4TWNA

Human epha3 kinase domain in complex with birb796
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
297
structure length
276
Chain Sequence
TVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 3
publication title Structural Analysis of the Binding of Type I, I1/2, and II Inhibitors to Eph Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 276
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4twnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4twnA01
1BL7A 4JX3A 3IK3A 4Y5QA 1FBNA 3E63A 4G6LA 4ZEGA 5K5XA 2BMCA 2CGWA 5C03A 4J98A 5IQEA 4XV9A 4PP7A 4QD6A 3FYKX 3VO3A 4G2FA 4HZRA 4M15A 4V01A 3AC2A 2IVVA 2RSVA 3D94A 4FG8A 4TYHA 3RMFA 2REIA 4FI1A 4FSMA 4FTKA 2Y4PA 3FMEA 4DEEA 4XLIA 1FVTA 4FEUA 1H1QA 1XBBA 4JVGA 4H05A 3A4PA 5GZ8A 2RIOA 3CLYA 1M17A 5TR6A 4HGSA 3ZEPA 3NVKI 3WBLA 3ANRA 4OLIA 1P14A 3FDNA 1FMKA 3Q52A 5LARA 2BAQA 3DQWA 3SXSA 1QL6A 3PXKA 4BCOA 3M2WA 4GK2A 2XEZA 3R22A 5BUEA 3NVMB 2XYNA 3MPTA 4KBAA 3IW4A 5JEBA 3Q4ZA 2VTTA 4O6LA 3HV5A 1XR1A 2SRCA 3D4QA 3KEXA 4HYSA 3K5VA 3FZPA 5F1ZA 5HE0A 2H9VA 4AW5A 3C1XA 4JXFA 4ZTRA 3OUNB 4BI1A 4BZOA 3K5UA 3TNHA 1OM1A 5HBHA 2R3GA 4TL0A 1Q24A 2YA9A 3EYHA 4KRDA 3L8XA 4J95A 1XWSA 5DG5A 4F09A 3UC3A 4B0GA 4YBKA 5F94A 2WIPA 1VEBA 4O2PA 3OG7A 2GMXA 4U8ZA 3TCPA 4AGCA 4NFNA 4FL2A 4F9CA 4WT6A 4I5HA 3JVRA 1YDTE 3RWPA 4ACCA 2B9HA 4O2ZA 3LPBA 3DPKA 3GB2A 4HZSA 4PTEA 5IUGA 4CFMA 5IUIA 4D0WA 4YJOA 3HMMA 1KUTA 4KSPA 4WSQA 4ZOGA 4B8LA 5HGIA 3R7EA 3P23A 3C4ZA 1B39A 3I1AA 4Z7GA 2QOKA 4QNYA 4DEAA 1M2PA 4YJRA 1XQZA 1PMVA 4PUZA 3CTHA 3R28A 4C34A 4DGGA 4L43A 1J3HA 4LGDA 4QP8A 3VC4A 3VF8A 3RCJA 1Q8TA 4L01A 4BDHA 4ZTMA 4FYOA 2JBOA 4FNYA 4GVAA 4E5BA 2UZLA 4JJRA 3D15A 2BRNA 2QLUA 3G6GA 3G0EA 1YXTA 4ALVA 2WXVA 4E5WA 5DN3A 4F9BA 5IH5A 4A07A 2A2AA 5K0XA 4N4SA 4EOLA 4DFNA 4HYUA 5AP7A 5AJQA 3PXQA 4RPVA 2WTKC 2F2UA 3RM7A 3O0GA 4O0XA 3RPRA 1AGWA 4YPSA 2GDOA 4G5JA 3R8MA 3TZ7A 4FZAB 4EC8A 2JLDA 3RPYA 2WMAA 3CQWA 3D7TB 4YJNA 3QUPA 4JAIA 4ZLYA 2WNTA 4EZ7A 2H34A 4BKYA 3E8NA 4Q5EA 3F61A 3KQ7A 1K9AA 4FICA 3IGGA 2ONLA 2EB2A 5FP6A 3BQCA 4DFLA 5CWZA 4K8AA 5B2MA 3QGYA 3DJ5A 5EKOA 3VW8A 3VUIA 4NM0A 5DNRA 3FZOA 2BROA 1Q4LA 4GEOA 3UNJA 2W5AA 3U8WA 4CMOA 2CCIA 1G5SA 4O0VA 3D7TA 2W96B 5JK3A 3D0EA 5B0XA 5KE0A 3KRWA 4JAJA 2YZLA 4OW8A 1NT2A 3DKGA 2XS0A 2X81A 4S32A 4WNKA 3DXNA 3KXGA 4G6OA 5CLPA 4ZAUA 4ORKA 2WTDA 4EOSA 3QF9A 5AMNA 2F2CB 2QURA 2C47A 3DNDA 1L8TA 1VZOA 3MIYA 3OT3A 3R9NA 5J9LA 2ZDTA 2VUWA 2V7OA 3SXFA 1PMUA 2XNBA 4C37A 