2X7FA

Crystal structure of the kinase domain of human traf2- and nck- interacting kinase with wee1chk1 inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
299
structure length
276
Chain Sequence
LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAGTPYWMAPEVIAYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAF2 AND NCK-INTERACTING PROTEIN KINASE
publication title Crystal Structure of the Kinase Domain of Human Traf2- and Nck-Interacting Kinase with Wee1Chk1 Inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 276
sequence length 299
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2x7fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2x7fA01
3AC1A 2WAJA 4QTEA 2VTQA 4IHPA 4C3RA 4EQUA 4YTCA 4K8AA 3IW7A 2UUEA 2V0DA 4I0SA 4BWXA 3ZFYA 2Z7RA 3SA0A 2WU6A 5CF5A 3F3VA 4O1OA 1U5QA 3W2CA 4R77A 4MVFA 5HOAA 2ITNA 2WMWA 5CAOA 2RFSA 3EQHA 5AIKA 3FEGA 4FGBA 3JPVA 5DFPA 4M0YA 3ZTXA 4B6LA 3WARA 4YO6A 2F49A 2G15A 2W05A 3NYXA 2XK8A 3ANQA 3QXOA 3QUDA 1VYZA 3P86A 2IW6A 4I92A 5D11A 4LMNA 4L68A 2WTVA 3QTRA 4QMOA 5EI6A 5EOLA 3BX5A 4ANSA 2GNHA 4AZVA 5HBHA 4NU1A 4Y95A 2ITVA 2R3RA 5M56A 3EB0A 2WMBA 3LW0A 4LRJA 4B7TA 3CCNA 4CVAA 4I1ZA 2B54A 4YJSA 4RSSA 4IX3A 5FDPA 3GQIA 4CFFA 3FY2A 1OBGA 4N6ZA 2RKUA 3FC1X 2QO9A 2QONA 4BDJA 3LJ2A 4FEVA 2PMIA 5L3AA 4X3FC 2PVHA 4ZIMA 4EYJA 3MV5A 4ZAUA 4WG4A 2IVUA 3JUHA 4HVIA 5IG1A 5TR6A 5JRQA 5LXMA 3EOCA 2QOLA 5EI8A 3AD4A 4BCMA 2X2MA 2IVTA 3SG8A 1OL1A 5BVFA 4RC2A 2R4BA 2PMOX 3MIAA 5AAEA 4WNKA 1H1PA 4A4LA 2PZIA 2HZ4A 4FL2A 5T3QA 3UPXA 5HG7A 5L2IA 3OEZA 2UZDA 3ZLWA 3MFRA 1XH7A 2BCJA 4CFVA 5EYCA 1YXTA 4ACHA 4EUUA 1OL5A 2HZ0A 4O38A 4DE4A 4JT3A 4PUZA 5HE0A 4CV8A 3U6HA 4AZEA 4YSJA 2H8HA 3WZJA 3QWKA 3UJGA 4BFMA 1GIIA 4O7YA 5BQ0A 4TYHB 1OB3A 4DFZE 4S2ZA 4NKAA 3UVQA 1CMKE 4DGMA 4F64A 4RA4A 3NUAA 4JRNA 3BGZA 3LCKA 2BDFA 3LXKA 4UV0A 3ZM4A 2CN8A 4CTCA 2VTOA 4WKQA 3HRFA 4AN3A 4EBWA 4JBPA 1FMOE 3Q96A 2FYSA 3EQGA 4U41A 3TWJA 3MESA 5G6VA 1Z9XA 3PTGA 1IRKA 2W4JA 5FEDA 3ATTA 2F2CB 2E9UA 3NIEA 4TWPA 3QGWA 4P5ZA 4B8MA 4XP3A 3M1SA 5CVFA 4HGLA 4W4YA 3SOAA 4USDA 3PJ1A 1KOAA 3I5NA 3U4UA 1R1WA 3QRUA 2B9IA 2W96B 4C59A 3O0GA 3DLZA 4RVMA 3AGMA 2XIYA 5M06A 4UZHA 5CEKA 2GNFA 3UP2A 4BCQA 2PSQA 4FUXA 2W5BA 5ANKA 3CGFA 3UDBA 4DN5A 2WQEA 2VRXA 4W9WA 3ODYX 3QZFA 4BBMA 4TPTA 5IDPA 2XKDA 1UU8A 2ETKA 4DFNA 1P4OA 2V55A 4CEGA 5BYLA 3FHIA 1Y91A 4I24A 3V5JA 3V5QA 3PVGA 5BNJA 3F5XA 2WGJA 4C0TA 3PE1A 2AC5A 2ETRA 2WO6A 2IW8A 4FKPA 3V5WA 5A9UA 2YIYA 4R7IA 3R8LA 4NCTC 2X7GA 3NCZA 4QYFA 4ID7A 1IA9A 1P5EA 2QQ7A 4XV3A 4EC8A 1SVEA 4FZ6A 3OCSA 4O0TA 4BKJA 4O7VA 4FTNA 2CKPA 2X1NA 3P79A 5GJFA 1A9UA 5FGKA 4LI5A 4RX8A 4I20A 3DA6A 5HG5A 5D7AA 4HW7A 3VS2A 3GC0A 2OFVA 3FMMA 4FZDB 4IM2A 4ZTRA 3HNGA 3NZ0A 4II5A 3L9LA 3VBVA 4AOTA 4DLIA 5AADA 3UG2A 2Y6MA 4WBBB 4R1VA 3AT2A 4Q5HA 4V04A 4ACGA 2C6KA 3D5UA 4FV2A 3BRBA 5FP5A 4IWOA 4U43A 4FKUA 5HVJA 2Y4IB 3OTUA 5GZAA 3NMUF 4NM3A 1H4LA 4BCOA 1H1WA 3Q5ZA 3QC4A 4IVBA 4MBJA 4PMMA 5E8UA 3FQHA 2HYYA 4C37A 3DJ6A 3HL7A 2C68A 4TYJA 4FEQA 4QMNA 3S1HA 5L2QA 3MWUA 4QNAA 5CU3A 2XRUA 3IDBA 3QKMA 3R9HA 2R0UA 2PK9A 3DTCA 4MXCA 5IEYA 2PZ5A 3OCBA 4AUAA 3DQWA 3DJ5A 3VUIA 5FM2A 4U81A 4YZ9A 5FRIA 4CNHA 4Z7GA 3O8TA 2W5AA 4TYEA 4I5HA 3KXHA 5CSXA 3TEIA 4X2GA 4I0TA 4K2RA 3TJCA 4D9TA 5C26A 1JWHA 1V1KA 4F1TA 3GXLA 1KE5A 3PG1A 1ZYCA 1ZYJA 3GT8A 2ITYA 2ZMCA 3I81A 4FTAA 4GJ3A 2YM5A 4H39A 4PNKA 5CAPA 3FZRA 3UTOA 4TYHA 1URWA 5HTIA 3ZZEA 4CFNA 4QPAA 3ID6C 3AXWA 1I44A 3QTXA 4Q2AA 5IQDA 2W1HA 4ZTNA 1E1XA 4N0SA 2JDOA 3TV7A 5IQFA 4M66A 3MIYA 3JR1A 3PJCA 4P7EA 2WTWA 3RKBA 4Z7HA 3QRJA 2IVSA 3AMYA 2BDJA 4FSZA 4HZRA 1JSUA 2VWUA 3DLSA 2YCFA 3DGKA 4DH5A 5AUTA 1F3MC 5I9WA 2BROA 3OBJA 3EQDA 3RCJA 4RX5A 3LOKA 2OGVA 4FKLA 4Y83A 5AP2A 2IZSA 3ZDIA 2BRMA 3E5AA 4IBMA 1NVSA 3W16A 4ANQA 3CPBA 3MVJA 3PVUA 4KABA 4OTIA 2XNMA 3R1YA 4EOLA 5CF8A 4RVTA 4HNFA 4C3PA 5L2WA 4KUJA 2QD9A 3EKNA 2V5QA 5D12A 4GYGA 4FKOA 4HYUA 4ZEGA 4DINA 2ZDTA 3EHAA 4YZBA 4E5AX 4LUDA 2H6DA 3RPVA 3ZZWA 4BIBA 3D7ZA 3PY3A 5K4JA 2JDSA 5E4HA 1FVTA 2XCKA 5BYYA 3BHVA 3JVSA 3BWFA 3A7IA 2CKEA 4BYIA 4FV5A 2PL0A 1GNGA 2E9VA 4RJ7A 4QYYA 4BDKA 2C0TA 2YJRA 4C4IA 4CMOA 3R7UA 2A2AA 3QALE 4WSQA 4YJPA 5CU4A 3F5PA 3VC4A 4FMQA 4NW6A 1GZ8A 3PG3A 3D5XA 3HA8A 4H1MA 4KS7A 5BVDA 4NM5A 3HEGA 2Z7LA 3NWWA 4AGDA 3NUNA 3QLGA 1NA7A 3DJ7A 2BKZA 4KBKA 3V51A 5M08A 3IGOA 2B52A 3LXPA 3P23A 3PFQA 3OXZA 4ALUA 2E9OA 4U80A 5CEPA 5ETFA 3S4QA 2X9EA 3VBYA 4RIXB 4QMWA 1BL7A 5AX9A 3CPCA 4XLVA 5A4EA 2C5XA 5HBEA 5KHXA 4R6VA 5BMSA 4XBRA 2RSVA 3I4BA 4AAAA 2C69A 5HNIX 1H00A 5T68A 3K3JA 2V62A 4IW0A 1GZNA 2OK1A 3PUPA 4XOZA 2OSCA 4J52A 4ZK5A 3R9OA 2G2FA 2WB8A 4JIAA 3SDJA 3H9OA 1PJKA 4AT3A 2EXEA 3P78A 4BWPA 4BDBA 2NRUA 5BUIA 5EM6A 1MQ4A 4QMYA 4MF1A 4TW9A 4ZXTA 1R39A 3OT8A 3MPMA 3QU0A 4DTAA 4CQEA 3DDQA 2HAKA 4FSYA 3BYOA 3BYUA 3R9RA 3O8PA 4YO4A 4HNIA 3TKIA 1ZMUA 3DKGA 5JZNA 4F6WA 3DTWA 3ZLSA 3VJNA 1YQJA 4EHEA 3LVPA 3NNVA 1ZZLA 2P4IA 3R22A 4L3PA 3ZUVA 2VNYA 4AGWA 5C8KA 3G51A 3NNUA 3BQCA 3OUNB 4AX8A 3Q2JA 2ZV8A 4IB1A 2QODA 2XIRA 4IE9A 5J9ZA 4YJTA 4OBQA 3R8PA 1OGUA 4U79A 4B99A 