 4QTBA 3GP0A 3OXZA 3PDTA 5L3AA 3NWWA 2J5EA 4FI1A 3LFQA 3VS4A 4FG9A 1LR4A 3W8QA 2OBJA 3V5WA 4EOOA 3BKBA 5CU4A 4BDFA 4BCOA 4QP9A 4IC8A 2WTDA 3BZ3A 4MD8E 3F3TA 4ZIMA 4DTBA 4ANQA 4PTCA 2WIHA 4BN1A 2Y0AA 3BYMA 4YJTA 5ANKA 1O6YA 4D1ZA 4ARKA 1ST4A 3CY2A 4FTKA 2XP2A 3UP2A 4AT4A 4YBKA 4BICA 4E6AA 4IACA 1GZOA 2XCHA 3W0PA 4OTWA 5CAOA 4GK4A 3ZMMA 2YM8A 3GOPA 3A7GA 2OXDA 4D4YA 5HOAA 1J7LA 3CR0A 2YA9A 3BI6A 4TXCA 4CZYB 4BCNA 2C0TA 2WQNA 4FIJA 4ZSAA 4LRMA 2PHKA 4GT3A 3UVPA 3DFCB 2OF4A 3W0SA 3ZRKA 3UG2A 4EK8A 5DT0A 4BI1A 4N4SA 3LHJA 2XAMA 4E5AX 2XEZA 3R83A 4HOKA 4RFMA 3KL8A 2Y9QA 4E6QA 1PYEA 2W1DA 4C35A 4LDTA 2QG5A 4D9TA 4NU1A 4LGGA 3RHKA 5BQ0A 4QMMA 4XNEA 4DH1A 3D5XA 4EQMA 4I0TA 3R7YA 4MQ2A 3P86A 3VF9A 4QQTA 3D2KA 4NCTA 4MK0A 4IX6A 4IM2A 5EDRA 4YSJA 1ST0A 5AV3A 5HO6A 2Z2WA 2HWOA 3R1NA 3VBTA 3WE8A 4I24A 3JYAA 3UIBA 2E2BA 3FL4A 3GXLA 4M7IA 3Q60A 3R73A 3QX2A 5HX6A 3R9RA 1W0XC 5KMMA 2JDTA 3VS5A 5M56A 4O96A 4E4NA 2QVSE 4LOPA 5HCZA 1H27A 2QQ7A 4NSTA 1BMKA 1BL7A 4XS2A 3OT8A 5IA3A 3OBGA 4MNEB 2BRGA 3FXXA 5JFXA 4TYHB 5AX9A 2PUIA 2I0EA 2XK8A 3COHA 3R9OA 5CF4A 5CSPA 2UZTA 2GQSA 2CCHA 3B8RA 4UALA 3ZO3A 4S34A 3S00A 3G33A 2XIRA 1OVEA 3NYNA 4IC7A 3CQUA 4XLVA 3FSKA 2BRHA 3GFWA 1HOWA 4YJUA 2PZYA 3ZLWA 4CZTA 3UOHA 4EZ7A 5TR6A 4R78A 5HIEA 2VTNA 3P79A 4GJ2A 2XK6A 1B39A 3SOCA 4C7TA 5TOZA 2UZEA 3BV3A 2QO7A 2IZUA 3Q4UA 2WPAA 4IWQA 4YP8A 2O65A 3ALOA 3LCSA 5FEQA 4YJPA 1Q99A 3MY1A 5F94A 5CWZA 2GS7A 3HMMA 4E5BA 4CG9A 3ZDIA 3VBQA 4FYOA 4DEIA 4E6CA 2OWBA 3K3JA 4ENXA 1GZKA 3MTLA 2X2KA 5CQUA 2HZIA 4APCA 4QTEA 2ZM4A 2WMWA 1CKJA 5HBHA 1WBTA 4DF3A 2P0CA 3I7CA 4EWHA 1ERKA 4GKHA 5I9ZA 1MP8A 3AOXA 2J0JA 4UXQA 5FTOA 4ACDA 1XMLA 4M3QA 2ZJWA 4HVSA 3IOKA 1H26A 5EM5A 