4RIXB 3UC4A 3GCVA 4GG5A 2Z8CA 3KRXA 4F9AA 3ID6C 2I0YA 4Y95A 2BRHA 3KA0A 4B9DA 4BTMA 5B2LA 2O8YA 2RF9A 1CKJA 2QLQA 3KCFA 5E8SA 3FXWA 4J7BA 5CZIA 4ACHA 5J7BA 1U54A 4FZFB 4F0GA 5C1QB 4OTGA 1XH5A 2ITWA 3BX5A 4PTGA 3MH1A 4I21A 3UYSA 5KMNA 3P7AA 2UW5A 2XIYA 2YM5A 3N51A 2OIDA 2WMXA 3LVPA 4RIXA 1U59A 4RJ5A 5EI6A 4GIIA 4DH3A 4EQMA 1XO2B 2C3IB 3NUYA 3ORLA 3LLAA 5LOHA 1H8FA 4FKSA 4U41A 4BHZA 5AV2A 2PZ5A 4RWLA 4YZ9A 3VQHA 2BILB 2R7BA 4FV1A 1Q8YA 5ANDA 3UO4A 4C33A 4IWDA 3UP7A 2VAGA 2VO6A 4OR5A 3SAYA 4W9XA 3ZO1A 3MN3A 2YERA 1WCCA 4P2KA 3AC4A 3FYJX 2PTKA 4RBLA 2NO3A 2V62A 3QTXA 2UW7A 2Z7RA 3LAUA 3VS6A 4BBMA 1LP4A 4EORA 5AUUA 1CKPA 2PVKA 4D9TA 4GFGA 3ZC5A 1VYWA 1DI8A 5EFQA 4WSYA 5HHWA 5ACKA 3OWKA 3NUUA 4FG7A 5A4EA 1YHWA 5CY3A 2X4ZA 3EMGA 4EQCA 5DMZA 1OPJA 1Y6AA 3A61A 5AV1A 4MYGA 2OSCA 4WO5A 4BWXA 4C3FA 4E26A 4AWIA 2QU6A 4AGUA 1TKIA 2QONA 4KS7A 4C3RA 5ITAA 5CEMA 1VR2A 1F3MC 5HO6A 4BGGA 2R7IA 1H07A 2XMYA 3LCSA 4QMNA 2CPKE 4PL5A 1JPAA 4AACA 2BTRA 3KN5A 3AQVA 4FZ7A 3CGFA 4UY9A 3VNTA 2VTNA 4EOOA 4HNIA 4FYNA 1KE9A 1GOLA 3VUTA 4C8BA 4DEDA 3U6IA 3MS9A 4RJ8A 4IVAA 4YJSA 3SD0A 3VRZA 3ZH8A 1ZXEA 4JR3A 4CVAA 4K33A 1SVHA 3AC5A 2X8EA 4MXXA 5CASA 4O0UA 4FNWA 2RG5A 4L45A 3QTZA 4C59A 4ZK5A 3DKOA 3R7VA 3M42A 4BDBA 1IR3A 3MGYA 3ZO4A 3ZUUA 4DFUA 5EI2A 1WVYA 4XG3A 4BDKA 4CQGA 4BCNA 4YTFA 3ZRLA 3FPMA 4K1BA 4ANNA 3QZIA 4BCFA 1V0OA 3QHWA 3VUHA 2W05A 4FSRA 4QYGA 3TNIA 3WZDA 1PMNA 3C4WA 3SW4A 2PVNA 3HV4A 4FOCA 5FM2A 2BKZA 3UBDA 2GS6A 4ACDA 3CR0A 4RZVA 3F5GA 1M7QA 4MVFA 5J9ZA 5JGBA 5FM3A 3SVVA 2H8HA 4FTLA 3KF7A 4F1OA 2OXDA 3NAXA 4D4RA 3LFAA 2BIKB 3P78A 4I92A 4AZVA 5L6OA 2X9EA 1FPUA 3P1AA 3TZ8A 2BZJA 3GOPA 3E64A 3IW5A 1NA7A 2CMWA 1FGKA 5C01A 3W2RA 4HVGA 3IECA 2FB8A 4O38A 3P4KA 4MXZA 3H9RA 4I24A 4DTKA 2XJ0A 4EH5A 3W8QA 3QWJA 1KE5A 1LUFA 5EDQA 2XK6A 3ZLYA 3PJ3A 4AZSA 4CSVA 5JFWA 2R3IA 2JIIA 4FODA 2JKQA 5LVPA 5CU6A 2BZIB 3EH9A 3M1SA 2JKKA 5KKRB 4I0TA 3O8UA 4DBXA 3DTWA 2PE0A 2WB8A 1YRPA 2P55A 2IG7A 4YLKA 2WMQA 5E8TA 4MWHA 3FE3A 5LWMA 5D7VA 4E1ZA 1JWHA 5FTOA 3IG7A 2WQNA 3HP5A 4GIHA 4YJVA 3HRCA 4ZTHA 4BIEA 5IG1A 3BBTB 2GTNA 3MB7A 3QALE 4ERKA 4BDGA 2YABA 5IU2A 4F6UA 3PPZA 4XP2A 4CFVA 2VV9A 2UVXA 1XKKA 3SW7A 3LCOA 1Q8UA 3F2AA 4U79A 5DR2A 3TKHA 3LQ5A 3DK3A 3PY1A 2HZ4A 3DCVA 4UN0C 1QPJA 3FJQE 3EFJA 4EBVA 5I3RA 2KULA 1IAJA 3L9MA 3V5JA 2C5NA 3COKA 3GQLA 1Q8ZA 4UYNA 2HIWA 2J5EA 4YO4A 4D2VA 2ITTA 4AT3A 1H4LA 4EEVA 5I9VA 3KRRA 3I79A 3MSSA 4ZZMA 1J7IA 4UYAA 2F7ZE 3SG8A 3KN6A 4ZP5A 2Z7QA 2XUUA 