4XLIA

Crystal structure of abl2/arg kinase in complex with dasatinib
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
264
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-specific protein-tyrosine kinase
publication title Structure of the ABL2/ARG kinase in complex with dasatinib.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 79
structure length 264
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xliA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xliA01
3REPA 2FSTX 3OTVA 4EYJA 4IJPA 2YM6A 1REKA 4R7HA 4FA2A 4NYEA 4RT7A 4RX5A 1ND4A 3DQWA 4XUFA 4ITJA 4N6ZA 4J8NA 4O0TA 4XP3A 1A06A 2W1EA 4KIKB 5AP4A 2J0JA 3QRTA 3K3IA 4IX4A 2P2IA 4XHKB 3PYYA 1HCKA 3FC1X 3W8QA 2UW4A 2R0IA 2R5TA 4AA4A 2J5FA 4C4GA 4FK6A 1H00A 1W0XC 4IE9A 2QOBA 1J7LA 5LJJA 2OXXA 3VIDA 2XNMA 4DTAA 1KE7A 3CR0A 3R2YA 3LIJA 3KXXA 2Z7RA 4M84A 2HY0A 3F3ZA 3ODZX 4O0SA 5CT0A 4I41A 1NVRA 5K5XA 5FUTA 4R3CA 5HESA 2WMUA 5LMAA 4I21A 4A9RA 3QTUA 3VO3A 3RNYA 4DH5A 3OBJA 3UO6A 1W83A 4GVJA 5BVNA 5E8WA 3AC5A 3LFAA 3OWPA 4WHZA 4HYUA 4BWXA 3VJOA 5JZJA 3LJ1A 2G2HA 4BDCA 3ZSHA 3Q04A 2VTOA 3HRCA 3KN5A 3N9XA 4WG4A 4EOJA 4BKJA 4OTIA 4RMZA 4BDFA 4DFZE 3G51A 4FKWA 5KHXA 5M51A 1YXVA 2ONLA 1O9UA 3DLSA 4ASDA 5CU4A 2W05A 2JKOA 2Y4IB 4Q5EA 4IQ6A 2YLEA 2J7TA 4X2KA 3NYXA 2XK4A 2W1IA 2J2IB 4TYHA 4IWPA 4O2ZA 5G6VA 4CYIA 4F9CA 2HIWA 4Q5HA 3R8PA 2GFSA 3BEGA 3NLBA 4QMMA 3FMEA 2BZHB 3QXPA 4GT5A 4IAFA 4BDBA 3PRFA 4O81A 4ZXTA 4IDVA 2RKUA 2PSQA 4DGNA 4C59A 2QOFA 3D7TB 3E8NA 2YIRA 3LCDA 1Q8WA 3KRJA 5GZAA 3MIAA 3G6HA 2AC5A 4ALVA 4IXPA 4EOKA 3K54A 4CKJA 4Q9SA 4CZTA 4U42A 5IDNA 3BBTB 5ETFA 5D41A 1PXIA 3MBLA 3T3VA 4ZY5A 4J8MA 4R78A 1QPJA 3H10A 5M09A 4CG8A 4YTFA 5BUJA 3G9LX 3R8MA 3W32A 2YIQA 2WTJA 4NIFA 4ITIA 1ZY5A 5BMSA 3EN4A 2X7FA 4J7BA 5KNJA 4EC8A 1WFCA 2C6LA 5E8XA 3LLTA 3NRMA 2XCKA 2BMCA 3QA0A 3ZRKA 3KFAA 4E7WA 1FBNA 2CGUA 1J1CA 4EEVA 3FLZA 3OEFX 1H1SA 4I6QA 4IAZA 4NSTA 4U7ZA 4YJVA 3HL7A 3GQLA 3Q4CA 4DGLC 2ZJWA 3RZFA 5DT4A 4AZSA 2QQ7A 4O0RA 2VWIA 4O0YA 3VJNA 3V5QA 5HX6A 2GHMA 4BYIA 4D2TA 2FVDA 1PXLA 4OBOA 4JOAA 4OTWA 4BI0A 5JSMA 2BRBA 5GNKA 3GU6A 1ZOEA 2J6MA 4XOZA 4H05A 4FODA 4I92A 4D55A 4U3ZA 4RJ7A 1YHVA 3F2NA 1LEWA 5ANOA 3OXZA 4JLCA 4O1PA 3FKOA 3EYGA 3ROCA 3TV4A 4X3FA 1Q8ZA 2BCJA 3VQHA 5CAVA 5IH5A 3SXSA 3TIZA 4RLKA 4KA3A 4CCBA 2FH9A 3HMNA 3UVPA 3F5PA 4HZSA 5E92A 1OIUA 2ITZA 4JQ7A 3BE9A 5DR6A 5TO8A 4BGGA 4YR8A 1RW8A 2AUHA 2EVAA 4IB3A 3QQGA 4IM2A 3EH9A 1OL1A 4EBVA 5C8NA 4CSVA 4KKHA 5CX9A 5I9ZA 5HTCA 3MH1A 3OBGA 2V62A 2W1ZA 2WMSA 4I0RA 3BLHA 4OTQA 3RMFA 4ERKA 3R28A 3IW7A 3KL8A 2OBJA 3MYGA 1U5QA 4PY1A 3EMGA 5ACKA 2QOOA 4L67A 2CNUA 4QP8A 1ZZLA 2QODA 2XA4A 3EN6A 4IX5A 4WKQA 4Y95A 5M44A 1H08A 3P1AA 5AR7A 4YO4A 3OVVA 3CTQA 4D1SA 2B9HA 3FKLA 3DK7A 3GC0A 1FMKA 5J8IA 4AN2A 4BZNA 3O7LB 2ZDUA 2QVSE 5AM7A 3LXNA 1FGKA 2XRUA 4OTRA 4A07A 3NYOA 4NZWB 4ANNA 2ZYBA 3NUSA 3PIYA 5ANJA 4U41A 2GDOA 1QL6A 3A7JA 3PJ3A 3COHA 4G34A 4QP2A 3CQWA 3BLQA 4RWLA 3ANQA 5FM3A 2GSFA 3RI1A 3RPRA 1YXUA 3PA5A 4FTAA 3DXPA 3QFVA 4QYGA 3ZC5A 5GJGA 1Q8YA 4Z55A 3OCBA 5DVRA 5BYZA 2UZTA 3CD8A 4QMOA 1UV5A 2HW6A 3QC4A 4LV5A 5FXSA 4PNKA 5HG8A 4J99A 3UIXA 4BI1A 4W4XA 1XBBA 3OY3A 2EWAA 2HOGA 1PMNA 2EU9A 3SG9A 2PE0A 1BX6A 1STCE 3TACA 4RQVA 4CZYB 4YTIA 3F88A 5J5SA 4O82A 4ACDA 5CSVA 2RSVA 2BPMA 4AZEA 1KWPA 4BY9E 4ID7A 1J91A 3A7GA 4P4CA 5M4CA 2J5EA 2XCHA 2XKCA 5JFVA 3MB6A 3MTFA 5HNGA 4D4YA 3EQHA 4GYGA 3UP2A 4EKLA 3QKLA 3BHYA 2Y8OA 4FSMA 2UZLA 2BDFA 3DZOA 2NRUA 3H4JA 4KSPA 4N0SA 4NKAA 4D9TA 4GIHA 3RK7A 3QUEA 1L3RE 4EOLA 4H1MA 4QNYA 1M7QA 3KF4A 4Y83A 4O7WA 3NCGA 4MXCA 4K33A 2B55A 2YAAA 3EKKA 3F5XA 3TDVA 1RJBA 4YBJA 3CY2A 5HLNA 3BKBA 4ZOGA 3MJ1A 2W5BA 3Q9XA 2I1MA 2WMVA 4XG6A 4P7EA 4OAVB 1ZYLA 2ONLC 3AMAA 3D5UA 3HGKA 4FZDB 2V5QA 5KMLA 3OC1A 3LJ2A 3GENA 3L9PA 4O7VA 2ZB0A 4GU9A 4PDSA 4EH6A 3Q53A 5IQEA 1APME 4FTMA 3S1HA 3VUKA 4N6YA 2Y4PA 3PE2A 2OWBA 4FV1A 4L00A 5HX8A 5C4KA 3R71A 1YHSA 1WBSA 1E1VA 4ZTHA 4BTMA 4JNWA 1REJA 5CF6A 2VNYA 3ALOA 3E3BX 4FYOA 4F65A 2UW6A 3OTUA 3S95A 5D9HA 3RWQA 2ZDTA 4WG3A 1OPJA 2OXYA 3RVGA 5FTGA 4DT9A 2ERZE 2J51A 3DBDA 5CXZA 3V5JA 3Q52A 2YN8A 4KABA 3ZYAA 5GIOE 3AMYA 3WZEA 2C4GA 5CLPA 2IZUA 4EH3A 3MFSA 3A7HA 5F95A 4IAYA 3VQUA 4DN5A 3LZBA 1MRVA 3VBXA 1NW1A 3EL8A 1ZRZA 4HVHA 2Z8CA 2FSOX 3ZFMA 3ZUVA 3MPTA 3ZU7A 4DFUA 4IVDA 3A60A 4K18A 5FRIA 3NW7A 3UGCA 5JK3A 5GHVA 3NDMA 4FEXA 2WPAA 1PXJA 5HVJA 2J0LA 5BMMA 3PRIA 3HRFA 4HGTA 5CU6A 4ZZOA 3ORPA 3C13A 5CSWA 3O50A 3OW4A 1U54A 4YNEA 4E1ZA 4KUJA 4CTBA 4BCGA 1PMVA 4FKRA 4AACA 3MB7A 3K5UA 4RA4A 3TV6A 1SVHA 4LV8A 3E8DA 4BCQA 2XRWA 2YWVA 1WBOA 3SOAA 3ZUUA 4FC0A 4FGBA 4QMQA 3ALNA 4IW0A 4IVAA 4LOQA 3EL7A 4M68A 4YO6A 3LFBA 4M15A 5BYYA 4X3FC 1JWHA 3R30A 5CSXA 4ANOA 3E92A 2QOKA 4DFLA 1YI6A 2VWXA 2F4JA 4IDTA 3UOLA 5C1QB 4AAAA 4HJOA 2GFCA 3A4OX 5FDXA 2IVTA 4A4OA 1UA2A 1BUHA 2J0MB 4FIFA 4WG5A 3IK3A 4DLIA 5M4FA 5GINE 1LP4A 3E88A 4ZLOA 1Z57A 3L9MA 5DH3A 2RFDA 3N4TA 4QPMA 3FXZA 2FSLX 4R1YA 1KSWA 1UKHA 4PDYA 4BHNA 4LI5A 4C57A 2QR8A 2G15A 3CE3A 4OTFA 4F4PA 4HPTE 4MQ2A 3DV3A 3B2TA 4RC2A 3QX4A 3Q60A 