4TWNA

Human epha3 kinase domain in complex with birb796
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
297
structure length
276
Chain Sequence
TVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of the Binding of Type I, I1/2, and II Inhibitors to Eph Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 3
total genus 96
structure length 276
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4twnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4twnA01
3MY1A 1PJKA 3DKFA 3FEGA 3JUHA 4D4RA 4HZRA 3L9MA 4CV9A 4XX9A 3VQHA 5LWMA 3QUDA 3NYNA 5DR9A 3ORMA 4MXOA 3C4XA 3DDQA 3MY5A 3R7GA 2W1DA 3AT2A 5LARA 3R7YA 3WZJA 3WZDA 3CSVA 3CD8A 4JG7A 5DEWA 3SW7A 4ZSLA 3LXPA 4M12A 3TG1A 4BKYA 4S31A 5K9IA 4C37A 4E26A 3S4QA 5AMNA 5JN2A 3SG8A 4XP2A 3QX2A 3KY2A 3FQHA 1OPLA 3NR9A 2PZYA 5EM6A 1Q24A 5LMBA 4HVDA 4WD5A 4G9CA 3MI9A 5F20A 2FUMA 2R7BA 5A14A 3MS9A 1U5QA 2R3FA 5CAOA 4K8AA 4ZLOA 3VHKA 4A9UA 2HWOA 4TYHB 3PYYA 4CKRA 2XJ2A 4U3YA 2IVSA 3K5VA 3KXNA 3TNPC 3HYHA 3KRXA 4QYYA 5DI1A 2A1AB 3R7OA 3NUXA 4ZY4A 3SC1A 4YBKA 3UGCA 4BCQA 5J7BA 2KULA 3NCGA 3D5XA 4EH2A 3O71A 4WNKA 4GT4A 4ZTSA 2BKZA 2BZHB 4FK3A 1ZWSA 3UNJA 4GVAA 5CXHA 4EOJA 3IONA 4TWOA 3WZKA 4QTBA 2VTQA 4TKSA 2BPMA 1JSUA 3QQKA 5ETAA 5KO1A 2PHKA 1WFCA 2W9FB 2C6OA 4H3PA 4O7SA 2H8HA 4XHKB 4RJ8A 1QMZA 2QVSE 3DXPA 2XCKA 3OOMA 3M2WA 3ACJA 1Q3DA 2C30A 2YITA 4I6FA 4U3ZA 5E8YA 4CLJA 5DA3A 2JC6A 3OZ6A 1M7QA 2RF9A 3SXFA 3IGGA 2JDSA 4HPTE 4I92A 2YEXA 5BVWA 3F5XA 2WQNA 3HAMA 4KB8A 3PPKA 1WBNA 4HCVA 4MF0A 3LE6A 2JLDA 1Q8ZA 5AP3A 3QKMA 2GPHA 2QQ7A 5J9ZA 2J0MB 3KXGA 2XA4A 4MK0A 4JR3A 1SNUA 3MFRA 4QMYA 4ALWA 4FR4A 5CWZA 2BDWA 5FEDA 3R9DA 1YDSE 3IG7A 4JI9A 4JBVA 2UZEA 3WOWA 4XV1A 2WXVA 3ATTA 5I0BA 3LXKA 3BE2A 5BYZA 4EYMA 5D1JA 3LFDA 3BGZA 4C4EA 2JKMA 4AFEA 1F0QA 2GHMA 2NO3A 4R3RA 3O17A 4EZ5A 3Q9WA 1Q8YA 1JNKA 1DAWA 4PUZA 1REKA 5AX3A 2IZTA 2WQMA 1YXVA 2Z7SA 3DNDA 4YLLA 4D2TA 4YO4A 4YJTA 5CALA 3KQ7A 3TJDA 2GNFA 1O6YA 3DFAA 2OLCA 3OMVA 2W5AA 4FKJA 4D2WA 5IZFA 4PP9A 3FJQE 3ULZA 4PV0A 3GU5A 3QKKA 5A3XA 1H08A 4F6UA 4JDJA 2P0CA 3ZEWA 2AC5A 3FMJA 4MBLA 2O8YA 3FI3A 5LVMA 1LEWA 4AN3A 1ATPE 3FLYA 5AAEA 4EK3A 3C4CA 4W9XA 3QHWA 5DOSA 5KNJA 2UVZA 5DWRA 3R0TA 5C27A 4Z16A 5G6VA 5IUIA 2C1AA 1BI7A 4QMSA 4MD8E 4QMZA 4O0YA 5AUTA 3HNGA 2VTIA 2ZJWA 3GCQA 5HCYA 4F9BA 2Z02A 4U45A 3E8EA 4HYUA 5FXQA 5EW8A 5C8KA 4GIHA 4L01A 4CRSA 4PMPA 1SVGA 5D9HA 5ITAA 3R7UA 5AUZA 4CEGA 3FZOA 2I7QA 2HXQA 2E2BA 1P5EA 2IO6A 3FMEA 4OLIA 4Y5QA 3WZUA 4BYJA 3A7IA 3RM7A 3ORNA 2C47A 4EYJA 3RVGA 4FT9A 3V04A 1PF8A 3BV3A 4HNFA 4LUEA 4ZZOA 5GIOE 1YHVA 5FEQA 2JD5A 3FLNC 4CFVA 5CZIA 3NW7A 3RPYA 4L9IA 4BDJA 4R78A 1KUTA 2NRYA 1GIHA 3TWJA 2XJ1A 4FTRA 4XP3A 3ZDUA 1JAMA 2WMXA 2XIRA 3EKKA 2GU8A 3ZSIA 4BKZA 1PXKA 1I44A 3DLZA 3QRUA 4CFNA 4DLJA 5H9BA 5EQEA 2OSCA 5CQUA 3UQCA 4NW6A 2XBJA 4EOOA 4F65A 3UIMA 4BTMA 3L8SA 4PY1A 1DI9A 4X3FB 3U55A 2E9UA 5EDQA 1Z5MA 4FTAA 2OBJA 1YWRA 1JQHA 2QG7A 3CE3A 5EK7A 2UUEA 3VVHA 2O2UA 3QCSA 5BNJA 2FSMX 4NM3A 1VJYA 2QCSA 4JX7A 3Q6WA 4BCMA 1DI8A 1ZOHA 3GBZA 4XG6A 5KMNA 2O3PA 4R7IA 3GP0A 3ZO1A 5HGIA 2VNYA 3KN6A 4IFCA 4BN1A 4YZMA 4FZFB 4YTFA 4ACDA 3UZPA 2C6TA 3LHJA 4ZTNA 4QNAA 3KK9A 3RKBA 4XH6A 1ZZ2A 3Q96A 3F3UA 4AOJA 2GHLA 2JBPA 2B0QA 2F7EE 3IECA 1BX6A 4YJRA 3FKOA 5HESA 1XJDA 2YCRA 5JFSA 2X4ZA 2ZM1A 3O50A 3UNZA 5BVKA 4DLIA 3VS7A 2QC6A 3BU3A 3PXYA 5HG7A 2QI8A 1TQMA 5LMAA 3R8UA 4RWKA 3DLSA 4G3FA 4BWXA 3OCBA 5LCJA 4TNBA 1UU9A 3RHXA 3D15A 3MH3A 4EH7A 4EQCA 3P5KA 5LOHA 1V0PA 4AT4A 4A9RA 2PMOX 3PVGA 4FTCA 3FQSA 5CX9A 4IDTA 4V05A 2B9JA 5GNKA 4S30A 2CNQA 2QLQA 4JR7A 3D14A 2NNWB 4QOXA 5ANIA 5BYLA 2R4BA 3OG7A 2XRUA 3UZTA 4Z7GA 4TY1A 4AA4A 4KS7A 3RI1A 4U79A 4LL5A 2J5FA 2OXDA 3CR0A 4L45A 5E8UA 3CLYA 1XQZA 3ZOSA 4C36A 2ITYA 4F09A 4FTOA 1WMKA 4FGBA 4PNIA 2X8IA 3DK7A 3QC9A 1PW2A 3MW1A 5IQGA 4HNIA 3SQQA 3RTPA 1FVRA 3RINA 3PVUA 4PPAA 3A7GA 5CU4A 1FINA 5J87A 3WIKA 1WBWA 3CPBA 4C38A 3O7LD 4KINA 4AG8A 4MQ2A 1WBOA 4XYFA 2C3IB 2XK6A 3MIYA 3PSDA 4UYNA 5A4QA 4O7LA 1R39A 3DBCA 5EQYA 3LMHA 3MFSA 3MDYA 3OXZA 3KULB 4FSZA 3VBTA 1QPJA 3DY7A 4B8MA 3DCVA 1OPJA 1H24A 5CT7A 5CVHA 5HE1A 4EOQA 3CTQA 3PWDA 3QXOA 3QKLA 3SX9A 4D2PA 2REIA 4XG2A 4TYHA 5AP6A 3IW4A 3OROA 4USEA 4OTGA 3UIBA 2Q0BA 4PRJA 4E5BA 4E6QA 3NZ0A 1WAKA 2AYPA 2XIXA 4MXYA 1OKYA 3EZRA 4JNWA 3P79A 3UYTA 1APME 2OH0E 5DR2A 4HGSA 1B39A 3FC2A 4CMUA 1PY5A 2A4LA 4G1WA 5F94A 4MQ1A 3UO4A 3UNKA 4FG8A 5HCZA 2BVAA 2R0UA 3FMLA 4UWYA 4BDCA 1P4OA 4MBIA 2VN9A 4FNXA 2VTRA 3DTCA 4FYNA 2P3GX 1ZYJA 4XLIA 4FF8A 2OJIA 4RVKA 2XKEA 4BI1A 3UPXA 2J0LA 2XEYA 2DS1A 3PRIA 5GHVA 4AGWA 4TYGA 2R3OA 4V01A 3QL8A 4DH5A 3VAPA 4Z7HA 5M4CA 2Y9QA 4D4YA 4O38A 2V7OA 2VX3A 2GTNA 1F5QA 4FC0A 4QMUA 5B0XA 4MWIA 4FTQA 4IWOA 4XEYA 1SMHA 4YPDA 4AT5A 2ITXA 3KVWA 5HNGA 4L3LA 5HNIX 2HENA 2WQOA 3C0IA 4O86A 1KE8A 3PE1A 3QD4A 4XG8A 4FZ6A 1OIUA 5EH0A 2ETRA 5GJDA 3PWYA 1VYZA 3FKLA 4FKGA 4YBJA 4RJ5A 4UZDA 1LPUA 3EB0A 4NM7A 4AP7A 2I0YA 3FXWA 4W9WA 5AR7A 4ZEGA 5HTBA 1OL7A 2PY3A 4U81A 3ZRMA 3HV7A 5KBRA 3A99A 1PXLA 2YM3A 4FV0A 2BHHA 5FTQA 4U0IA 5CAVA 3R02A 4BDEA 1LEZA 4D1SA 