5L2TA 3KB7A 3IS5A 4CMTA 2GTMA 4GS6A 1Q3WA 2JDVA 4I4FA 3WIGA 3TM0A 4OTWA 4C35A 3NNWA 3U51A 3CQEA 4QYEA 5EG3A 3DQXA 4JDHA 4KB8A 1PJKA 2I0HA 1WBTA 3FLZA 2YAKA 3KXZA 1RW8A 1ZWSA 2C4GA 4BDAA 4FT5A 4J71A 1APME 2QOBA 4LRKA 2RKUA 4TWCA 4GUBA 5C26A 3BRBA 1U5RA 3HDMA 3W10A 5HKMA 2C0OA 4J8NA 5DR9A 2GNJA 3MWUA 3PYYA 4H39A 3ORTA 4OBQA 4OUCA 5CXZA 4ZSEA 2HWOA 4A06A 4F0FA 2O65A 3F2RA 3DFCB 2VGOA 4M84A 4EK6A 1OBGA 2YCSA 4KKGA 4O7WA 4D2RA 3VS4A 3V8TA 4AP7A 4FEWA 2X2MA 4RWJA 4XEYA 1O9UA 4FV8A 2UW6A 5HLPA 4DBNA 5KBQA 3RPSA 1J1BA 3ORPA 4EHEA 1H25A 2J0JA 3F3ZA 4D2WA 4L3JA 4X21A 4IC8A 3VS7A 4FKWA 4HGEA 3DNEA 3DB8A 4AA5A 4KKHA 4EOIA 3RNYA 1BUHA 3WZEA 2YDKA 1OL7A 5IMXA 4W4YA 3GQIA 4BN1A 2A27A 3JY9A 5CU4A 4PY1A 4RIWA 2W99B 4KIOA 5CQWA 5BVNA 2J9MA 2B9FA 2GNIA 5T68A 5EDPA 5AR5A 3LCDA 2E9UA 3ZM4A 2BKKA 2CJMA 4IX5A 3OT8A 1KV2A 4TYEA 3VBWA 3ZYAA 4K0YA 4UMQA 4O1OA 2O0UA 3D2KA 3ORMA 3OWJA 4PV0A 2GU8A 3PXYA 3JS2A 3RPOA 3ZBFA 5CAPA 1OMWA 4V05A 3VS0A 2QHNA 3SDJA 4TKSA 4FKLA 5AP5A 2W1ZA 3VJOA 3JR1A 1OIQA 2ETRA 3BEAA 3NUPA 4RA5A 2ZB1A 5JFVA 5CU3A 3R9RA 1W82A 3FAAA 3Q9WA 1H24A 3FL4A 3QA8A 2YDJA 2HY0A 3KXNA 5FWKK 3NYNA 3W18A 4GK4A 4O0YA 4USFA 5AWMA 1GY3A 1P4FA 4XRJA 1Q3DA 2IZSA 3O50A 1W83A 4FTUA 5B2KA 1WVXA 3EIDA 4APCA 3U6HA 1CMKE 3AXWA 1I44A 4QQJA 3HEGA 3PP1A 4QQTA 4FV7A 3LCTA 4LV8A 4YSJA 3QCSA 4W4WA 3LFFA 3V5PA 2CGUA 1JKSA 4DLIA 4E3CA 5HE3A 5AP2A 3ET7A 3OZ6A 3QD3A 1JKKA 3HZTA 4WOVA 3FQEA 4FT7A 2R3FA 4IAFA 4U43A 2XYUA 4TYIA 4GV1A 4FZDB 4YBJA 3KMWA 3ORIA 4ALUA 4O82A 4M0YA 2PWLA 4KIKB 3OXIA 2CCHA 4MNEA 2YM3A 1VJYA 3KKVA 5C27A 3WI6A 5M07A 5E91A 3TKIA 4G9CA 3GGFA 3REPA 3P5KA 3HYHA 5CI7A 3HV7A 5H8BA 3V8SA 4BCHA 5BMSA 4BCKA 2W17A 4C4IA 5LVNA 2QOCA 2CLXA 4OTDA 3PY0A 4DAWA 3KVXA 1U5QA 4Q9ZA 5G1XA 1JAMA 5FTGA 2WQEA 4IEBA 3ZTXA 2QOHA 5CEPA 5CF5A 2QR8A 2PZPA 3EL7A 3A60A 5IEYA 3VS2A 4FEQA 4B7TA 4EH4A 2OBJA 2VWZA 5E8VA 2F4JA 3PVGA 4B6LA 2QO2A 2CDZA 1V0PA 3Q5IA 3ZXZA 4YURA 2OJJA 2CKQA 4DFXE 2C1AA 1YXXA 3ZZWA 4R1YA 1YWNA 5EHYA 4HW7A 4ZXTA 2QO9A 4CYIA 5AX9A 4X2GA 5CX9A 2VTHA 4HJOA 3TDVA 3I81A 4JDIA 2HOGA 5J1WA 3RINA 4LUEA 5DE2A 4JG8A 5A54A 1ZMVA 3F88A 1ND4A 3F6XA 4EOPA 1OL6A 3HV6A 3PXZA 1A06A 4RG0A 4EUTA 5DH3A 2OF4A 4FKOA 4F9YA 5KMIA 1GIIA 4P4CA 5DT3A 4F6WA 2UVZA 2CN8A 3F2NA 2B54A 3LXLA 2XNEA 4FBXA 2PMNX 4WNPA 4UWBA 1B38A 1ZY5A 2R64A 4FT0A 3FL5A 4G5PA 2IW8A 4TWPA 3VULA 4D9UA 3NYOA 2C6DA 3FZRA 2UW9A 3VBYA 2I6LA 4D1SA 3A99A 4YPDA 5HEZA 4E5AX 4FUXA 4MX9A 2DYLA 4KS8A 2QODA 3SRVB 3OD6X 1MRYA 