4M3QA 4XG9A 2VWUA 1FINA 3FHRA 3KEXA 2UZNA 3ZBFA 2ZV8A 3GEQA 3AD4A 3FY2A 4G5PA 2QC6A 5AX9A 3QWKA 2UZBA 4MNFA 3FI2A 1YHWA 4QMNA 5BQ0A 3W2PA 3LVPA 1H1WA 3WF5A 3FHIA 4AW1A 2P3GX 1SVGA 3HA6A 2OIQA 4FSQA 3V3VA 2ITVA 3VUHA 3KREA 4GRBA 3UO4A 5L8JA 2BRGA 2Z7SA 4PDOA 2FSMX 2QOHA 3UIUA 2R3GA 5C8MA 1TKIA 4PRJA 2CKQA 2C3JA 2VX1A 4L01A 3BBWA 2XBAA 4FSRA 5CQWA 2E2BA 4USDA 4DINA 3NYVA 4FV6A 4FK3A 4IJ9A 3VF9A 5KMNA 2BTRA 1FVRA 3NIEA 4V0GB 5HCXA 3HYHA 4QD6A 4AT5A 1Y6AA 4CV8A 4E4LA 3ORNA 2B54A 2UZVA 4AGCA 5ICPA 2KTYA 4CFFA 4QP9A 4BIEA 4YP8A 2IWIA 3KF7A 4I6BA 4Y5HA 5AAGA 3PY0A 3DA6A 3AMBA 4MH7A 1O6YA 3HA8A 3MI9A 4Z7GA 4EORA 4R5SA 2Z7QA 4KB8A 3FDNA 5HKMA 4DC2A 4RWKA 3FMMA 3FZSA 3PWDA 4ZTMA 2R3KA 1BLXA 4BWPA 4BI2A 2R3OA 4KS8A 4AW2A 3RTPA 3Q32A 4TXCA 3SGCA 1OIRA 4FZAB 1F3MC 1R0PA 5GIPE 3CIKA 2A1AB 2F2UA 2XZSA 3CJFA 2QU6A 4G6LA 4XRJA 3U6JA 4GKHA 4I6HA 3R7OA 2QD9A 5DBXA 3D14A 4JDKA 4RC3A 5ANIA 4CFUA 4ENYA 2PVLA 4EUTA 1XKKA 4XYFA 4CV9A 3ELJA 2QG5A 3QD0A 3NVMB 2YLFA 2OJFE 5ANDA 3DFCB 4MK0A 4C0TA 4E3CA 3BGPA 4WOVA 4YUQA 4JDJA 5CEQA 2JDOA 2GCDA 3G15A 3LQ5A 5K4JA 4IWOA 4ACGA 4JAJA 3DKFA 3MH0A 2A19B 2XKEA 4MYGA 3WILA 1J1BA 1YDTE 2OKRA 1JQHA 3HV7A 1UU9A 2G2FA 4YTHA 4OTPA 3OXIA 3CTJA 1Q24A 2I6LA 4CQGA 2GTNA 4ZJIA 4XLVA 3BU6A 2RGPA 3OEZA 3V8TA 3ZO3A 5IQBA 3DTWA 3QD2B 4IMYA 1Q4LA 3FZTA 4X7QA 4AW0A 4J95A 4C58A 2O65A 2R3IA 2QOIA 5IA2A 3FMLA 3ZZWA 4I5CA 2VWVA 4U6RA 5J87A 3DY7A 2VN9A 3GP0A 4KS7A 2F7EE 3LFFA 5CU3A 4MD8E 4D2RA 2YM7A 3BZ3A 4ZSEA 5FP5A 5I0BA 4WUNA 3VRYA 3ATTA 2XM9A 2X8EA 3VRZA 2YIWA 3OY1A 4U3YA 3LFSA 3TKUA 1H24A 4QP6A 3IOKA 4LUDA 2GNIA 4BICA 5HVYA 1E9HA 2X8IA 3UOHA 5H8GA 4FF8A 4FL3A 5HU9A 2HK5A 4FV7A 2W1CA 4MWIA 4FTNA 3TT0A 5KUPA 3IS5A 3ZCLA 3ZXTA 1E1XA 1NVQA 2F57A 3O0GA 2PVJA 4GJ3A 2PUPA 3GI3A 3R7EA 1PXOA 4R6VA 3VS1A 1KE8A 4Z3VA 4BGHA 3VHKA 3OWKA 2H6DA 3CLYA 4FNZA 3TZMA 5JFXA 3QHRA 5EKOA 1ERKA 3VBQA 5M4IA 3KRXA 4YSJA 3R1YA 5D7AA 1FPUA 4RVKA 2UZUE 4MBLA 3I6UA 4F0IA 4NFMA 4G6NA 4HZRA 3HP2A 4FV3A 3QCYA 4AW5A 3HKOA 4K0YA 2O64A 2B53A 4IB5A 3G2FA 4HCTA 3NUYA 4AUAA 1H1RA 1YDRE 4XG3A 4AFEA 1TQIA 2OG8A 5DN3A 2W1HA 3VUIA 3CTHA 5FEQA 3MFRA 5CF8A 2YISA 3S2PA 2PZYA 3KMUA 4AGDA 5KO1A 2WIPA 3FEGA 4JBQA 1Q41A 1U5RA 2P33A 2BDWA 3O8UA 2I0YA 2V55A 2Y6OA 3P9JA 5EDPA 3Q9YA 3ZRMA 3NSZA 3QC9A 5L4QA 4F6UA 2GNLA 4EJ7A 4F1TA 4PQNA 1WZYA 4RIXA 1JPAA 5AP6A 4PMMA 4E73A 1UWJA 2VRXA 2QR7A 3FAAA 4YC3A 3PFQA 2HXQA 3GUBA 3VBVA 2A0CX 4FKPA 4EONA 2PPQA 3ZZEA 5HO8A 4XP2A 1OBGA 5AUUA 4ZY4A 3EB0A 2C6IA 5EM8A 2Q0BA 5AV3A 3TEIA 3KQ7A 5A4CA 5CALA 4G9CA 3FC2A 4FL2A 5A46A 2I7QA 4F9WA 4L42A 2C5VA 5E90A 2PWLA 2R7IA 2XK6A 4GK2A 5IEXA 4J97A 2X6EA 2X7OA 5CENA 4U81A 3SHEA 4OBQA 5BX0A 3FZ1A 3FQHA 1PMUA 2F49A 3MA3A 2JIVA 3H30A 2BFYA 3WOWA 2BR1A 3C4ZA 2HWOA 3ANRA 1HOWA 4WSYA 4YJNA 3SDJA 1CSNA 2YDIA 5F94A 4DEHA 4JX3A 4IVCA 1MP8A 4JQEA 4R3PA 4OUCA 3ZO1A 1ZARA 3A62A 2PVRA 1FGIA 1FVTA 2E9PA 4WO5A 4ENXA 3UC4A 3D7ZA 1G8SA 3ID6C 3CKWA 3MSSA 3V8WA 2C68A 4FT9A 5HBHA 5KBRA 5AV4A 1MUOA 5AAFA 3QYZA 3W1FA 3UMXA 4JG7A 3UZPA 2ITNA 5DFPA 3FLWA 4F6WA 4FZ7A 4TW9A 3B8QA 4FTUA 2GNJA 3M1SA 5GJDA 2RF9A 5J5TA 1TVOA 2OK1A 5L2IA 4MX9A 5CQUA 5CT7A 2LAVA 4EHEA 3M42A 4XCUA 5EQEA 4EZ5A 4B8LA 2ZB1A 4DA5A 1OL2A 3I6WA 5E8UA 4TL0A 3QTSA 2YZLA 3F66A 5CVFA 3G6GA 2GTMA 4C61A 4DFBA 4NJ3A 2W4KA 3F9NA 3QBNA 4FTLA 4FUYA 3UODA 3MS9A 3QTIA 4X2NA 4G6OA 3GT8A 4M14A 3R02A 3OD6X 1SNUA 4RFMA 2OH4A 4NW5A 2VTHA 5K4IA 3ZSGA 2W4JA 4LQMA 4AOJA 3DK3A 3QLFA 4NM3A 2X2MA 4EBWA 5K0XA 3P79A 3HUBA 3TZ9A 3VBYA 2JFLA 4FV0A 2B4SB 4G3DA 4Y5QA 5HIDA 3TTIA 4BCFA 4Y85A 3QZIA 3QTXA 3ZTXA 4UXQA 4O27B 4YZNA 4D9UA 1U4DA 4EH7A 3V51A 2QCSA 3Q2MA 2QHNA 4RC4A 3KY2A 5CEPA 4BBFA 4ONAA 5JZNA 5EG3A 5L8KA 2VWYA 4BCJA 3FI4A 3PXKA 4IEBA 5CF5A 3UOJA 1O6KA 4GU6A 4FKLA 4W4YA 3UJGA 3FLYA 4DLJA 3BLRA 2VZ6A 4BCHA 5HNBA 3QKKA 2UVYA 1M17A 4D5KA 3UPZA 4QMPA 1I44A 4F70A 4QNAA 3FSFA 4L53A 4JBPA 4TYIA 5FLFA 5DRBA 2X8DA 5I3RA 3DJ5A 3D5WA 1U59A 3F69A 4KIOA 3U8WA 4WUAA 4JG6A 4QT1A 5BVKA 3I81A 2XNGA 2QI8A 5AP2A 2BDJA 5A14A 4FICA 4E5WA 3RPYA 5A6OA 3MWUA 3P86A 2X4FA 4IHPA 4O2PA 3E93A 4EWHA 2QOQA 2VO7A 2CHLA 4FKOA 1PYXA 3NNXA 3ZEWA 4D2SA 2JITA 5EH0A 3THBA 2HXLA 5K0KA 4J96A 4YJTA 4YNOA 2R3PA 3HV3A 4NM0A 3SXRA 2C30A 1H07A 2C3KA 3KU2A 1YI3A 2IVVA 2C5NA 2OO8X 2J90A 3QQLA 1BKXA 2UZEA 4Y46A 3A4PA 1VZOA 2BRMA 5EW9A 3VWAA 4AT3A 2BTSA 4GVAA 2BAKA 2R4BA 4U80A 3GFEA 4D2PA 3NZ0A 4JT3A 4D2VA 4QMZA 2QO7A 5DT0A 4FNWA 2NO3A 5DGZA 2OJ9A 3MA6A 3R2BA 1OIQA 3BWFA 3T3UA 3VW8A 1XR1A 3TUDA 4S34A 5JGDA 5M56A 5LMKA 4IB0A 3GOKA 1R3CA 3PSCA 2GMXA 4C3PA 2V0DA 3TL8A 4EHGA 4CG9A 4TYJA 2FYSA 4MF1A 3WIKA 1DM2A 4C34A 3FI3A 2B9IA 2JDRA 2BZJA 4FSUA 4G3FA 4BYJA 2YJRA 4C33A 5ETAA 1ZZ2A 3EN5A 3RPVA 1GZNA 2UZOA 3DK6A 4J98A 5IA5A 1JAMA 4A4XA 2GHLA 4GIIA 4N4SA 5EW3A 3KKVA 1VYZA 3WZJA 1V0OA 3ZBXA 3ZO2A 4F6SA 4PX6A 5L2QA 3TI1A 2WKMA 4FNYA 4QP7A 3H0ZA 2C5OA 4GKIA 4W8EA 5E8ZA 3Q2JA 4Y72A 4PMTA 3LMIA 3ZLSA 5CU0A 5J1WA 3R73A 3OWJA 3UQFA 3A7FA 3R04A 2PYWA 3UG1A 5EW8A 4DBNA 3GC9A 3BU3A 4FTCA 2HENA 3C4WA 4QPSA 4CFMA 4FVRA 4QMXA 4II5A 3VHEA 3QD4A 5FEEA 