5DI1A 1DAYA 5LWNA 2X0GA 3E7VA 2W9ZB 2C30A 4I6HA 2R3RA 5AP7A 3QF9A 3OVVA 1FVVA 2ZAZA 4UXLA 5DRDA 4NEUA 4KIQA 4DH3A 3UOKA 1ZXEA 3EQPA 1H08A 3K54A 5HEZA 4YC8A 5HHWA 3SQQA 4EK4A 3HAVA 3MIAA 4AFEA 3ELJA 3CGFA 1R3CA 3DPKA 4I1ZA 4RBLA 5AV0A 3DQXA 3QKKA 4XH6A 1U4DA 5D7AA 4FA2A 1KE7A 3IG7A 5A9UA 3E8DA 4C4FA 3QQHA 4M0YA 4CFNA 2CNQA 3DLSA 4MYGA 3WZDA 3PWDA 2B1PA 3UC4A 4IZ5A 1Q41A 2UZUE 3RM6A 4YPSA 3VBVA 1APME 2JC6A 2C6LA 3BYVA 3NYOA 4FKOA 3REPA 4D0XA 4ZP5A 4DTKA 4GW8A 2CKEA 3SG8A 2XYNA 3HUCA 3C0IA 2Z7RA 5DT3A 3C4CA 3R0TA 1GIJA 4PDYA 3Q32A 5FEEA 1O6LA 3V04A 4AOTA 1WBVA 1OGUA 2X4FA 2QHNA 3B2WA 3FAAA 3GGFA 4CMTA 2ACXA 3DY7A 4DG3E 4AQKA 5I3RA 2C6OA 4R1VA 5FGKA 4LMNA 5FG8A 5KMIA 5DH3A 2QOCA 3SC1A 4ZOGA 4AN2A 3PPJA 2QC6A 5BVEA 2WQBA 5J7BA 2ZV9A 2WZJA 4Y72A 4TY1A 4YR8A 4B99A 4ALVA 5DR9A 4IX4A 2B9IA 2QI8A 2VGOA 4L44A 4L6QA 4DFLA 3DXQA 2QHMA 2W1FA 4MXYA 1W84A 5M44A 2KULA 3V51A 5L2SA 4QMTA 4JJRA 2ITQA 1M17A 2ZV8A 4MHAA 4B0GA 1W2DA 2OJGA 5KMJA 3ULZA 3P23A 4XRLA 4BCQA 4ZLYA 5DFPA 2XBJA 2PE2A 3U9CA 5J1WA 4GK3A 3POOA 4TW9A 1V0BA 2W1HA 4OTQA 3C4FA 1R0PA 3EJ1A 3F66A 4GK2A 4FNZA 4AW2A 5IEXA 3LLAA 4G6OA 5I9XA 4IFCA 1PMVA 2VTMA 2W5BA 4JS8A 2ZM1A 4CXAA 1U5RA 3DQWA 5AR5A 2BDWA 3MH1A 1LEZA 4M84A 4XUFA 4XYFA 3AKLA 4IQ6A 4RVTA 3CGOA 4JX3A 2GNHA 2PVMA 2VTSA 3KRJA 3LOKA 2OKRA 3Q9XA 4BBMA 4DFBA 2JLDA 4AN3A 4GUBA 3SW4A 5B7VA 3DXPA 5JMSA 2VO0A 4FTJA 4YHFA 3KCKA 3O8UA 5ETCA 4HW7A 1P2AA 4K6ZA 3QYZA 3F69A 1RE8A 4DITA 2UW3A 4IAFA 4JOAA 4NM0A 3COMA 4G6LA 3QZFA 4DGNA 4FEQA 2Y7JA 4FT0A 4WD5A 2C5VA 3QQKA 3NMUF 2R4BA 3ANQA 4ZZMA 3ZM4A 3QD4A 4O0TA 5D9HA 4W8EA 4FSWA 3MB7A 2SRCA 4HVIA 5CXZA 5E4HA 4FUXA 4ONAA 3PJCA 3W2CA 4I93A 3R7UA 4D2RA 5IZFA 2HW7A 2QNJA 4DGMA 