1YOLA 4RMZA 5IA1A 2AC5A 2JKOA 3E93A 4XG8A 4EJ7A 3RAKA 2J90A 1H1RA 4HYIA 4QNAA 4ARKA 4FG9A 5TE0A 4FT9A 3VBTA 5HBJA 3ORNA 2B0QA 2Y9QA 4EOQA 3R21A 1PXOA 2CHLA 4ACMA 3OCTA 4V0GA 4BCQA 5GJDA 3GFEA 1BL6A 5A14A 2IPXA 3DJ7A 4RA4A 3QRTA 4QMQA 2BIYA 2NRUA 3HMOA 3VWAA 5M53A 5EQYA 4M3QA 3QQFA 4ACGA 4MHAA 1URWA 3O7LB 5DPVA 3HKOA 2O3PA 4GKHA 3GU8A 1P2AA 4A9YA 4OTHA 2UW0A 4S2ZA 5E92A 3ZXTA 4E93A 2QG7A 3Q32A 2ZAZA 4O91A 1JLUE 1AQ1A 3GCPA 1TQIA 1PY5A 5D7AA 4NCTA 4WUAA 4EHGA 3QC9A 3PRIA 3QQJA 1XH7A 5HIDA 2FH9A 1ZAOA 1BLXA 3FC1X 2BPMA 1H1PA 2P2IA 4IX4A 2WTIA 4DC2A 5IQBA 4XV3A 2PVJA 3PWYA 1WBPA 1Q41A 2C0TA 3C0IA 3DU8A 3FMNA 3R7YA 4BHNA 1UA2A 4WIHA 3C4FA 4N70A 3TIYA 4CTBA 2VD5A 4DLJA 3BLHA 3EWHA 5AA9A 1YOMA 3ORKA 4F7LA 4G34A 5M4FA 2VTAA 4F7JA 4X6QC 3RBWA 3BLQA 4O7TA 4EL9A 3ITZA 2YDIA 3ODYX 3ZDUA 2C68A 1JKLA 4KIPA 3DAJA 5CT7A 3TV4A 3D83A 3FY0A 4X3FB 5FUTA 2GS2A 3ETAA 2PYWA 4USDA 2PZRA 5EW3A 4PMPA 4CLJA 3MH0A 5G6VA 2YWVA 5K4IA 2FSLX 3SX9A 4U97A 4ASEA 2ITQA 2XNOA 2QD9A 4QMSA 5AUZA 4JOAA 4H36A 4XBUA 4AAAA 2EB3A 4NM5A 1WBOA 2ERZE 5BVKA 5A3XA 4RLLA 4LV5A 4EH3A 5CSHA 4KAOA 2HWPA 3GVUA 4X3FA 5JKGA 4XMOA 3AOXA 3CPCA 5LVOA 2UZUE 1ZLTA 5IQDA 2W9ZB 4U40A 4Y85A 5C4KA 3OY1A 5CT0A 2YITA 4UMRA 5HIBA 3FHIA 3PLSA 1YKRA 3BYVA 2VRXA 4IAIA 3C5UA 3RJCA 3ALNA 4I4EA 2JFLA 2JIUA 3B2TA 3BELA 4I22A 4XV1A 3ACKA 3EQHA 2RFEA 2XB7A 5HNIX 2EVAA 3CP9A 3FZTA 3JXWA 4YHFA 4C62A 5BQ0A 3F3UA 3LLTA 2DUVA 1ZYCA 4FV0A 2OJGA 4AFJA 4RGJA 3W8LA 4EK3A 3RNIA 4JIKA 4BWPA 2NPQA 3R83A 1NVRA 1OBDA 2XK7A 1YI3A 4FEXA 3U6JA 3AMYA 3O71A 3LMIA 4PF4A 4MKCA 4H1JA 5KMKA 3P7BA 4CZUA 2XK9A 4OTQA 5CAQA 1HCLA 4AZWA 5CEKA 5HTCA 3QWKA 4EUUA 2FUMA 1SMHA 3TN8A 1DAYA 2VWIA 5BNJA 2R9SA 3C4XA 1K2PA 3DK7A 3OXTA 5FQDC 4RVKA 4P7EA 5GJFA 4EH6A 3PA5A 2J4ZA 3A8WA 4XRLA 5JFXA 3ZSGA 1YXVA 5EQPA 2EU9A 2OO8X 1Q61A 1NXKA 2OG8A 3IQ7A 3TACA 2AYPA 5CNNA 2CNQA 4RRVA 3N9XA 4IX3A 2UW8A 5FGKA 1A48A 2Z2WA 4DFZE 1PXMA 3WILA 4FMQA 1Q99A 4OTFA 3VS5A 1NY3A 5GNKA 4ZY6A 4WG3A 4R5SA 2WOTA 4DEBA 3QTWA 1H1SA 4QPSA 4ZSJA 3NCZA 2OK1A 2WD1A 2BALA 4RIYA 4CFUA 4L9IA 1GIJA 2ONLC 2WGJA 4BFMA 5EI8A 1Y91A 2Q0BA 4BIDA 4QMZA 4IMYA 3MIAA 3UMWA 3SQQA 5ANEA 5A4CA 3IKAA 4G3EA 3IGOA 3BHTA 4Q9SA 3BQRA 4AOTA 3RAIA 4C02A 1PKGA 3ZRMA 4MD7E 4C58A 3DFAA 1MUOA 4I6FA 5I9ZA 2C5YA 2WPAA 1LPUA 3P86A 3TI1A 5C8NA 1NW1A 3MJ2A 3UO5A 2Y6OA 4L7FA 3PJ2A 4FNZA 3DBDA 4PL4A 5M55A 2JDOA 2XP2A 4I41A 4RVTA 3VS3A 3UZRA 3DJ6A 3VIDA 3D5XA 2ZV7A 3I7BA 1OGUA 3FI3A 3FLNC 4FKJA 5J5SA 3ZM9A 4IB5A 