4EH4A 3QYWA 3I1AA 2QOLA 1OL7A 4DEIA 4QYHA 3DBFA 3E87A 5DT3A 5LVLA 2VX0A 5EYMA 4GK4A 3EQFA 3F5UA 4EHVA 4LRJA 5HBJA 3ZM9A 4K1BA 3FLQA 4NCTA 4YLJA 4RQKA 3QU0A 4C7TA 4D5HA 2I0VA 1GZKA 2X9FA 3FJQE 3RHKA 3S00A 3QF9A 4G1WA 4GCJA 3CQEA 4I23A 3GNIB 3NPCA 4L68A 4RIYB 3EHAA 4E5AX 5CAQA 2XYNA 4M7IA 3LXLA 2PVYA 3VN9A 4XEYA 2IZRA 1Y8GA 2ZMCA 2XM8A 3L8SA 4WNKA 3T9TA 4A4LA 4A9TA 2PVKA 5IISA 3ORTA 3R1QA 4JDIA 2DWBA 4AT4A 3QRIA 4EH8A 3AGMA 4XP0A 4ANMA 1YVJA 5T6KA 3MH2A 1ZYDA 2E9VA 4U43A 3KC3A 1T45A 4FMQA 4FZFB 2UV2A 4FVQA 5AP1A 2KULA 1WBPA 2HZIA 1OUKA 4MXZA 3W2SA 5E9EA 5D10A 5IG1A 4V04A 1Q3DA 4AF3A 2ZM1A 4RVTA 4UWBA 2PK9A 4JBVA 1KE6A 2HZNA 3PIZA 2W5AA 5KX8A 3U55A 2OU7A 2XEYA 1KOBA 1MQBA 4YHTA 1YOMA 4RJ4A 3EIDA 5AR8A 4DCEA 3QQUA 4NWMA 2R3NA 4XX9A 3HAMA 2Y9QA 1Y91A 4EOPA 4BKZA 2YAKA 4O0XA 3TG1A 4UYNA 4QMLA 3PXYA 5E1EA 2YDKA 3MV5A 1IA8A 2VO6A 3KN6A 5HCYA 4UEUA 5DWRA 4C4EA 4EQMA 4XMOA 2F7ZE 1OBDA 3QTWA 2R3LA 4AA0A 4O7RA 4NJDA 4BFMA 4IAIA 4LRKA 5CEMA 4ZS4A 4QQTA 4IFCA 3FZOA 3W2OA 3SRVA 2ETKA 4MNEB 5LARA 3KMWA 1WBNA 3R01A 4M67A 3FLNC 2CSNA 4FVPA 4FG7A 5K3YA 5CASA 2C47A 1JKKA 4YJOA 2CGXA 2OJJA 3PPZA 4EH2A 2H9VA 4PP7A 2BALA 2XK8A 5AJQA 3WF8A 1SZMA 4BTFA 3OROA 4O0WA 4IAAA 3QCXA 1GZOA 5CNNA 3LCKA 1XH5A 2WMAA 4HYIA 3DBEA 4UB7A 2BVAA 5E1SA 3IECA 4WT6A 4RJ6A 3V6SA 4FTTA 2R3HA 4TPTA 2HWPA 4X2JA 5DE2A 5HD4A 5I9UA 3HV4A 3K2LA 2G1TA 3D5VA 2WMXA 2VTJA 3LE6A 1IAJA 2YERA 4HYSA 3SKCA 4PNIA 3UDBA 3PVGA 5DIAA 2OZOA 3O8TA 1GIJA 1RQQA 4CMTA 4FE2A 4FT0A 2WQOA 1DAWA 3KGAA 2XB7A 4IANA 2CJMA 3GBZA 4USEA 3MVMA 3IQ7A 4UMUA 4J71A 4JR7A 3KK9A 1PF8A 4UMPA 2HELA 5L6WL 1BI7A 5F20A 4K2RA 3GCSA 5HORA 1P4FA 4EL9A 4F63A 2BZKB 4D0XA 3EFWA 3P7CA 3Q96A 4L3LA 3FSKA 4DGGA 4F9YA 3IW4A 4PTEA 2JDTA 3DGKA 4JXFA 1BL6A 2IW8A 3P7AA 3UP7A 3NIZA 1UNLA 4ZIMA 3RBWA 3TUBA 4TY1A 4O83A 2YM3A 4I1ZA 3PXFA 2BRHA 1V0BA 3BYMA 4ZZMA 4BVUA 1OGUA 3R00A 1OECA 2OJGA 4TYHB 1NVSA 5HO6A 3NAYA 2SRCA 3E7VA 3ITZA 2EB2A 3K3JA 3V5TA 3ET7A 2J0KA 4UWYA 2W99B 5J79A 4FL1A 5KCVA 1SM2A 3T9IA 4H1JA 3VF8A 3AT4A 1OKYA 3UQCA 3NMUF 4L45A 4NTSA 5CAUA 2QG7A 2C69A 4R8QA 4O22A 4UN0C 2C5XA 3QCSA 2BUJA 2FB8A 1ZAOA 4XV9A 2CN8A 5EDQA 2IZSA 5ANKA 4FKTA 5DA3A 3I60A 3U9NA 3K5VA 2NRYA 2OI4X 3QL8A 4YHFA 3DDPA 3UMWA 3KXHA 3LMGA 3PJ8A 4UMRA 3OZ6A 3PVBA 3MDYA 4NCTC 4IM3A 4TTHB 2VD5A 4NIFB 3WE8A 2YHVA 5CY3A 3L9NA 1PYEA 5HTIA 5I9VA 3OT3A 4YJQA 2OZAA 2R0UA 5EM5A 4O21A 4FSZA 3VW6A 3ZO4A 4BC6A 3EFLA 3LFQA 4G16A 4QYFA 4TRLA 5TR6A 2IVUA 3NCZA 3V5WA 4O7YA 4GT4A 2JKMA 4RBLA 2BZIB 2O63A 1K9AA 4RLLA 5IKWA 5I5ZA 3R7UA 4C37A 5LCJA 3IDBA 4FV9A 2VTRA 3RAHA 4IB1A 3LLAA 3JVSA 5CANA 3PJCA 4QTEA 4HGLA 3KULA 1JLUE 3TNWA 4IC7A 3PE1A 5DPVA 3GU5A 2IJMA 4IADA 3IW6A 3DQXA 3R83A 4J53A 2OW3A 1OPLA 5BVEA 1B38A 5F1ZA 4AWIA 2XJ0A 1JKTA 2JAVA 3GC8A 4ZY6A 2JDVA 4WRSA 4N57A 4DEAA 2BKZA 4WRGA 4X3FB 3SQQA 3Q9WA 3NUPA 4WBOA 4FYNA 4IM0A 4MBIA 4IC8A 4IZ5A 3C50A 2YZAA 2A2AA 2OFUA 2WOTA 4MD7E 1H0VA 4JJRA 4OR5A 4I4FA 4RJ5A 5DEYA 4O7LA 2W96B 3FV8A 3BYVA 4FIIA 4EQCA 4C2WA 1J7IA 5FXRA 2WO6A 3SOCA 2Z60A 2ITOA 3ZHPC 4F08A 4YU2A 1CDKA 1MQ4A 3WBLA 4CLIA 3ODYX 1VYWA 4DAWA 4ZJJA 4PL3A 5AADA 5I9XA 4CEGA 2PVHA 2UW5A 3Q5IA 4H3PA 3SV0A 3RNIA 2IN6A 1TQPA 2OXDA 4LL0A 4BTKA 4P90A 5AMNA 4R7IA 4BB4A 4CT2A 4QQJA 2BIKB 1NT2A 4RSSA 3HRBA 4YGAA 5TKDA 3R7GA 3OCSA 5EK7A 1B39A 2XEZA 2XK9A 3RM6A 4C4IA 4E5BA 2C1AA 4GEOA 4OGRA 4BWKA 4L7SA 3CGOA 5KZIA 1K2PA 1JSVA 3RPSA 3ORIA 4AP7A 5FXQA 5KBQA 4ZSAA 3DXNA 2VTMA 3ERKA 3CJGA 5HLPA 5IQIA 5BUEA 4FKVA 2BROA 4BCOA 4EOOA 4GT3A 2VTSA 4M8TA 3WZKA 4CKRA 3BE2A 3ZLWA 2R3RA 1YWVA 2WXVA 3JVRA 3HMOA 2X1NA 4NM5A 3TJCA 1R39A 2WMQA 4MD9E 2Z7LA 5LVPA 3GCVA 1WMKA 2ZM4A 5EHYA 4BKYA 4EK5A 3TN8A 4ACCA 2XIXA 4NFNA 4I20A 2HW7A 5L6OA 2RL5A 3W55A 3FWQA 2GQRA 1PXPA 3HVCA 4C4FA 3C4XA 1QPDA 3CEKA 4FTOA 4QQ5A 5D12A 4ACMA 4UZHA 3HX4A 4HVIA 4I5MA 5EYKA 3H3CA 4KWPA 4BF2A 2VGOA 3MFTA 3QCQA 1WBVA 3E8EA 4FT7A 5FG8A 3DAKA 3FUPA 4LGHA 3DBCA 3NR9A 4AE9A 2NNWB 5HBEA 2HAKA 3R8LA 2RG6A 2WAJA 5T3QA 4RIWA 5A6NA 3TKHA 2CGVA 2VTNA 3F2RA 5AA8A 4EOSA 5ETCA 1YXTA 5CZIA 4BCNA 4X2FA 2BIYA 2WQMA 4FTKA 3PA4A 2Z02A 2XK3A 4ZTNA 2WHBA 2XS0A 4L44A 5FGKA 3TDWA 1YXXA 2YABA 4W4WA 2WTKB 2W5HA 3O51A 5CAPA 4XOYA 2OIDA 2REIA 3H0YA 3JY0A 4FT5A 3BCEA 4FV2A 3COKA 4IFGA 5JFSA 4A06A 5AM6A 2IG7A 1M2PA 3F3UA 1UWHA 1JSUA 2XNEA 4CFVA 4DH1A 3D4QA 4P5ZA 4NEUA 3N4UA 5EHLA 2XJ1A 2PVFA 5EOLA 4Q9ZA 3IOPA 4FV8A 2W9FB 2VUWA 2HCKA 3KVXA 2WTKC 2EXEA 4I4EA 4XG2A 1YKRA 3ORXA 3TNIA 4C4JA 2UW8A 3MY0A 5HOAA 4ZMEA 1DAYA 3AOXA 3I7BA 4XBUA 2WMRA 3BHTA 4NTTA 4M69A 4QMUA 4OW8A 5EOBA 5EQYA 3EQBA 2XNBA 2YIYA 3LFNA 4K8AA 4DH8A 3F6XA 2PZ5A 4AE6A 3KRLA 3DS6A 4IX3A 2WU7A 2XJ2A 2JDSA 4OLIA 3RHXA 3TNPC 1VR2A 1U54B 3IW5A 1ZY4A 3I5NA 2C1BA 4GG5A 4EH9A 4F9BA 4OTDA 1DS5A 3BYSA 2YEXA 3QRJA 4I6FA 3SX9A 4IVBA 4D2WA 1CTPE 2R3FA 4W8DA 2ESMA 1YWRA 4BGQA 5HIEA 5M06A 5IU2A 3R8VA 4PMPA 1WCCA 2X4ZA 5L3AA 5A4LA 2XMYA 5JT2A 2PMLX 3C4FA 4FG9A 2QURA 3PXQA 3H9OA 3IG7A 1XHAA 4ZAUA 3HNGA 5AUXA 5CU2A 2YITA 2VTTA 3KXGA 3MVJA 5G1XA 4EZ7A 1WVYA 2O8YA 1ZYCA 3E3PA 5FWKK 3QX2A 4D4RA 3QTQA 3S0OA 