2HCKA 2OIQA 2VX3A 2I1MA 4L3JA 3GOPA 2QO2A 4QMLA 3NGAA 4J98A 4BYJA 4CZUA 4YNEA 2BZKB 4ZTMA 4HVGA 3EZVA 3NDMA 5LARA 1XH6A 2QU6A 3Q53A 4WNOA 2WMTA 3KC3A 4NM0A 4OW8A 5JMSA 4AA4A 5GZ8A 2RIOA 3EFJA 5M4FA 4I4EA 3C7QA 3RZFA 3H3CA 2ERZE 4EORA 3FPMA 5K5NA 3FJQE 2C6MA 4FTJA 4QPSA 2GDOA 3ORTA 1IEPA 3QCQA 3HMIA 4RIWB 4ZLOA 3ITZA 3QZGA 4WOVA 4RIYB 4G3DA 4FZAB 4IH8A 3OG7A 4RWIA 4RZWA 3PA4A 3WZEA 4EHVA 2W1ZA 4IWDA 5CS6A 2Q83A 4FSTA 3A4OX 3C1XA 2LAVA 5DEWA 2BHHA 4AZTA 5J95A 4CT1A 4O86A 4NH1A 3PP0A 3U6JA 4AW1A 3MH1A 3QX4A 3T9TA 4UMUA 4OAVB 5FTGA 2ZM4A 3DV3A 4EOQA 4M0ZA 1NY3A 3T3VA 3TCPA 3H10A 2ITPA 5EM8A 1JVPP 2C4GA 2C6IA 2I6LA 3GCPA 4MWHA 5IQBA 1ZZ2A 2OF2A 5CY3A 4OTQA 3DK6A 4GK3A 2VN9A 4M7IA 4NK9A 2GS7A 5ETAA 3VHEA 5AV3A 2R0IA 1TQPA 1R0PA 2QO7A 4E73A 5LVPA 2VTAA 1WFCA 4QTAA 1MRUA 4FI1A 5HO8A 5KBQA 4PPAA 4ZLYA 3D2KA 4V05A 5CAQA 1WBNA 3Q60A 4RFZA 4BWKA 4PPCA 3COIA 2F7ZE 2XJ2A 5HCXA 4BDIA 4E6CA 1YKRA 3FLNC 4A06A 3RTPA 3E8CA 4FG7A 1WBPA 2OXXA 4F1OA 3PY1A 5LWMA 2WELA 5LMKA 4IWPA 4UWYA 3LIJA 3R04A 4RA5A 3O17A 4FVPA 3LXLA 5B2KA 3HYHA 4FOBA 2PE2A 4CZTA 3KCFA 3SW4A 4BN1A 2Z60A 1FVVA 2ESMA 5AAFA 3UVPA 2JKKA 4DGGA 3FMDA 4EHZA 4I5CA 3FMHA 3GBZA 4BCGA 3QX2A 3BBTB 2C0OA 5L2SA 4QNYA 4WHZA 4DFLA 2R3LA 3R1NA 1O9UA 5CSPA 3LFAA 4W9XA 4E26A 4RX9A 3BU3A 3MSSA 3LAUA 1Q8YA 3DKFA 4UMQA 3PRIA 1V0PA 4PTEA 5E8XA 2CCIA 3QD0A 4WSYA 4IM3A 4OR5A 3VJOA 5I9YA 3PYYA 2BAJA 2R3OA 3LCDA 4WG3A 3RINA 4B0GA 4C8BA 1Y57A 4YC8A 3TACA 4G3FA 1MP8A 4CFXA 3ENMA 4PNIA 2JC6A 4I0RA 2RG5A 4EH3A 5IA4A 3BKBA 3E62A 2OH0E 4GL9A 2W17A 3ORZA 5EFQA 5HG8A 4PMSA 3RAWA 3C4XA 1OMWA 4OLIA 4RVLA 2R3MA 3BEGA 2YWPA 3FDNA 4O7ZA 2ZB0A 3ULIA 3Q9ZA 5AP0A 2G2HA 5JGBA 4M14A 2GNIA 2UW6A 3I7BA 4FT9A 1M14A 5J8IA 2QVSE 3AT3A 4L6QA 3MA3A 1KV2A 2C3KA 3NAXA 5BVOA 5IUGA 1J3HA 3EQIA 1IAHA 1APME 3POZA 5CEQA 4EK3A 5LCKA 1UVRA 4Z16A 3UBDA 4IWQA 4CZYB 3V8WA 1H28A 2W9FB 5EYKA 3DU8A 3U54A 1ZYSA 3LCSA 4GUEA 1YDTE 4ZS0A 2QOOA 4LGGA 3VW6A 4AW5A 3ZH8A 4BDAA 4CRSA 3VRYA 4GT5A 4IACA 4G17A 5F9EA 3DY7A 5AR8A 5CU2A 5IPJA 4O6LA 3KXZA 4RIYA 4KA3A 3PIZA 4O84A 2XRWA 3GEQA 4GUBA 2A19B 3IW6A 2GNGA 4GG5A 4M15A 4K33A 4MTAA 4ZP5A 4H05A 1DM2A 4H3PA 3UQFA 1O6KA 1PYEA 4G5JA 4IB5A 4X2KA 4HGEA 4XOYA 4JBVA 4JJRA 4L01A 2FVDA 3UQGA 4FSQA 5DBXA 1FBNA 3SX9A 3RAIA 5A4CA 1YVJA 2R3FA 3AMBA 5HIBA 2XNOA 2UW8A 3PP1A 5HIDA 3NUPA 3DBEA 4ZSLA 1AD5A 4RC4A 5E90A 5I9XA 2V7OA 1YWRA 1ZOGA 5L8KA 4XBUA 4FE2A 4GIIA 4J53A 3FKNA 4FEUA 1JBPE 4HCTA 3AG9A 1YHSA 4YGAA 4EWQA 4PDSA 4CLJA 2YN8A 4A9RA 3TUCA 2A4LA 2G9XA 3OBGA 3A60A 1YHWA 3WBLA 2BTRA 4LMUA 5ITAA 3RAHA 2X8EA 3A7FA 3D4QA 3O50A 4G3CA 3RAKA 4DA5A 4PRJA 1OPLA 5EDQA 5JH6A 3FMKA 2B7AA 3VBQA 4Q9ZA 5CENA 1J7UA 3L1SA 5L6PA 3E3PA 3WF6A 4X2FA 2GQGA 4RFYA 4DLJA 3P1AA 4C38A 3QRTA 4XLIA 4DH8A 4ZMFA 3DDPA 1QPDA 1K2PA 3CIKA 2HK5A 3ZYAA 4RC3A 3W2PA 4KINA 2XNEA 5JRSA 3FI8A 2WMVA 5LQFA 4QTCA 2UZWE 4A9TA 3JYAA 4YHJA 3O71A 3NVMB 5EH0A 2IVVA 3OVVA 2QURA 3SC1A 3SRVA 1A48A 3EN4A 2XCHA 5CZHA 3SV0A 2C5OA 4D4YA 1W8CA 5AUYA 4F6SA 5E1EA 2W06A 1IASA 1L3RE 4FK6A 2PYWA 3HV4A 5CZIA 4AA5A 3JS2A 4TY1A 4YHFA 2ACXA 5IU2A 4TWNA 2OJ9A 5L2TA 1OIRA 5E8SA 3FMJA 3PVWA 1YI6A 3G5DA 4DH7A 3HMPA 2J0LA 4I23A 4WBOA 1SNXA 5A6OA 3KK8A 3ALNA 1I09A 1M7QA 2HELA 5HG9A 5ETCA 1YXVA 5E8WA 3R7OA 4NJDA 5J1WA 3ETAA 2UZTA 3PZEA 3QUEA 3BPRA 3E92A 2YIQA 3QQGA 2VTNA 3WF8A 4AW0A 4BCFA 4BTFA 5CYIA 5JQ8A 3QWJA 1QL6A 2CHLA 2OXDA 4WO5A 3LFQA 4WG5A 3QUPA 4KSPA 5AA8A 4GT3A 3W2OA 1ZWSA 3GENA 4C4JA 3ZEWA 4IC7A 2OZAB 4YJUA 5HE2A 4CD0A 5M07A 4ZOGA 2BAQA 1T45A 3VS1A 4O7WA 3FLWA 4HOKA 5AUXA 4E20A 2GQSA 4D9UA 4LOPA 3ATSA 3TDWA 2XUUA 3FZPA 3CXWA 5H3QA 2OIBA 5ICPA 1PW2A 3FLYA 3QYWA 4R5SA 4E5WA 2JBPA 4KBCA 3KK9A 1LEZA 1YI4A 1M7NA 2X8DA 3KF4A 4GK4A 4E93A 2J50A 2W1FA 4OAUC 3CSVA 3UNKA 4GEOA 3ZBXA 4ARKA 2BRGA 3SXFA 2X81A 4QQ5A 3C0IA 5DR9A 4IJ9A 3ELJA 1V0OA 4YJVA 5FD2A 3M2WA 2JLDA 3OROA 1KE8A 4GG7A 2QHMA 4IC8A 3R02A 5AUVA 2X9FA 3GCQA 3OW4A 2W1EA 2C3IB 3ZRLA 3BLRA 3NS9A 2VTRA 3ZEPA 3PE2A 4DEIA 3C5IA 3CJFA 3MS9A 3QTSA 4ANNA 4EH5A 3D94A 1YWNA 3OTVA 3O23A 3FHRA 5CANA 1H27A 3VUMA 2F57A 2CLQA 3KB7A 5G1XA 1YDSE 3N51A 4BKYA 3FY0A 4FSWA 4XNEA 3COHA 4E4MA 5M44A 1U59A 1RJBA 2HIWA 1J1CA 3FSKA 3VS6A 1KUTA 1ZYLA 2W1CA 4YU2A 5CAVA 3FLQA 3FYKX 4FTUA 1OL6A 2C6TA 3R0TA 1UWJA 4AP7A 2I7QA 1TKIA 4RQVA 3PXKA 4YUQA 2GCDA 4RT7A 4O0UA 2HWOA 3PSBA 3QQHA 4JQ7A 5M4UA 2J0MB 2WTKC 3NSZA 1KSWA 3COMA 2GTMA 3G33A 1DS5A 3PIYA 3QHWA 4I21A 3COKA 3W55A 2CJMA 5FEEA 2JITA 2BDWA 4DAWA 4FTLA 3R8MA 5HTCA 3C4CA 1Q62A 1AGWA 1UA2A 3DBCA 2J2IB 1XHAA 3RPSA 5GJGA 4CTBA 3UP7A 4YZNA 3HP2A 2VWIA 4EHGA 5K0XA 5JK3A 4BBEA 2Z02A 2GU8A 1UU9A 2WMRA 4BGHA 3KMWA 2X2KA 2ITQA 1H8FA 3RHKA 3P0MA 4FKWA 2ZM3A 2H34A 4AXAA 3CTQA 4XHKB 3RK9A 5IF1A 3QD3A 2DYLA 4MXYA 5FM3A 4D4VA 4JDIA 4EOKA 3P08A 4M13A 3BGPA 1IR3A 1JLUE 4P2KA 5HNBA 1O6YA 4LM5A 4YP8A 4E3CA 2R64A 3MVMA 2CGUA 3WZKA 3FQEA 2UW0A 3FMNA 4DEDA 2V22A 3HRBA 4O96A 4AT4A 5LVOA 1GIJA 3GC7A 5TKDA 3DCVA 2ONLA 3C4ZA 5A54A 5LJJA 4EEVA 1PXOA 3ZLYA 1OKYA 4EH4A 1Y6AA 4JAJA 4YTFA 4WUNA 2HW7A 1KWPA 3A2CA 3SHEA 1NT2A 3RJCA 4U44A 2C3JA 4M3QA 