1ZMWA 3K2LA 3V3VA 3QZGA 5CF6A 1PYXA 4IB1A 2UVYA 4LRMA 4MD9E 4YJUA 3GI3A 4TYJA 5D9HA 4M97A 4QTDA 4ENYA 5I9YA 5AUWA 4IAAA 4PDSA 4Y72A 4LGGA 1SM2A 4H3BA 5E8WA 4ENXA 2BHHA 2ITNA 1GZKA 4BKJA 2YEXA 3JUHA 3QD0A 3S3IA 1NVQA 2IW9A 5JN2A 3V01A 2J0LA 3VW6A 4KIQA 5M4IA 3U9NA 2Q83A 4CV9A 3WZKA 1IA8A 3WYXA 3RK7A 5L6WL 4AN9A 1UKHA 4CFWA 4FSWA 4AG8A 3FLYA 5EM6A 3NUXA 3M11A 4IM3A 4I93A 3SLSA 5ETIA 3EQGA 3ACJA 4GUEA 5KZIA 3LMHA 2GNHA 3C5IA 5EHLA 4AW2A 4DH7A 4IDTA 4M68A 3ELJA 3B8QA 5DBXA 4B99A 4BCMA 2RFDA 3E88A 4QYHA 5TOZA 4C57A 4TW9A 5J8IA 1R78A 3CE3A 2X2KA 4U6RA 4LG4A 2HY81 4C38A 4O1PA 3EZVA 3EKKA 4IVCA 3DGKA 5HLNA 5ACBC 5K5NA 3BGQA 2JKMA 4UZDA 5HCYA 5M57A 3F3VA 1MQ4A 4FKRA 2BZKB 5F95A 5HX8A 3NPCA 4GFOA 3HMIA 2NRYA 2VTLA 4N57A 4PDPA 3VHEA 4HCUA 4EYJA 3OF0A 4L00A 4O7NA 1UKIA 1BKXA 3HUBA 4M8TA 3G5DA 4FUYA 4MAOA 2H96A 3E87A 3NW5A 4FSNA 3SV0A 3BYUA 4CKIA 4CTCA 2R3PA 2VTQA 5JZJA 4D2PA 2EUFB 3I6WA 2YM6A 3QUDA 3PIZA 3FV8A 3KVWA 3ZS5A 2YIXA 4QP1A 3UVQA 4G9RA 5A4TA 3VBXA 3FI8A 2C3LA 3ZLWA 3SXRA 1OECA 3A4OX 1FQ1B 2A19B 4QQ5A 3V5QA 1V0BA 4U80A 2R3RA 3FZSA 1U46A 3GXLA 3LE6A 3WARA 4X6RA 2LAVA 4I0RA 1PHKA 4QTCA 4U45A 3C0GA 2V22A 4CMUA 2R3MA 4O27B 4U42A 1R39A 4GRBA 2VO3A 2XEYA 1Y6BA 2XNPA 3BHYA 2XKDA 4PP9A 5JFSA 4BTJA 1DS5A 4O6EA 3OFMA 5J95A 4KRCA 2G15A 1REJA 4LYNA 4W8DA 5JGDA 4YTIA 1LEZA 2Y4IB 4B4LA 4BL1A 5EM7A 5IQFA 5L3AA 5FLFA 1XJDA 4ANLA 4UXLA 3Q4TA 1KOBA 4IAYA 4PMSA 2OXYA 1M2QA 4ANBA 3LFBA 2HYYA 4XOZA 2XKFA 5D12A 3WE8A 4F65A 3KRJA 2J6MA 4QMMA 2VO7A 4C4GA 1WZYA 3UIXA 4CZTA 4MBIA 4KUJA 1BI8A 1YHVA 3UNKA 2CGXA 3LCKA 1W84A 3MVMA 4GJ2A 4LRJA 4XUFA 2R0IA 1OL5A 1YQJA 4NT4A 3Q60A 4U44A 2CGVA 4YJQA 3UQCA 5T3QA 3QZHA 4D2TA 4R78A 2X39A 3AD5A 4MCVA 3BU3A 2PVFA 4F1TA 3RKBA 3S95A 3R8UA 4AFEA 3GC7A 2DWBA 4O7SA 4FKIA 1Q62A 3ZLXA 4D5HA 5LXMA 2C69A 3DAEA 5GJGA 3GP0A 3WF8A 2HW6A 4C0TA 4NYEA 2ITZA 4XBRA 5KKRC 4RQKA 4B8MA 3IOKA 2ZOQA 3MBLA 3A7FA 5J9YA 4L6QA 4QMTA 3C0HA 4OBPA 3GCQA 4FKTA 3IDCA 4N6ZA 4EOKA 5F4NA 4NH1A 3FY2A 4NJDA 4O86A 2CKOA 3F3TA 1REKA 3C13A 2EXCX 3ZC6A 4IJ9A 2HZIA 3OBJA 4PQNA 1GZOA 2W5BA 3B2WA 3HUCA 1YHSA 3LIJA 3BHUA 3PG3A 1YVJA 3QQUA 3UMXA 3ZO3A 1UU8A 5DEYA 4DE4A 4QYYA 5LCKA 3NNXA 4DH8A 4KD1A 5LMAA 3DKFA 4FIEA 2YIWA 3OS3A 1OB3A 3MY0A 4IFGA 1YOJA 3E8EA 3AD6A 3R1SA 3W33A 3OBGA 4PDOA 5K9IA 2F7EE 3PSDA 3R8ZA 4QO9A 5EOLA 2R2PA 1J1CA 5FEDA 2E9OA 3ENHA 2R3OA 4K9YA 4TNBA 3PA3A 4EKLA 5HVKA 2JITA 2R3LA 4M66A 4BGQA 2R3HA 4JQ7A 3ZZEA 3R9OA 1J7LA 3P0MA 3COHA 3FWQA 3KXHA 3W32A 