3OCTA 3UNKA 2VO0A 1HCLA 4TT7A 2PY3A 4I93A 4KRDA 5KKRC 5L2TA 2Y6MA 3QHWA 4QP4A 2QNJA 3P23A 3P78A 2VWZA 2J50A 5EM7A 3D15A 2WQEA 4IZ7A 2WELA 3O8PA 3PA3A 3QZGA 2VTIA 4C2VA 5A4EA 5LWMA 3CC6A 5IQAA 2AYPA 4Z16A 3O96A 2CLQA 1H26A 3Q4ZA 4YPDA 4NL0A 3CY3A 3BV3A 3L9LA 1BI8A 4H3QA 5J1VA 3GVUA 2JBOA 4UBAA 4FSNA 4FKUA 5IEVA 4FTRA 2ZAZA 2P4IA 4DCAA 3QD3A 4O7SA 4LG4A 5HG5A 2C6KA 3QAME 5C8KA 3DJ7A 2Q0NA 5EM6A 3EFJA 2Q83A 4F7LA 3AQVA 2GQSA 3BQRA 4AOTA 4QOXA 5A4QA 3DNDA 2GS6A 3C5IA 4IH8A 4CYJA 3Q3BA 2WU6A 2A27A 4AG8A 4DHFA 1ZXEA 3V5LA 4S30A 1ZWSA 2B52A 2G01A 3BX5A 2VNWA 1F5QA 5HICA 4DGMA 3UYSA 4I3ZA 4F7SA 1Y8YA 4PPCA 1UU3A 3GC7A 2W4OA 4B8MA 1W82A 4CRSA 3NW5A 3FZPA 3MH3A 3VC4A 4FEVA 5T68A 4C36A 4XLIA 4CGAA 3EQCA 5ACBC 3G9NA 2JIIA 5D7VA 4H58A 5HO7A 3SVVA 4KAOA 4FBXA 4KIKA 2CNVA 3O7LD 2R3QA 2QONA 4I0TA 4YZCA 3O2MA 3QUDA 1YRPA 1GJOA 1VJYA 1LUFA 3II5A 4RGJA 3GOPA 4CCUA 3D2KA 2PUIA 4D28A 1P5EA 3VS3A 3ZS5A 3RINA 3VS5A 1AGWA 4BL1A 3IDCA 4QYEA 5BPYA 5JKGA 1Q8TA 4H3BA 2YM8A 4AX8A 4DFXE 3P0MA 2XNOA 5H2UA 2VO3A 5AEPA 1XBAA 2QO9A 5HEZA 3L8PA 1I09A 1Y57A 4EWQA 2XVDA 2X39A 5HE1A 2C0IA 4JS8A 4TWNA 2CCHA 2RIOA 4KRCA 1XH6A 1P14A 1IG1A 2HYYA 3V5PA 1FVVA 2PZPA 1H27A 2V7OA 5CWZA 1OPKA 2PZRA 2ZV7A 5LMBA 3F2AA 4OTHA 1OL6A 5JRSA 4YMJA 4ALWA 5B2MA 5D1JA 3AT2A 4C4HA 3S3IA 4LOOA 1GY3A 4KIPA 5IUIA 2O0UA 2O5KA 3FLSA 5KMOA 3FPQA 1NA7A 3O23A 4LMUA 5A9UA 2GPHA 4MHAA 5CZHA 5GZ8A 5AV0A 4E6CA 3VS2A 1RE8A 2ZVAA 2CGWA 3HLLA 2YFXA 3F82A 3PXRA 3OP5A 2E9NA 2P0CA 4HW7A 1GAGA 3PG3A 2ZV2A 4EOMA 3NVKI 4CMOA 5JRQA 2R3MA 1H28A 3E63A 3EZRA 4IZYA 5HNIX 1M2RA 3LQ3A 2ITXA 3EOCA 3QLGA 4U0IA 1LPUA 3DDQA 4BDAA 3D7TA 1H4LA 3OUKA 1PXKA 4FX3A 4Y73A 1DI8A 5C03A 2Z2WA 4KNBA 5DYJA 2GS2A 4K77A 4GG7A 4NM7A 4RJ3A 4EI4A 3DCVA 3QQJA 4BCIA 3R9OA 2WB8A 3UZTA 4YC8A 3PSBA 3OMVA 3VBWA 1OKZA 4R5YA 4UYAA 3R9HA 1XJDA 3PG1A 5D11A 3ORLA 3HECA 5B2KA 4X2GA 4BBEA 3QKMA 4ZS0A 5AUVA 3RZBA 2E9OA 2WZJA 4KBCA 3W16A 3ZLXA 4HVGA 3BEAA 3HDNA 3AXWA 2YA9A 3GXLA 3FQSA 3G33A 2HZ4A 2XIYA 3I0QA 4O38A 4YZ9A 5JQ8A 4JRVA 3ACJA 3QTRA 1H1PA 2YJSA 5CNOA 1WVWA 5E8TA 3N51A 1OKWA 5AP5A 3KA0A 1DI9A 4FI1A 3QUPA 4YHJA 5ANGA 2QLUA 3PY1A 4G2FA 3DT1A 2NP8A 2GQGA 4EYMA 3AGLA 4ZJVA 3NNUA 5L6PA 4LYNA 4WNMA 3PPJA 3TWJA 4BTJA 3H9RA 3DOGA 5J95A 2CN5A 2JGZA 2XBJA 3FMKA 3HP5A 4C3FA 2UZWE 2XNNA 1ZYSA 2C0OA 2QU5A 3ZH8A 4GV1A 1R0EA 3DZQA 3GU8A 3NNVA 3ORMA 4JRNA 4RIXB 1IR3A 5BVDA 4JBOA 4QQCA 4QPAA 4RVMA 3C7QA 3ZRLA 4LMNA 4L8MA 3OHTA 3FY0A 3O71A 4D4VA 1UVRA 1YQJA 4MAOA 4ZSJA 3R7IA 4I5HA 3I7CA 1H25A 3G5DA 1Q99A 2ITUA 1SYKA 5EYCA 4E4XA 5BUIA 1QPCA 4QMYA 5E8YA 5AV1A 4DG0E 1UNGA 4ZMFA 5AR4A 2ZM3A 5DNRA 5M4UA 3CSVA 4FSYA 4TYGA 3DB6A 1UKIA 3TNHA 4DEDA 3EQIA 3L8XA 3A8XA 4P2KA 4XG4A 4R3RA 5K9IA 5FTQA 3UO5A 5FDPA 4P5QA 3HMIA 4W9WA 4CFXA 2XIZA 4E93A 4H39A 3DFAA 3UIMA 3ZEPA 3R7VA 3FI8A 3VUTA 3OOGA 4FOCA 3IW8A 2RFNA 3HUCA 3D0EA 4JI9A 3BPRA 3NYNA 4S32A 5HIBA 4EK6A 4ZTRA 5L2WA 1J3HA 3DBQA 3NGAA 4EHZA 3T8OA 1T46A 5DLSA 3AT3A 2JKQA 3QTZA 3FZRA 4L43A 4L6QA 3R9NA 4DH3A 2CNQA 3LMHA 3NAXA 4FNXA 4XNEA 2UVZA 2PE2A 4HCUA 3PVWA 4AU8A 1CKIA 3DAJA 3QGYA 4O96A 4MEDA 3A99A 3VULA 5AP3A 1Z5MA 3FE3A 1O6LA 4RG0A 4TZRA 3LCOA 3VVHA 1Q3WA 3HAVA 2WTWA 3WI6A 4QMWA 1V0PA 4U97A 4HNIA 5DRDA 1G5SA 4BDHA 4YLLA 5JH6A 4BR3A 3AC4A 1OUYA 3FPMA 2JLDA 3NW6A 5H3QA 4TWPA 3CQUA 4DG2E 1X8BA 2JC6A 5IA1A 2BKKA 1IAHA 1JKSA 3FL5A 5CI7A 5J7HA 4WNOA 1QPEA 4EK8A 1W8CA 4ITHA 2EXMA 3AC3A 3LW0A 5CTPA 3F61A 4HOKA 4AGWA 3ORKA 4I24A 5EI6A 4DTBA 2VWBA 4YPSA 4PUZA 4ACHA 1ZYJA 1S9JA 5CSPA 2QO2A 3DTCA 3PY3A 4Z9LA 4ZLZA 4QTAA 2J0IA 3EYHA 3Q4TA 2VGPA 3IGGA 3IKAA 5JEBA 4AFJA 4E26A 2WTDA 4RJ8A 3VNTA 5HHWA 1WBTA 2BAQA 3FBVA 5A3XA 1CM8A 3RKBA 3WF9A 1URWA 3BHUA 2RFSA 1OITA 4E20A 5HZNA 4TKSA 3HV6A 5B7VA 2XYUA 3A2CA 3C0IA 3DLZA 3PWYA 4HNFA 4JVGA 2Y4IC 3R8ZA 3WIGA 4GJ2A 5AV2A 4PMSA 4IZAA 4LM5A 2PTKA 2WTCA 4E6DA 3JS2A 4B99A 1XWSA 4WBBB 5ITAA 5I9YA 4AGUA 1FMOE 5CI6A 3UBDA 1JSTA 5AA9A 4L3JA 2DUVA 5BVOA 4EJNA 5EDRA 3OW3A 4MTAA 2VV9A 2ZV9A 4M12A 2R3JA 3ZDIA 1BMKA 3OS3A 2CLXA 4ASEA 4LL5A 1AQ1A 1GNGA 3O17A 5B2LA 2XUUA 2WGJA 2V22A 2ZMDA 4GFOA 3W8LA 4D58A 5JN2A 4OT5A 4RIOA 5JGBA 4APPA 1PMEA 3BV2A 4GW8A 4FEUA 3HMMA 4AZFA 4O7TA 5M53A 3GB2A 3AC1A 3V01A 4RZVA 5FTOA 5CAOA 3OG7A 4M97A 2UW9A 2CKPA 2FUMA 1XBCA 5HTBA 4BRXA 4PTCA 3I5ZA 1IEPA 4YSMA 1BL7A 3LCTA 4IAKA 4KKGA 3D2IA 3HDMA 3G0EA 4RX9A 2GNGA 3POOA 2OGVA 3C1XA 4DYMA 3KRWA 1WAKA 3DKCA 1ZOHA 2ITWA 3BU5A 5CVHA 3GCPA 2JKKA 5DOSA 1JVPP 3G0FA 4S31A 1PHKA 1ATPE 1CMKE 4BDGA 3EN7A 3DXQA 3W33A 2VAGA 2B1PA 2C6DA 5TT7A 4BDEA 4XS2A 5K5NA 5LQFA 2UUEA 2FA2A 3GCUA 4G3GA 4EH5A 2LGCA 4ZSGA 5I3OA 3B8RA 3Q6WA 4JL9A 1LEZA 3COIA 3P4KA 3UPXA 4FV5A 4DT8A 4C62A 2YWPA 3SW4A 1IA9A 3D83A 3GQIA 3OT8A 4BIBA 5EI8A 5AUWA 4KBAA 3LFCA 3ORZA 4CVAA 4V01A 2JD5A 5KE0A 1EH4A 4BN1A 2CPKE 5DEWA 3FMNA 3LM5A 4B0GA 4DEEA 4MBJA 1Q62A 1XO2B 4YJUA 3RK5A 4BDIA 2X9EA 1M14A 2DYLA 3ZUTA 1UU8A 5LMKC 3AD5A 3P08A 2VTAA 4M0YA 2C3IB 2X7GA 3U4UA 4FT3A 4HPUE 1M2QA 4YZMA 4F7NA 2XP2A 2PL0A 1U46A 3KRRA 4CXAA 3W2RA 2UVXA 2ETMA 1A9UA 4AA5A 3DKGA 4FKIA 3IPHA 