3RK7A 4C4EA 2PPQA 4FTCA 5KMKA 4PY1A 5J5TA 2QKWB 1OVEA 2UW9A 3OMVA 4UYNA 4AN9A 4ZLZA 5KKRC 2CNUA 3LE6A 4UMTA 5LMAA 3ZSIA 4PMPA 3W8QA 1YXSA 3GOKA 5J9YA 4FL3A 4CXAA 4F7NA 3EYGA 3QA0A 4YPDA 4F99A 5CI6A 3WF9A 3LFCA 2B53A 4BI0A 5JQ5A 4O7RA 3TIYA 4XH6A 1MUOA 4RG0A 4RLKA 3ENHA 5IEXA 2PVRA 3F2RA 3VUKA 2I0HA 3LCTA 4X7QA 4MNEB 3S95A 3ZXZA 3TZ9A 3PLAE 4L53A 3CBLA 1REJA 3SOCA 3HDMA 3HX4A 3KRWA 4D0XA 4TWCA 5M55A 5ACBC 2XK3A 4D28A 3A62A 3V8TA 5KE0A 5CF4A 2WQBA 2ITOA 4CKRA 5BVWA 1XJDA 2VAGA 3RWQA 2ONLC 4FG8A 1HCLA 3ACKA 4IDTA 4AZSA 1UNLA 2WU7A 4F63A 3DXNA 1REKA 3HLLA 4U6RA 3ZSGA 1YDRE 1XBCA 2KULA 3VW8A 5HVKA 3F3WA 4BTKA 1WVWA 2JBOA 2YITA 4F70A 1Z5MA 4P4CA 4Z55A 3N4TA 2HZIA 4RRVA 4FSRA 4UYAA 4BCNA 1JKTA 4TYGA 3VO3A 3ORLA 1UKHA 5CVHA 4UMRA 4HPUE 3HA6A 3NYOA 1DAWA 2VWWA 3PJ3A 4JDHA 1CDKA 4G3GA 1B6CB 3NEWA 4WT6A 2YM7A 5A4LA 4LG4A 5JT2A 4R7BA 2JAMA 3FL4A 4R8QA 5I9UA 5IQEA 5IMXA 3TUBA 1Y8GA 2G2IA 3OEFX 3SD0A 2OJJA 3CQUA 4XUFA 5JFSA 3H9RA 2UZLA 4F7JA 2JD5A 1TVOA 4UB7A 1IAJA 2YERA 3TKUA 3E8EA 2C0IA 3FZOA 3FMEA 3RHXA 4HGTA 3BHUA 2A0CX 4UXQA 3B8QA 2YM4A 3OWKA 3VF9A 3MBLA 4S31A 5IMEA 3P9JA 4C36A 2GHMA 3KL8A 3IW8A 3U6IA 1OM1A 4NTTA 2W7XA 4X2NA 4OTRA 2PVKA 2UZBA 3R7EA 1W83A 1WZYA 3MN3A 4IQ6A 2WMUA 3JY0A 4AG8A 3ROCA 3EQFA 3ZOSA 1UU3A 1FOTA 4HPTE 4KIKB 4RJ5A 4XEYA 3ERKA 2C5NA 3HZTA 3KXXA 5C03A 4UALA 2O5KA 1JKKA 2XMYA 3FUPA 3EIDA 4CKJA 5B2LA 2VTHA 1ZY4A 1M17A 5I3OA 2UZVA 2Y4PA 3II5A 4IAIA 4JG8A 5A46A 2FGIA 4ITJA 2B9HA 2WKMA 4ACDA 5GJDA 3VBXA 4B8LA 3KRLA 5JFWA 5D1JA 5I4NA 1Q61A 4IMYA 3TTIA 4N6YA 3GCVA 4IX6A 4BC6A 2JFMA 2NNWB 5AP3A 2XK4A 3M11A 5DEYA 4D2WA 5CAUA 4ENYA 4FKVA 2VTPA 4FK3A 4YSMA 1PMUA 2KTYA 3MB7A 1Q24A 2UVYA 4Q5EA 3UYTA 1OUYA 5FBNC 3DNDA 3G0FA 3GGFA 4EI4A 3PVBA 4UWBA 3HV7A 2BRNA 4FSMA 4E1ZA 4RJ8A 3R7YA 2J5FA 3FC2A 3V5TA 4D1ZA 2CMWA 3NPCA 4AE9A 2IPXA 5EDPA 3TNWA 3VWAA 2W4KA 2JEDA 5AFVA 1Q8ZA 3RCDA 3TKHA 1BUHA 4C57A 5CWZA 4DGLC 3C5UA 3GU5A 3FV8A 4MNEA 4XX9A 2HXQA 3RMFA 3IW5A 2WTJA 3A99A 1OKZA 3R71A 4DTKA 4QMTA 2VNWA 2REIA 4O7SA 4ZY4A 2VV9A 4QMUA 3G2FA 4IZYA 4BVUA 2PY3A 3EH9A 3F3UA 4ITIA 1OKVA 2R3IA 3MW1A 3PXZA 5EDRA 4EK6A 2A27A 3V04A 4F65A 2XYUA 3EQBA 5A6NA 4O82A 4XG2A 3AQVA 2W5HA 2XK9A 3DOGA 3A61A 4G34A 1DI8A 4RWLA 3D14A 3IGGA 1KV1A 5B0XA 4F9WA 3DAJA 4AACA 2JFLA 3ANRA 4EZ7A 3FLZA 4DEAA 2ZMDA 4CGAA 3OW3A 4IVDA 4D4RA 1JAMA 2XJ1A 3DNEA 4BL1A 4RLLA 1R78A 1W7HA 2BPMA 2R2PA 3PPJA 3Q4TA 5AR2A 5C01A 3UOKA 2JGZA 3E8DA 4PDPA 4H1JA 3PRFA 4J95A 3QQLA 3WE8A 2PZYA 5CQUA 4MK0A 4ASZA 3IW4A 3LKMA 4YBKA 4BZOA 4DEHA 3NW6A 3WYYA 3V5PA 3T8OA 1YHVA 1PXLA 3TZ7A 4FTMA 3ZM9A 1PXJA 2I40A 2GNJA 4R3RA 5FEQA 4KD1A 3MH2A 4BRXA 2PUNA 1U54B 2NO3A 4O0SA 2ZV7A 4CFUA 2FO0A 3QTUA 3QXPA 4IZ7A 4W4XA 2UVXA 5D41A 3DBQA 3QLFA 4LGDA 5FDXA 4FX3A 4DGOA 5IH5A 5JGAA 5HNGA 2O65A 4GCJA 2PVLA 3O2MA 4NM7A 3G6GA 5FXSA 3TUDA 1Q4LA 2R5TA 3OD6X 4X6QC 5ANEA 5KUPA 4JBQA 5FLFA 3P7AA 2BZIB 4RPVA 4X21A 2GFSA 4BI1A 2PVFA 2UZNA 4MCVA 4E4LA 2XM8A 1WBVA 3W2QA 4Y85A 3AC8A 2Y0AA 4YLJA 4UBAA 4AN2A 4BCIA 4BIEA 2OH4A 4FVRA 1H1RA 2WEIA 3UNZA 3V6RA 4DBXA 2W1GA 2YCQA 4M69B 4QT1A 4FIFA 2QR8A 3ZO1A 3NYVA 5H2UA 2HWPA 1VR2A 1Q5KA 2Q0BA 3UQCA 5CF6A 3W8LA 4YR8A 4RIOA 3FE3A 5TOZA 3LQ5A 5IQCA 3QAME 1Z57A 3MFUA 4G2FA 1WBOA 5J9LA 1XBAA 3EFWA 1PY5A 1SVGA 2O0UA 5EKOA 2P55A 5CVGA 3IONA 4MX9A 4QOXA 5HBJA 4ALVA 3LMGA 2XBAA 4L42A 3C4EA 5GINE 4Y5QA 4O7LA 3EQCA 4NIFB 2RFEA 3F66A 3UC4A 1W98A 3E7OA 4ANMA 3FXZA 4XP2A 5HORA 5IQIA 5IDNA 3F2AA 5M51A 4FZFB 5AV4A 4F7LA 3A7JA 4F08A 5I3RA 4JQ8A 4BKZA 2OO8X 5IKWA 2IG7A 5AP1A 5EOBA 3QQJA 1H07A 3CY3A 3DAKA 4RJ6A 5KZIA 5L6WL 3UODA 3HRCA 3KN6A 4FKGA 2PMLX 4A4OA 4U97A 3U4WA 4EH2A 4YURA 3LFFA 4HJOA 4BCHA 1JQHA 2Y4IC 1OL2A 3QHRA 3GP0A 3EL7A 3IPHA 5DVRA 2F7XE 4PV0A 5HO7A 4U8ZA 5CLPA 3ULZA 3BE2A 4MXOA 3IQ7A 5DMZA 5HD4A 1PMVA 1VZOA 4FKTA 3RVGA 4PTCA 1GAGA 1KE6A 2Y6OA 1H24A 5AUZA 5DOSA 3L8SA 3RM7A 4EH6A 5JZJA 1G5SA 1Q3DA 2R9SA 4O0VA 4ZSJA 1BYGA 2XK6A 3R21A 4HVDA 4ZZNA 4BHNA 4WRSA 4YLLA 4JX7A 3PSCA 3QQKA 5AR7A 4Z3VA 3BHTA 2CKQA 1P4FA 4KBAA 4LV5A 2R7IA 1XH5A 4FSUA 2OLCA 3R8ZA 4G3EA 2CLXA 2X7OA 4LRMA 3DK3A 2JIUA 5C8MA 1Q8UA 4APCA 3F82A 2YIXA 3MY5A 4FZ7A 4XG7A 1ZOHA 4EOSA 3WF7A 3OHTA 2XNPA 4Y5HA 1OIQA 4UXLA 5BVEA 4FIHA 4ZJVA 5IZFA 5IUIA 4C34A 2QU5A 4BI2A 1RW8A 3OY3A 4LFIA 4J7BA 2BTSA 4AS0A 3EJ1A 3LFBA 4LL0A 1CKPA 1WAKA 4KWPA 1SMHA 3UGCA 2XKEA 4MXXA 4RZVA 5JGDA 1ZY5A 3OZ6A 4QP6A 4QMMA 2XP2A 2UZUE 3Q4CA 3HAVA 4PWNA 3E8NA 4CQGA 4RIXA 2FSTX 2VO6A 4S32A 5CXZA 4NYEA 4ZSGA 4XV2A 3B8RA 4M97A 4XG4A 4LV8A 1ZRZA 4QTBA 2BR1A 4V0GB 5BUJA 2BAKA 3HMMA 4TZRA 5AV1A 4KIQA 2ZB1A 1W84A 3BGQA 3E63A 4YJQA 5DT3A 2WNTA 4NT4A 4WA9A 2J5EA 1JSVA 3E7VA 4O0XA 5ANIA 3UZRA 4N4SA 1W0XC 2X2LA 4H36A 4J71A 4BY9E 4XCUA 3F2NA 3AD6A 5EG3A 3NUXA 4C7TA 1G8AA 4GKIA 1T46A 3MH0A 4AF3A 4EK5A 2PMNX 4FKQA 2LGCA 3FSFA 3QCYA 2YDIA 3EQRA 2XYNA 4F09A 4UX9A 2SRCA 1KE7A 3OS3A 4L3LA 1WCCA 2FSLX 2WHBA 4O0WA 2CSNA 2WQNA 3NNXA 3PXRA 1H26A 2BIKB 2QOHA 3V3VA 4F9YA 4NIFA 2J7TA 4CCBA 3OOMA 2YISA 4DFBA 4PP7A 2O8YA 2UW3A 3BEAA 3D0EA 3KGAA 5HE1A 5E91A 3HECA 3N4UA 4BBFA 2R3PA 5TE0A 4UZDA 