2PZIA 4R3PA 4YO6A 5LCJA 3SA0A 4DT9A 2GPHA 4WRSA 4A9TA 3FI4A 3MVHA 3ULIA 4CRSA 5DT0A 2OJ9A 1B6CB 2HELA 4DG0E 5A6OA 3E8CA 2LGCA 3E92A 4PL3A 3U54A 3R8PA 5AR2A 2Q0NA 4AXAA 1OIUA 1WVWA 1Q5KA 2BUJA 5HBEA 1QCFA 3F7WA 3OEFX 4L68A 5H9BA 1H01A 4AOIA 3FZ1A 4HGTA 5KX8A 2ETKA 2JD5A 3GC9A 2VWYA 2BZHB 4AS0A 3G0FA 2FSOX 5HICA 3TUDA 4RFYA 3LFCA 2YM7A 3CGOA 5AUYA 4FEVA 2X4FA 3QTIA 3ATSA 2XRUA 2IZUA 5I9WA 4PPAA 1ZOGA 2OZAB 4WG5A 1CM8A 4JNWA 5EW9A 5IQAA 2QCSA 1CDKA 3R9HA 4F4PA 4NWMA 4DGOA 4CFXA 3HLLA 5FXRA 1G3NA 5C8KA 4NW6A 3VUKA 5IUHA 3F5PA 4TWOA 4XYFA 1R0PA 4JBVA 4ZTLA 3R2BA 5HQ0A 2P0CA 4JR7A 3ZSIA 2BRBA 2X7OA 3R71A 1WBNA 3KFAA 4CFNA 3OW4A 4OTRA 3UJGA 2ZM4A 4D5KA 4I6QA 2YM4A 2WZJA 4IQ6A 4MQ1A 5FXQA 4ALWA 4RFZA 5AV3A 3FC2A 3L8VA 1UV5A 2EXMA 3ZRKA 2FVDA 3OHTA 4Y8DA 5LQFA 4ZY5A 2Y0AA 4GU6A 3NS9A 1HOWA 4J8MA 4FF8A 4UMUA 4BZNA 3DTCA 2OH4A 3VBVA 4CCBA 3GUBA 3AMAA 4NM7A 5FEEA 3EJ1A 5GIPE 2VN9A 2JC6A 2OW3A 4O0RA 4FZ6A 4K18A 3BWFA 3OMVA 3ZFYA 4DYMA 3PA4A 3GNIB 5LMKA 3QYWA 4Y46A 3SC1A 2CKPA 2HENA 4FR4A 4RJ6A 1XHAA 1ZZLA 3KC3A 3LFQA 5E1SA 1JOWB 5CSPA 4Z55A 1W0XC 4I1ZA 3GU4A 4NKSA 4CD0A 4CQEA 4TRLA 3SGCA 4ANQA 4CT1A 5DEWA 4QP4A 4QT1A 3QQKA 4IJPA 3G51A 5HTBA 4AF3A 5JT2A 5IQCA 3R7GA 4V04A 5KMMA 1KE8A 2QOIA 4LOQA 4DGNA 2ZJWA 3PY3A 1ZOHA 3HA6A 4N0SA 5CSVA 2UZWE 3O23A 5I4NA 3T3VA 3HVCA 2Z7SA 5DRBA 4RX9A 4W8EA 5ANKA 4YMJA 5AADA 1DAWA 4RC2A 1ZZ2A 5E7RA 3LQ3A 1BYGA 3WZUA 4AGWA 4F08A 3HDNA 3OCGA 4LI5A 2J0MB 5L2SA 4LQMA 4QMXA 5DRDA 3VJNA 3MB6A 3PVWA 5CTPA 3RAWA 4ITJA 3FKNA 2QNJA 4HVDA 3EFLA 4PPCA 3RPVA 2FO0A 3P08A 4FTQA 3BYSA 2E9NA 2WU6A 2FSMX 2PVHA 1YWRA 4LMUA 3Q4CA 4FSYA 4GMYA 5DLSA 4QP7A 1H27A 4LFIA 5E8XA 4APPA 4USEA 3IW8A 2OIBA 4X2NA 5HVYA 2B53A 3BLRA 4NFMA 3EQDA 3UPXA 3QAME 2OJFE 5IH6A 5EYDA 3BYMA 4K2RA 3DXQA 2XIKA 3AMBA 2OKRA 4GT5A 4KKEA 1Z57A 4YTCA 5L8JA 3UE4A 3D5VA 5CF8A 1H28A 4EKKA 2RG6A 4XHKB 5AP3A 2WQBA 2QQ7A 3DZOA 2OGVA 3QA0A 3G33A 1TQMA 2HK5A 3MVLA 4O22A 2W0JA 2ITPA 4L3LA 4UALA 4XG2A 4D4YA 5M4UA 1Y8YA 5JMSA 3G9LX 2VWUA 1FGIA 2GQGA 3QQGA 1M52A 1O6KA 4LGHA 4W4XA 4Q2AA 3L8SA 4UBAA 1SYKA 2OICA 3QX2A 3FQSA 3TJDA 4DG2E 2X9FA 4GK3A 5CENA 4M14A 4CKJA 1PXIA 5TO8A 4MH7A 5IA4A 4FKGA 3SOAA 5IQHA 5M08A 3QD2B 4XOYA 4A9RA 2I1MA 2IZTA 4PX6A 2PY3A 3JYAA 3UG2A 1OKVA 2KTYA 2WMSA 4EBWA 5AAGA 3F5UA 4R3CA 3O8TA 3EQBA 5E1EA 5EYMA 4AT4A 1ERKA 5IA0A 2ESMA 4IAKA 4I94A 3EN9A 3DBEA 5IA5A 3F66A 4FIHA 5BYZA 3SOCA 5JRQA 5FXSA 3WYYA 1OKWA 1YW2A 1EH4A 4OAVB 5AP1A 4R7HA 5DFPA 3MH3A 4MK0A 5CAVA 