4ASXA 2OJIA 4FIGA 2I0HA 3BELA 4G9RA 5KMMA 5TOZA 2C0TA 2XIRA 4EZ3A 3ROYA 3PXZA 3I4BA 5IZFA 1SMHA 3COMA 3A61A 5IH6A 4QTDA 3PLAE 4MWHA 5JMSA 3NUUA 4D4SA 3TZ7A 3ZDUA 4KIQA 4MQ1A 5KHWA 5IQCA 1KE9A 2Y7JA 1MRYA 1GZ8A 3RPOA 4FEWA 4BCPA 4C38A 1P2AA 2W0JA 4QMSA 2PMNX 4RVLA 3UYTA 4U79A 3WARA 3LFEA 4IX6A 4V0GA 4UY9A 3LM0A 3LHJA 4BDDA 5J9YA 3CCNA 4QRCA 2UW3A 2QLQA 3C51A 1YDSE 3ZFXA 5IQGA 2P55A 4EOIA 4YZBA 5TE0A 2R7BA 2DS1A 3CXWA 1W84A 3CKXA 2WEVA 3PZHA 4PP9A 5LVOA 4R1VA 3RM7A 5AAEA 1XH8A 5C4LA 2R64A 1QMZA 2RG5A 3ZMMA 4TNBA 3V8SA 4Z7HA 3TJDA 5DG5A 4AZVA 2C6OA 4LRMA 3N4VA 1XH9A 5E8VA 1YWNA 3CP9A 3QQKA 1Q61A 2F7XE 2VU3A 3PP0A 4FKJA 3RAWA 4RRVA 2BRNA 5HG9A 2GNHA 5HE2A 3KXMA 4PPBA 4G3EA 3IO7A 3W10A 3ZSIA 5IDPA 4EK3A 4IWQA 4UALA 4CMUA 4OT6A 3B2WA 3BYOA 4JG8A 3KCKA 3HV5A 1GIIA 2CDZA 3PVUA 4GH2A 3MESA 4RWIA 3UZRA 4EQUA 3SC1A 3QA8A 1J7UA 5LWNA 2XH5A 5C27A 3D5XA 2YCRA 3JPVA 4MVFA 4KBKA 3UNJA 1JKLA 4W9XA 2VTPA 4G17A 1W7HA 4XV3A 4O7ZA 5CEIA 4JIKA 2BILB 4BZOA 4FEQA 5AIKA 4A7CA 4M66A 4GMYA 4GSBA 4F9AA 2JAMA 5M55A 3E64A 5F4NA 4R7BA 1A48A 4HCVA 4ASZA 4U9AA 1BYGA 3ACKA 4AZTA 4TNDA 3IDPA 4EC9A 3R21A 4PWNA 4EK4A 1OIYA 3E8CA 1ZMVA 5HGIA 5EHOA 5AWMA 4BBMA 3SRVB 2X81A 1GIHA 5AR5A 1OB3A 4F0FA 1AD5A 2B9JA 4FIEA 3UOKA 3BIZA 4ZTLA 4PTGA 3S4QA 4DG3E 2WTIA 4KD1A 5LXMA 3SG8A 1KE5A 3CGFA 2Y0AA 2F9GA 2PUUA 3DAEA 5HCZA 4CQEA 5IQDA 2EUFB 2QOCA 3F3VA 4U5JA 5J9LA 1OZ1A 4ANBA 2X0GA 4C35A 2CKOA 3SD0A 4CZUA 4FKSA 3JR1A 1H8FA 4IACA 4NUSA 4IBMA 3BHVA 4UX9A 3WF7A 4WD5A 1PXNA 4FV4A 1JNKA 3OF0A 4HGSA 3PP1A 3L1SA 5AUZA 4C8BA 5HQ0A 5L2SA 3TM0A 4GFMA 3TCPA 3NNWA 4JR3A 4HYHA 4L9IA 5IA0A 2W7XA 4U44A 1OL5A 1VEBA 1R1WA 4BDJA 2OLCA 5M07A 4TN6A 5LVNA 2GU8A 2PMIA 3RAKA 4APCA 1KOAA 3UC3A 3VUMA 3MGYA 1JOWB 2DQ7X 2ITTA 3FXXA 4BCKA 5LOHA 5BYLA 4G3CA 1JBPE 4NU1A 4L52A 3VS0A 4O0VA 3TTJA 3TXOA 3P5KA 4FG8A 2VTQA 4FUXA 3BRBA 5BVWA 4D1ZA 1NY3A 3NUXA 4GS6A 2PULA 3EWHA 5IEYA 2WOUA 3EQGA 3QRUA 1WBWA 3DU8A 4U40A 4M13A 3DJ6A 3MTLA 3R6XA 4WA9A 3NX8A 5IUHA 4KINA 2PVMA 3W2CA 4IIRA 4K6ZA 3KK8A 5AFVA 3VUDA 2WQBA 3BGQA 3ZOSA 3QRKA 5E91A 5HI2A 1H0WA 1Q97A 5HLWA 5DR9A 4UXLA 5AP0A 2ITYA 2B9FA 5AUYA 4GUEA 3L8VA 3EZVA 4ZP5A 3QQHA 4I0SA 2H34A 2ERKA 3A7IA 2UZDA 3DPKA 1S9IA 2HZ0A 4M0ZA 4RFYA 5H9BA 4YJRA 4RZWA 2JIUA 5AR3A 3EJ1A 3NWWA 3PZEA 5C9CA 1ZOGA 3RCJA 3WYYA 5EI2A 4GYIA 4F99A 3U87A 4NT4A 2IO6A 3HMPA 1OMWA 4ORKA 5CYIA 5FEDA 5FQDC 4ANQA 4DBXA 4L7FA 2IW9A 5FBNC 2JBPA 3BWJA 3W2QA 1H01A 4U45A 2OSCA 3PIXA 2FGIA 2WTVA 4YJPA 3IGOA 3M11A 1URCA 2C5YA 2WNTA 5AX3A 2B0QA 2WEIA 3JXWA 4FKQA 1Q5KA 3IONA 5HE0A 4F0GA 3ZC6A 4EOQA 3RJCA 3BI6A 3C0GA 2YIXA 4PDPA 1K3AA 2GHGA 4MXYA 3RAIA 2C6TA 1MRUA 5H8EA 2I40A 3JYAA 4PL4A 5E7RA 3RK9A 3SA0A 2OH0E 4OAUC 4W4VA 4UV0A 4AN9A 4C3RA 3U54A 1Y6BA 2WQNA 4LGGA 1PY5A 3OCGA 3OUNB 2OZAB 2YCQA 3KVWA 2E9UA 3OOMA 4F7JA 2YDJA 5JGAA 2BAJA 2O3PA 4B4LA 5EYDA 5CXHA 3LAUA 3E62A 3TKIA 3UTOA 2WD1A 4ZSLA 4YLKA 4F1OA 1WVXA 4O84A 3G90X 5EKNA 3PUPA 1KUTA 4J1RA 4ANLA 1G3NA 1TQMA 3M2WA 3WYXA 3KULB 3FMHA 4BCMA 4RA5A 1W98A 4RPVA 3FKNA 2OF2A 2YCFA 3SLSA 4NK9A 3U6HA 3AC8A 3BGZA 4DFYA 5AUTA 4X3JA 4O1OA 3VAPA 1FQ1B 4QYYA 4O6EA 4D0WA 3CS9A 4O7NA 2WMWA 2W9ZB 1H1QA 1PKDA 3MVLA 2WMTA 3P7BA 4X6QC 5CS6A 3ZXZA 4ERWA 1PXMA 5F9EA 1ZLTA 2WMBA 2X2KA 3MJ2A 3QXOA 3FL4A 4MXOA 5HE3A 2CCIA 2XIKA 3PTGA 5IA3A 2XK7A 4E8AA 4E6AA 2GS7A 1F0QA 4BZDA 4Q2AA 4B7TA 4LUEA 3V04A 3F7ZA 4CFWA 5KKRB 1CKJA 3TZ8A 1R78A 3WF6A 2ITQA 5DI1A 4MF0A 4FTIA 5B0XA 2RFEA 3LJ0A 3SAYA 4DFNA 4MXXA 4AXAA 3GCQA 1NXKA 3QWJA 3VS7A 4L46A 3R0TA 4QO9A 2PMOX 5HU3A 3DNEA 1V1KA 4ZTSA 3EN9A 2QKWB 2V7AA 2AC3A 4FTQA 2J9MA 3LPBA 5HG7A 3ZFYA 4Y8DA 2IZTA 5CSHA 5L8LA 1OM1A 2BFXA 4DH7A 1PKGA 4AZWA 5CEOA 5I4NA 4G5JA 3MY5A 3DKOA 5KMJA 3LKMA 3OXTA 5J9ZA 1PJKA 4PF4A 3EQPA 3OFMA 4FTJA 2W1DA 4FKGA 3R9DA 3WE4A 4N70A 5AR2A 4GK3A 1Q8UA 3QZHA 4TWCA 4JQ8A 4XJ0A 4MKCA 2PZIA 3ULZA 5IQHA 2VWWA 4ZK5A 3C9WA 4FOBA 3KMMA 3BHHA 3QQFA 4J52A 4BDKA 5IH4A 4E4NA 4O86A 3AC2A 5FM2A 5M57A 3D9VA 2ACXA 2YM4A 5FP6A 4ZZNA 4ANSA 4TYEA 3CBLA 3PJ1A 4FSTA 4GFGA 3POZA 2G2IA 3FQEA 4PV0A 4UMTA 5H8BA 3U9CA 3UVQA 4ARKA 4CTCA 4JIAA 3KB7A 1CKPA 4H36A 2VX3A 4KSQA 1YW2A 2YACA 3MPMA 5I9WA 4DEGA 3GU4A 3LXPA 2WFYA 4X0MA 4ZEGA 3MW1A 3UE4A 4XG7A 3MVHA 5FD2A 3PLSA 4CFNA 4K9YA 3UQGA 4PL5A 3VS6A 4LGDA 5IQFA 3SXFA 5CVGA 3WZDA 3TV7A 2A4LA 3VBTA 5JQ5A 5KMIA 4UWCA 2ITPA 4CT1A 3EQDA 2OFVA 2PU8A 3EKNA 4QMTA 4A9SA 2UW0A 2NPQA 2WIHA 4YJSA 2W17A 2PUNA 4JAIA 3ULIA 1M7NA 4HGEA 4I94A 4F64A 3SW7A 5HVKA 2O2UA 2IPXA 4RX8A 2OICA 4F1MA 5BVFA 3BQCA 2QHMA 3C5UA 3ATSA 2CMWA 4DF3A 2IW6A 5TF9A 3MPAA 3RWPA 4QP3A 4FZ6A 3F3TA 1OKVA 2H96A 3F7WA 3ZLYA 2YCSA 4CKIA 5DR2A 3ETAA 2C6EA 4RIWB 4AS0A 3F3WA 4DITA 4EUUA 3FMJA 3H9FA 1B6CB 4OBPA 5E4HA 3EFKA 3E5AA 4CLJA 2I0EA 2W1GA 3EQRA 3GGFA 3UNZA 4YTCA 5C26A 3PDTA 4XV2A 4UZDA 2JEDA 1M52A 3FYKX 4FIHA 4WSQA 3Q6UA 3Q9ZA 4I5PA 2CKEA 3VUGA 4JDHA 4O91A 1UU7A 4RFZA 5ETIA 5EFQA 4ZTQA 2IVSA 4O6LA 1XH4A 5KMKA 4XV1A 3PJ2A 2OIBA 4FGRA 4FR4A 4DGOA 2OF4A 4DE4A 2PHKA 3DB8A 3FYJX 3MN3A 3R1SA 3A8WA 4AQCA 3GFWA 5GZ9A 4G31A 4FSWA 1UNHA 3AG9A 3Q4UA 