4QO9A 4RQVA 5AADA 3QGWA 4HGEA 4LV7A 4ZMFA 4BBFA 4PP9A 5E90A 4BWPA 5HKMA 5AM7A 4RX5A 2XIZA 2F49A 4EC8A 3KXXA 5A4LA 3P7BA 4BRXA 2WTWA 4F78A 3PVGA 2R3PA 1IA8A 1U46A 3F5UA 3BHVA 4AS0A 4GVJA 5L2WA 4CKIA 4JG7A 2GS2A 3TEIA 4IW0A 3ZH8A 3LM5A 5CVFA 4A4XA 4A9RA 1VYWA 1XQZA 3PFYA 2W5HA 4DT9A 4QP6A 5D7VA 4H1MA 5HBEA 4L42A 4BDJA 4O7YA 2ZMCA 4Y5HA 2J5FA 4J8NA 5E92A 4DGLC 3NNXA 4BR3A 3ACJA 4BI2A 4ACCA 4G9RA 2ZV2A 1YI4A 5J79A 3FV8A 2F2UA 5KBRA 2I40A 2PE0A 3VW8A 4AZSA 2R0IA 5DMZA 3R7GA 5HG5A 5LXMA 1OBDA 5CX9A 1UV5A 3F3UA 2C3KA 3UODA 5EW8A 4O86A 4I4FA 3PY0A 4BCFA 1Y57A 3CKXA 4X2JA 3IECA 3NNUA 4FV2A 1Y6AA 4CMOA 1F0QA 3IS5A 3AC2A 5DYJA 1AD5A 3OWLA 4FGRA 2PUUA 3VUMA 2QR8A 2C5XA 5CLPA 5CT7A 4DAWA 2VX1A 3QA8A 2C6IA 4O0VA 4DH7A 3F3ZA 3KRRA 5CSVA 4CRLA 2ITZA 5GZAA 4I5CA 5M4CA 3NUYA 3QZGA 4L52A 4AGDA 5CEOA 3DZQA 3QRJA 3ZUVA 4AW5A 3O7LD 1JSTA 1OUKA 2R7IA 5ANIA 5DG5A 4EYMA 3U6JA 5LVOA 3VC4A 1YOMA 3Q9ZA 5IQHA 4A9SA 2EB2A 2OICA 5CASA 2C4GA 4EYJA 4ACHA 4BVUA 2BALA 4YZMA 4EQUA 4F08A 2VTRA 2A4LA 5I9UA 3V5TA 5LMBA 2WGJA 2ITPA 4GJ3A 3ZO2A 1OITA 3W2SA 1SMHA 3OW4A 4O7SA 1E9HA 3F5XA 1J1CA 2XCKA 3CD3A 3EL7A 4HYIA 5AM6A 3CD8A 3DK3A 5I9VA 4GS6A 3C50A 4P7EA 3PA3A 4O4DA 4DDIA 3RPOA 3L8VA 4O1OA 4BTJA 3HV6A 2W05A 4ITHA 3GEQA 3QTZA 1FVRA 1Q4LA 2FVDA 4ANNA 3G51A 1W7HA 4UMPA 1R0EA 3IDCA 5F95A 3ZS5A 2OGVA 3JVRA 3HVCA 3TKUA 4ANLA 4F9AA 3QKMA 4CD0A 5HNGA 5BUEA 1FVTA 3KXHA 1IEPA 3OY1A 4IM3A 4QMUA 3LQ8A 4YJQA 3BEGA 3UO4A 4PNKA 1LUFA 1ZWSA 3TM0A 4N6ZA 3W33A 5CENA 4L67A 4NCTC 4MAOA 3BHYA 4XG2A 4ASEA 2QG7A 3EFWA 2OIBA 5CAVA 3VUTA 2QR7A 4H3QA 1XH7A 4ZSLA 4O22A 3E8NA 4NK9A 2GNIA 2Z7QA 3NLBA 4EKLA 4JNWA 4E20A 5T6KA 2BIYA 4WHZA 3V6SA 3G5DA 3FE3A 3FXWA 4QP4A 1GZNA 3EQCA 