3OWJA 5KO1A 5CALA 5CNOA 1UNHA 2O64A 2W1IA 4QP9A 3EMGA 4GFOA 4I93A 2RFDA 4FUYA 4QP4A 2J0KA 4EOOA 4G9RA 5FXQA 1PXMA 1XR1A 4C61A 5LMKC 5B2MA 4BCPA 5GZ9A 3BYSA 3ZXTA 5J5SA 3VIDA 1UU7A 2FSOX 4CYJA 1ZOEA 2YLEA 1OKWA 3D83A 3Q6UA 4JQEA 1KOBA 2VU3A 4IVCA 4MBLA 5JFVA 4A7CA 3DBDA 4TWOA 4AGUA 5FUTA 3U51A 4TN6A 3PA5A 1BI8A 2CKOA 4FV7A 3VBTA 3PA3A 3KXNA 3UO4A 3DKOA 4RIWA 4C02A 4O21A 5AP6A 5KX8A 4F9AA 5DGZA 3QZHA 2UW5A 4FV9A 4IAYA 4QP7A 4BF2A 5M09A 2VD5A 2X4FA 3NW5A 4U45A 2WD1A 4GU6A 4L7FA 2HY0A 2JDVA 3VUHA 3PJ2A 4OUCA 1OL7A 5DRBA 4EOPA 1ND4A 2VTMA 2WMAA 4IEBA 1M2QA 4P5QA 2YZAA 2E2BA 3EYHA 4PX6A 4QTDA 3JY9A 3K5VA 1Y6BA 3VNTA 3GU7A 2CGWA 4E4NA 2OXYA 4FV6A 3R1QA 2XEYA 1PXPA 4FT7A 1OBDA 5E7RA 4HYSA 3KMMA 1UV5A 2WOTA 3FAAA 3HMOA 3NUSA 3WIKA 4TL0A 3NRMA 3FPQA 4DHFA 4E8AA 2ITZA 4EKLA 5LOHA 3KULB 2VWXA 3FXWA 5KNJA 2QNJA 2WXVA 4DGNA 3HKOA 1O6LA 2WQMA 1LR4A 5DLSA 5DWRA 4KKGA 4CCUA 3RK5A 4ANOA 4IB3A 1BMKA 4A9UA 4DT8A 4S34A 5AAGA 1A06A 1GOLA 2QOBA 3F6XA 4P90A 2YZLA 2ITXA 4JVGA 3TNPC 5IQGA 5IQAA 5HX8A 2VGPA 3IOPA 4WRGA 3VS3A 4JOAA 5KCVA 4FICA 1QPJA 2YDJA 5T6KA 4V0GA 3LMHA 2BILB 3Q3BA 1ZMWA 4M68A 2YDKA 3EN6A 3AT4A 3A8WA 2PZPA 4PTGA 5CTPA 3ZBFA 2OW3A 4HZSA 1ZLTA 1XH4A 4M84A 2C5VA 2C3LA 3BE9A 2R3HA 2W4OA 5BPYA 3QA8A 2YACA 3P7BA 5KZ0A 2YAAA 3IO7A 4CKIA 3QTQA 3G6HA 1PXNA 4O0RA 3L9PA 1XQZA 1UWHA 4EJNA 2EXCX 3F5GA 4U7ZA 4WNPA 4G6OA 5M57A 4TXCA 2OF4A 4W8DA 2ZDUA 3V01A 3TL8A 3F69A 5KBRA 1OIYA 4U3ZA 4FT0A 2OFUA 5LCJA 3VRZA 4X3FB 4ZZMA 3FMLA 4BDEA 4A4XA 4ZY5A 5DG5A 2H9VA 3MY1A 2PU8A 2PVMA 1WVYA 3R00A 2VTTA 5DNRA 4CT2A 4U3YA 4X6RA 4QD6A 3KMUA 5HO6A 3SXRA 4ITHA 3UPZA 3R9NA 1JNKA 3MH3A 2NPQA 1JPAA 3EFKA 2XKFA 5LMBA 1MRYA 2RG6A 3CD8A 4E5BA 4GV1A 3UZPA 3LMIA 4JBOA 3MPTA 4G1WA 3D15A 3VUTA 3OP5A 3HV3A 5GNKA 2X7FA 2VWVA 3G15A 1YOMA 4OTHA 4M8TA 5LVLA 3SKCA 3W2SA 3WIGA 4CG9A 2EB2A 5DR2A 5HLWA 2B1PA 3AD5A 4LRKA 3P5KA 4J97A 4U42A 4N70A 4XRLA 3TJDA 1H25A 2B0QA 5TF9A 4FGRA 4MH7A 3K3IA 4KRCA 4USFA 4L67A 5AV0A 4RBLA 5F94A 5HEZA 2PUPA 3VUGA 1Q41A 1ATPE 3AOXA 2JIVA 2C1AA 1PKGA 1RDQE 3GU8A 3N4VA 4G6NA 5HGIA 3OWLA 4GVJA 3BYMA 4EZ5A 5KMNA 1XBBA 3MJ2A 4IZ5A 2PULA 4NFNA 1JKSA 1AQ1A 4EK4A 2RGPA 2GS6A 3E87A 2IZUA 3HUBA 4I4FA 2C5YA 4DG0E 5AEPA 2JKMA 3NVKI 2GFCA 4XG9A 3OC1A 4YZDA 3TI1A 2ZV2A 3DT1A 4NL0A 4AA0A 4RGJA 4JS8A 3LLTA 4I6BA 3RBWA 4CLIA 4AZFA 2Y7JA 4JLCA 5K3YA 5HX6A 4M67A 4YPSA 4D55A 3FI3A 3I5ZA 4O27B 1VYWA 2C6OA 3MVHA 4OTGA 5HD7A 4TNBA 1PMNA 2J4ZA 2QOFA 5FQDC 3R2BA 3UOJA 3FZ1A 2OJFE 5JSMA 2HZNA 3MTLA 3QKLA 2X6DA 4G6LA 4H3BA 3ZLXA 5D7VA 3W18A 3QTIA 5DA3A 3GU6A 3QBNA 5AUUA 3UNJA 5C8NA 2CDZA 2B55A 4L44A 3DS6A 4L46A 3A7HA 3C13A 4PDOA 4TT7A 5EHOA 2BRBA 4D2VA 3DXQA 2EXMA 2F7EE 4O81A 3NLBA 2OU7A 4J96A 5H8GA 5A4QA 2OI4X 4GJ2A 4CRLA 4C3FA 1XO2B 3H4JA 3LLAA 3ZC5A 3UYSA 4KKEA 3Q52A 4QMQA 1XH8A 3TT0A 4DEGA 4EOJA 2VO7A 4JG6A 5I9VA 4LYNA 3NW7A 4D5HA 3ALOA 3CQWA 3ORXA 1PF8A 3DZOA 3MJ1A 2WIHA 4LUEA 5FG8A 4XG8A 3BLQA 3D5WA 1G3NA 3A8XA 4FBXA 4X3JA 4RJ3A 2ZAZA 2VO3A 1DAYA 2XBJA 3ET7A 3W32A 4G5PA 4YJNA 3OT3A 4DBNA 5IA3A 2VX0A 4FTOA 3UIBA 3MFSA 3Q6WA 4FYOA 4JL9A 4USEA 4X3FA 3EFLA 3GFWA 5FBOA 1Q3WA 4D0WA 3PIXA 4NUSA 4EOIA 3ZONA 4O83A 1URCA 1ZYDA 4XG3A 3SLSA 3R01A 4MD7E 3NNWA 2XKCA 4EJ7A 3CKXA 2FA2A 2Y8OA 4J8NA 4ANBA 1FVRA 3C9WA 4O2ZA 3C0GA 4K6ZA 1Q8TA 4M12A 1S9IA 2OBJA 3BU5A 4QQJA 1GY3A 3WILA 4FSNA 3SAYA 2BHEA 2ETMA 4FTQA 3EZRA 1E9HA 3GB2A 3QC9A 2YM3A 4D5KA 2DWBA 2J51A 4OGRA 3R2YA 2UV2A 4G9CA 2BVAA 2OZAA 3PWDA 4MHAA 1IA8A 4E6QA 2R3KA 3UO5A 2C1BA 4UMPA 3KRJA 4ZS4A 1OI9A 4YJRA 2XEZA 3L9MA 2F4JA 4C4GA 3GC8A 4EQCA 2CGVA 4EH7A 4RQKA 5EHYA 2WMSA 2BMCA 4RJ4A 5DR6A 2ZJWA 3OXTA 4QMPA 5DT4A 2R7BA 2I0EA 2OJIA 3Q9XA 2OKRA 4EQMA 2YCSA 4BTMA 3LZBA 4AFEA 3MGYA 1FMKA 1P14A 3GQLA 3O7LD 3R6XA 3F7WA 3VBWA 2GS2A 2PVJA 4IX5A 4C4FA 4DC2A 2O2UA 3EL8A 1XH9A 4C33A 5KMMA 4XV9A 5F1ZA 3TIZA 2DS1A 4AWIA 5ANGA 4D2PA 2FH9A 3QCSA 5GIOE 4MWIA 5HVYA 4H3QA 3R9DA 2QR7A 1NVQA 3CQEA 3UZTA 4J1RA 4AE6A 5JN2A 4FTKA 4FC0A 3I0QA 5AX3A 2QOQA 2QLQA 4IX4A 1ZXEA 4NKSA 4BDGA 3OFMA 3BWJA 4DCAA 5KMIA 3UC3A 2R3NA 3KN5A 3BQRA 1FQ1B 2XJ0A 3R7IA 4ASEA 5BVNA 5TT7A 3RPYA 2AYPA 2XA4A 1EH4A 3FKLA 2QHNA 5E8YA 5CT0A 2G1TA 5CEOA 3BHYA 3CS9A 5HLPA 2VGOA 3UMXA 2BALA 1BLXA 4Y46A 2EU9A 4BIDA 4FT5A 4F6UA 5FWKK 3RM6A 3HVCA 2V7AA 3I6WA 3RP9A 3EN5A 3R63A 4IB0A 3UIMA 4I22A 4NCTA 5IQHA 5EYMA 5H8BA 3WE4A 4KKHA 3ZCLA 4OTWA 3O8UA 2CCHA 4OBOA 4QMXA 3L8XA 4ANLA 4KRDA 3K5UA 4BGQA 3VS0A 5M53A 1GZKA 4OTFA 3TTJA 5KMJA 3JXWA 5HCZA 3RWPA 3OUKA 5CX9A 3Q2MA 2IZTA 4I41A 4WD5A 4JAIA 4YC3A 3GC9A 4O0YA 3QL8A 4OTDA 3VUDA 3F3TA 3RGFA 2H96A 4YMJA 3CGOA 5DI1A 4R3PA 3MI9A 3NIZA 3KVWA 1ERKA 4FV3A 2ZVAA 5CEMA 4UEUA 4DITA 4RX7A 5FTQA 4KSQA 3BELA 5GIPE 5BX0A 1PRYA 2Z7QA 3ZFMA 4ENXA 4W4WA 2Z8CA 3AMAA 4FEXA 2YIRA 2PVYA 2XNBA 4FIGA 5AM6A 1BX6A 5E8TA 1YOJA 1PMEA 4NW5A 4K0YA 3ZUTA 4BDCA 5L4QA 5EQEA 3BV2A 2WIPA 3ORKA 2VUWA 3FYJX 1QMZA 3F9NA 3HDNA 3D5VA 3ZO2A 3C0HA 1J7IA 4AT5A 4PF4A 2UZOA 4FV4A 4NSTA 5L6OA 3A7GA 3EN9A 3FWQA 1LP4A 3PPZA 5ANJA 5DPVA 2YM6A 4FTTA 3HV5A 4IAAA 4IM0A 3UE4A 2VWZA 2CNQA 3BZ3A 3AGLA 4FNXA 4S33A 3ZDUA 