1LR4A 4ALUA 4XH6A 3NUAA 4OTGA 3I0OA 4YBKA 3KCFA 4IWDA 1XH7A 4DEBA 4DTKA 5IUGA 4UMQA 1KV2A 4AN3A 1YXSA 4R77A 2X6DA 4QTCA 4X6RA 4BHZA 2R9SA 3RALA 4GUBA 5C01A 3LOKA 3UG2A 3ENMA 4USFA 1IASA 4KKEA 5IMEA 2BHEA 3R22A 1OI9A 2XNPA 3RGFA 2H8HA 5GJFA 4O0UA 5IPJA 4M69B 4JX7A 2EB3A 2XKFA 4NKSA 4HVDA 2G9XA 4CD0A 3JUHA 3ZONA 3HZTA 4C02A 3KXNA 4XBRA 5CEKA 1YOLA 4EKKA 2R2PA 2F2CB 4MXAA 3WZUA 1SNXA 2W06A 3PSDA 2UW7A 1G8AA 4NW6A 4GL9A 2JFMA 5LCKA 3C4CA 3LFDA 3KXZA 4YZDA 4F09A 4PPAA 3GU7A 4LFIA 5DHJA 2FO0A 3I79A 4E6QA 4RIYA 3UIBA 3R9RA 3U4WA 4AOIA 4QP1A 2YM5A 4L3PA 1SVEA 4RWJA 2J4ZA 4B9DA 3NS9A 1FOTA 5M08A 3R7YA 5ANEA 1RDQE 4YC6A 3V6RA 3MIYA 1ZMUA 1Z9XA 5J7BA 5E8SA 2C6MA 3R8UA 3R1NA 5KZ0A 2XKDA 2VTLA 2X2LA 3BYUA 3R63A 5A54A 4BIDA 5AIRA 2PVNA 3TUCA 1L8TA 4FIJA 4K11A 4WNPA 4ZLYA 4LOPA 2HY81 4WIHA 3RCDA 5JFWA 3U6IA 4CNHA 5IA4A 4MCVA 5EQPA 3TNQB 3QZFA 1QCFA 1P4OA 4TWOA 4XG8A 4X21A 1GOLA 5FBOA 4B6LA 1ZMWA 2P2HA 3VS4A 5IMXA 4D1XA 2BHHA 4I22A 2XF0A 4U8ZA 5IF1A 3U51A 3CPBA 3CD3A 2ETRA 2QKRA 1KV1A 1OVEA 4QTBA 3W18A 3AD6A 3ENHA 2C3LA 5DMZA 3ZM4A 3NEWA 4YURA 3OWLA 3LXKA 2B7AA 3C4EA 1IRKA 3QGWA 3LQ8A 3MY1A 1XQZA 5AP7A 5CF4A 5A4TA 3NUNA 3FMDA 4RX7A 2ZOQA 1YOJA 3HEGA 4V05A 3MFUA 3UVRA 4S33A 5BNJA 4CRLA 3RP9A 3CPCA 3QALE 4E4MA 3C0HA 2W1FA 4XRLA 2GNFA 4NH1A 3E7OA 1PW2A 4QMVA 1PRYA 4S2ZA 3LCSA 5LVMA 4A9UA 4MNEA 3D94A 3F5GA 4HVSA 3Q5ZA 5HD7A 2PE1A 4A9YA 1YI4A 3PPKA 3TIYA 3JY9A 2EXCX 3FXWA
chains in the Genus database with same CATH superfamily
3REPA 2FSTX 3OTVA 4EYJA 4IJPA 2YM6A 1REKA 4R7HA 4FA2A 3KIOC 4NYEA 4RT7A 4RX5A 1ND4A 3DQWA 4XUFA 4ITJA 4O4CA 4N6ZA 4J8NA 4O0TA 4XP3A 1A06A 2W1EA 4KIKB 5AP4A 2J0JA 3QRTA 3K3IA 4IX4A 2P2IA 4XHKB 3PYYA 1HCKA 3FC1X 3W8QA 2UW4A 2R0IA 2R5TA 4AA4A 2J5FA 4C4GA 4FK6A 1H00A 1W0XC 4IE9A 2QOBA 1J7LA 1XMLA 5LJJA 2OXXA 3VIDA 2XNMA 4DTAA 1KE7A 3CR0A 3R2YA 3LIJA 3KXXA 2Z7RA 3UDTA 4M84A 2HY0A 3F3ZA 3ODZX 4O0SA 5CT0A 4I41A 1NVRA 5K5XA 5FUTA 4R3CA 5HESA 2WMUA 5LMAA 1W2CA 4I21A 4A9RA 3QTUA 3VO3A 3RNYA 4DH5A 3OBJA 3UO6A 1W83A 4GVJA 5BVNA 5E8WA 4AQKA 3AC5A 3LFAA 3OWPA 4WHZA 4HYUA 4BWXA 3VJOA 5JZJA 3LJ1A 3W0RA 2G2HA 4BDCA 3ZSHA 3Q04A 2VTOA 3HRCA 3KN5A 3N9XA 4WG4A 4EOJA 4BKJA 4OTIA 4RMZA 4BDFA 4DFZE 3G51A 4FKWA 5KHXA 5M51A 1YXVA 2ONLA 1O9UA 3DLSA 4ASDA 5CU4A 2W05A 2JKOA 2Y4IB 4Q5EA 4IQ6A 2YLEA 2J7TA 4X2KA 3NYXA 2XK4A 2W1IA 2J2IB 4TYHA 4IWPA 4O2ZA 5G6VA 4CYIA 4F9CA 2HIWA 4Q5HA 3R8PA 2GFSA 3BEGA 3NLBA 4QMMA 3FMEA 2BZHB 3QXPA 4GT5A 4IAFA 2X0PA 4BDBA 3PRFA 4O81A 4ZXTA 4IDVA 2RKUA 2PSQA 4DGNA 4C59A 2QOFA 3D7TB 3E8NA 2YIRA 3LCDA 1Q8WA 3KRJA 5GZAA 3MIAA 3G6HA 2AC5A 4ALVA 4IXPA 4EOKA 3K54A 4CKJA 4Q9SA 4CZTA 4U42A 5IDNA 3BBTB 5ETFA 5D41A 1PXIA 3MBLA 3T3VA 4ZY5A 4J8MA 4R78A 1QPJA 3H10A 5M09A 4CG8A 4YTFA 5BUJA 3G9LX 3R8MA 3W32A 2YIQA 2WTJA 4NIFA 4ITIA 1ZY5A 5BMSA 3EN4A 2X7FA 4J7BA 5KNJA 4EC8A 1WFCA 2C6LA 5E8XA 3LLTA 3NRMA 2XCKA 2BMCA 3QA0A 3ZRKA 3KFAA 4E7WA 1FBNA 2CGUA 1J1CA 4EEVA 3FLZA 3OEFX 1H1SA 4I6QA 4IAZA 4NSTA 4U7ZA 4YJVA 3HL7A 3GQLA 3Q4CA 4DGLC 2ZJWA 3RZFA 5DT4A 4AZSA 2QQ7A 4O0RA 2VWIA 4O0YA 3VJNA 3V5QA 5HX6A 2GHMA 4BYIA 4D2TA 2FVDA 1PXLA 4OBOA 4JOAA 4OTWA 4BI0A 5JSMA 2BRBA 5GNKA 3GU6A 1ZOEA 2J6MA 4XOZA 4H05A 4FODA 4I92A 4D55A 4U3ZA 4RJ7A 1YHVA 3F2NA 1LEWA 5ANOA 3OXZA 4JLCA 4O1PA 3FKOA 3EYGA 3ROCA 3TV4A 4X3FA 1Q8ZA 2BCJA 3VQHA 5CAVA 5IH5A 3SXSA 3TIZA 4RLKA 4KA3A 4CCBA 2FH9A 3HMNA 3UVPA 3F5PA 4HZSA 5E92A 1OIUA 2ITZA 4JQ7A 3BE9A 5DR6A 5TO8A 4BGGA 4YR8A 1RW8A 2AUHA 2EVAA 4IB3A 3QQGA 4IM2A 3EH9A 1OL1A 4EBVA 5C8NA 4CSVA 4KKHA 5CX9A 5I9ZA 5HTCA 3MH1A 3OBGA 2V62A 2W1ZA 2WMSA 4I0RA 3BLHA 4OTQA 3RMFA 4ERKA 3R28A 3IW7A 3KL8A 2OBJA 3MYGA 1U5QA 4PY1A 3EMGA 5ACKA 2QOOA 4L67A 2CNUA 4QP8A 1ZZLA 2QODA 2XA4A 3EN6A 4IX5A 4WKQA 4Y95A 5M44A 1H08A 3P1AA 2AQXA 5AR7A 4YO4A 3OVVA 3CTQA 4D1SA 2B9HA 3FKLA 3DK7A 3GC0A 1FMKA 5J8IA 4AN2A 4BZNA 3O7LB 2ZDUA 2QVSE 5AM7A 3LXNA 1FGKA 2XRUA 4OTRA 4A07A 3NYOA 4NZWB 4ANNA 2ZYBA 3NUSA 3PIYA 5ANJA 4U41A 2GDOA 1QL6A 3A7JA 3PJ3A 3COHA 4G34A 4QP2A 3CQWA 3BLQA 4RWLA 3ANQA 5FM3A 2GSFA 3RI1A 3RPRA 1YXUA 3PA5A 4FTAA 3DXPA 3QFVA 4QYGA 3ZC5A 5GJGA 1Q8YA 4Z55A 3OCBA 5DVRA 5BYZA 2UZTA 3CD8A 4QMOA 1UV5A 2HW6A 3QC4A 4LV5A 5FXSA 4PNKA 5HG8A 4J99A 3UIXA 4BI1A 4W4XA 1XBBA 3OY3A 2EWAA 2HOGA 1PMNA 2EU9A 3SG9A 2PE0A 1BX6A 1STCE 3TACA 4RQVA 4CZYB 4YTIA 3F88A 5J5SA 4O82A 4ACDA 5CSVA 2RSVA 2BPMA 4AZEA 1KWPA 4BY9E 4ID7A 1J91A 3A7GA 3BLAA 4P4CA 5M4CA 2J5EA 2XCHA 2XKCA 5JFVA 3MB6A 3MTFA 5HNGA 4D4YA 3EQHA 4GYGA 3UP2A 4EKLA 3QKLA 3BHYA 2Y8OA 4FSMA 2UZLA 2BDFA 3DZOA 2NRUA 3H4JA 4KSPA 4N0SA 4NKAA 4D9TA 3W0OA 4GIHA 3RK7A 3QUEA 1L3RE 4EOLA 4H1MA 4QNYA 1M7QA 3KF4A 4Y83A 4O7WA 3NCGA 4MXCA 4K33A 2B55A 2YAAA 3EKKA 3F5XA 3TDVA 1RJBA 4YBJA 3CY2A 5HLNA 3BKBA 4ZOGA 3MJ1A 2W5BA 3Q9XA 2I1MA 2WMVA 4XG6A 4P7EA 4OAVB 1ZYLA 2ONLC 3AMAA 3D5UA 3HGKA 4FZDB 4QEBA 2V5QA 5KMLA 3OC1A 3LJ2A 3GENA 3L9PA 1XMMA 4O7VA 2ZB0A 4GU9A 4PDSA 4EH6A 3Q53A 5IQEA 1APME 4FTMA 3S1HA 3VUKA 4N6YA 3ML1A 2Y4PA 3PE2A 2OWBA 4FV1A 4L00A 5HX8A 5C4KA 3R71A 1YHSA 1WBSA 1E1VA 4ZTHA 4BTMA 4JNWA 1REJA 5CF6A 2VNYA 3ALOA 