3COIA 2B4SB 5FUTA 2A19B 1DS5A 3FKNA 1UV5A 5CU6A 1KE5A 2GQGA 3VUIA 4YTIA 3EKNA 4IH8A 5FBNC 2IVTA 3Q4ZA 4P5ZA 3AG9A 3ZBXA 4QMPA 4KABA 3EL8A 4DFNA 4GL9A 3H10A 3UVRA 4ASXA 4NM0A 2QU5A 3SAYA 2Q0NA 3T8OA 2OJFE 4O96A 4ANBA 1KOBA 2UZUE 1XBAA 2J90A 3ZUVA 1FGKA 3TJCA 5A6NA 2IN6A 5ACBC 5H8BA 3KRWA 4CKJA 4XG4A 3U8WA 3DPKA 4G3CA 4NKSA 3UJGA 3O2MA 3PVWA 4NCTA 1H0VA 1YDTE 4RQVA 3R01A 4WA9A 3V01A 4EH5A 3IW6A 3VRZA 2HZ4A 4JG6A 4D28A 1S9IA 3GI3A 3C4EA 3ZLXA 3WILA 4L43A 5C26A 3MJ2A 4IQ6A 1Q41A 4AX8A 3FMKA 4QPSA 4O81A 2F4JA 2XF0A 3MJ1A 5FDXA 4F0IA 3CTJA 5DGZA 2ONLA 2XB7A 3A62A 1Q8WA 4NIFB 4C4IA 1J1BA 3WARA 3C1XA 3GU7A 4MWHA 3KL8A 2R9SA 4EQUA 3CY2A 1OKWA 1H1WA 2W17A 4BVUA 5CF8A 1WZYA 4NCTC 2B7AA 2ITTA 4FIEA 5DIAA 4AE6A 4EHZA 4F6WA 3UMXA 5HU9A 3A61A 3SHEA 4YZNA 4NFNA 5LQFA 5DFPA 3TZ9A 3GQLA 3GOPA 3Q2MA 4EOLA 2PZ5A 5CTPA 4FKUA 3ZC6A 4EWHA 4M3QA 1O9UA 2F2UA 1PYEA 2WMUA 4IAZA 3GC7A 4I6BA 5HCXA 4M14A 3RHKA 3C5UA 2O0UA 4HVGA 1U54A 3FI2A 4AUAA 3OY1A 2JAVA 2CKPA 2GTMA 2CGXA 3EOCA 2BIKB 1Q97A 1BUHA 2AUHA 3ORLA 2C5XA 2BALA 3FE3A 2QOQA 4DG3E 4HVHA 5J5SA 3DJ5A 3HVCA 3Q9ZA 2F7XE 2OIQA 1E9HA 4IZ7A 2PUUA 4Y72A 1ZYDA 2XNBA 2UZBA 4U9AA 4XG3A 1URCA 5AA8A 4QMMA 4C2WA 3MSSA 3UP2A 1V0OA 4KIOA 4M0YA 2NRUA 3ZMMA 2KTYA 1Y57A 3PXZA 3FYJX 2HAKA 4APCA 5HIBA 5BVNA 5ANDA 3I4BA 1A06A 3OW3A 4GT3A 4QYEA 2XKDA 3NUYA 3UQGA 2IWIA 2EB3A 2X0GA 3R1NA 4RIWA 5IEVA 2PYWA 2W1EA 3BZ3A 1TKIA 4FVPA 4BFMA 2R5TA 3U4UA 1G5SA 1WVYA 4FUYA 4UMQA 4ZSEA 4BICA 1GZOA 4QMXA 1ZY5A 3RM6A 3R2BA 2XIYA 2E9VA 4UXQA 5H3QA 4O6LA 2YLEA 2VTHA 3SOAA 4YSJA 2JFMA 4IM2A 4KBCA 4E1ZA 4DE4A 4JL9A 2UZNA 1T46A 2W7XA 3GT8A 3I1AA 3LFEA 5EM7A 2C6DA 3M11A 3Q52A 4ZLYA 4RT7A 4KWPA 1FOTA 5H2UA 4R1YA 4C33A 2ZDTA 1PHKA 4UY9A 2R3NA 3NYXA 3KXMA 3D0EA 2XIZA 2P4IA 2WO6A 3SVVA 4ZOGA 4FZAB 2J51A 4RPVA 4EJNA 1ND4A 5GINE 3RAHA 2IW6A 3H3CA 4F7SA 3C51A 4LFIA 3ZLSA 2R3MA 2UW4A 5J9YA 3E62A 3MVJA 4W8EA 3P4KA 1U59A 4USDA 4RLKA 2I40A 3Q2JA 2ERKA 2XNNA 3DKOA 3TIYA 3BHUA 4X3FC 3TDVA 3DTWA 2YHVA 3GC9A 1E1XA 3AGLA 4MH7A 3IOPA 5I9WA 3QWJA 4FTTA 3CKXA 5EQPA 2WPAA 4O2ZA 3OT8A 4IXPA 4EH9A 5HIEA 1Q99A 2RGPA 4ID7A 1UU7A 3VBXA 1BYGA 4FKTA 3C4FA 4GU9A 4IWDA 4FTIA 3BX5A 3WZEA 3MTFA 4YZ9A 5T6KA 2UW0A 4PNKA 3G2FA 5LJJA 4A4OA 2X6DA 4HVIA 4AOIA 3VJNA 2FYSA 5LCKA 3SV0A 4KNBA 3RNIA 5K0XA 2ZV2A 3F3ZA 1VZOA 2HY0A 2AC3A 2XK7A 4FK6A 4GYGA 4IAYA 2BZKB 3W18A 4D4SA 5BUJA 2ZMCA 4U8ZA 5A4LA 4QQ5A 1YDRE 3AMBA 2F2CB 3JVRA 3QZFA 4JS8A 5HO6A 3UTOA 4E7WA 4PDYA 4JQEA 3ANRA 3DBEA 4IADA 4IVCA 5A4EA 3OT3A 2YJRA 4FOBA 3RBWA 2HIWA 3N51A 4ZTRA 2J50A 3IDPA 3FLSA 4CD0A 4HYHA 5IUHA 3FMDA 3GGFA 3SKCA 4L7SA 3FPQA 3KF4A 2YIWA 5K5XA 1PYXA 4A9TA 3WBLA 4IX3A 4BGQA 3GNIB 4IWQA 4C3FA 2C3LA 3CD3A 1XH4A 2VWXA 5AP7A 4IMYA 4X3JA 5IA3A 4IC7A 3EIDA 3SA0A 2XKCA 4AGDA 3N4UA 4J71A 5CEMA 2F7ZE 3LMGA 2B1PA 5FWKK 5IH5A 3VBQA 4U80A 1VYWA 3HA6A 1BL7A 1QCFA 4D1ZA 4AZTA 4CXAA 1NVQA 4BCKA 3E7VA 4IAAA 5IQAA 3HV4A 3ORIA 4WBBB 2Y4IC 3LVPA 1OIYA 3R9OA 4Y85A 4BCJA 1MRVA 1J7IA 2XYUA 2ITWA 4XV2A 5AM6A 4ZK5A 4QMWA 3MPAA 3R7VA 2VTOA 3V51A 3DJ6A 4QMQA 1Y6AA 5KHWA 5IA1A 4O83A 3KB7A 1PMVA 1NXKA 2VTLA 3ACKA 1KE9A 3O7LB 4FV9A 5D12A 5ETIA 4BTKA 5I9ZA 4UV0A 4ZMEA 4RX8A 4F0GA 4GRBA 4R7BA 3OWLA 4LRJA 2ZB1A 3RK9A 4IVBA 2ZV9A 4HOKA 4AACA 4IJ9A 1YKRA 2VU3A 5IMEA 3HGKA 3R71A 3KEXA 4ZY6A 2Q83A 5AWMA 5HO8A 3S2PA 3ODYX 3I79A 2ZYBA 3DU8A 5D7AA 3D83A 4OTIA 2YFXA 2CCHA 5IF1A 1MUOA 3EQHA 5CASA 1W8CA 4FNYA 4BCGA 4BL1A 2BRBA 3BGQA 4AW2A 4EHEA 1W82A 4R5SA 5BMMA 5FLFA 2XCHA 3PE2A 2WOTA 4UMRA 1U5RA 5IQIA 4L3JA 4LOPA 3ZYAA 2J0IA 4GK4A 4YJUA 4Q9SA 3V5WA 3F5GA 3KA0A 2RIOA 1KOAA 4DG0E 2ONLC 5L8KA 3ZLWA 3KFAA 4FKPA 4YJOA 5AV0A 3ZXTA 2GCDA 5J5TA 2C4GA 4Q9ZA 4CTCA 3DB8A 1IAJA 3GCUA 2QOHA 2XNOA 5IQDA 2CJMA 2R3JA 2VX0A 3WF9A 3G6GA 2C6IA 3EQDA 3HV5A 4RQKA 2J4ZA 3NUUA 4KAOA 1OL6A 3GU4A 3A2CA 4MXXA 5CSVA 3ZHPC 3ATSA 2NP8A 4DN5A 2V55A 4I6HA 4GIIA 4G5PA 1BMKA 4RJ4A 5AR3A 3BI6A 4F9YA 4HPUE 5M51A 4WNOA 3F7ZA 4CZYB 2PULA 3MH1A 3F3WA 3MPTA 4I21A 3QQUA 5CSXA 3CTHA 3NIEA 2PZPA 4IE9A 4E8AA 4YU2A 3GENA 4KIKB 3RWPA 5IISA 1Y6BA 3FSKA 4EORA 4LV8A 1I09A 4MX9A 4XOZA 2VTMA 3ZBFA 4PF4A 3NWWA 4AZFA 3WIGA 5KZIA 4E4MA 5E91A 2JBOA 4Y8DA 4I41A 5IQFA 1DM2A 2W99B 1MP8A 3LKMA 3K54A 1B6CB 3OW4A 3VRYA 4WKQA 3FMNA 3PDTA 4FTNA 5EW3A 5JT2A 1J3HA 5GZ9A 2P33A 3UVPA 3UE4A 4XG9A 3BYSA 4DTBA 4L67A 3QQLA 4DG2E 2R3GA 4F70A 3CQEA 2VWBA 4RLLA 4E6AA 4DC2A 4RJ6A 1TVOA 4PTCA 5B2LA 3DFCB 4PQNA 1GAGA 4LG4A 4YZDA 3DJ7A 2WHBA 2OI4X 4F9CA 4OW8A 1Q62A 1XH5A 4ALUA 1OIRA 5HD4A 4Y46A 3VS6A 5KMOA 3NUSA 5BMSA 3DBFA 3GCSA 2G01A 4AWIA 3H4JA 4ONAA 3VBWA 3D4QA 3MIAA 3VUTA 3F69A 4AU8A 3VUGA 5JZJA 3QTSA 4GFOA 4O22A 4FMQA 4OAUC 3ANQA 1JSVA 3D94A 2WTCA 2PMIA 1BI8A 2C5OA 4FV3A 3DZOA 1CKJA 4XRJA 4YC3A 1XH6A 2P2HA 2W1HA 3DT1A 3MESA 4UMUA 5JGBA 1YI6A 1XHAA 4TYIA 4XUFA 2DQ7X 5DPVA 2QNJA 5JKGA 1YRPA 4PDOA 3CJGA 2Y6MA 3F5UA 3QRJA 3QRTA 5AV1A 4CFXA 3L9NA 3VBVA 4O2PA 4QP2A 2VD5A 4MD9E 4GSBA 4GK3A 4K2RA 4RC2A 5KE0A 5DYJA 3I0OA 5EW9A 3WF7A 1Z9XA 2FB8A 2WTDA 3T3UA 3ZONA 5BVOA 4FTKA 2VAGA 4FKRA 4ZTQA 3SXRA 3EWHA 3V6RA 3FY0A 1OB3A 