5J1VA 3I0OA 3CY2A 3MA6A 4XG6A 3CEKA 3WF5A 4HYHA 5DH3A 3AC5A 3PXFA 1LPUA 3OOGA 3D9VA 4EWHA 2YLFA 1SNUA 3PLSA 5HESA 3ZU7A 2VWBA 4JXFA 3C51A 4NEUA 5EQYA 3GUBA 2W0JA 3DXPA 4BTJA 4L8MA 3W10A 4Z9LA 4PL5A 4WUAA 4QP2A 3KU2A 2WTIA 2IO6A 4XS2A 4JDJA 5FP6A 5BVKA 2WMQA 4ZJJA 3ZO3A 5I0BA 5AM7A 4ZJIA 4IFGA 2E9PA 5L8JA 3O7LB 1XKKA 4A9SA 2XIZA 2EVAA 3MB6A 1WVXA 2OIDA 4LQMA 3RZBA 5A3XA 3VHKA 5B7VA 2W9ZB 4I5MA 3SXSA 3QGYA 4O7NA 2GQRA 3CC6A 2BZHB 2VX1A 5EW9A 2DQ7X 4LGHA 4MAOA 2OZOA 5DE2A 1W82A 3RPRA 1YRPA 2PWLA 2PHKA 1LUFA 3FZSA 2GPHA 4BDFA 5A4TA 4RWKA 3ROYA 4KIOA 1MQBA 3KVXA 2B9FA 3F5UA 5AR4A 4QP1A 3ZHPC 2EWAA 4B9DA 3NR9A 4XMOA 5K0KA 2RF9A 3ORPA 4FKJA 5H8EA 4FEWA 5HKMA 5LWNA 4IIRA 2QCSA 3LXNA 5AR5A 5HIEA 1X8BA 4NJ3A 4C2WA 3DBFA 1XWSA 4EC9A 4ZZOA 5JFXA 2WPAA 4PPBA 4MNFA 1U5RA 3DFAA 3ODZX 4JG7A 3UMWA 5IEVA 4TNDA 2CN5A 4XRJA 3AC2A 5AUWA 2JDRA 3DZQA 5CSVA 1QCFA 4ACCA 2PUIA 3TDVA 2WZJA 4IXPA 3R7GA 4Y73A 4QP8A 3G0EA 3TN8A 4HGSA 3FLSA 3KXMA 5EHLA 4QQTA 3QYZA 2WTCA 2X39A 4Y8DA 1OITA 5J79A 1B38A 3VQUA 5BUEA 3WZDA 3QD4A 4N57A 3LFDA 5KHWA 4JDKA 3W2RA 4DG2E 3ZUUA 1OUKA 3GCSA 4DFYA 5M4IA 4FIIA 3R30A 3QQFA 4KB8A 4EK8A 5HTBA 4GYIA 3QD2B 4ZMEA 3I1AA 3VS7A 2EUFB 1CKIA 5CSWA 3R7VA 4L45A 3UG1A 4QO9A 4XV1A 2Z2WA 5LVNA 4FF8A 1TQIA 2GNLA 4CFMA 4YTIA 2YAKA 1OPJA 3WOWA 2P33A 4WNMA 3CKWA 4X2JA 4C4HA 4BCJA 4CFWA 5HHWA 3PY0A 1FINA 4E6DA 2X6EA 4GH2A 3QKKA 4JX3A 5HCYA 4KIKA 1STCE 4R78A 3VF8A 2BFXA 3D7TB 3LFEA 4A07A 4DH3A 2OICA 5C4KA 3TNHA 4ERKA 3DKCA 3C4WA 3PXQA 3THBA 4F0IA 4AW2A 1QPCA 4JNWA 3VQHA 5M4CA 3LJ1A 3H9FA 4GMYA 3VULA 1GJOA 3FBVA 4U9AA 4QYHA 1F0QA 2FSMX 4MQ1A 4ALWA 4QP3A 2YFXA 1R3CA 1UKIA 2Z7SA 4FKIA 5IH4A 1V0BA 3TNQB 4W8EA 3WYXA 4Y72A 3ZRKA 2PVNA 5EM7A 3BHHA 2YEXA 4BGGA 1LEWA 4C35A 3ZSHA 4BICA 3CD3A 4V01A 3BU6A 3L8PA 2J9MA 1B39A 3V6SA 2C30A 4K18A 5EI2A 4FNZA 4YHTA 4DFXE 3QTWA 5JKGA 4IDVA 4ASXA 4BB4A 3QCXA 3RPOA 4U5JA 3LM0A 5H9BA 4FL1A 4YLKA 4DG3E 2HOGA 1BI7A 4F4PA 3B2TA 3IK3A 1HCKA 3QTZA 5KMLA 4FG9A 4DF3A 4FYNA 2J0IA 2VO0A 1H08A 4I6FA 4OT5A 2J0JA 3LJ0A 3FZTA 3P7CA 4MYGA 2J6MA 2RL5A 1WBWA 2YIWA 3E64A 3I6UA 1GZOA 2UZEA 3ACJA 4FTRA 3N9XA 4ZSAA 2YM8A 1CTPE 4APPA 4YBJA 4AOJA 2WFYA 4PP9A 4CV9A 3G9LX 2PTKA 3LQ3A 3L9NA 1R0EA 3QFVA 4UN0C 4DFUA 3V8SA 3GNIB 4ZTHA 2Y9QA 4BDHA 3EKKA 5ANOA 3WI6A 2AC3A 2VTIA 5EW8A 4O91A 3H30A 3OXIA 5EK7A 3RNYA 1KE9A 2NRYA 2X8IA 3ZC6A 4NTSA 4S30A 4CG8A 4E4XA 5HE3A 1ZARA 3OY1A 3LQ8A 3NYNA 4FR4A 2W1DA 4QMSA 4R7HA 3G90X 4ONAA 2I0YA 5LVMA 1TQMA 1JKLA 4FODA 3IG7A 2QI8A 5IA2A 1U4DA 4RVKA 4X0MA 4MD9E 5EW3A 1M2RA 2P0CA 5AP7A 4DCEA 3SW7A 4BCKA 1OIUA 1YI3A 4K1BA 1U54A 3KEXA 3SQQA 3DK7A 3W1FA 3UIUA 3SG9A 4F7SA 4FA2A 3ORMA 4OT6A 2XNGA 4J99A 3UOHA 5E9EA 4GSBA 4GRBA 3POOA 4HVHA 2ITUA 1BKXA 5HICA 5HQ0A 4UY9A 4D2SA 5J7HA 4FIJA 2F9GA 2OJGA 4FTIA 2XZSA 3R83A 3P4KA 3Q9YA 3S2PA 3UVRA 5L8LA 5TO8A 1FGKA 2VTJA 1YW2A 2QC6A 3KFAA 4IANA 5E1SA 3A4PA 5AP4A 4L00A 3W33A 1RE8A 1PXKA 2PE0A 3CLYA 3GVUA 3H0YA 3G9NA 4HVSA 2FB8A 3D7TA 5D10A 3RNIA 4EKKA 3S3IA 1RQQA 3GCUA 5CSHA 2R3GA 1H1SA 3D2IA 4M69A 4O22A 1E1VA 3LM5A 5CXHA 5DRDA 1F5QA 5AR3A 2C47A 4O6EA 3Q4UA 3I60A 4FT3A 3IECA 3CTHA 5ETIA 5AP5A 3E3BX 3HAMA 3WZUA 3TXOA 1WMKA 3BCEA 4L52A 5EKNA 3K54A 5E8VA 3BIZA 3MVLA 3FKOA 3O96A 3JVRA 4AGCA 5HI2A 4D2TA 2XF0A 1M2PA 3HP5A 4YTHA 2CGXA 4AOIA 1WBTA 4CYIA 3TG1A 3KREA 2YHVA 4KNBA 3KXGA 4OTPA 3VAPA 3VN9A 5CQWA 2C6DA 2QOIA 5AJQA 4IAKA 2P3GX 5D9HA 3QF9A 1YXUA 4DT9A 3ZFXA 4YZMA 3MYGA 3Q04A 4Q9SA 1OZ1A 3S00A 1SVHA 1WBSA 3ZO4A 4QRCA 3QZIA 3VVHA 1K3AA 4I6HA 2P2IA 4ZTQA 2E9NA 2O63A 3EWHA 2QLUA 2YABA 1J7LA 3SRVB 4ACMA 1NW1A 3U8WA 1PHKA 4G31A 2HXLA 4MXZA 1HOWA 3I79A 2HW6A 1H01A 3AC4A 5J7BA 2ZOQA 3U9NA 4PL3A 5CEIA 1VJYA 2AUHA 2GTNA 3C50A 4WIHA 4MXAA 4FOCA 4GIHA 4HCUA 5EYDA 5I5ZA 3TNIA 2HENA 4AZWA 5K9IA 4GFGA 4CMUA 5FXRA 4PMTA 3ZS5A 4PQNA 2IJMA 3F3ZA 3R1SA 3OWPA 5EQPA 1J91A 3HUCA 2EB3A 1Q8WA 4A9YA 2DUVA 4IZAA 4FKSA 5HU9A 2ERKA 1ZAOA 2BRHA 2QKRA 5DN3A 5F95A 4ZY6A 4EYMA 4TTHB 1H0VA 4QMVA 4EBVA 2IZRA 4H58A 3T3UA 4FVQA 3NUYA 2ZYBA 2I0VA 2WQOA 1Q99A 3DB8A 4YZCA 3SGCA 3GI3A 5DHJA 5AA9A 5IA0A 2ITTA 4FNWA 2FUMA 4FV1A 2PE1A 3F7ZA 3LHJA 4LL5A 5BYZA 4EL9A 2R3QA 1PXIA 4FKRA 4D4SA 4DTBA 4O2PA 3PSDA 2A1AB 4GT4A 3F88A 3ORIA 3HV6A 3PZHA 2QG7A 2VZ6A 3NX8A 3BYVA 3FI2A 4FV8A 4O1PA 4TKSA 4QQCA 3U9CA 3UIXA 4DYMA 4GKHA 2WTKB 1BL6A 2BIYA 3BV3A 2OG8A 2VTSA 2QG5A 1GIHA 3FQSA 4GW8A 4IAFA 3DB6A 4FNYA 5DYJA 1ZMVA 3R73A 3KCKA 3LPBA 4MQ2A 4OBPA 5F20A 5AIRA 5CI7A 1Q97A 3KRRA 5K4IA 3PPKA 2XB7A 2X4ZA 4CSVA 1YOLA 3CTJA 2CPKE 1UNGA 3GFEA 4D1SA 5BMMA 3HMNA 2XIKA 3I7CA 3Q32A 5GHVA 2UW7A 2C6EA 2YCRA 3LCOA 5IISA 4C2VA 2G01A 2QOKA 3E88A 3S0OA 2BZJA 5AV2A 1G8SA 4ERWA 4HCVA 3NCGA 3BLHA 4L7SA 4EZ3A 5A14A 4F9CA 4IJPA 4EONA 2R3JA 2GSFA 2XM9A 3IS5A 5ANDA 3FI4A 4MEDA 2XIXA 4ZTLA 2XK7A 4K77A 2JKQA 3FXXA 4IFCA 4U40A 3KF7A 3ZRMA 2P2HA 4QYGA 4W4VA 4F0GA 1CKJA 4E6AA 3OCTA 1VEBA 3EN7A 4EUTA 2IN6A 4IAZA 4GU9A 2WTDA 3B2WA 3H0ZA 5EM5A 3R8UA 3VS4A 2YWVA 5CU0A 3KKVA 3MPAA 3CE3A 3HGKA 4R3CA 2PUUA 5CU6A 3DPKA 4LOQA 3MFTA 3LFSA 4MBIA 4E7WA 5C27A 4BR3A 1FPUA 2ITWA 1SZMA 1H1QA 