3E3BX 4FYOA 4F65A 2UW6A 3OTUA 3S95A 5D9HA 3RWQA 2ZDTA 1ST0A 4WG3A 1OPJA 2OXYA 3RVGA 5FTGA 4DT9A 2ERZE 2J51A 3DBDA 5CXZA 3V5JA 3Q52A 2YN8A 4KABA 3ZYAA 5GIOE 3AMYA 3WZEA 2C4GA 5CLPA 2IZUA 4EH3A 3MFSA 3A7HA 5F95A 4IAYA 3VQUA 4DN5A 3LZBA 1MRVA 3VBXA 1NW1A 3EL8A 1ZRZA 4HVHA 2Z8CA 2FSOX 3ZFMA 3ZUVA 3MPTA 3ZU7A 4DFUA 4IVDA 3A60A 4K18A 5FRIA 3NW7A 3UGCA 5JK3A 5GHVA 3NDMA 4FEXA 2WPAA 1PXJA 5HVJA 2J0LA 5BMMA 3PRIA 3HRFA 4HGTA 5CU6A 4ZZOA 3ORPA 4DDIA 3C13A 5CSWA 3O50A 3OW4A 1U54A 4YNEA 4E1ZA 4KUJA 4CTBA 4BCGA 1PMVA 4FKRA 4AACA 3MB7A 3K5UA 4RA4A 3TV6A 1SVHA 4LV8A 3E8DA 4BCQA 2XRWA 2YWVA 1WBOA 3SOAA 3ZUUA 4FC0A 4FGBA 4QMQA 3ALNA 4IW0A 4IVAA 4LOQA 1TFFA 3EL7A 4M68A 4YO6A 3LFBA 4M15A 5BYYA 4X3FC 1JWHA 3R30A 5CSXA 4ANOA 3E92A 2QOKA 4DFLA 1YI6A 2VWXA 2F4JA 4IDTA 3UOLA 5C1QB 4AAAA 4HJOA 2GFCA 2IF8A 3A4OX 5FDXA 2IVTA 4A4OA 1UA2A 1BUHA 2J0MB 4FIFA 4WG5A 3IK3A 4DLIA 5M4FA 5GINE 1LP4A 3E88A 4ZLOA 1Z57A 3L9MA 5DH3A 2RFDA 3N4TA 4QPMA 3FXZA 2FSLX 4R1YA 1KSWA 1UKHA 4PDYA 4BHNA 4LI5A 4C57A 2QR8A 2G15A 3CE3A 4OTFA 4F4PA 4HPTE 4MQ2A 3DV3A 3B2TA 4RC2A 3QX4A 3Q60A 4M3QA 4XG9A 2VWUA 1FINA 3FHRA 3KEXA 2UZNA 3ZBFA 2ZV8A 3GEQA 3AD4A 3FY2A 4G5PA 2QC6A 5AX9A 3QWKA 2UZBA 4MNFA 3FI2A 1YHWA 4QMNA 5BQ0A 3W2PA 3LVPA 1H1WA 3WF5A 3FHIA 4AW1A 2P3GX 1SVGA 3HA6A 2OIQA 4FSQA 3V3VA 2ITVA 3VUHA 3KREA 4GRBA 3UO4A 5L8JA 2BRGA 2Z7SA 4PDOA 2FSMX 2QOHA 3UIUA 2R3GA 5C8MA 1TKIA 4PRJA 2CKQA 2C3JA 2VX1A 4L01A 3BBWA 2XBAA 4FSRA 5CQWA 2E2BA 4USDA 4DINA 3NYVA 4FV6A 4FK3A 4IJ9A 3VF9A 5KMNA 2BTRA 1FVRA 3NIEA 4V0GB 5HCXA 3HYHA 4QD6A 4AT5A 1Y6AA 4CV8A 4E4LA 3ORNA 2B54A 2UZVA 4AGCA 5ICPA 2KTYA 4CFFA 4QP9A 4BIEA 4YP8A 2IWIA 3KF7A 2AEGA 4I6BA 4Y5HA 5AAGA 3PY0A 3DA6A 3AMBA 4MH7A 1O6YA 3HA8A 3MI9A 4Z7GA 4EORA 4R5SA 2Z7QA 4KB8A 3FDNA 5HKMA 4DC2A 4RWKA 3FMMA 3FZSA 3PWDA 4ZTMA 2R3KA 1BLXA 4BWPA 4BI2A 1ST4A 2R3OA 4KS8A 4AW2A 3RTPA 3Q32A 4TXCA 3SGCA 1OIRA 4FZAB 1F3MC 1R0PA 3TYKA 3CIKA 2A1AB 2F2UA 2XZSA 3CJFA 2QU6A 4G6LA 4XRJA 3U6JA 4GKHA 4I6HA 3R7OA 2QD9A 5DBXA 3D14A 4JDKA 4RC3A 5ANIA 4CFUA 4ENYA 2PVLA 4EUTA 1XKKA 4XYFA 4CV9A 3ELJA 2QG5A 3QD0A 3NVMB 2YLFA 2OJFE 5ANDA 3DFCB 4MK0A 4C0TA 4E3CA 3BGPA 4WOVA 4YUQA 4JDJA 5CEQA 2JDOA 2GCDA 3G15A 3LQ5A 5K4JA 4DHJA 4IWOA 4ACGA 4JAJA 3DKFA 3MH0A 2A19B 2XKEA 4MYGA 3WILA 1J1BA 1YDTE 2OKRA 1JQHA 3HV7A 1UU9A 2G2FA 4FJVA 4YTHA 4OTPA 3OXIA 3CTJA 1Q24A 2I6LA 4CQGA 2GTNA 4ZJIA 4XLVA 3BU6A 2RGPA 3OEZA 3V8TA 3ZO3A 5IQBA 3DTWA 3QD2B 4IMYA 1Q4LA 3FZTA 4X7QA 4AW0A 4J95A 4C58A 2O65A 2R3IA 2QOIA 5IA2A 3FMLA 3ZZWA 4I5CA 2VWVA 4U6RA 5J87A 3DY7A 2VN9A 3GP0A 4KS7A 2F7EE 3LFFA 5CU3A 4MD8E 4D2RA 2YM7A 3BZ3A 4ZSEA 5FP5A 5I0BA 4WUNA 3VRYA 3ATTA 2XM9A 2X8EA 3VRZA 2YIWA 3OY1A 4U3YA 3LFSA 3TKUA 1H24A 4QP6A 3IOKA 4LUDA 2GNIA 4BICA 5HVYA 1E9HA 2X8IA 3UOHA 5H8GA 4FF8A 4FL3A 5HU9A 2HK5A 4FV7A 2W1CA 4MWIA 4FTNA 3TT0A 5KUPA 3IS5A 3ZCLA 3ZXTA 1E1XA 1NVQA 2F57A 3O0GA 2PVJA 4GJ3A 2PUPA 3GI3A 3R7EA 1PXOA 4R6VA 3VS1A 1KE8A 4Z3VA 4BGHA 3VHKA 3OWKA 2H6DA 3CLYA 4FNZA 3TZMA 5JFXA 3QHRA 5EKOA 1ERKA 3VBQA 5M4IA 3KRXA 4YSJA 3R1YA 5D7AA 1FPUA 4RVKA 2UZUE 4MBLA 3I6UA 4F0IA 4NFMA 4G6NA 4HZRA 3HP2A 4FV3A 3QCYA 4AW5A 3HKOA 4K0YA 2O64A 2B53A 4IB5A 3G2FA 4HCTA 3NUYA 4AUAA 1H1RA 1YDRE 4XG3A 4AFEA 1TQIA 2OG8A 5DN3A 1W2DA 2W1HA 3VUIA 3CTHA 5FEQA 3MFRA 5CF8A 2YISA 3S2PA 2PZYA 3KMUA 4AGDA 5KO1A 2WIPA 3FEGA 4JBQA 1Q41A 1U5RA 2P33A 2BDWA 3O8UA 2I0YA 2V55A 2Y6OA 3P9JA 5EDPA 3Q9YA 3ZRMA 3NSZA 3QC9A 5L4QA 4F6UA 2GNLA 4EJ7A 4F1TA 4PQNA 1WZYA 4RIXA 1JPAA 5AP6A 4PMMA 4E73A 1UWJA 2VRXA 2QR7A 3FAAA 4YC3A 3PFQA 2HXQA 3GUBA 3VBVA 2A0CX 4FKPA 4EONA 2PPQA 3ZZEA 5HO8A 4XP2A 1OBGA 5AUUA 4ZY4A 3EB0A 2C6IA 5EM8A 3VONA 2Q0BA 5AV3A 3TEIA 3KQ7A 5A4CA 5CALA 4G9CA 3FC2A 4FL2A 5A46A 2I7QA 4F9WA 4L42A 2C5VA 5E90A 2PWLA 2R7IA 2XK6A 4GK2A 5IEXA 4J97A 2X6EA 2X7OA 3NFFB 5CENA 4U81A 3SHEA 4OBQA 5BX0A 3FZ1A 3FQHA 1PMUA 2F49A 3MA3A 2JIVA 3H30A 2BFYA 3WOWA 2BR1A 3C4ZA 2HWOA 3ANRA 1HOWA 4WSYA 4YJNA 3SDJA 1CSNA 2YDIA 5F94A 4DEHA 4JX3A 4IVCA 1MP8A 4JQEA 4R3PA 4OUCA 3ZO1A 1ZARA 3A62A 2PVRA 1FGIA 1FVTA 2E9PA 4WO5A 4ENXA 3UC4A 3D7ZA 1G8SA 3ID6C 3CKWA 3MSSA 3V8WA 2C68A 4FT9A 5HBHA 5KBRA 5AV4A 1MUOA 5AAFA 3QYZA 3W1FA 3UMXA 4JG7A 3UZPA 2ITNA 5DFPA 3FLWA 4F6WA 4FZ7A 4TW9A 3B8QA 4FTUA 2GNJA 3M1SA 5GJDA 2RF9A 5J5TA 1TVOA 2OK1A 5L2IA 4MX9A 5CQUA 5CT7A 2LAVA 4EHEA 3M42A 4XCUA 5EQEA 4EZ5A 4B8LA 2ZB1A 4DA5A 1OL2A 3I6WA 5E8UA 4DHZA 4TL0A 3QTSA 2YZLA 3F66A 5CVFA 3G6GA 2GTMA 4C61A 4DFBA 4NJ3A 2W4KA 3F9NA 3QBNA 4FTLA 4FUYA 3UODA 3MS9A 3QTIA 4X2NA 4G6OA 3GT8A 4M14A 3R02A 3OD6X 1SNUA 4RFMA 2OH4A 4NW5A 2VTHA 5K4IA 3ZSGA 2W4JA 4LQMA 4AOJA 3DK3A 3QLFA 4NM3A 2X2MA 4EBWA 2XARA 5K0XA 3P79A 3HUBA 3TZ9A 3VBYA 2JFLA 4FV0A 2B4SB 4G3DA 4Y5QA 5HIDA 3TTIA 4BCFA 4Y85A 3QZIA 3QTXA 3ZTXA 4UXQA 4O27B 4YZNA 4D9UA 1U4DA 4EH7A 3V51A 2QCSA 3Q2MA 2QHNA 4RC4A 3KY2A 5CEPA 4BBFA 4ONAA 5JZNA 5EG3A 5L8KA 2VWYA 4BCJA 3FI4A 3PXKA 4IEBA 5CF5A 3UOJA 1O6KA 4GU6A 4FKLA 4W4YA 3UJGA 3FLYA 4DLJA 3BLRA 2VZ6A 4BCHA 5HNBA 3QKKA 2UVYA 1M17A 4F78A 4D5KA 3UPZA 4QMPA 1I44A 4F70A 4QNAA 3FSFA 4L53A 4JBPA 4TYIA 5FLFA 