3OBJA 3TKUA 3LJ0A 3CJFA 3EYGA 3FMHA 3PP0A 3TCPA 5I5ZA 3EFKA 4A4LA 5AR8A 4BZNA 3C9WA 3S95A 5CXZA 2R3HA 2XKFA 5DG5A 1UU8A 1HOWA 2CN5A 2B9FA 2SRCA 5G1XA 2YDJA 4C35A 2QR8A 1MQ4A 4DH1A 5LXMA 3TNHA 4TN6A 2GSFA 5E92A 4DGGA 5IH4A 2OW3A 4CG8A 4M97A 3AGMA 4KBAA 5ANKA 4ARKA 4DEEA 5AUUA 3UO5A 4JQ8A 2Y0AA 3G0EA 1P2AA 3QXPA 5DHJA 3W2QA 3LMIA 1ERKA 5AP2A 5EFQA 1H28A 1YWVA 4EC8A 3OTUA 5ACKA 3HLLA 4F7JA 3QQFA 3E8DA 5KHXA 2XK9A 5C01A 3DAKA 1FMOE 3OCGA 5EHOA 4RA5A 2FGIA 4O0TA 4RIWB 4AN2A 4XJ0A 1OPKA 3C4WA 3OWPA 4J8MA 3W2OA 5AUXA 2XUUA 3R28A 5AR4A 3D7ZA 2XNMA 3HA8A 4TPTA 5CI7A 2BFYA 3E3BX 1UWHA 3ZUTA 5M4IA 2PVNA 4ITJA 5I4NA 3EQCA 3R7EA 2JIUA 4DH7A 3QTQA 4PWNA 4CCUA 3UOLA 5A54A 3S3IA 3H9FA 3LQ5A 3OEFX 3THBA 4B0GA 4G6LA 4OTDA 3BKBA 3O8UA 4HVSA 5L2IA 3U6JA 4IB0A 4FT7A 4L8MA 4QTDA 3D5VA 1YI3A 3MTLA 4YHTA 2OXXA 5C9CA 3FZRA 4IAFA 3ROYA 5BX0A 1UNLA 4NKAA 1ZYLA 5CF5A 2V62A 1CKIA 3BRBA 5L8LA 4CMTA 4ERWA 4C2VA 5DRDA 3G9NA 3PP1A 3EN4A 3VIDA 3UIXA 4OBQA 3F2RA 3O96A 2RFEA 3ZZWA 4CKIA 3VW8A 3NW5A 4KIPA 4ZS4A 2WTWA 3O23A 2X9EA 3V5LA 2HWPA 2O65A 5IQEA 3MFTA 3TV6A 5EOLA 5E90A 3LFBA 2JKQA 2GNHA 3DOGA 1YQJA 2WMBA 4AZEA 3FLWA 4MVFA 3TZ8A 5EI6A 5H8EA 3V8WA 4FKIA 4CFWA 3P0MA 5K4JA 2QD9A 1GZNA 3R73A 4ZJVA 5K4IA 1CSNA 4JDKA 2P2IA 4Q2AA 2C5YA 3NS9A 1PRYA 4D2RA 5I3OA 3GB2A 3QALE 5CVGA 4I0SA 4DF3A 2DUVA 1YI4A 5IH6A 4IHPA 4G3GA 3KMWA 2XNEA 4HW7A 3U6HA 1H1PA 4GK2A 4S2ZA 2ZMDA 4AW0A 3QTIA 2ITPA 2CPKE 3LJ2A 3W10A 3HL7A 4B9DA 4CGAA 2ITZA 3ORPA 3FLQA 2QO7A 4HJOA 4FGRA 5CNNA 3QTWA 1WCCA 4FKSA 1H07A 2CHLA 4I23A 3PPJA 3I5ZA 3U9NA 4UALA 4YLKA 4JRNA 2QOCA 3SDJA 3L8PA 4DFYA 3F6XA 3P08A 5C03A 2PU8A 3QWKA 3OS3A 1OVEA 3C5IA 5E8WA 5JGAA 4O1OA 3UO6A 4FKWA 4CFUA 3EN6A 3ZM9A 3M1SA 4II5A 3OD6X 4LRMA 4EEVA 3AC5A 4DH8A 4WUNA 3UC3A 2GNGA 1YXSA 1H1QA 4X0MA 3ULIA 5EM5A 3KC3A 3O51A 3F3VA 2GFSA 4GKHA 1H01A 2BKKA 3NIZA 2OO8X 3LCDA 4GT5A 1URWA 2W06A 4RRVA 4ZTHA 3MH2A 4KRDA 4RG0A 3ZO2A 2EVAA 3P7AA 2IVVA 4D5KA 5ANJA 5CI6A 3Q4CA 3DV3A 4ACMA 3MVMA 2YCSA 5DE2A 3QU0A 3P7CA 5JH6A 2R3QA 4QP7A 5JZNA 1IA9A 2B53A 2VWVA 4JLCA 3WE4A 2RG6A 5B2KA 4XBUA 2WELA 3E92A 4LOQA 4MBJA 2CDZA 3HDNA 5HI2A 1H00A 5JFVA 3TNQB 3IW5A 4GVJA 3ORTA 2VTPA 4NSTA 2YLFA 4MNEB 3V5PA 5JQ5A 4O7VA 5IQBA 3C50A 4AF3A 1FVTA 5DN3A 4BGHA 4RIXA 3Q32A 2BTRA 4OAVB 3LM5A 4R7HA 4KKGA 4YZBA 4G31A 4CTBA 4UMPA 2BZIB 4BCHA 3TUDA 2FSTX 1XWSA 3QLGA 1OM1A 1R1WA 2BRNA 2VTSA 4UX9A 2O5KA 4NT4A 2OJGA 2ITVA 1UWJA 4F63A 5F1ZA 4FEVA 1SZMA 2X8DA 1PXIA 3G9LX 4V0GB 5CT0A 3IDBA 4FBXA 4RBLA 3HV3A 1IEPA 2R3IA 3NAXA 4RSSA 4EKKA 4RC3A 4Y83A 3BU6A 4PTEA 2OFVA 5CEKA 4DEAA 3PIZA 2OKRA 4BDAA 1OGUA 3VS5A 5DEYA 4EK8A 4P90A 3G6HA 2RFNA 3QFVA 2CGWA 2YDIA 2VTJA 4IB3A 4QNYA 1R3CA 5EI8A 2WMRA 2ZB0A 1Y8GA 4TL0A 4EZ7A 3BIZA 5KCVA 3GEQA 4GG5A 5AX9A 3V6SA 1KV1A 4B6LA 2YM6A 2Y7JA 3L1SA 3MA6A 1SM2A 2GS6A 5FGKA 3U87A 4B7TA 3PZEA 5HG8A 4ZY5A 1FPUA 4G16A 4FNWA 1H25A 3BYMA 2ITNA 4X7QA 3COKA 3EQPA 2G9XA 3A8WA 2ESMA 4M7IA 4RVTA 2G1TA 4LUDA 2HXLA 2VTTA 3POZA 5AFVA 4IVDA 5HOAA 4A9SA 4H1JA 4H36A 4BRXA 4FL2A 5KMIA 4MXCA 5I9XA 2QR7A 1MRYA 2PWLA 3U4WA 4EUTA 3LFCA 3FPMA 3AD6A 3O8TA 3A4OX 1XH7A 4D2SA 5BVDA 5CSPA 3DA6A 1NT2A 4IX6A 4NIFA 5AAFA 2JIVA 2QOKA 3ENMA 5L8JA 3EN9A 3F82A 3Q5ZA 4XG7A 3P1AA 4L46A 3SD0A 4BBFA 4JBQA 3RALA 4BBMA 5AADA 4O21A 5M07A 4IW0A 3QA8A 4FEWA 2DWBA 2XK4A 4M67A 1YXTA 5C8MA 1M2PA 2R3RA 1LUFA 4UWCA 3ZSHA 3T9IA 5ANGA 2O63A 4EHVA 3SRVA 3QGYA 1OECA 4U5JA 3C4ZA 3ET7A 4BR3A 2X1NA 4O6EA 1XBBA 3HRBA 4XP0A 1W0XC 3LFSA 4FEUA 2UVXA 4RZVA 2GNIA 3PFQA 5L2WA 4ZTMA 3LFNA 4V04A 3TKHA 5BVFA 4NZWB 1OBGA 1PXOA 3R8LA 1DAYA 2WOUA 4H39A 4WG5A 1P14A 5IU2A 2OICA 4QT1A 3F7WA 4DEGA 3ZRLA 2J5EA 3IW8A 4PTGA 4RWJA 3QBNA 4NTTA 4PMSA 4AW1A 4BDBA 4C4GA 4YPSA 5HZNA 3DAEA 2Z8CA 3FC1X 2ETKA 1PKDA 4IX4A 3ORZA 2B52A 1J1CA 2CGUA 4NYEA 4IVAA 1ZOGA 4L44A 2CSNA 1YHSA 4W4XA 3ID6C 1WVWA 1WBSA 2ITOA 3BLRA 2BRHA 4OTFA 2BFXA 1S9JA 1A9UA 5AM7A 2X7OA 3RPVA 4C4HA 3QTUA 3CS9A 3ZS5A 5M4FA 4KIKA 1JKLA 1M7NA 5HORA 3UPZA 3E8CA 4YHFA 4XLVA 2VRXA 3TN8A 5IEXA 4TWNA 3BBTB 3HMNA 4EH4A 4EC9A 4BCPA 5IKWA 3BGPA 2UW6A 4K9YA 3BLHA 5A4TA 4NW5A 3W32A 4NM5A 2BILB 3NW6A 4TNDA 3NNWA 3VNTA 4JRVA 2EU9A 3V8TA 4U41A 4EOKA 1ZRZA 4CSVA 1M14A 4IACA 2GQRA 1WBVA 4B99A 1K9AA 1PMNA 4PL5A 4E4XA 3BYVA 2WIHA 2O64A 4KD1A 3KU2A 3AXWA 4OTHA 4ZJIA 3R8MA 2X9FA 4JT3A 3IOKA 2IW8A 3C7QA 4AQCA 3N4TA 4Y95A 5A9UA 2ERZE 4FV6A 2X7GA 3S0OA 1ZYSA 4OR5A 4YHJA 3LZBA 4EBWA 4FV2A 4LM5A 3FZTA 4IDVA 3FXXA 5C1QB 4OGRA 3DZQA 4FIGA 4F1TA 3FL5A 4U44A 3CCNA 2X81A 4RFYA 4E93A 4RIOA 4BDDA 3HECA 4RMZA 2R7IA 3IDCA 2IW9A 4FSYA 3LLTA 5BQ0A 3QHRA 5DMZA 5FRIA 4BYIA 3FZ1A 3TNIA 4TT7A 2VTAA 3RMFA 4CZUA 5HHWA 3EQBA 4YNEA 4IC8A 5E8SA 4TYEA 3QTRA 1BL6A 4JAIA 1GIJA 1U46A 5HVYA 5CVFA 4FSRA 4YP8A 4DFBA 3QX4A 4A4XA 3G33A 5EHLA 4R5YA 3HUCA 3EQGA 4HGTA 3D5WA 5E1SA 5EHYA 2QHNA 1YOLA 3QA0A 1VR2A 4G2FA 2BRGA 3Q4UA 3LQ8A 4FV5A 3KRLA 4WG4A 2I6LA 2CNVA 3NUAA 5HBEA 5K5NA 3TDWA 3AT3A 3BQRA 2IVUA 4R3PA 5TO8A 4QMNA 4MXAA 3OTVA 3KGAA 5D41A 3R9RA 3EMGA 4GH2A 4F7LA 2CKEA 1UU3A 5F9EA 1WVXA 2ZV8A 3QCXA 4FUXA 4I5PA 4OBPA 5FD2A 