4MD8E 3KQ7A 4ZTSA 4J8MA 4D1XA 4K11A 4C58A 2IWIA 3O51A 3BI6A 3IKAA 2NP8A 1FGIA 1U46A 5C9CA 2UW4A 1H0WA 4BZDA 2VTLA 3LFNA 3V5LA 4EH9A 5KKRB 1M52A 4DEEA 5CASA 1SYKA 4IVAA 4ORKA 1PYXA 2B4SB 2GMXA 3KA0A 4YC6A 2F2UA 4BDDA 2YJSA 1YXXA 2VWYA 5IH6A 5E8ZA 2WOUA 4FIEA 5C1QB 1J1BA 3MDYA 4AU8A 4FV0A 3NAYA 4JIKA 1PKDA 2XH5A 3EQPA 3PXYA 4K9YA 3FL5A 4PL4A 5CNNA 3U55A 3AC3A 4JR7A 2GHGA 4R1YA 3CP9A 2XNNA 4LOOA 4AQCA 3PJ8A 2JAVA 3MTFA 4YJOA 1S9JA 5AMNA 4NWMA 3UO6A 4GFMA 1QPEA 4U0IA 4F9BA 2ZM1A 1NXKA 2W99B 4QPMA 4DH1A 5DT0A 4PDYA 2UVZA 4F0FA 4D2RA 4EH8A 3GU4A 1NVRA 3C4FA 3DAEA 3KY2A 3MY0A 3NUUA 3R28A 4NZWB 4R5YA 3RI1A 2HY81 4JR3A 2JIIA 5IA5A 3E93A 5J87A 4B4LA 5DIAA 3TM0A 3CR0A 2IW9A 2JKOA 4O7TA 3Q5IA 1DI9A 3CJGA 3OF0A 1OECA 3DFCB 5C4LA 4RWJA 4XP0A 4BZNA 2J90A 2WEVA 2XVDA 3KULA 3RALA 1YWVA 2Q0NA 4ZSEA 4AFJA 4ASDA 4KS8A 3IDCA 3VS5A 4F1MA 4KAOA 2BKKA 4KIPA 2X0GA 3DQXA 2PZRA 3TZMA 4L9IA 4GVAA 4JRVA 2C6LA 4IADA 5K5XA 5I9ZA 4GK2A 4UWCA 2XS0A 3U87A 4L43A 1MRVA 3Q4ZA 4HYIA 1CM8A 3TV6A 5IUHA 4RFMA 3SVVA 2GHLA 4TYIA 4YNOA 5F4NA 1IG1A 2BFYA 3REPA 4I6QA 1SM2A 4G16A 2WMXA 2ZV9A 3K2LA 4XYFA 3IDPA 4BHZA 5HZNA 3ORNA 1Y8YA 3M42A 3TZ8A 1JOWB 5HU3A 1P2AA 3OCGA 4I94A 3TV4A 5E92A 1L8TA 2YA9A 4XJ0A 5CT7A 5FTOA 3ZMMA 4TRLA 2OWBA 5ACKA 5AWMA 5IA1A 1CSNA 4GS6A 3QRKA 3PDTA 2O3PA 4C62A 3PWYA 4EOMA 1OPKA 1K9AA 2BUJA 4MF0A 4MKCA 2QOCA 3F61A 3QRIA 3L8VA 5JEBA 3UOLA 4JI9A 4QMZA 3Q9WA 5KMOA 2RFNA 3R8VA 4DEBA 4NFMA 3T9IA 3KRXA 4QYEA 4I5PA 2JDTA 5HLNA 4RMZA 3BBWA 4D58A 3IOKA 1JSTA 4I3ZA 2CNVA 4CMTA 2B9JA 3QQUA
chains in the Genus database with same CATH superfamily
3AC1A 2WAJA 4QTEA 2VTQA 4IHPA 4C3RA 4EQUA 4YTCA 4K8AA 3IW7A 2UUEA 2V0DA 4I0SA 4BWXA 3ZFYA 2Z7RA 3SA0A 2WU6A 5CF5A 3F3VA 4O1OA 1U5QA 3W2CA 4R77A 4MVFA 5HOAA 2ITNA 2WMWA 5CAOA 2RFSA 3EQHA 5AIKA 3FEGA 4FGBA 3JPVA 5DFPA 4M0YA 3ZTXA 4B6LA 3WARA 4YO6A 2F49A 2G15A 2W05A 3NYXA 2XK8A 3ANQA 3QXOA 3QUDA 1VYZA 3P86A 2IW6A 4I92A 5D11A 4LMNA 4L68A 2WTVA 3QTRA 4AAYA 4QMOA 5EI6A 5EOLA 3BX5A 4ANSA 2GNHA 4AZVA 5HBHA 4NU1A 4Y95A 2ITVA 2R3RA 5M56A 3EB0A 2WMBA 3LW0A 4LRJA 4B7TA 3CCNA 4CVAA 4I1ZA 2B54A 4YJSA 4RSSA 4IX3A 5FDPA 3GQIA 4CFFA 3FY2A 1OBGA 4N6ZA 2RKUA 3FC1X 2QO9A 2QONA 4BDJA 3LJ2A 4FEVA 2PMIA 5L3AA 4X3FC 2PVHA 4ZIMA 4EYJA 3MV5A 4ZAUA 4WG4A 2IVUA 3JUHA 4HVIA 5IG1A 5TR6A 5JRQA 5LXMA 3EOCA 2QOLA 5EI8A 3AD4A 4BCMA 2X2MA 2IVTA 3SG8A 1OL1A 5BVFA 4RC2A 2R4BA 2PMOX 3MIAA 5AAEA 4WNKA 1H1PA 4A4LA 2PZIA 2HZ4A 4FL2A 5T3QA 3UPXA 5HG7A 5L2IA 3OEZA 2UZDA 3ZLWA 3MFRA 1XH7A 2BCJA 4CFVA 5EYCA 1YXTA 4ACHA 4EUUA 1OL5A 2HZ0A 4O38A 4DE4A 4JT3A 4PUZA 5HE0A 4CV8A 3U6HA 4AZEA 4YSJA 2H8HA 3WZJA 3QWKA 3UJGA 4BFMA 1GIIA 4O7YA 5BQ0A 4TYHB 1OB3A 4DFZE 4S2ZA 4NKAA 3UVQA 1CMKE 4DGMA 4F64A 4RA4A 3NUAA 4JRNA 3BGZA 3LCKA 2BDFA 3LXKA 4UV0A 3ZM4A 2CN8A 4CTCA 2VTOA 4WKQA 3HRFA 4AN3A 4EBWA 2XANA 4JBPA 1FMOE 3Q96A 2FYSA 1XMLA 3EQGA 4U41A 3TWJA 3MESA 5G6VA 1Z9XA 3PTGA 1IRKA 2W4JA 5FEDA 3ATTA 4I6LA 2F2CB 2E9UA 3NIEA 4TWPA 3QGWA 4P5ZA 4B8MA 4XP3A 3M1SA 4DHIB 5CVFA 4HGLA 4W4YA 3SOAA 4USDA 3PJ1A 1KOAA 3I5NA 3U4UA 1R1WA 3QRUA 2B9IA 2W96B 4C59A 3O0GA 3DLZA 4RVMA 3AGMA 2XIYA 5M06A 4UZHA 5CEKA 2GNFA 3UP2A 4BCQA 4DHJA 2PSQA 4FUXA 2W5BA 5ANKA 3CGFA 3UDBA 4DN5A 3W0OA 2WQEA 2VRXA 4W9WA 3ODYX 3QZFA 4BBMA 4TPTA 5IDPA 2XKDA 1UU8A 2ETKA 4DFNA 1P4OA 2V55A 4CEGA 5BYLA 3FHIA 1Y91A 4I24A 3V5JA 3V5QA 3PVGA 5BNJA 3F5XA 2WGJA 4C0TA 3PE1A 2AC5A 2ETRA 2WO6A 2IW8A 4FKPA 3V5WA 5A9UA 2YIYA 4R7IA 3R8LA 4NCTC 2X7GA 3NCZA 4QYFA 4ID7A 1IA9A 1P5EA 2QQ7A 4XV3A 4EC8A 1SVEA 4FZ6A 3OCSA 4O0TA 4BKJA 4O7VA 4FTNA 2CKPA 2X1NA 3P79A 5GJFA 1A9UA 5FGKA 4LI5A 4RX8A 4I20A 3DA6A 5HG5A 5D7AA 4HW7A 3VS2A 3GC0A 2OFVA 3FMMA 4FZDB 4IM2A 4ZTRA 3HNGA 3NZ0A 4II5A 3L9LA 3VBVA 4AOTA 4DLIA 5AADA 3UG2A 2Y6MA 4WBBB 4R1VA 3AT2A 4Q5HA 4V04A 4ACGA 2C6KA 3D5UA 4FV2A 3BRBA 5FP5A 4IWOA 4U43A 4FKUA 5HVJA 2Y4IB 3OTUA 5GZAA 3NMUF 4NM3A 1H4LA 4BCOA 1H1WA 3Q5ZA 3QC4A 4IVBA 4MBJA 4PMMA 5E8UA 3FQHA 2HYYA 4C37A 3DJ6A 3HL7A 2C68A 4TYJA 4FEQA 4QMNA 3S1HA 5L2QA 3MWUA 4QNAA 5CU3A 2XRUA 3IDBA 3QKMA 3R9HA 2R0UA 2PK9A 3DTCA 4MXCA 5IEYA 2PZ5A 3OCBA 4AUAA 3DQWA 3DJ5A 3VUIA 5FM2A 4U81A 4YZ9A 5FRIA 4CNHA 4Z7GA 3O8TA 2W5AA 4TYEA 4I5HA 3KXHA 5CSXA 3TEIA 4X2GA 4I0TA 4K2RA 3TJCA 4D9TA 5C26A 1JWHA 1V1KA 4F1TA 3GXLA 1KE5A 3PG1A 1ZYCA 1ZYJA 3GT8A 2ITYA 2ZMCA 3I81A 4FTAA 4GJ3A 2YM5A 4H39A 4PNKA 5CAPA 3FZRA 3UTOA 4TYHA 1URWA 5HTIA 3ZZEA 4CFNA 4QPAA 3ID6C 3AXWA 1I44A 3QTXA 4Q2AA 5IQDA 2W1HA 4ZTNA 1E1XA 4N0SA 2JDOA 3TV7A 5IQFA 4M66A 3MIYA 3JR1A 3PJCA 4O4CA 4P7EA 2WTWA 3RKBA 4Z7HA 3QRJA 2IVSA 3AMYA 2BDJA 4FSZA 4HZRA 1JSUA 2VWUA 3DLSA 2YCFA 3DGKA 4DH5A 5AUTA 1F3MC 5I9WA 2BROA 3OBJA 3EQDA 3RCJA 4RX5A 3LOKA 2OGVA 4FKLA 4Y83A 5AP2A 2IZSA 3ZDIA 2BRMA 3E5AA 4IBMA 1NVSA 3W16A 4ANQA 3CPBA 3MVJA 3PVUA 4KABA 4OTIA 2XNMA 3R1YA 4EOLA 5CF8A 4RVTA 4HNFA 4C3PA 5L2WA 4KUJA 2QD9A 3EKNA 2V5QA 5D12A 4GYGA 4FKOA 4HYUA 4ZEGA 4DINA 2ZDTA 3EHAA 4YZBA 4E5AX 4LUDA 2H6DA 3RPVA 3ZZWA 4BIBA 3D7ZA 3PY3A 5K4JA 2JDSA 5E4HA 1FVTA 2XCKA 5BYYA 3BHVA 3JVSA 3BWFA 3A7IA 2CKEA 4BYIA 4FV5A 2PL0A 1GNGA 2E9VA 4RJ7A 4QYYA 