5DRBA 2X8DA 5I3RA 3DJ5A 3D5WA 1U59A 3F69A 4KIOA 3U8WA 4WUAA 4JG6A 4QT1A 5BVKA 3I81A 2XNGA 2QI8A 5AP2A 2BDJA 5A14A 4FICA 4E5WA 3W0NA 3RPYA 5A6OA 3MWUA 3P86A 2X4FA 4IHPA 4O2PA 3E93A 4EWHA 2QOQA 2VO7A 2CHLA 4FKOA 1PYXA 3NNXA 3ZEWA 4D2SA 2JITA 5EH0A 3THBA 2HXLA 5K0KA 4J96A 4YJTA 4YNOA 2R3PA 3HV3A 4NM0A 3SXRA 2C30A 1H07A 2C3KA 3KU2A 1YI3A 2IVVA 2C5NA 2OO8X 2J90A 3QQLA 1BKXA 2UZEA 4Y46A 3TMOA 3A4PA 1VZOA 2BRMA 5EW9A 3VWAA 4AT3A 2BTSA 4GVAA 2BAKA 2R4BA 4U80A 3GFEA 4D2PA 3NZ0A 4JT3A 4D2VA 4QMZA 2QO7A 5DT0A 4FNWA 2NO3A 5DGZA 2OJ9A 3MA6A 3R2BA 1OIQA 3BWFA 3T3UA 3VW8A 1XR1A 3TUDA 4S34A 5JGDA 5M56A 4AXDA 5LMKA 4IB0A 3GOKA 1R3CA 3PSCA 2GMXA 4C3PA 2V0DA 3TL8A 4EHGA 4CG9A 4TYJA 2FYSA 4MF1A 3WIKA 1DM2A 4C34A 3FI3A 2B9IA 2JDRA 2BZJA 4FSUA 4G3FA 4BYJA 2YJRA 4C33A 5ETAA 1ZZ2A 3EN5A 3RPVA 1GZNA 2UZOA 3DK6A 4J98A 5IA5A 3W0PA 1JAMA 4A4XA 2GHLA 4GIIA 4N4SA 5EW3A 3KKVA 1VYZA 3WZJA 1V0OA 3ZBXA 3ZO2A 4F6SA 4PX6A 5L2QA 3TI1A 2WKMA 4FNYA 4QP7A 3H0ZA 2C5OA 4GKIA 4W8EA 5E8ZA 3Q2JA 4Y72A 4PMTA 3LMIA 3ZLSA 5CU0A 5J1WA 3R73A 3OWJA 3UQFA 3A7FA 3R04A 2PYWA 5GIPE 3UG1A 5EW8A 4DBNA 3GC9A 3BU3A 4FTCA 2HENA 3C4WA 4QPSA 4CFMA 4FVRA 4QMXA 4II5A 3VHEA 3QD4A 5FEEA 4EH4A 3QYWA 3I1AA 2QOLA 1OL7A 4DEIA 4QYHA 3DBFA 3E87A 5DT3A 5LVLA 2VX0A 5EYMA 4GK4A 3EQFA 3F5UA 4EHVA 4LRJA 5HBJA 3ZM9A 4K1BA 3FLQA 4NCTA 4YLJA 4RQKA 3QU0A 4C7TA 4D5HA 2I0VA 1GZKA 2X9FA 3FJQE 3RHKA 3S00A 3QF9A 4G1WA 4GCJA 3CQEA 4I23A 3GNIB 3NPCA 4L68A 4RIYB 3EHAA 4E5AX 5CAQA 2XYNA 4M7IA 3LXLA 2PVYA 3VN9A 4XEYA 2IZRA 1Y8GA 2ZMCA 2XM8A 3L8SA 4WNKA 3T9TA 4A4LA 4A9TA 2PVKA 5IISA 3ORTA 3R1QA 4JDIA 2DWBA 4AT4A 3QRIA 4EH8A 3AGMA 4XP0A 4ANMA 1YVJA 5T6KA 3MH2A 1ZYDA 2E9VA 4U43A 3KC3A 1T45A 4FMQA 4FZFB 2UV2A 4FVQA 5AP1A 2KULA 1WBPA 2HZIA 1OUKA 4MXZA 3W2SA 4I6LA 5E9EA 5D10A 5IG1A 4V04A 1Q3DA 4AF3A 2ZM1A 4RVTA 4UWBA 2PK9A 4JBVA 1KE6A 2HZNA 3PIZA 2W5AA 5KX8A 3U55A 2OU7A 2XEYA 1KOBA 1MQBA 4YHTA 1YOMA 4RJ4A 3EIDA 5AR8A 4DCEA 3QQUA 4NWMA 2R3NA 4XX9A 3HAMA 2Y9QA 1Y91A 4EOPA 4BKZA 2YAKA 4O0XA 3TG1A 4UYNA 4QMLA 3PXYA 5E1EA 2YDKA 3MV5A 1IA8A 2VO6A 3KN6A 5HCYA 4UEUA 5DWRA 4C4EA 4EQMA 4XMOA 2F7ZE 1OBDA 3QTWA 2R3LA 4AA0A 4O7RA 4NJDA 4BFMA 4IAIA 4LRKA 5CEMA 3O5AA 4ZS4A 4QQTA 4IFCA 3FZOA 3W2OA 3SRVA 2ETKA 4MNEB 5LARA 3KMWA 1WBNA 3R01A 4FRFA 4M67A 3FLNC 2CSNA 4FVPA 4FG7A 5K3YA 5CASA 2C47A 1JKKA 4YJOA 2CGXA 2OJJA 3PPZA 4EH2A 2H9VA 4PP7A 2BALA 2XK8A 5AJQA 3WF8A 1SZMA 4BTFA 3OROA 4O0WA 1TZDA 4IAAA 3QCXA 1GZOA 5CNNA 3LCKA 1XH5A 2WMAA 4HYIA 3DBEA 4UB7A 2BVAA 5E1SA 3IECA 4WT6A 4RJ6A 3V6SA 4FTTA 2R3HA 4TPTA 2HWPA 4X2JA 5DE2A 5HD4A 5I9UA 3HV4A 3K2LA 2G1TA 3D5VA 2WMXA 2VTJA 3LE6A 1IAJA 2YERA 4HYSA 3SKCA 4PNIA 3UDBA 3PVGA 5DIAA 2OZOA 3O8TA 1GIJA 1RQQA 4CMTA 4FE2A 4FT0A 2WQOA 1DAWA 4LV7A 3KGAA 2XB7A 4IANA 2CJMA 3GBZA 4USEA 3MVMA 3IQ7A 4UMUA 4J71A 4JR7A 3KK9A 1PF8A 4UMPA 2HELA 5L6WL 1BI7A 5F20A 4K2RA 3GCSA 5HORA 1P4FA 4EL9A 4F63A 2BZKB 4D0XA 3EFWA 3P7CA 3Q96A 4L3LA 3FSKA 4DGGA 4F9YA 3IW4A 4PTEA 2JDTA 3DGKA 4JXFA 1BL6A 2IW8A 3P7AA 3UP7A 3NIZA 1UNLA 4ZIMA 3RBWA 3TUBA 4TY1A 4O83A 2YM3A 4I1ZA 3PXFA 2BRHA 1V0BA 3BYMA 4ZZMA 4BVUA 1OGUA 3R00A 1OECA 2OJGA 4TYHB 1NVSA 5HO6A 3NAYA 2SRCA 3E7VA 3ITZA 2EB2A 3K3JA 3V5TA 3ET7A 2J0KA 4UWYA 2W99B 5J79A 4FL1A 5KCVA 1SM2A 3T9IA 4H1JA 3VF8A 3AT4A 1OKYA 3UQCA 3NMUF 4L45A 4NTSA 5CAUA 2QG7A 2C69A 4R8QA 4O22A 4UN0C 2C5XA 3QCSA 2BUJA 2FB8A 1ZAOA 4XV9A 2CN8A 5EDQA 2IZSA 5ANKA 4FKTA 5DA3A 3I60A 3U9NA 3K5VA 2NRYA 2OI4X 3QL8A 4YHFA 4AXFA 3DDPA 3UMWA 3KXHA 3LMGA 3PJ8A 4UMRA 3OZ6A 3PVBA 3MDYA 4NCTC 4IM3A 4TTHB 2VD5A 4NIFB 3WE8A 2YHVA 5CY3A 3L9NA 1PYEA 5HTIA 3W0QA 5I9VA 3OT3A 4YJQA 2OZAA 2R0UA 5EM5A 4O21A 4FSZA 3VW6A 3ZO4A 4BC6A 3EFLA 3LFQA 4G16A 4QYFA 4TRLA 5TR6A 2IVUA 3NCZA 3V5WA 4O7YA 4GT4A 2JKMA 4RBLA 2BZIB 2O63A 1K9AA 4RLLA 5IKWA 5I5ZA 3R7UA 4C37A 5LCJA 3BL7A 3IDBA 4FV9A 2VTRA 3RAHA 4IB1A 3LLAA 3JVSA 5CANA 3PJCA 4QTEA 4HGLA 3KULA 1JLUE 3TNWA 4IC7A 3PE1A 5DPVA 3GU5A 2IJMA 4IADA 3IW6A 3DQXA 4DHIB 3R83A 4J53A 2OW3A 1OPLA 5BVEA 1B38A 5F1ZA 4AWIA 2XJ0A 1JKTA 2JAVA 3GC8A 4ZY6A 2JDVA 4WRSA 4N57A 4DEAA 2BKZA 4WRGA 4X3FB 3SQQA 3W0MA 3Q9WA 3NUPA 4WBOA 4FYNA 4IM0A 4MBIA 4IC8A 4IZ5A 3C50A 2YZAA 2A2AA 2OFUA 2WOTA 4MD7E 1H0VA 4JJRA 4OR5A 4I4FA 4RJ5A 5DEYA 4O7LA 2W96B 3FV8A 3BYVA 4FIIA 4EQCA 4C2WA 1J7IA 5FXRA 2WO6A 3SOCA 2Z60A 2ITOA 3ZHPC 4F08A 4YU2A 1CDKA 1MQ4A 4O4DA 3WBLA 4CLIA 3ODYX 1VYWA 4DAWA 4ZJJA 4PL3A 5AADA 5I9XA 4CEGA 2PVHA 2UW5A 3Q5IA 4H3PA 3SV0A 2XANA 3RNIA 2IN6A 1TQPA 2OXDA 4LL0A 4BTKA 4P90A 5AMNA 4R7IA 4BB4A 4CT2A 4QQJA 2BIKB 1NT2A 4RSSA 3HRBA 4YGAA 5TKDA 3R7GA 3OCSA 5EK7A 1B39A 2XEZA 2XK9A 3RM6A 4C4IA 4E5BA 2C1AA 4GEOA 3PUFC 4OGRA 4BWKA 4L7SA 3CGOA 5KZIA 1K2PA 1JSVA 3RPSA 3ORIA 4AP7A 5FXQA 5KBQA 4ZSAA 3DXNA 2VTMA 3ERKA 3CJGA 5HLPA 5IQIA 5BUEA 4FKVA 2BROA 4BCOA 4EOOA 4GT3A 2VTSA 4M8TA 3WZKA 4CKRA 3BE2A 3ZLWA 2R3RA 1YWVA 2WXVA 3JVRA 3HMOA 2XALA 2X1NA 4NM5A 3TJCA 1R39A 2WMQA 4MD9E 2Z7LA 5LVPA 3GCVA 1WMKA 2ZM4A 5EHYA 4BKYA 4EK5A 3TN8A 4ACCA 2XIXA 4NFNA 4I20A 2HW7A 5L6OA 2RL5A 3W55A 3FWQA 2GQRA 1PXPA 3HVCA 4C4FA 3C4XA 1QPDA 3CEKA