2UZWE 3JYAA 5LWNA 1CDKA 2WB8A 3ALNA 3RAKA 2HW6A 2PPQA 2XS0A 5L3AA 5M44A 3GU8A 1QPDA 4G17A 4DFZE 2ETMA 4J52A 4WNMA 2CCIA 3I5NA 4JAJA 1OUKA 4FT5A 1J91A 3IW7A 1GIIA 2VWZA 4I22A 4M84A 2ZVAA 3B2WA 4ZS0A 5AUVA 3W2SA 2WMWA 4IM0A 3V5QA 1AGWA 2QO2A 3QGWA 4I24A 1OZ1A 3FHRA 3MB6A 4MTAA 3W2CA 3KREA 3F9NA 2F9GA 1ZMWA 4DEDA 4F0FA 4I0RA 3UYSA 1JKTA 3ZSGA 4CNHA 2EB2A 2PZRA 2WFYA 3BQCA 5CZHA 4UXLA 1OL2A 4ZP5A 1A48A 3EL7A 4RVMA 1PXMA 2HZNA 2XJ0A 3KF7A 4AAAA 4ZZMA 3P86A 3HMMA 2QU6A 4QP8A 3UVQA 3OCSA 3B8QA 4HCUA 4KBKA 4CFFA 5E8VA 4EH8A 3F3TA 1SVHA 3Q60A 4BKJA 2UW7A 4ZAUA 4RIYB 4C7TA 4X2NA 3E3PA 4IZ5A 2W5BA 5DR6A 2QOLA 2VO7A 2W4KA 2YZAA 3WE8A 4C3PA 1PXPA 3E8NA 5J1VA 3QTZA 1CM8A 2PE2A 2ZDUA 2WEVA 5HTCA 4I3ZA 3KRRA 4BHZA 3MVLA 4U97A 2CLXA 4N70A 1QPEA 3E87A 4C3RA 1H1SA 2YM8A 4FVQA 3DK6A 5J95A 3MA3A 4AZVA 4CT2A 3P9JA 3GVUA 4QP9A 4TRLA 1W98A 1W83A 3MY0A 3VWAA 3WF6A 2B55A 4O0VA 3HRCA 3LLAA 3GCVA 2BDFA 4BZOA 4W8DA 3BEAA 2PL0A 4FTJA 4A06A 4LOOA 3NMUF 1OI9A 4PX6A 3CY3A 4LYNA 4DFLA 1MRUA 4L7FA 3P7BA 5TR6A 4EK6A 4FEXA 1QPCA 5ETCA 3VO3A 3G0FA 3EHAA 3EYHA 2W1IA 4XV9A 3RWQA 3MYGA 3AC8A 2YZLA 1YVJA 4AOTA 2OH4A 4CYJA 5EG3A 2OJ9A 2R3KA 4YMJA 2RSVA 3QQJA 3DDPA 4DITA 5FXSA 4TWPA 4UBAA 2PVFA 4I20A 5FDPA 2B54A 5C8NA 3WYYA 3OP5A 2XK8A 5IPJA 2H34A 4ANNA 3BBWA 3RAIA 4APPA 5CENA 2V5QA 3BWJA 3EZVA 4Y5HA 5GJFA 2WMSA 4I4EA 3QUEA 2OZAB 2WGJA 2HELA 4NJDA 4PDSA 3OCTA 5E8XA 2JDOA 4D2VA 3EJ1A 4EK5A 3D5UA 4P4CA 4O0RA 3F66A 3KULA 4I5HA 5HG9A 4DAWA 3CQWA 1ZLTA 3LFQA 3BHHA 1H1RA 2EXMA 5AIKA 5KZ0A 2YIQA 5CQWA 4LV5A 2WMTA 5AUYA 5HEZA 4S34A 3QTXA 5KBQA 1ZMUA 4KKHA 4L68A 4A07A 4D1XA 3HMOA 2Z7RA 3ZO3A 3R22A 4ENYA 3FY2A 3RZBA 1ZZLA 3ENHA 4BDKA 4GU6A 4WT6A 4AE9A 4UZHA 4WG3A 3PXKA 3EQFA 4OBOA 3NPCA 4I5CA 4DTKA 1OUYA 3PY1A 4MKCA 5AIRA 3W33A 5HIDA 4DCEA 3R83A 5JMSA 2BAJA 2C1BA 2E9OA 4A9YA 4LMNA 2GS2A 5EYDA 3W8QA 4AGCA 2JIIA 3GFWA 4GYIA 4DT8A 2VV9A 4KKEA 3W2PA 4XMOA 1GOLA 5GZAA 2HK5A 2HZIA 1B38A 3UIUA 1Q5KA 3AC2A 3IQ7A 1ZMVA 1Q8UA 1IRKA 1ZYCA 3DGKA 3R1SA 2OIBA 2VTNA 2E9PA 4W4WA 2PVMA 3GCPA 1JVPP 3RK7A 4QMOA 4QO9A 3ZC5A 4FIIA 4YJNA 4ZTLA 3VQUA 4H3QA 4BCOA 4YJSA 2GMXA 2LAVA 4IX5A 1OKVA 4ZJJA 4R77A 4OTQA 4OUCA 2YWVA 2G2IA 3LAUA 3QD0A 3NNVA 3U51A 4PL3A 4X2JA 4EONA 3SGCA 4GUBA 4F99A 4YJQA 5BVEA 1M52A 2JEDA 4FEQA 4JXFA 4P2KA 1OIQA 3H9OA 3ERKA 3COMA 3MN3A 3MPMA 3SLSA 5HX8A 2CKQA 2OK1A 3QC4A 3OWKA 3ZH8A 2J6MA 4DGMA 3W2RA 4Z55A 5HLPA 4ZXTA 1RE8A 1J7LA 3EQIA 3I81A 4FTMA 4X21A 3UBDA 4FX3A 4IAKA 3RNYA 5DT3A 2LGCA 5EDPA 3PIXA 2J9MA 5E8TA 4YTCA 4O0WA 1Y91A 3ITZA 3CXWA 3L8XA 3VBYA 3PLAE 4WRSA 1NVRA 1XH8A 2Z60A 3KKVA 4RWLA 1R0EA 4C59A 4F9AA 1O6KA 4JJRA 3BE9A 4GFGA 4IFGA 2BDJA 3ZFMA 4C34A 3ZCLA 5IG1A 3RP9A 2BZJA 2YACA 5JFXA 2IG7A 3RCJA 3A4PA 3NUPA 5I9VA 3PSCA 3TZMA 4O0XA 4EOSA 2J0KA 2JDRA 5HVKA 2WMVA 4NTSA 2EWAA 4FSUA 1UVRA 3AC4A 3H30A 2XZSA 2B9HA 2BROA 4USFA 5HX6A 3E88A 4N4SA 4CMOA 3I0QA 2QG5A 3BELA 5LMKC 3A7JA 4J99A 3A60A 3ZXZA 2QURA 4QMLA 1YOMA 4ALVA 2GNLA 4WBOA 2W4OA 1OKZA 4EJ7A 2BUJA 2C0IA 2R64A 3DAJA 3FYKX 4QRCA 3KVXA 2GFCA 3D2IA 5KUPA 3K3IA 4BC6A 1ZOEA 3HP5A 4EZ3A 3GOKA 5J7HA 5KKRC 3QQGA 1R0PA 5A4CA 1UNHA 5M55A 3R8VA 2A2AA 2ACXA 3PJCA 2XVDA 1UKHA 4KRCA 4F08A 1TQIA 1IAHA 1WBPA 4M69A 5AP0A 4TW9A 3ZO4A 3NVMB 2PMNX 3W16A 3HZTA 2HY81 4RFMA 4K77A 4BIEA 1YXUA 5HE0A 2PVRA 1OL1A 2JKOA 4O84A 4G6NA 5JRQA 3AD5A 4EKLA 4I94A 2HCKA 1R78A 1OBDA 2C5NA 4JVGA 5AP1A 4DYMA 4BDHA 1UNGA 4NUSA 4IBMA 3R9NA 3MBLA 2XYNA 4BGGA 4O7NA 4EH6A 5KMKA 3BCEA 4DH3A 3AC1A 3SXSA 3VUHA 1UA2A 3CKWA 2YM4A 5FTOA 4AFJA 5CEOA 4V0GA 1L8TA 3OWJA 5AAGA 3R1YA 3FLZA 2F49A 2J7TA 3KXZA 4N0SA 4D58A 2G15A 3W8LA 3P23A 4WRGA 5L4QA 3PJ3A 3UMWA 4G34A 5JGDA 4HCTA 4M69B 1WBTA 3QYWA 4C58A 5IDNA 2C6LA 1Q4LA 2X2LA 4F1MA 4OT6A 1H4LA 5FXRA 4FKOA 4ZMFA 5CU3A 3G51A 3FHIA 3QD3A 1CTPE 4MNEA 4ACCA 4O27B 2WIPA 3S1HA 4PPBA 2PZIA 5HNBA 4P7EA 2JFLA 3NAYA 3TIZA 1O6LA 2PVJA 3R00A 4X6QC 2PTKA 2RFDA 3HDMA 3CQUA 4EOIA 1V1KA 2XBAA 3FI8A 4FV4A 2VWIA 4CVAA 2W05A 3Q5IA 5FQDC 4AA0A 4R3CA 4IJPA 4QYHA 2VNWA 4NL0A 3SW4A 2IJMA 4BTJA 4RZWA 4FL3A 4U42A 3AMAA 5CU0A 4S32A 5M56A 1JKSA 3L9PA 4ZSJA 1XR1A 3D2KA 5AUWA 5L2QA 3NCZA 2FSLX 1Q61A 2V22A 3II5A 3PTGA 3Q6UA 5EKOA 1M2QA 3NNUA 4XV3A 3AD4A 4XRLA 2W96B 3CEKA 4FKQA 1KWPA 2GS7A 2WTIA 1ZY4A 3ZU7A 3EFWA 2WNTA 3LXNA 5TF9A 1PKGA 4WHZA 4QPAA 2XIKA 3TKIA 2BCJA 5IQCA 2J2IB 5AV2A 2IPXA 4FA2A 3CP9A 2EXCX 2OG8A 4J97A 1JWHA 2BAKA 3ZEPA 3JXWA 5GIPE 3QZHA 4AA5A 3UC4A 4GMYA 3T9TA 3ZFYA 4G5JA 3W55A 4ITHA 3ALOA 4YJPA 1EH4A 2I0VA 3UG1A 2YJSA 2ZM3A 4K11A 3R1QA 4D9UA 2BMCA 5CAQA 3FZSA 4L42A 4JDHA 5HLWA 2X6EA 2OXYA 2JDTA 3VUKA 3K2LA 3JVSA 5HU3A 1PMEA 2YA9A 2YAKA 3IK3A 4FICA 5M4UA 2OU7A 5JRSA 3FDNA 3PJ2A 3NNXA 4D55A 2OWBA 5BUEA 3OBGA 4J96A 4F4PA 3TM0A 3I6WA 3IS5A 5J9LA 4IZAA 3EN5A 1G3NA 5CSHA 3PA4A 2VZ6A 2IZSA 3H9RA 5CNOA 2CN8A 5ANOA 4PMMA 2X39A 4RGJA 4K6ZA 4NWMA 4EOMA 4L6QA 2Y6OA 5IA2A 4DT9A 1FMKA 5T68A 1YXXA 3FV8A 4XNEA 4C62A 2YABA 2R0IA 4FT3A 3RZFA 3KRJA 3ZRKA 3KMUA 3D9VA 4NK9A 4DA5A 4ANLA 3LCSA 2OZOA 2PVLA 4BDIA 3B8RA 5M09A 2RFSA 1AD5A 1SVEA 3TV7A 4E20A 3PJ8A 5K0KA 