2IW8A 1XJDA 3C51A 3SGCA 3KQ7A 2O2UA 4FKUA 3ZC6A 2IZRA 3FMEA 2VTOA 4O4CA 4PY1A 5ANEA 3VRYA 3ORXA 4DFXE 4CLIA 4IIRA 4WT6A 5IA0A 3C1XA 4O0RA 4UZHA 2V0DA 4AGCA 5CEKA 5ICPA 4J71A 4EI4A 2HOGA 3IW8A 4XG7A 3LXNA 4B4LA 5LCJA 3LQ3A 3LXPA 2G2FA 3HRFA 4OTDA 4UYAA 2YDIA 2B9FA 4BCGA 1PKGA 3O7LB 3CQWA 3VS7A 1NVSA 3DK7A 3UYTA 3H0YA 2FO0A 3EYHA 1M52A 3QLFA 1PXNA 4FV7A 4R7HA 3WZKA 3O8PA 4U44A 4YZDA 5C1QB 3OP5A 4NZWB 2FSTX 4HVDA 4FL2A 4MNEA 5L6WL 4F9WA 5J7HA 4ZZOA 3I7BA 4FTNA 3D5VA 3DBQA 4F63A 4AXDA 1ZMUA 3U51A 5CZIA 4YU2A 3PG1A 1OGYA 2OLCA 3AC4A 2AQXA 2HAKA 3I0OA 2VWBA 3CJFA 5E8TA 3L9LA 3LKMA 3FMHA 1OIYA 2B53A 3PJ1A 3D83A 1B6CB 3R9DA 4GYGA 4KABA 4RA4A 4MWHA 3F88A 2YFXA 4IDTA 3TG1A 3UP7A 4C02A 3A8XA 5L2QA 3WF5A 3D14A 1J3HA 3C13A 4KNBA 4USFA 4XHKB 3QXOA 5DN3A 4I22A 4XG8A 4EEVA 1BYGA 4W9XA 2JDSA 4EOPA 1ZYJA 2VTTA 5JKGA 3C0GA 1QPDA 1U59A 3AD4A 4FZ6A 4IWPA 4QP3A 5E8XA 3KXGA 4DEHA 3SLSA 5FXRA 4OAVB 4FRFA 4AXEA 1DI9A 4OUCA 3R7IA 4DFZE 5FM3A 3P78A 1AQ1A 2X2MA 3P5KA 4G3GA 3MTFA 3GUBA 3BPRA 4QQCA 3FDNA 5J8IA 5IA2A 4F6SA 2VTQA 3COKA 3FSFA 3MGYA 4RVMA 4DBXA 4R77A 4ZXTA 4I4EA 2XKFA 3NUPA 5A54A 4EOJA 2EXCX 5J5TA 5E1SA 4YNOA 4O4FA 2BVAA 5A4EA 5LMAA 5J1VA 5KO1A 2GHLA 2VWYA 2XB7A 2XRUA 1GIIA 5JFSA 4FL1A 4NFNA 3IW7A 1MRVA 3F5PA 4PUZA 3S3IA 2F57A 5CI6A 4QYHA 4O2PA 3WF9A 3EN7A 4IAZA 2F7EE 4KS8A 5TT7A 2ZFYA 2BDFA 4OTFA 2R3FA 1R39A 4KKGA 3ENMA 2HWPA 3UIUA 5HVYA 3GC9A 3UBDA 2X6EA 4BKZA 1H4LA 4C61A 1G8JA 2BAJA 1XO2B 4Z9LA 3LXKA 3Q5IA 4NJDA 4BDIA 2GSFA 3OHTA 1RJBA 3IW5A 4L68A 4O7ZA 3P4KA 4DEGA 4DHIB 5HICA 3ZZEA 5AP1A 2QOBA 4I92A 5HTCA 3OS3A 2CN5A 3VAPA 2C69A 4BI0A 4D4SA 5DR2A 3VS6A 2A98A 3LAUA 4UB7A 4J98A 4D2VA 3DZOA 3L9MA 4FBXA 4C4JA 2RFNA 2WMVA 2GCDA 2VZ6A 