4BDKA 4AXEA 2C0TA 2YJRA 4C4IA 4CMOA 3R7UA 2A2AA 3QALE 4WSQA 4YJPA 5CU4A 3F5PA 3VC4A 4FMQA 4NW6A 1GZ8A 3PG3A 3D5XA 3HA8A 4H1MA 4KS7A 5BVDA 4NM5A 3HEGA 2Z7LA 3NWWA 4AGDA 3NUNA 3QLGA 1NA7A 3DJ7A 2BKZA 4KBKA 3VONA 3V51A 5M08A 3IGOA 2B52A 3LXPA 3P23A 3PFQA 3OXZA 4ALUA 2E9OA 4U80A 2A98A 5CEPA 5ETFA 3S4QA 2X9EA 3VBYA 4RIXB 4QMWA 1BL7A 5AX9A 3CPCA 4XLVA 5A4EA 2C5XA 5HBEA 5KHXA 4R6VA 5BMSA 4XBRA 2RSVA 4DHZA 3I4BA 4AAAA 2C69A 5HNIX 1H00A 4QDEA 5T68A 3K3JA 2V62A 4IW0A 1GZNA 2OK1A 3PUPA 4XOZA 2OSCA 4J52A 4ZK5A 3R9OA 4AXFA 3PUFC 2G2FA 2WB8A 4JIAA 3SDJA 3H9OA 1PJKA 4AT3A 2EXEA 3P78A 4BWPA 4BDBA 2NRUA 5BUIA 5EM6A 1MQ4A 4QMYA 4MF1A 4TW9A 4ZXTA 1R39A 3OT8A 3MPMA 3QU0A 4DTAA 4CQEA 3DDQA 2HAKA 4FSYA 3BYOA 3BYUA 3R9RA 3O8PA 4YO4A 4HNIA 3TKIA 1ZMUA 3DKGA 5JZNA 4F6WA 3DTWA 3ZLSA 3VJNA 1YQJA 4EHEA 3LVPA 3NNVA 1ZZLA 2P4IA 3R22A 4L3PA 3ZUVA 2VNYA 4O4DA 4AGWA 3G51A 3NNUA 3BQCA 3OUNB 4AX8A 5C8KA 3Q2JA 2ZV8A 4IB1A 2QODA 2XIRA 4IE9A 5J9ZA 4YJTA 4OBQA 3R8PA 1OGUA 4U79A 4B99A 2HCKA 2OIQA 2VX3A 2I1MA 2X0PA 3GOPA 2QO2A 4L3JA 3NGAA 4J98A 4QMLA 4BYJA 4CZUA 4YNEA 2BZKB 4ZTMA 4HVGA 3EZVA 3NDMA 5LARA 1XH6A 2QU6A 3Q53A 4WNOA 2WMTA 3KC3A 4NM0A 4OW8A 5JMSA 4AA4A 5GZ8A 2RIOA 3EFJA 5M4FA 4I4EA 3C7QA 3RZFA 3H3CA 2ERZE 4EORA 3FPMA 5K5NA 3FJQE 2C6MA 4FTJA 4QPSA 2GDOA 3ORTA 1IEPA 3QCQA 3HMIA 4RIWB 4ZLOA 3ITZA 3QZGA 4WOVA 4RIYB 4G3DA 4FZAB 3P5JC 4IH8A 4O4BB 3OG7A 4RWIA 4RZWA 3PA4A 3WZEA 4EHVA 2W1ZA 4IWDA 5CS6A 2Q83A 4FSTA 3A4OX 3C1XA 2LAVA 5DEWA 2BHHA 4AZTA 5J95A 4CT1A 4O86A 4NH1A 3PP0A 3U6JA 4AW1A 3MH1A 3QX4A 3T9TA 4UMUA 4OAVB 5FTGA 2ZM4A 3DV3A 4EOQA 4M0ZA 1NY3A 3T3VA 3TCPA 3H10A 2ITPA 5EM8A 1JVPP 2C4GA 2C6IA 2I6LA 3GCPA 4MWHA 5IQBA 1ZZ2A 2OF2A 5CY3A 4OTQA 3DK6A 4GK3A 2VN9A 4M7IA 4NK9A 2GS7A 5ETAA 3VHEA 5AV3A 2R0IA 1TQPA 1R0PA 2QO7A 4E73A 5LVPA 2VTAA 1WFCA 1XMMA 4QTAA 1MRUA 4FI1A 5HO8A 5KBQA 4PPAA 4ZLYA 3D2KA 4V05A 5CAQA 1WBNA 3Q60A 4RFZA 4BWKA 4PPCA 3COIA 2F7ZE 2XJ2A 5HCXA 4BDIA 4E6CA 1YKRA 4LV7A 3FLNC 4A06A 3RTPA 3E8CA 4FG7A 1WBPA 2OXXA 4F1OA 3PY1A 5LWMA 2WELA 5LMKA 4IWPA 3BL7A 4UWYA 3LIJA 3R04A 4RA5A 3O17A 4FVPA 3LXLA 5B2KA 3HYHA 4FOBA 2PE2A 4CZTA 3KCFA 3SW4A 4BN1A 2Z60A 1FVVA 2ESMA 5AAFA 3UVPA 2JKKA 4DGGA 3FMDA 4EHZA 4I5CA 3FMHA 3GBZA 4BCGA 3QX2A 3BBTB 2C0OA 5L2SA 4QNYA 4WHZA 4DFLA 2R3LA 3R1NA 1O9UA 5CSPA 3LFAA 4W9XA 4E26A 4RX9A 3BU3A 3MSSA 3BL9A 3LAUA 1Q8YA 3DKFA 4UMQA 3PRIA 1V0PA 4PTEA 5E8XA 2CCIA 3QD0A 4WSYA 4IM3A 4OR5A 3VJOA 5I9YA 3PYYA 2BAJA 3TYKA 2R3OA 3LCDA 4WG3A 3RINA 4B0GA 4C8BA 1Y57A 4YC8A 3TACA 4G3FA 1MP8A 2AQXA 4CFXA 3ENMA 4PNIA 2JC6A 4I0RA 2RG5A 4EH3A 5IA4A 3BKBA 3E62A 2OH0E 4GL9A 2W17A 3ORZA 5EFQA 5HG8A 4PMSA 3RAWA 3C4XA 1OMWA 4OLIA 4RVLA 2R3MA 3BEGA 4AXCA 2YWPA 3FDNA 4O7ZA 2ZB0A 3ULIA 3Q9ZA 5AP0A 2G2HA 5JGBA 4M14A 2GNIA 2UW6A 3I7BA 4FT9A 1M14A 5J8IA 2QVSE 3AT3A 4L6QA 3MA3A 1KV2A 2C3KA 3NAXA 5BVOA 5IUGA 1J3HA 3EQIA 1IAHA 1APME 3POZA 5CEQA 4EK3A 5LCKA 1UVRA 4Z16A 3UBDA 4IWQA 4CZYB 3V8WA 1H28A 2W9FB 5EYKA 3DU8A 3U54A 1ZYSA 3LCSA 4GUEA 1YDTE 4ZS0A 2QOOA 4LGGA 3VW6A 4AW5A 3ZH8A 4BDAA 4CRSA 3VRYA 4GT5A 4IACA 4G17A 5F9EA 3DY7A 5AR8A 5CU2A 5IPJA 4O6LA 3KXZA 4RIYA 4KA3A 3PIZA 4O84A 2XRWA 3GEQA 4GUBA 3W0SA 2A19B 3IW6A 2GNGA 4GG5A 4M15A 4K33A 4MTAA 4ZP5A 4H05A 1DM2A 4H3PA 3UQFA 1O6KA 1PYEA 4G5JA 4IB5A 4X2KA 4HGEA 4XOYA 4JBVA 4JJRA 4L01A 2FVDA 3UQGA 3PFYA 4FSQA 5DBXA 2XAOA 1FBNA 3SX9A 3RAIA 5A4CA 1YVJA 2R3FA 3AMBA 5HIBA 2XNOA 2UW8A 3PP1A 5HIDA 3NUPA 3DBEA 4ZSLA 1AD5A 4RC4A 5E90A 5I9XA 4MUQA 2V7OA 1YWRA 1ZOGA 5L8KA 4XBUA 4FE2A 4GIIA 4J53A 3FKNA 4FEUA 1JBPE 4HCTA 3AG9A 1YHSA 4YGAA 4EWQA 4O4EA 4PDSA 4CLJA 2YN8A 4A9RA 3TUCA 2A4LA 2G9XA 3OBGA 3A60A 1YHWA 3WBLA 2BTRA 1VLRA 4LMUA 5ITAA 3RAHA 2X8EA 3A7FA 3D4QA 3O50A 4G3CA 3RAKA 4DA5A 4PRJA 1OPLA 5EDQA 5JH6A 3FMKA 2B7AA 3VBQA 4Q9ZA 5CENA 1J7UA 3L1SA 5L6PA 3E3PA 4BJJA 3WF6A 3W0PA 4X2FA 2GQGA 4RFYA 4DLJA 3P1AA 4C38A 3QRTA 4XLIA 4DH8A 4ZMFA 3DDPA 1QPDA 1K2PA 3CIKA 2HK5A 3ZYAA 4RC3A 3W2PA 4KINA 2XNEA 5JRSA 3FI8A 2WMVA 5LQFA 4QTCA 2UZWE 4A9TA 3JYAA 4YHJA 3O71A 3NVMB 5EH0A 2IVVA 3OVVA 2QURA 3NFGB 3SC1A 3SRVA 1A48A 3EN4A 2XCHA 5CZHA 3SV0A 2C5OA 4D4YA 1W8CA 5AUYA 4F6SA 5E1EA 2W06A 1IASA 1L3RE 4FK6A 2PYWA 3HV4A 5CZIA 4AA5A 3JS2A 4TY1A 4YHFA 2ACXA 5IU2A 4TWNA 2OJ9A 5L2TA 1OIRA 5E8SA 3FMJA 3PVWA 1YI6A 3G5DA 4DH7A 3HMPA 2J0LA 4I23A 4WBOA 1SNXA 5A6OA 3KK8A 3ALNA 1I09A 1M7QA 2HELA 5HG9A 5ETCA 1YXVA 5E8WA 3R7OA 4NJDA 5J1WA 3ETAA 2UZTA 3PZEA 3QUEA 3BPRA 3E92A 2YIQA 3QQGA 2VTNA 3WF8A 4AW0A 4BCFA 4BTFA 5CYIA 5JQ8A 3QWJA 1QL6A 2CHLA 2OXDA 4WO5A 3LFQA 4WG5A 3QUPA 4KSPA 5AA8A 4GT3A 3W2OA 1ZWSA 3GENA 4C4JA 3ZEWA 4IC7A 2OZAB 4YJUA 5HE2A 4CD0A 5M07A 4ZOGA 2BAQA 1T45A 3VS1A 4O7WA 3FLWA 4HOKA 5AUXA 4E20A 2GQSA 4D9UA 4LOPA 3ATSA 3TDWA 2XUUA 3FZPA 3CXWA 5H3QA 2OIBA 5ICPA 1PW2A 3FLYA 3QYWA 4R5SA 4E5WA 2JBPA 4KBCA 3KK9A 1LEZA 1YI4A 1M7NA 2X8DA 3KF4A 4GK4A 4E93A 2J50A 2W1FA 4OAUC 3CSVA 3UNKA 5BV3A 4GEOA 3ZBXA 4ARKA 2BRGA 3SXFA 2X81A 4QQ5A 3C0IA 5DR9A 4IJ9A 3ELJA 1V0OA 4YJVA 5FD2A 3M2WA 2JLDA 3OROA 1KE8A 4GG7A 2QHMA 4IC8A 3R02A 5AUVA 2X9FA 3GCQA 3OW4A 2W1EA 2C3IB 3ZRLA 