4FOCA 4HYSA 3NYVA 4IB1A 5HE3A 3V5TA 3QCQA 2QOOA 4EWQA 4JBOA 3AQVA 1GY3A 2UW5A 5BUIA 4H1MA 4G9RA 4XBRA 5HQ0A 5I3RA 4WSYA 4FSNA 2WQEA 2V7AA 2PVHA 3DQXA 3FZPA 2WQBA 3WYXA 3TUBA 5HLNA 4CQGA 3VC4A 2YISA 3IPHA 3L8VA 3V3VA 3QUPA 3DB6A 4YUQA 2JDVA 4JOAA 3VS0A 4DEHA 5CF4A 2WEIA 3OF0A 2JKKA 2FO0A 4L3PA 1GJOA 2OZAA 3L9LA 1BKXA 1E1VA 2XMYA 4NU1A 5D10A 2HOGA 2V0DA 4FIFA 3QZGA 3HEGA 4XOYA 3ZDIA 2HZ0A 2QOBA 3VULA 1V0BA 4MCVA 3DBDA 3TXOA 4GFMA 2C68A 3T3VA 3HUBA 3NRMA 3R2YA 4U43A 3ZFXA 4CLIA 2CGVA 1HCKA 5LMKA 3PA5A 4QPMA 3MWUA 5AR2A 4DGOA 2C0TA 2VO3A 4EK4A 4O7YA 5J1WA 3LFFA 5CEPA 3GXLA 2W1GA 3BYUA 3VN9A 3R04A 1YHWA 4IM3A 3OC1A 3ROCA 3V5JA 2B9IA 5DT4A 4ASEA 3RCDA 4QQTA 3C13A 2YN8A 4J8NA 3ZLYA 2IZRA 4DCAA 3REPA 3IGOA 3DXQA 3BHYA 3LM0A 1FVVA 4OT5A 4HGEA 4BBEA 4BCIA 2PVKA 3QLFA 4BI0A 3BWFA 4NH1A 1M2RA 3LXLA 4FNZA 1FGIA 4FODA 3K3JA 3FQEA 3MH0A 2WKMA 3UZRA 3IKAA 4L53A 5TOZA 4JG8A 5E9EA 1X8BA 4PPCA 3ZZEA 1H27A 4CRLA 4LMUA 1OL5A 1K3AA 2YERA 3BYOA 3DKGA 3E5AA 3EQRA 3LCOA 4BCFA 3S00A 2WAJA 4DGLC 2X2MA 5M57A 5DRBA 3LPBA 4ZZNA 4Q5HA 5TE0A 1TQPA 4OTWA 4X2KA 3KN5A 3CGOA 3GC0A 4RIYA 3TEIA 2XM9A 4CCBA 3LJ1A 5BYYA 5I9YA 5B2MA 2H9VA 3RPRA 3H0ZA 3PY0A 2OJJA 4EL9A 4JDIA 3FSFA 2CLQA 4PMTA 3MV5A 4Q5EA 3HV6A 4RVLA 4DINA 2H6DA 2YIXA 4GS6A 2C6MA 3R63A 3EH9A 4F64A 4FE2A 3GU6A 3OFMA 1IASA 2WU7A 3PRFA 4M13A 4PL4A 3R9HA 3AC3A 4FIHA 2EXEA 2UW8A 2Y8OA 4Z9LA 5BPYA 5IA5A 3CBLA 3IO7A 3ZUUA 1NA7A 3AOXA 3BEGA 4QD6A 1RJBA 3A8XA 5AP5A 2XNGA 4FSQA 4OTRA 5CAPA 5LVOA 4C4FA 1J7UA 3F5PA 4FTUA 4U40A 5GJGA 3TI1A 4M68A 3FL4A 4GG7A 1YW2A 3OUKA 4K1BA 5CYIA 1GZ8A 2ZOQA 3GQIA 4IEBA 4UYAA 2PK9A 5EYMA 4ITIA 3WF8A 1QL6A 4LGHA 4GV1A 5CAUA 3DBQA 4G3EA 3UQFA 4QTEA 2VUWA 2YAAA 2UVYA 2YCFA 4KSPA 4MD7E 1OITA 1IR3A 3LCTA 5ETFA 4H58A 2J0JA 3R6XA 4ERKA 4BZDA 5A46A 4C61A 2QHMA 2PVYA 5ICPA 2OF4A 4LL0A 3QYZA 1KSWA 2OF2A 3FWQA 1LP4A 3KK8A 3TT0A 2WTKC 3GC8A 4JIKA 4FV1A 3U9CA 4O7TA 4DFUA 2Z2WA 3U54A 3QQHA 3TTJA 3R30A 3VUDA 4BWPA 2JGZA 3KCKA 5FP5A 5CEIA 2GHGA 2RL5A 4QTCA 2BIYA 4QYGA 3Q04A 5EM8A 3UOKA 4EUUA 4F7NA 2C6EA 5KX8A 3VF8A 1RW8A 3C0HA 2W1FA 4YJVA 4QP1A 3RPSA 4U6RA 3U6IA 4RIXB 4WSQA 5IA4A 5E7RA 3G90X 3F88A 3UOJA 3EN7A 4X3FA 5JK3A 4E6CA 4WO5A 2G2HA 3UDBA 2OIDA 1VEBA 1AQ1A 1XO2B 2OFUA 2UZDA 5CY3A 5IQHA 4WNPA 3LQ3A 3DXNA 3PZHA 4M8TA 2VGPA 3JR1A 3BU5A 4FV7A 2I1MA 5ANEA 3JY0A 4IANA 4O91A 2PMLX 4K33A 2PUIA 3O8PA 4D5HA 5J8IA 4RJ7A 4FVRA 4K0YA 4Y73A 1NY3A 5EKNA 3B2TA 4BIDA 4E3CA 1PXNA 1FQ1B 3DS6A 2R3PA 5HKMA 3GUBA 5DLSA 4UMTA 2E9NA 1NW1A 5IEYA 3HMIA 4F9WA 1HCLA 2JITA 5EDRA 2PUPA 4AGUA 3POOA 4YZCA 1H8FA 3PVBA 4ACHA 2XRWA 2UV2A 3ORXA 2RG5A 3PG1A 1M17A 2WMQA 4U7ZA 4LQMA 1PMUA 4MF1A 5CLPA 4D0WA 2YDKA 4O1PA 2XM8A 4W4YA 3OXTA 5CU2A 3OOGA 5FP6A 4AS0A 2Y4PA 4BDFA 1RQQA 4J7BA 4H05A 4YC8A 3FI4A 3ORKA 2ITUA 3QRKA 1BLXA 5L6PA 4FYOA 4FSTA 4IAIA 4QTAA 1JLUE 3MVHA 2A27A 4O0UA 4RJ3A 2ZV7A 4YURA 2IZUA 3OUNB 2XP2A 3VJOA 3P78A 3Q4TA 4ENXA 4M66A 4MEDA 3EFJA 4FL1A 4ZIMA 3D7TA 4BWKA 3HRFA 1ZARA 3LOKA 4RA4A 4DBNA 3SG9A 3Q9YA 5HICA 4F1OA 4D9TA 4GCJA 4MNFA 2UZTA 5JFWA 3QCYA 4GW8A 4O7ZA 3VW6A 3MB7A 5EI2A 4I4FA 2C6KA 5FG8A 3TTIA 3PA3A 4TXCA 1XH9A 2BRMA 4FG9A 3E7OA 4CYIA 3PLSA 4WIHA 2CNUA 3AMYA 2QKRA 4W4VA 3F61A 4AZSA 4XS2A 3ZTXA 2C3KA 2R3LA 3HP2A 2VWUA 3WI6A 4DHFA 2YWPA 4TTHB 3VF9A 4H3BA 3Q9XA 4IZYA 4DBXA 2YIRA 4CZTA 2PUNA 2GQSA 4DTAA 2R2PA 1P4FA 1RDQE 4IWPA 1ZXEA 2XH5A 2BHEA 3VHEA 3VS3A 2W4JA 3OY3A 2F57A 3PIYA 3COHA 2FH9A 4YGAA 4O0SA 2WD1A 5C4LA 4I1ZA 1MQBA 3I60A 2VO6A 5DBXA 2UW9A 2ZAZA 5LVNA 2JAMA 5KMJA 5K3YA 4DEBA 5HTIA 3PY3A 4MHAA 5TKDA 2Y4IB 5AA9A 1LR4A 4KS8A 4RWIA 4TWCA 4K18A 4ZSGA 4HZSA 3UG2A 4BHNA 3FAAA 3OHTA 4B4LA 5AV4A 2CMWA 2HW7A 1ZAOA 2WTJA 3KMMA 1SNXA 4N6ZA 4R1VA 2VX1A 2WTVA 4XCUA 4YO6A 3H0YA 3QRIA 1STCE 3R8ZA 3VS4A 1XKKA 5L2TA 4CQEA 3PSBA 3BHTA 2PE1A 3PJ1A 3W1FA 4JIAA 3PUPA 4QQCA 5CANA 3O0GA 1GZKA 1SYKA 2C5VA 4ACGA 3R7IA 5AV3A 5JEBA 3FXZA 5A6OA 3ZM4A 1JOWB 5M06A 3PG3A 4WOVA 5EYKA 2Z7LA 4NFMA 5E1EA 5TT7A 2HYYA 5HBJA 3SRVB 5HE2A 3QZIA 3RAWA 1JSTA 1OMWA 3KXXA 2QLUA 3ETAA 3ODZX 4G3DA 4GEOA 2FVDA 5HVJA 5JQ8A 2BR1A 3LIJA 4ANOA 4EHGA 4KA3A 4TYJA 4ASDA 3RJCA 3QD2B 1IA8A 4FZ7A 3UOHA 5FBOA 4UWBA 3I7BA 3LFAA 5FM2A 4E5WA 2W9ZB 3ELJA 4FG7A 5L6OA 3MGYA 2H96A 3EFLA 5DT0A 5D11A 4AXAA 4L00A 4YTHA 5DH3A 1YOJA 1FBNA 1U4DA 5DNRA 2UZLA 4NJ3A 5KMMA 4MXZA 4E6DA 4AZWA 4QMTA 3NYOA 5F95A 3NGAA 5HD7A 2G2FA 2YM7A 2QOFA 4GJ3A 3BHVA 3E64A 3FBVA 5J79A 3NVKI 2WTKB 2BAQA 4CFMA 4PP7A 1YWNA 4HGLA 5H8GA 3DQWA 4J53A 3D7TB 2YM5A 2UW3A 5KKRB 4UEUA 1G8AA 4QMVA 3NSZA 2PSQA 3TV4A 4E4LA 1Q3WA 1CMKE 5FM3A 3N4VA 2YCQA 3VS2A 4QYFA 5KMLA 2I0EA 3F2NA 3HAVA 4CT1A 3CIKA 3E93A 4C57A 4O82A 4KSQA 3FMMA 4IB5A 4ANQA 3OEZA 3NLBA 1NVSA 4DFXE 4QP4A 4FTLA 4ASZA 4ORKA 3CC6A 4GJ2A 2GNJA 1K2PA 2X8EA 3TZ7A 3N9XA 4EQMA 1JBPE 4N57A 4I0TA 4S33A 5L6WL 5M53A 2QONA 3V8SA 4RX9A 5JSMA 4QP6A 5L2SA 3JS2A 1XBCA 2I0HA 2Z7QA 5F4NA 4BB4A 4ZLZA 3VUMA 4FKVA 4FT0A 4IIRA 2ZM4A 4X2GA 4PDPA 4FIJA 4GUEA 4KUJA 3JY9A 3R21A 4ANSA 5IDPA 4X6RA 5EYCA 3LW0A 3A7FA 2VWWA 4C0TA 4TZRA 4EBVA 1KE6A 5GZ8A 4DEIA 4E5AX 