1KE6A 3EYGA 2R3QA 5K4JA 3SG9A 5H8GA 2B9JA 3VVHA 1SNUA 2IVTA 4KABA 5HO7A 3W2SA 5I3OA 3F9NA 2O63A 3A7IA 4FOBA 4L3PA 4MWIA 4BI2A 4FKQA 4FK3A 2CKEA 5HI2A 5D10A 3LXKA 4KIKA 5AR8A 3FMKA 4TXCA 3ZUTA 4NCTC 5IMEA 3S4QA 3L1SA 2VGPA 3OTVA 3V51A 3QFVA 3CKXA 2WMBA 3U87A 4ASZA 3ZOSA 4EONA 2ITXA 3PZHA 4FKPA 2WMRA 3QRIA 3WIKA 3MYGA 4JQEA 2QO7A 4CEGA 3LQ8A 4J97A 5AIKA 4G1WA 3IDPA 4M69B 1H00A 1OI9A 3COIA 4O7LA 3F3WA 5AUXA 5KHWA 4GU9A 2WHBA 4E6QA 2F9GA 4IWOA 3B8RA 2QI8A 3AC1A 4U5JA 4X3JA 2ZM3A 3Q3BA 1PYEA 3D5UA 1JNKA 5LVMA 4NKAA 4GYIA 2BRMA 1XBAA 1NVSA 4EQUA 2F49A 4O0WA 4E4MA 4XG9A 4E4NA 1QMZA 2YLEA 4KINA 3SKCA 5TKDA 5FD2A 1SNXA 3BI6A 3Q5ZA 3QLFA 4TWNA 3TZ9A 3O8PA 3PJ8A 4ZTQA 3ZO2A 3CY3A 5LJJA 4IH8A 5D41A 3R6XA 3FBVA 1KE7A 2R3NA 3OC1A 2Y8OA 3OXZA 4DEGA 5IA3A 2PULA 3NCGA 3QCQA 2ZV2A 3W2CA 4I6BA 5M51A 3C50A 3NIZA 3K3IA 2XRWA 2VWXA 2W4JA 2BDJA 4PMTA 4NZWB 5EOBA 1Z5MA 4J99A 3KGAA 5CSXA 3TT0A 2ZB0A 3OOMA 4X3FC 5EQEA 4GFMA 4AA0A 1GZ8A 2BHEA 4HOKA 4BTKA 1WAKA 4HVSA 2Z7LA 4IBMA 1QPDA 2JEDA 2X1NA 4BDIA 5B7VA 4C2VA 4ZTSA 3MESA 4EH9A 4DG3E 5C8MA 5C9CA 4BC6A 2E9VA 5A4LA 2ZDUA 3II5A 3P9JA 4EZ5A 3SRVA 2XM9A 2G2FA 3WF9A 4BYJA 4EH2A 3KREA 4IANA 4ZJIA 2IVSA 4GSBA 4QP6A 5M06A 3POOA 4J52A 5CANA 5JH6A 3EZRA 3H3CA 3V6RA 3N4TA 2W7XA 3CD8A 2RL5A 4GG7A 5AP4A 5FBOA 4NW5A 2AUHA 3A2CA 3HECA 3OCSA 4YHJA 5ANJA 3HX4A 3NX8A 2GFSA 5CI6A 5HG9A 2C6MA 5I9UA 2W06A 2WELA 3ROCA 3GT8A 3EHAA 2ITOA 4X0MA 4AA4A 4QTEA 2C5OA 2UZTA 5BYYA 2PUIA 2Y6MA 2C6LA 1P5EA 5EM5A 3DDPA 1UNHA 2ITUA 2YISA 4ZZOA 4DTBA 2YN8A 3NWWA 2Z02A 4FV3A 3MW1A 3I0OA 3QCXA 1OKYA 1PXPA 5CVGA 3KL8A 4D2SA 5IKWA 5CALA 1E9HA 4NUSA 4QMVA 3LOKA 3P7CA 4DH5A 4Z7HA 2GQSA 1PMEA 1KSWA 2BAJA 2V5QA 5CSWA 3RM6A 3UOLA 3N4VA 3DKCA 4IM0A 3DS6A 2VO0A 2C3JA 2XK3A 4YC6A 3QRUA 4KBKA 3BBWA 4RWKA 4BCPA 1J7UA 1X8BA 3PE1A 4LL0A 3R30A 4JBPA 3Q6WA 4D1XA 2VTSA 3NSZA 4RZWA 4UWCA 5DT4A 4IVDA 3TUBA 3BPRA 4NTSA 3DLSA 5J87A 4QYFA 2NP8A 3W55A 4IACA 4P5ZA 2XKCA 2X6EA 3A62A 4TTHB 4M13A 3NNVA 4IC7A 3PP0A 3R8LA 4E4XA 5BPYA 1JSTA 3KF4A 3W2PA 4PPBA 1UNLA 4DITA 3BIZA 1H26A 2EWAA 5AP6A 3AG9A 3Q9ZA 3ZONA 3NRMA 4M12A 2XBJA 4YLJA 4ZMFA 3CQUA 3L9PA 3VS1A 4EWHA 4O7ZA 5DIAA 3DDQA 4GT3A 3VHKA 2BCJA 1ZYSA 1WFCA 4F7SA 3KULB 4QPMA 4WA9A 3I4BA 1U4DA 5FDPA 4F70A 4NJ3A 2B7AA 5A9UA 3LJ0A 1PXJA 4C4EA 2VTOA 3C4EA 3F5XA 4BYIA 2QOLA 1PXLA 2RGPA 4MD8E 5EW8A 2B4SB 1FINA 2G9XA 4ID7A 3F7ZA 4H3QA 4R7BA 1W7HA 2B9IA 3OROA 3KMMA 4C4JA 3OTUA 3R1NA 4ZMEA 4EK8A 4XG4A 3RK9A 3IW6A 3U55A 3QC4A 5E90A 