3BLRA 3NS9A 2VTRA 3ZEPA 3PE2A 4DEIA 3C5IA 3CJFA 3MS9A 3QTSA 4ANNA 4EH5A 3D94A 1YWNA 3OTVA 3O23A 3FHRA 5CANA 1H27A 3VUMA 2F57A 2CLQA 3KB7A 5G1XA 1YDSE 3N51A 4BKYA 3FY0A 4FSWA 4XNEA 3COHA 4E4MA 5M44A 1U59A 1RJBA 2HIWA 1J1CA 3FSKA 3VS6A 1KUTA 1ZYLA 2W1CA 4YU2A 5CAVA 3FLQA 3FYKX 4FTUA 1OL6A 2C6TA 3R0TA 1UWJA 4AP7A 2I7QA 1TKIA 4RQVA 3PXKA 4YUQA 2GCDA 4RT7A 4O0UA 2HWOA 3PSBA 3QQHA 4JQ7A 5M4UA 2J0MB 2WTKC 3NSZA 1KSWA 3COMA 2GTMA 3G33A 1DS5A 3PIYA 3QHWA 4I21A 3COKA 3W55A 2CJMA 5FEEA 2JITA 2BDWA 4DAWA 4FTLA 3R8MA 5HTCA 3C4CA 1Q62A 1AGWA 1UA2A 3DBCA 2J2IB 1XHAA 3RPSA 5GJGA 4CTBA 3UP7A 4YZNA 3HP2A 2VWIA 4EHGA 5K0XA 5JK3A 4BBEA 2Z02A 2GU8A 1UU9A 2WMRA 4BGHA 3KMWA 2X2KA 2ITQA 1H8FA 3RHKA 3P0MA 4FKWA 2ZM3A 2H34A 4AXAA 3CTQA 4XHKB 3RK9A 5IF1A 3QD3A 2DYLA 4MXYA 5FM3A 4D4VA 4JDIA 4EOKA 3P08A 4M13A 3BGPA 1IR3A 1JLUE 4P2KA 5HNBA 1O6YA 4LM5A 4YP8A 4E3CA 2R64A 3MVMA 2CGUA 3WZKA 3FQEA 2UW0A 3FMNA 4DEDA 2V22A 3HRBA 2NYAA 4O96A 4AT4A 5LVOA 1GIJA 3GC7A 5TKDA 3DCVA 2ONLA 3C4ZA 5A54A 5LJJA 4EEVA 1PXOA 3ZLYA 1OKYA 4EH4A 1Y6AA 4JAJA 4YTFA 4WUNA 2HW7A 1KWPA 3A2CA 3SHEA 1NT2A 3RJCA 4U44A 2C3JA 4M3QA 3RK7A 4C4EA 2PPQA 4FTCA 5KMKA 4PY1A 5J5TA 2QKWB 1OVEA 2UW9A 3OMVA 4UYNA 4AN9A 4ZLZA 5KKRC 2CNUA 3LE6A 4UMTA 5LMAA 3ZSIA 4PMPA 3W8QA 1YXSA 3GOKA 5J9YA 4FL3A 4CXAA 4F7NA 3EYGA 3QA0A 4YPDA 4F99A 5CI6A 3WF9A 3LFCA 2B53A 1W2DA 4BI0A 5JQ5A 4O7RA 3TIYA 4XH6A 1MUOA 4RG0A 4RLKA 3ENHA 5IEXA 2PVRA 3F2RA 3VUKA 2I0HA 3LCTA 4X7QA 4MNEB 3W0NA 3S95A 3ZXZA 3TZ9A 3PLAE 4L53A 3CBLA 1REJA 3SOCA 3HDMA 3HX4A 3KRWA 4D0XA 4TWCA 5M55A 5ACBC 2XK3A 4D28A 3A62A 3V8TA 5KE0A 5CF4A 2WQBA 2ITOA 4CKRA 5BVWA 1XJDA 2VAGA 3RWQA 2ONLC 4FG8A 1HCLA 3ACKA 4IDTA 4AZSA 1UNLA 2WU7A 4F63A 3DXNA 1REKA 3HLLA 4U6RA 3ZSGA 1YDRE 1XBCA 2KULA 3VW8A 5HVKA 3F3WA 4BTKA 1WVWA 2JBOA 2YITA 4F70A 1Z5MA 4P4CA 4Z55A 3N4TA 2HZIA 4RRVA 4FSRA 4UYAA 4BCNA 1JKTA 4TYGA 3VO3A 3ORLA 1UKHA 5CVHA 4UMRA 4HPUE 3HA6A 3NYOA 1DAWA 2VWWA 3PJ3A 4JDHA 1CDKA 4G3GA 1B6CB 3NEWA 4WT6A 2YM7A 5A4LA 4LG4A 5JT2A 4R7BA 2JAMA 2XARA 3FL4A 4R8QA 5I9UA 5IQEA 5IMXA 3TUBA 1Y8GA 2G2IA 3OEFX 3SD0A 2OJJA 3CQUA 4XUFA 5JFSA 3H9RA 2UZLA 4F7JA 2JD5A 1TVOA 4UB7A 1IAJA 2YERA 3TKUA 3E8EA 2C0IA 3FZOA 3FMEA 3RHXA 4HGTA 3BHUA 2A0CX 4UXQA 3B8QA 2YM4A 3OWKA 3VF9A 3MBLA 4S31A 5IMEA 3P9JA 4C36A 2GHMA 3KL8A 3IW8A 3U6IA 1OM1A 4NTTA 2W7XA 4X2NA 4OTRA 2PVKA 2UZBA 3R7EA 1W83A 1WZYA 3MN3A 4IQ6A 2WMUA 3JY0A 4AG8A 3ROCA 3EQFA 3UDZA 3ZOSA 1UU3A 1FOTA 4HPTE 4KIKB 4RJ5A 4XEYA 3ERKA 2C5NA 3HZTA 3KXXA 5C03A 4UALA 2XMYA 2O5KA 1JKKA 3FUPA 3EIDA 4CKJA 5B2LA 2VTHA 1ZY4A 1M17A 5I3OA 2UZVA 2Y4PA 3II5A 4IAIA 4JG8A 5A46A 2FGIA 4ITJA 2B9HA 2WKMA 4ACDA 5GJDA 3VBXA 4B8LA 3KRLA 5JFWA 5D1JA 5I4NA 1Q61A 4IMYA 3TTIA 4N6YA 3GCVA 4IX6A 4BC6A 2JFMA 2NNWB 5AP3A 2XK4A 3M11A 5DEYA 4D2WA 5CAUA 4ENYA 4FKVA 2VTPA 4FK3A 4YSMA 1PMUA 2KTYA 3MB7A 1Q24A 2UVYA 4Q5EA 3UYTA 1OUYA 5FBNC 3DNDA 3G0FA 3GGFA 4EI4A 3PVBA 4UWBA 3HV7A 2BRNA 4FSMA 4E1ZA 4RJ8A 3R7YA 2J5FA 3FC2A 3V5TA 4D1ZA 2CMWA 3NPCA 4AE9A 2IPXA 5EDPA 3TNWA 3VWAA 2W4KA 2JEDA 5AFVA 1Q8ZA 3RCDA 3TKHA 1BUHA 4C57A 5CWZA 4DGLC 3C5UA 3GU5A 3FV8A 4MNEA 4XX9A 2HXQA 3RMFA 3IW5A 2WTJA 3A99A 1OKZA 3R71A 4DTKA 4QMTA 2VNWA 2REIA 4O7SA 4ZY4A 2VV9A 4QMUA 3G2FA 4IZYA 4BVUA 2PY3A 3EH9A 3F3UA 4ITIA 1OKVA 2R3IA 3MW1A 3PXZA 5EDRA 4EK6A 2A27A 3V04A 4F65A 2XYUA 3EQBA 5A6NA 4O82A 4XG2A 3AQVA 2W5HA 2XK9A 3DOGA 3A61A 4G34A 1DI8A 4RWLA 3D14A 3IGGA 1KV1A 5B0XA 4F9WA 3DAJA 4AACA 2JFLA 3ANRA 4EZ7A 3FLZA 4DEAA 2ZMDA 4CGAA 3OW3A 4IVDA 4D4RA 1JAMA 2XJ1A 3DNEA 4BL1A 4RLLA 1R78A 1W7HA 2BPMA 2R2PA 3PPJA 3Q4TA 5AR2A 5C01A 3UOKA 3UDSA 2JGZA 3E8DA 4PDPA 4H1JA 3PRFA 4J95A 3QQLA 3WE8A 2PZYA 5CQUA 4MK0A 4ASZA 3IW4A 3LKMA 4YBKA 4BZOA 4DEHA 3NW6A 3WYYA 3V5PA 3T8OA 1YHVA 1PXLA 3TZ7A 4FTMA 3ZM9A 1PXJA 2I40A 2GNJA 4R3RA 5FEQA 4KD1A 3MH2A 4BRXA 2PUNA 1U54B 2NO3A 4O0SA 2ZV7A 4CFUA 2FO0A 3QTUA 3QXPA 4IZ7A 4W4XA 2UVXA 5D41A 3DBQA 3QLFA 4LGDA 5FDXA 4FX3A 4DGOA 1G8KA 5IH5A 5JGAA 5HNGA 2O65A 4GCJA 2PVLA 3O2MA 4NM7A 3G6GA 5FXSA 3TUDA 1Q4LA 2R5TA 3OD6X 4X6QC 5ANEA 5KUPA 4JBQA 5FLFA 3P7AA 2BZIB 4RPVA 4X21A 2GFSA 4BI1A 2PVFA 2UZNA 4MCVA 4E4LA 2XM8A 1WBVA 3W2QA 4Y85A 3AC8A 2Y0AA 4YLJA 4UBAA 4AN2A 4BCIA 4BIEA 2OH4A 4FVRA 1H1RA 2WEIA 3UNZA 3V6RA 4DBXA 2W1GA 2YCQA 4M69B 4QT1A 4FIFA 2QR8A 3ZO1A 3NYVA 5H2UA 2HWPA 1VR2A 1Q5KA 2Q0BA 3UQCA 3BLAA 5CF6A 3W8LA 4YR8A 4RIOA 3FE3A 5TOZA 3LQ5A 5IQCA 3QAME 1Z57A 3MFUA 4G2FA 1WBOA 5J9LA 1XBAA 3EFWA 1PY5A 1SVGA 2O0UA 5EKOA 2P55A 5CVGA 3IONA 4MX9A 4QOXA 5HBJA 4ALVA 3LMGA 2XBAA 4L42A 3C4EA 5GINE 4Y5QA 4O7LA 1ST0A 3EQCA 4NIFB 2RFEA 3F66A 3UC4A 1W98A 3E7OA 4ANMA 3FXZA 4XP2A 5HORA 5IQIA 5IDNA 3F2AA 5M51A 4FZFB 5AV4A 4F7LA 3A7JA 4F08A 5I3RA 4JQ8A 4BKZA 2OO8X 5IKWA 2IG7A 5AP1A 5EOBA 3QQJA 1H07A 3CY3A 3DAKA 4RJ6A 5KZIA 5L6WL 3UODA 3HRCA 3KN6A 4FKGA 2PMLX 4A4OA 4U97A 3U4WA 4EH2A 4YURA 3LFFA 4HJOA 4BCHA 1JQHA 2Y4IC 1OL2A 3QHRA 3GP0A 3EL7A 3IPHA 5DVRA 2F7XE 4PV0A 5HO7A 4U8ZA 5CLPA 3ULZA 3BE2A 4MXOA 3IQ7A 5DMZA 5HD4A 1PMVA 1VZOA 4F78A 4FKTA 3RVGA 4PTCA 1GAGA 1KE6A 2Y6OA 1H24A 5AUZA 5DOSA 3L8SA 3RM7A 4EH6A