2QKWB 5LVPA 2EUFB 5EOBA 1U54B 4MAOA 4AT3A 3RGFA 4YLJA 5FTGA 1KV2A 1Z57A 4I6QA 1Y8YA 5IUGA 4FSMA 2FSOX 3OXIA 2W5HA 4FI1A 3CPCA 4ZSAA 4E73A 4EOPA 4R6VA 4C4JA 3TUCA 4J98A 3UP7A 3WF5A 2PE0A 3NUNA 4AW5A 4L52A 1IG1A 4YR8A 4BY9E 2X7FA 3NX8A 5DVRA 4YSMA 5FEEA 5CS6A 2X2KA 4JQ7A 4YC6A 1GNGA 3RPOA 4B8LA 3UODA 2WZJA 3I6UA 3TL8A 4BTFA 2WMAA 4RX5A 3FUPA 2W1CA 2BTSA 1REJA 3LCKA 3Q3BA 1Q8TA 4E4NA 3G15A 4C02A 5CF6A 2UZOA 2XNPA 3MFUA 4LI5A 3AT4A 2RKUA 2XK3A 3BLQA 4DGNA 2ITQA 3QF9A 3Q53A 4BIBA 1L3RE 1T45A 1JPAA 4ANMA 4QQJA 1W84A 3I7CA 4MYGA 3E63A 3A7HA 3BV2A 2YIYA 4UN0C 3G5DA 2VGOA 4P5QA 5AEPA 4N6YA 4FKLA 2QO9A 2VO0A 4QP3A 1H26A 3OVVA 4HYIA 1W7HA 4WUAA 3PXFA 4BF2A 4LGGA 4BDGA 4GKIA 1G8SA 3BPRA 4J1RA 5LVLA 1UKIA 3KCFA 4FZDB 4YNOA 3VS1A 5CEQA 4C8BA 3DK3A 4D4VA 3K5UA 5M08A 3DNEA 3GFEA 3PXQA 2VWYA 3HMPA 5CSWA 5D7VA 1H0WA 5AR5A 3RK5A 3SOCA 3TACA 4EH3A 3CGFA 4M15A 3M42A 4OTPA 4RC4A 4RFZA 5HBHA 3NEWA 4JX3A 4Z3VA 2P55A 2NPQA 2W0JA 3QAME 5AP4A 4KIQA 4D0XA 5HO7A 4LGDA 4O7RA 2WU6A 5IA0A 5E8ZA 5E4HA 3DKCA 3KXHA 5T3QA 2W1ZA 1F3MC 5AJQA 1KE7A 1JKKA 3F2AA 3HX4A 3HKOA 4I93A 4CV8A 2C0OA 4FV8A 4LRKA 3R8PA 3PPZA 2QOIA 3JPVA 4M0ZA 5HG5A 2OGVA 2A0CX 2CKOA 4RX7A 2X4FA 1PXJA 4NEUA 3TNWA 5B7VA 4UB7A 4O7WA 3PXRA 4BI2A 1CKPA 2C3JA 4CG9A 4R8QA 2QODA 3C0GA 4BCNA 2C69A 2FA2A 4AN9A 4F6SA 5C4KA 5I9UA 2XEZA 4FSWA 4X2FA 2UZVA 5IMXA 4I5MA 4G6OA 4EI4A 3NDMA 4J95A 2GDOA 4JBPA 4A7CA 2DYLA
chains in the Genus database with same CATH superfamily
3MY1A 1PJKA 3DKFA 3FEGA 3JUHA 4D4RA 4HZRA 3L9MA 4CV9A 4XX9A 3VQHA 5LWMA 3QUDA 3NYNA 5DR9A 3ORMA 4MXOA 3C4XA 3DDQA 3MY5A 3R7GA 2W1DA 3AT2A 5LARA 3R7YA 3WZJA 3WZDA 3CSVA 3CD8A 4JG7A 5DEWA 3SW7A 4ZSLA 3LXPA 4M12A 3TG1A 4BKYA 4S31A 5K9IA 4C37A 4E26A 3S4QA 3KIOC 5AMNA 5JN2A 3SG8A 4XP2A 3QX2A 4DDIA 3KY2A 3FQHA 1OPLA 3NR9A 2PZYA 5EM6A 1Q24A 5LMBA 4HVDA 4WD5A 4G9CA 3MI9A 5F20A 2FUMA 2R7BA 5A14A 3MS9A 1U5QA 2R3FA 5CAOA 4K8AA 4ZLOA 3VHKA 4A9UA 2HWOA 4TYHB 3PYYA 4CKRA 2XJ2A 4U3YA 2IVSA 3ML1A 3K5VA 3KXNA 3TNPC 3HYHA 3KRXA 4QYYA 5DI1A 2A1AB 3R7OA 3NUXA 4ZY4A 3SC1A 4YBKA 3UGCA 4BCQA 5J7BA 2KULA 3NCGA 3D5XA 4EH2A 3O71A 2X0OA 4GT4A 4WNKA 4ZTSA 2BKZA 2BZHB 4FK3A 1ZWSA 3UNJA 4GVAA 5CXHA 4EOJA 3IONA 4TWOA 3WZKA 4QTBA 2VTQA 4TKSA 2BPMA 1JSUA 3QQKA 5ETAA 5KO1A 2PHKA 1WFCA 2W9FB 2C6OA 4H3PA 4O7SA 2H8HA 4XHKB 4RJ8A 1QMZA 2QVSE 3DXPA 2XCKA 3OOMA 3M2WA 3ACJA 1Q3DA 2C30A 2YITA 4I6FA 4U3ZA 5E8YA 4CLJA 5DA3A 2JC6A 3OZ6A 1M7QA 2RF9A 3SXFA 3IGGA 2JDSA 4HPTE 4I92A 2YEXA 5BVWA 3F5XA 2WQNA 3HAMA 4KB8A 3PPKA 1WBNA 4HCVA 4MF0A 3LE6A 2JLDA 1Q8ZA 5AP3A 3QKMA 2GPHA 2QQ7A 5J9ZA 2J0MB 3KXGA 2XA4A 4MK0A 4JR3A 1SNUA 3MFRA 4QMYA 3W0QA 4ALWA 4FR4A 5CWZA 2BDWA 5FEDA 3R9DA 1YDSE 3IG7A 4JI9A 4JBVA 2UZEA 3WOWA 4XV1A 2WXVA 3ATTA 5I0BA 3LXKA 3BE2A 5BYZA 4EYMA 5D1JA 3LFDA 3BGZA 4C4EA 2JKMA 4AFEA 1F0QA 2GHMA 2NO3A 4R3RA 3O17A 4EZ5A 3Q9WA 1Q8YA 1JNKA 1DAWA 4PUZA 1REKA 5AX3A 2IZTA 2WQMA 1YXVA 2Z7SA 3DNDA 4YLLA 4D2TA 2XAMA 4YO4A 4YJTA 5CALA 3KQ7A 3TJDA 2GNFA 1O6YA 3DFAA 2OLCA 3OMVA 2W5AA 4FKJA 4D2WA 5IZFA 4PP9A 3FJQE 3ULZA 4PV0A 3GU5A 3QKKA 5A3XA 1H08A 4F6UA 4JDJA 2P0CA 3ZEWA 2AC5A 3FMJA 4MBLA 2O8YA 3FI3A 3O5AA 5LVMA 1LEWA 4AN3A 1ATPE 3FLYA 5AAEA 4EK3A 3C4CA 4W9XA 3QHWA 5DOSA 5KNJA 2UVZA 5DWRA 3R0TA 5C27A 4Z16A 5G6VA 5IUIA 2C1AA 1BI7A 4QMSA 4MD8E 4QMZA 4O0YA 5AUTA 3HNGA 2VTIA 2ZJWA 3GCQA 5HCYA 4F9BA 2Z02A 4U45A 3E8EA 4HYUA 5FXQA 5EW8A 5C8KA 4GIHA 4L01A 4CRSA 4PMPA 1SVGA 5D9HA 5ITAA 3R7UA 5AUZA 4CEGA 3FZOA 2I7QA 2HXQA 2E2BA 1P5EA 2IO6A 3FMEA 4OLIA 4Y5QA 3WZUA 4BYJA 3A7IA 3RM7A 3ORNA 2C47A 4EYJA 3RVGA 4FT9A 3V04A 1PF8A 3BV3A 4HNFA 4LUEA 4ZZOA 5GIOE 1YHVA 5FEQA 2JD5A 3FLNC 4CFVA 5CZIA 3NW7A 3RPYA 4L9IA 4BDJA 4R78A 1KUTA 2NRYA 1GIHA 3TWJA 2XJ1A 4FTRA 4XP3A 3ZDUA 1JAMA 2WMXA 4AAYA 2XIRA 3EKKA 2GU8A 3ZSIA 4BKZA 1PXKA 1I44A 3DLZA 3QRUA 4CFNA 4DLJA 5H9BA 5EQEA 2OSCA 5CQUA 3UQCA 4NW6A 2XBJA 4EOOA 4F65A 3UIMA 4BTMA 3L8SA 4PY1A 1DI9A 4X3FB 3U55A 2E9UA 5EDQA 1Z5MA 4FTAA 2OBJA 1YWRA 1JQHA 2QG7A 3CE3A 5EK7A 2UUEA 3VVHA 2O2UA 3QCSA 5BNJA 2FSMX 4NM3A 1VJYA 2QCSA 4JX7A 3Q6WA 4BCMA 1DI8A 1ZOHA 3GBZA 4XG6A 5KMNA 2O3PA 4R7IA 3GP0A 3ZO1A 5HGIA 2VNYA 3KN6A 4IFCA 4BN1A 4YZMA 4FZFB 4YTFA 4ACDA 3UZPA 2C6TA 3LHJA 4ZTNA 4QNAA 3KK9A 4O4FA 3RKBA 4XH6A 1ZZ2A 3Q96A 3F3UA 4AOJA 3W0OA 2GHLA 2JBPA 2B0QA 2F7EE 2XANA 3IECA 1BX6A 4YJRA 3FKOA 5HESA 1XJDA 2YCRA 5JFSA 2X4ZA 2ZM1A 3O50A 3UNZA 5BVKA 4DLIA 3VS7A 2QC6A 3BU3A 3PXYA 5HG7A 2QI8A 1TQMA 5LMAA 3R8UA 4RWKA 3DLSA 4G3FA 4BWXA 3OCBA 5LCJA 4TNBA 1UU9A 3RHXA 3D15A 3MH3A 4EH7A 4EQCA 3P5KA 5LOHA 1V0PA 4AT4A 4A9RA 2PMOX 3PVGA 4FTCA 3FQSA 5CX9A 4IDTA 4V05A 3TMOA 2B9JA 5GNKA 4S30A 2CNQA 2QLQA 4JR7A 3D14A 2NNWB 4QOXA 5ANIA 5BYLA 2R4BA 3OG7A 2XRUA 3UZTA 4Z7GA 4TY1A 4AA4A 4KS7A 3RI1A 4U79A 4LL5A 2J5FA 2OXDA 3CR0A 4L45A 5E8UA 3CLYA 1XQZA 3ZOSA 4C36A 2ITYA 4F09A 4FTOA 1WMKA 4FGBA 4PNIA 2X8IA 3DK7A 3QC9A 1PW2A 3MW1A 5IQGA 4HNIA 3SQQA 3RTPA 1FVRA 3RINA 3PVUA 4PPAA 3A7GA 5CU4A 1FINA 5J87A 3WIKA 1WBWA 3CPBA 4C38A 3O7LD 4KINA 4AG8A 4MQ2A 1WBOA 4XYFA 2C3IB 2XK6A 3MIYA 3PSDA 4UYNA 5A4QA 4O7LA 1R39A 3DBCA 