3LVPA 1H8FA 4L7SA 4AW1A 4DHZA 3NCZA 1XBAA 4L9IA 4RSSA 2C3IB 3D15A 2WTKC 1LP4A 3PPZA 4IHPA 2G2IA 3R04A 2W4JA 4ZJJA 1V1KA 3E88A 5E8ZA 4PMSA 4FIFA 4FSTA 4FV1A 2A19B 4XP0A 3WF7A 3VHEA 4E73A 2VWXA 3QYWA 3FZPA 4CVAA 4FK6A 3AMYA 5CNOA 5ANOA 4I0RA 4AUAA 3E5AA 1R78A 2R3NA 4ZK5A 2EXMA 3ZEPA 2XAOA 3EQRA 3I5ZA 4GKIA 4BIBA 4C59A 2W06A 1H0WA 4W4VA 5J9YA 4JMQA 2WTVA 3W8LA 1UWHA 1OI9A 2R3JA 4RIWB 3HMOA 2FA2A 3QTUA 4I6QA 4XBUA 3UGCA 3KY2A 4IE9A 2YM7A 2CJMA 4EJNA 4FKRA 4J99A 2GHMA 3KN6A 4EK6A 2I1MA 1DS5A 3NAXA 4MXXA 4UEUA 3OMVA 5EKOA 3DOGA 3R7EA 1FGKA 2Y6MA 3OG7A 3W1FA 2E9OA 3KFAA 4WG3A 2CHLA 3TV4A 3UNZA 4BDCA 5HVKA 1PMNA 4DHJA 3W2PA 4IANA 5J95A 5IQAA 3EN4A 5BVNA 2BRBA 3DFAA 1SZMA 3ROCA 4CFVA 3FI4A 3MY0A 3UMXA 2IG7A 5TE0A 4W4YA 4RZVA 5IISA 3DAKA 1TQIA 4FTAA 4QTCA 5C27A 2YABA 3VS2A 5K4IA 4QMVA 4O0SA 4BDEA 4XOZA 3FQEA 4U79A 3TTIA 2NYAA 3PFQA 1VR2A 4FX3A 2JIVA 4EUUA 3TNQB 4PDOA 5IQFA 4BZNA 3WIKA 4KS7A 5IQDA 2XNPA 3BQRA 4D5HA 3PA4A 5E8WA 3R8VA 2UVZA 3COIA 2CGUA 1VZOA 2J2IB 5GNKA 1UKIA 3BYOA 3UC3A 3LFDA 2C0OA 3RPRA 3DLZA 2X6DA 3QQLA 4BKJA 5IQIA 3E64A 5HNIX 3I6UA 5HO8A 4M67A 4EONA 4QP7A 3NW5A 2O0UA 4K18A 4BZOA 2BAKA 2XBAA 3OUNB 2EU9A 3QD3A 2F7ZE 3CBLA 3KK9A 3MJ2A 1SNUA 3P0MA 4KAOA 4QTAA 2AEGA 3G0FA 3N4UA 3JVSA 1YOLA 5FTGA 2JITA 3QTSA 2QOFA 5C26A 3NIEA 3L1SA 4BCIA 4BL1A 4TWOA 4X2NA 4AZEA 2VWUA 4YZBA 5FRIA 3GVUA 2P2HA 4H3BA 2JD5A 2B4SB 3CTQA 3FMDA 3Q3BA 3CTJA 3ZO4A 4DT8A 4AT3A 4AWIA 2EVAA 3HDMA 4K8AA 2GTNA 5BNJA 3QZIA 1Q61A 1IASA 1OM1A 1E1XA 2XJ0A 4QPMA 1OL2A 4FK3A 1U5QA 3ZLXA 4YLJA 3ULIA 1ZOHA 3UPXA 2XM9A 3BBWA 3P08A 2ETKA 3UYSA 3NUNA 4G5JA 3DU8A 3QTXA 2H34A 3GC7A 2EWAA 3NVKI 4IJPA 2F9GA 4WA9A 4KBKA 5H3QA 4U45A 3RAIA 5AEPA 5FDXA 2NPQA