5EQYA 3LMHA 3MFSA 3MDYA 3OXZA 3KULB 4FSZA 3VBTA 1QPJA 3DY7A 4B8MA 3DCVA 1OPJA 1H24A 5CT7A 5CVHA 5HE1A 4EOQA 3CTQA 3PWDA 3QXOA 3QKLA 3SX9A 4D2PA 2REIA 4XG2A 4TYHA 5AP6A 3IW4A 3OROA 4USEA 4OTGA 3UIBA 2Q0BA 4PRJA 5BV3A 4E5BA 4E6QA 3NZ0A 1WAKA 2AYPA 2XIXA 4MXYA 1OKYA 3EZRA 4JNWA 3P79A 3UYTA 1APME 2OH0E 5DR2A 4HGSA 1B39A 3FC2A 4CMUA 1PY5A 2A4LA 4G1WA 5F94A 4MQ1A 3UO4A 3UNKA 2X0QA 4FG8A 5HCZA 2BVAA 2R0UA 3FMLA 4UWYA 4BDCA 1P4OA 4MBIA 2VN9A 4FNXA 2VTRA 3DTCA 4FYNA 2P3GX 4AXCA 1ZYJA 4XLIA 4FF8A 2OJIA 4RVKA 2XKEA 4BI1A 3UPXA 2J0LA 2XEYA 2DS1A 3PRIA 5GHVA 4AGWA 4TYGA 2R3OA 4V01A 3QL8A 4DH5A 3VAPA 4Z7HA 5M4CA 2Y9QA 4D4YA 4O38A 2V7OA 1W2FA 2VX3A 2GTNA 1F5QA 4FC0A 4QMUA 5B0XA 4MWIA 4FTQA 4IWOA 4XEYA 1SMHA 4YPDA 4AT5A 2ITXA 3KVWA 5HNGA 4L3LA 5HNIX 2HENA 2WQOA 3C0IA 4O86A 1KE8A 3PE1A 3QD4A 4XG8A 4FZ6A 1OIUA 5EH0A 2ETRA 5GJDA 3PWYA 1VYZA 3FKLA 4FKGA 4YBJA 4RJ5A 4UZDA 1LPUA 3EB0A 4NM7A 4AP7A 2I0YA 3FXWA 4W9WA 5AR7A 4ZEGA 5HTBA 1OL7A 2PY3A 4U81A 3ZRMA 3HV7A 5KBRA 3A99A 1PXLA 2YM3A 4FV0A 2BHHA 5FTQA 4U0IA 5CAVA 3R02A 4BDEA 1LEZA 4D1SA 3COIA 2B4SB 5FUTA 2A19B 1DS5A 3FKNA 1UV5A 5CU6A 1KE5A 1W2CA 2GQGA 4YTIA 3VUIA 3EKNA 4IH8A 5FBNC 2IVTA 3Q4ZA 4P5ZA 3AG9A 3ZBXA 4QMPA 4KABA 3EL8A 4DFNA 4GL9A 3H10A 3UVRA 4ASXA 4NM0A 2QU5A 3SAYA 2Q0NA 3T8OA 2OJFE 4O96A 4ANBA 1KOBA 2UZUE 1XBAA 2J90A 3ZUVA 3PFYA 1FGKA 3TJCA 5A6NA 2IN6A 5ACBC 2AEGA 5H8BA 3KRWA 4CKJA 4XG4A 3U8WA 3DPKA 4G3CA 4NKSA 3UJGA 3O2MA 3PVWA 4NCTA 1H0VA 1YDTE 4RQVA 3R01A 4WA9A 3V01A 4EH5A 3IW6A 3VRZA 2HZ4A 4JG6A 4D28A 1S9IA 3GI3A 3C4EA 3ZLXA 3WILA 4L43A 5C26A 3MJ2A 4IQ6A 1Q41A 4AX8A 1XMMA 3FMKA 4QPSA 3UDSA 4O81A 2F4JA 2XF0A 3MJ1A 5FDXA 4F0IA 3CTJA 5DGZA 2ONLA 2XB7A 3A62A 1Q8WA 4NIFB 4C4IA 1J1BA 3WARA 3C1XA 3GU7A 4MWHA 3KL8A 2R9SA 4EQUA 3CY2A 1OKWA 1H1WA 2W17A 4BVUA 5CF8A 1WZYA 4NCTC 2B7AA 2ITTA 4FIEA 5DIAA 4AE6A 4EHZA 4F6WA 3UMXA 3NFGB 5HU9A 3A61A 3SHEA 4YZNA 4NFNA 5LQFA 5DFPA 3TZ9A 3GQLA 3GOPA 3Q2MA 4EOLA 2PZ5A 5CTPA 4FKUA 3ZC6A 4EWHA 4M3QA 1O9UA 2F2UA 1PYEA 2WMUA 4IAZA 3GC7A 4I6BA 5HCXA 4M14A 3RHKA 3C5UA 2O0UA 4HVGA 1U54A 3FI2A 4AUAA 3OY1A 2JAVA 2CKPA 2GTMA 2CGXA 3EOCA 2BIKB 1Q97A 1BUHA 2AUHA 3ORLA 2C5XA 2BALA 3FE3A 2QOQA 4DG3E 4HVHA 5J5SA 3DJ5A 3P5JC 3HVCA 3Q9ZA 2F7XE 2OIQA 1E9HA 4IZ7A 2PUUA 4Y72A 1ZYDA 2XNBA 2UZBA 4U9AA 4XG3A 1URCA 5AA8A 4QMMA 4C2WA 3MSSA 3UP2A 1V0OA 4KIOA 4M0YA 2NRUA 3ZMMA 2KTYA 1Y57A 3PXZA 4BJJB 3FYJX 2HAKA 4APCA 5HIBA 5BVNA 5ANDA 3I4BA 1A06A 3OW3A 4GT3A 4QYEA 2XKDA 3NUYA 3UQGA 2IWIA 2EB3A 2X0GA 3R1NA 4RIWA 5IEVA 2PYWA 2W1EA 3BZ3A 1TKIA 4FVPA 4BFMA 2R5TA 3U4UA 1G5SA 1WVYA 4FUYA 4UMQA 4ZSEA 4BICA 1GZOA 4QMXA 1ZY5A 3RM6A 3R2BA 2XIYA 2E9VA 4UXQA 5H3QA 4O6LA 2YLEA 2VTHA 3SOAA 4YSJA 2JFMA 4IM2A 4KBCA 4E1ZA 4DE4A 4JL9A 2UZNA 1T46A 2W7XA 3GT8A 3I1AA 3LFEA 5EM7A 2C6DA 3M11A 3Q52A 4ZLYA 4RT7A 4KWPA 1FOTA 5H2UA 4R1YA 4C33A 2ZDTA 1PHKA 4UY9A 2R3NA 3NYXA 3KXMA 3D0EA 2XIZA 2P4IA 2WO6A 3SVVA 4ZOGA 4FZAB 2J51A 4RPVA 4EJNA 1ND4A 5GINE 3RAHA 2IW6A 3H3CA 4F7SA 3C51A 4LFIA 3ZLSA 2R3MA 2UW4A 5J9YA 3E62A 3MVJA 4W8EA 3P4KA 1U59A 4USDA 4RLKA 2I40A 3Q2JA 2ERKA 2XNNA 3DKOA 3TIYA 3BHUA 4X3FC 3TDVA 3DTWA 2YHVA 3GC9A 1E1XA 3AGLA 4MH7A 3IOPA 5I9WA 3QWJA 4FTTA 3CKXA 5EQPA 2WPAA 4O2ZA 3OT8A 4IXPA 4EH9A 5HIEA 1Q99A 2RGPA 4ID7A 1UU7A 3VBXA 1BYGA 4FKTA 3C4FA 4GU9A 4IWDA 4FTIA 3BX5A 3WZEA 3MTFA 4YZ9A 5T6KA 2UW0A 4PNKA 3G2FA 5LJJA 4A4OA 2X6DA 4HVIA 4AOIA 3VJNA 2FYSA 5LCKA 3SV0A 4KNBA 3RNIA 5K0XA 2ZV2A 3F3ZA 1VZOA 2HY0A 2AC3A 2XK7A 4FK6A 4GYGA 4IAYA 2BZKB 3W18A 4D4SA 5BUJA 2ZMCA 4U8ZA 5A4LA 4QQ5A 1YDRE 3AMBA 2F2CB 3JVRA 3QZFA 4JS8A 5HO6A 3UTOA 4E7WA 4PDYA 4JQEA 3ANRA 3DBEA 4IADA 4IVCA 5A4EA 3OT3A 2YJRA 4FOBA 3RBWA 2HIWA 3N51A 4ZTRA 2J50A 3IDPA 3FLSA 4CD0A 4HYHA 5IUHA 3UDTA 3FMDA 3GGFA 3SKCA 4L7SA 3FPQA 3KF4A 2YIWA 5K5XA 1PYXA 4A9TA 3WBLA 4IX3A 2A98A 3GNIB 4IWQA 4BGQA 4C3FA 2C3LA 3CD3A 1XH4A 2VWXA 5AP7A 4IMYA 4X3JA 5IA3A 4IC7A 3EIDA 3SA0A 2XKCA 4AGDA 3N4UA 4J71A 5CEMA 2F7ZE 3LMGA 2B1PA 5FWKK 5IH5A 3VBQA 4U80A 1VYWA 3HA6A 1BL7A 1QCFA 4D1ZA 4AZTA 4CXAA 1NVQA 4BCKA 3E7VA 4IAAA 5IQAA 3HV4A 3ORIA 4WBBB 2Y4IC 3LVPA 1OIYA 3R9OA 4Y85A 4BCJA 1MRVA 1J7IA 2XYUA 2ITWA 4XV2A 5AM6A 4ZK5A 4QMWA 3MPAA 3R7VA 2VTOA 3V51A 3DJ6A 4QMQA 1Y6AA 5KHWA 5IA1A 4O83A 3KB7A 1PMVA 1NXKA 2VTLA 3ACKA 1KE9A 3O7LB 4FV9A 5D12A 5ETIA 4BTKA 5I9ZA 4UV0A 4ZMEA 4RX8A 4F0GA 4GRBA 4R7BA 3OWLA 4LRJA 2ZB1A 3RK9A 4IVBA 2ZV9A 4HOKA 4AACA 4IJ9A 1YKRA 2VU3A 5IMEA 3HGKA 3R71A 3KEXA 4ZY6A 2Q83A 5AWMA 5HO8A 3S2PA 3ODYX 3I79A 2ZYBA 3DU8A 5D7AA 3D83A 4OTIA 2YFXA 2CCHA 5IF1A 1MUOA 3EQHA 5CASA 1W8CA 4FNYA 4BCGA 4BL1A 2BRBA 3BGQA 4AW2A 4EHEA 1W82A 4R5SA 5BMMA 5FLFA 2XCHA 3PE2A 2WOTA 4UMRA 1U5RA 5IQIA 4L3JA 4LOPA 3ZYAA 2J0IA 4GK4A 4YJUA 4Q9SA 3V5WA 3F5GA 3KA0A 2RIOA 1KOAA 4DG0E 2ONLC 5L8KA 3ZLWA 3KFAA 4FKPA 4YJOA 5AV0A 3ZXTA 2GCDA 5J5TA 3AKKA 2C4GA 4Q9ZA 4CTCA 3DB8A 1IAJA 3GCUA 2QOHA 2XNOA 5IQDA 2CJMA 2R3JA 2VX0A 3WF9A 3G6GA 2C6IA 3EQDA 3HV5A 4RQKA 2J4ZA 3NUUA 4KAOA 1OL6A 3GU4A 3A2CA 4MXXA 5CSVA 3ZHPC 3ATSA 2NP8A 4DN5A 2V55A 4I6HA 4GIIA 4G5PA 1BMKA 4RJ4A 5AR3A 3BI6A 4F9YA 4HPUE 5M51A 4WNOA 3F7ZA 4CZYB 2PULA 3MH1A 3F3WA 3MPTA 4I21A 3QQUA 5CSXA 3CTHA 3NIEA 2PZPA 4IE9A 4E8AA 4YU2A 3GENA 4KIKB 3RWPA 5IISA 1Y6BA 3FSKA 4EORA 4LV8A 1I09A 4MX9A 4XOZA 2VTMA 3ZBFA 4PF4A 3NWWA 4AZFA 3WIGA 5KZIA 4E4MA 5E91A 2JBOA 4Y8DA 4I41A 5IQFA 1DM2A 2W99B 1MP8A 3LKMA 3K54A 1B6CB 3OW4A 3VRYA 4WKQA 3FMNA 3PDTA 4FTNA 5EW3A 5JT2A 1J3HA 5GZ9A 2P33A 3UVPA 3UE4A 4XG9A 3BYSA 4DTBA 4L67A 3QQLA 4DG2E 2R3GA 4F70A 3CQEA 2VWBA 4RLLA 4E6AA 4DC2A 4RJ6A 1TVOA 4PTCA 5B2LA 3DFCB 4PQNA 1GAGA 4LG4A 4YZDA 3DJ7A 2WHBA 2NYAA 2OI4X 4F9CA 4OW8A 1Q62A 1XH5A 4ALUA 1OIRA 5HD4A 4Y46A 3VS6A 5KMOA 3NUSA 5BMSA 3DBFA 3GCSA 2G01A 4AWIA 3H4JA 4O4CA 4ONAA 3VBWA 3D4QA 3MIAA 3VUTA 3F69A 4AU8A 3VUGA 5JZJA 3QTSA 4GFOA 4O22A 4FMQA 4OAUC 3ANQA 1JSVA 3D94A 2WTCA 2PMIA 1BI8A 2C5OA 4FV3A 3DZOA 1CKJA 4XRJA 4YC3A 4AXEA 1XH6A 2P2HA 2W1HA 3DT1A 3MESA 4UMUA 5JGBA 1YI6A 1XHAA 4TYIA 4XUFA 2DQ7X 5DPVA 2QNJA 5JKGA 1YRPA 4PDOA 3CJGA 2Y6MA 3F5UA 3QRJA 3QRTA 5AV1A 4CFXA 3L9NA 3VBVA 4O2PA 4QP2A 2VD5A 4MD9E 4GSBA 4GK3A 4K2RA 4RC2A 5KE0A 5DYJA 3I0OA 5EW9A 3WF7A 1Z9XA 2FB8A 2WTDA 3T3UA 3ZONA 5BVOA 4FTKA 2VAGA 4FKRA 4ZTQA 3SXRA 3EWHA 3V6RA 3FY0A 1OB3A 3OBJA 3TKUA 3LJ0A 3CJFA 3EYGA 3FMHA 3PP0A 3TCPA 5I5ZA 3EFKA 4A4LA 5AR8A 4BZNA 3C9WA 3S95A 5CXZA 2R3HA 2XKFA 5DG5A 3BL9A 1UU8A 1HOWA 2CN5A 2B9FA 2SRCA 5G1XA 2YDJA 4C35A 4DHIB 2QR8A 1MQ4A 4DH1A 5LXMA 3TNHA 4TN6A 2GSFA 5E92A 4DGGA 5IH4A 2OW3A 4CG8A 4M97A 3AGMA 4KBAA 5ANKA 4ARKA 4DEEA 5AUUA 3UO5A 4JQ8A 2Y0AA 3G0EA 1P2AA 3QXPA 5DHJA 3W2QA 3LMIA 1ERKA 5AP2A 5EFQA 1H28A 1YWVA 4EC8A 3OTUA 5ACKA 3HLLA 4F7JA 3QQFA 3E8DA 5KHXA 2XK9A 2XALA 5C01A 3DAKA 1FMOE 3OCGA 5EHOA 4RA5A 2FGIA 4O0TA 4RIWB 4AN2A 4XJ0A 1OPKA 3C4WA 3OWPA 4J8MA 3W2OA 5AUXA 2XUUA 3R28A 5AR4A 3D7ZA 2XNMA 3HA8A 4TPTA 5CI7A 2BFYA 3E3BX 1UWHA 3ZUTA 5M4IA 2PVNA 4AXDA 4ITJA 5I4NA 3EQCA 3R7EA 2JIUA 4DH7A 3QTQA 4PWNA 4CCUA 3UOLA 5A54A 3S3IA 3H9FA 3LQ5A 3OEFX 3THBA 4B0GA 4G6LA 4OTDA 3BKBA 3O8UA 4HVSA 5L2IA 3U6JA 4IB0A 4FT7A 4L8MA 4QTDA 3D5VA 1YI3A 3MTLA 4QEBA 4YHTA 2OXXA 5C9CA 3FZRA 4IAFA 3ROYA 5BX0A 1UNLA 4NKAA 1ZYLA 5CF5A 2V62A 1CKIA 3BRBA 5L8LA 4CMTA 4ERWA 4C2VA 5DRDA 2XAOA 3G9NA 3PP1A 3EN4A 3VIDA 3UIXA 4OBQA 3F2RA 3O96A 2RFEA 3ZZWA 4CKIA 3VW8A 3NW5A 4KIPA 4ZS4A 2WTWA 3O23A 2X9EA 3V5LA 2HWPA 2O65A 5IQEA 3MFTA 3TV6A 5EOLA 5E90A 3LFBA 2JKQA 2GNHA 3DOGA 1YQJA 2WMBA 4AZEA 3FLWA 4MVFA 3TZ8A 5EI6A 5H8EA 3V8WA 4FKIA 4CFWA 3P0MA 5K4JA 2QD9A 4AQKA 1GZNA 3R73A 4ZJVA 5K4IA 1CSNA 4JDKA 2P2IA 4Q2AA 2C5YA 3NS9A 1PRYA 4D2RA 5I3OA 3GB2A 3QALE 5CVGA 4I0SA 4DF3A 2DUVA 1YI4A 5IH6A 4IHPA 4G3GA 3KMWA 2XNEA 4HW7A 3U6HA 1H1PA 4GK2A 4S2ZA 2ZMDA 4AW0A 3QTIA 2ITPA 2CPKE 3LJ2A 3W10A 3HL7A 4B9DA 4CGAA 2ITZA 3ORPA 3FLQA 2QO7A 4HJOA 4FGRA 5CNNA 3QTWA 1WCCA 4FKSA 1H07A 2CHLA 4I23A 3PPJA 3I5ZA 3U9NA 4UALA 4YLKA 4JRNA 2QOCA 3SDJA 3L8PA 4DFYA 3F6XA 3P08A 5C03A 2PU8A 3QWKA 3OS3A 1OVEA 3C5IA 5E8WA 5JGAA 4O1OA 3UO6A 4FKWA 4CFUA 3EN6A 3ZM9A 3M1SA 4II5A 3OD6X 4LRMA 4EEVA 3AC5A 4DH8A 4WUNA 3UC3A 2GNGA 1YXSA 1H1QA 4X0MA 3ULIA 5EM5A 3KC3A 3O51A 3F3VA 2GFSA 4GKHA 1H01A 2BKKA 3NIZA 2OO8X 3LCDA 4GT5A 1URWA 2W06A 4RRVA 4ZTHA 3MH2A 4KRDA 4RG0A 3ZO2A 2EVAA 3P7AA 2IVVA 4D5KA 5ANJA 5CI6A 3Q4CA 3DV3A 4ACMA 3MVMA 3AKLA 2YCSA 5DE2A 3QU0A 3P7CA 5JH6A 2R3QA 4QP7A 5JZNA 1IA9A 2B53A 2VWVA 4JLCA 3WE4A 2RG6A 5B2KA 4XBUA 2WELA 3E92A 4LOQA 4MBJA 2CDZA 3HDNA 5HI2A 1H00A 5JFVA 3TNQB 3IW5A 4GVJA 3ORTA 2VTPA 4NSTA 2YLFA 4MNEB 3V5PA 5JQ5A 4O7VA 5IQBA 3C50A 4AF3A 1FVTA 5DN3A 4BGHA 4RIXA 3Q32A 2BTRA 4OAVB 3LM5A 4R7HA 4KKGA 4YZBA 4G31A 4CTBA 4UMPA 2BZIB 4BCHA 3TUDA 2FSTX 1XWSA 3QLGA 1OM1A 1R1WA 2BRNA 2VTSA 4UX9A 2O5KA 4NT4A 2OJGA 2ITVA 1UWJA 4F63A 5F1ZA 4FEVA 1SZMA 2X8DA 1PXIA 3G9LX 4V0GB 5CT0A 3IDBA 4FBXA 4RBLA 3HV3A 1IEPA 2R3IA 3NAXA 4RSSA 4EKKA 4RC3A 4Y83A 3BU6A 4PTEA 2OFVA 5CEKA 4DEAA 1XMLA 3PIZA 2OKRA 4BDAA 1OGUA 3VS5A 5DEYA 4EK8A 4P90A 3G6HA 2RFNA 3QFVA 2CGWA 2YDIA 2VTJA 4IB3A 4QNYA 1R3CA 5EI8A 2WMRA 2ZB0A 1Y8GA 4TL0A 4EZ7A 3BIZA 5KCVA 3GEQA 4GG5A 5AX9A 3V6SA 1KV1A 4B6LA 2YM6A 2Y7JA 3L1SA 3MA6A 1SM2A 2GS6A 5FGKA 3U87A 4B7TA 3PZEA 5HG8A 4ZY5A 1FPUA 4G16A 4FNWA 1H25A 3BYMA 2ITNA 4X7QA 3COKA 3EQPA 2G9XA 3A8WA 2ESMA 4M7IA 4RVTA 2G1TA 4LUDA 2HXLA 2VTTA 3POZA 5AFVA 4IVDA 5HOAA 4A9SA 4H1JA 4H36A 4BRXA 4FL2A 5KMIA 4MXCA 5I9XA 2QR7A 1MRYA 2PWLA 3U4WA 4EUTA 3LFCA 3FPMA 3AD6A 3O8TA 3A4OX 1XH7A 4D2SA 5BVDA 5CSPA 3DA6A 1NT2A 4IX6A 4NIFA 5AAFA 2JIVA 2QOKA 3ENMA 5L8JA 3EN9A 3F82A 3Q5ZA 4XG7A 3P1AA 4L46A 3SD0A 4BBFA 4JBQA 3RALA 4BBMA 5AADA 4O21A 5M07A 4IW0A 3QA8A 4FEWA 2DWBA 2XK4A 4M67A 1YXTA 5C8MA 1M2PA 2R3RA 1LUFA 4UWCA 3ZSHA 3T9IA 5ANGA 2O63A 4EHVA 3SRVA 3QGYA 1OECA 4U5JA 3C4ZA 3ET7A 4BR3A 2X1NA 4O6EA 1XBBA 3HRBA 4XP0A 1W0XC 3LFSA 4FEUA 4LDTA 2UVXA 4RZVA 2GNIA 3PFQA 5L2WA 4ZTMA 3LFNA 4V04A 3TKHA 5BVFA 4NZWB 1OBGA 1PXOA 3R8LA 1DAYA 2WOUA 4H39A 4WG5A 1P14A 5IU2A 2OICA 4QT1A 3F7WA 4DEGA 3ZRLA 2J5EA 3IW8A 4PTGA 4RWJA 3QBNA 4NTTA 4PMSA 4AW1A 4BDBA 4C4GA 4YPSA 5HZNA 3DAEA 2Z8CA 3FC1X 2ETKA 1PKDA 4IX4A 3ORZA 2B52A 1J1CA 2CGUA 4NYEA 4IVAA 1ZOGA 4L44A 2CSNA 1YHSA 4W4X