2WFYA 4DINA 2IW6A 3UPZA 3QRJA 2OF2A 3TEIA 1XH9A 2HW7A 3TZMA 3UOHA 4BGHA 4IDVA 4Y5HA 3TG1A 3EQCA 3NDMA 2CNVA 3I5ZA 4G31A 3AT2A 5HE2A 1JKTA 4HCVA 3R7OA 3W16A 1IG1A 3KXMA 4C36A 4UMTA 5E8ZA 3Q04A 3S0OA 3LKMA 1R0EA 2OI4X 1DM2A 4CNHA 2XK4A 5M09A 5EHOA 4GW8A 1WBSA 2VWBA 5CEOA 3UIUA 2UZVA 5CVHA 3EQIA 3NIEA 3DOGA 4J96A 2G2IA 2GHMA 3GU5A 3V5WA 4BKZA 5KMOA 3UGCA 3LFDA 4ZSLA 4AQCA 5IISA 4QMUA 4NIFB 4RSSA 4JDKA 4MTAA 4F7NA 4O96A 4JG7A 3A7JA 4W4VA 3O17A 4E6DA 2XCKA 5H8EA 5KO1A 5HZNA 4L7SA 2WU7A 2OFUA 5GZAA 4JQ8A 4L8MA 4F63A 2WMUA 2JDTA 4P5QA 3Q2MA 4TYHB 4AT5A 5KCVA 4CG9A 4UV0A 5I5ZA 2G2HA 3I0QA 2YM8A 3O96A 4O0SA 3EKNA 4FVRA 3ZCLA 3BWJA 4NIFA 3PRFA 4FKUA 3DAKA 3R8VA 3CS9A 2P3GX 2WKMA 3MV5A 4J53A 4RX5A 5HCZA 3LM5A 2DS1A 3QKKA 4MBJA 1W98A 3ULZA 5JQ8A 4A9SA 3MI9A 4HPUE 4BY9E 3FKLA 5KMLA 5H3QA 3COMA 3E7OA 3DA6A 3QYZA 4MNFA 4JRVA 3THBA 4L46A 4EWQA 3ALOA 4F1MA 4FTJA 4RIOA 4RJ3A 2WTVA 2QG5A 3DBCA 3SHEA 5KNJA 4BDFA 4O21A 3ERKA 3PXFA 2YHVA 3PXRA 5FRIA 4Z3VA 5A4QA 4HGLA 1YDSE 4YNOA 4ANSA 2QVSE 3NUNA 1ZYLA 4L42A 3UQFA 3PSBA 1RQQA 2VX1A 3R00A 4X7QA 2ZMDA 4KWPA 3VUDA 3A7HA 5HTIA 2GHGA 4R7IA 2UZDA 2J0KA 4IIRA 4L67A 3DBQA 1OUKA 3MVJA 2W1FA 1F5QA 3C9WA 2C6IA 4FSUA 2WAJA 3V5LA 2HAKA 4GL9A 4C4FA 3TTIA 2X0GA 3IONA 3R7IA 1OKZA 1MRUA 4FTCA 1R1WA 3KCKA 3QTUA 5CEQA 3H10A 3HP2A 4FIGA 2RFSA 4OTIA 4QP2A 2XCHA 5ANIA 4MEDA 3T3UA 4IHPA 4RQVA 2V0DA 2YZAA 4HNFA 1RE8A 3QBNA 4X2KA 2PUNA 4CLIA 4ZJJA 3AGMA 4FV6A 4GVJA 4FK6A 2OH0E 1QPEA 3FHRA 4UEUA 2VTRA 3O7LD 2JFMA 2W1DA 5IDPA 1DI9A 5I9XA 2XM8A 3EN4A 4AW1A 2PU8A 1JSUA 2Y4IC 2W4KA 4ERWA 4GT4A 3TNPC 4XP0A 2XKEA 3WZJA 5F20A 4FTNA 4YU2A 3BEGA 4D4VA 4W9WA 3FMDA 3LXNA 3TIZA 4E7WA 2W5HA 4JL9A 1GIHA 3L8PA 4DA5A 5J1VA 1UU7A 2OXXA 2PMLX 5ETCA 4O7RA 3UP2A 5E4HA 5LWNA 4FIFA 3UTOA 2VTPA 3DK6A 5CU0A 3HAMA 4FV2A 4JDJA 3NUSA 4QOXA 3R9DA 3HA8A 1ZOEA 4LOOA 2J7TA 4QP3A 2X7GA 3MTLA 5HG7A 4RLKA 4KBCA 5HO8A 5CQUA 3NGAA 5BYLA 1V1KA 3BV2A 3I7CA 5T6KA 1XH8A 3PJCA 4IZYA 1QPCA 3RALA 1LEWA 3KU2A 1TQPA 2BFYA 4L44A 3RK5A 1OIYA 4NK9A 2UV2A 1STCE 3QU0A 4QMLA 5DR6A 5J5TA 3N4UA 4I0SA 4ITIA 4X2JA 4X2FA 1GNGA 1M7NA 4LMNA 4XV2A 3CEKA 2QKRA 3R2YA 2CNUA 3DZQA 4IZ5A 1PXNA 2OJIA 3R1QA 4S31A 4YC8A 3ZMMA 2HZ0A 3QZFA 1E1XA 2BRGA 4PNIA 3BHHA 4JI9A 2IJMA 4EH8A 1URCA 5AX3A 2VWVA 3GBZA 4MF1A 4FC0A 5EYKA 3CJFA 3NAYA 3MPAA 1JBPE 4BBEA 3VUMA 1FMOE 2BR1A 4FGBA 1U54B 3A7GA 3QRKA 3BE9A 4QTAA 4BF2A 5CAUA 4BCGA 5M44A 3AC8A 4U9AA 4UXQA 1Y8GA 3TWJA 3Q53A 4WHZA 2QU5A 3ODZX 5FDXA 5GHVA 3T9TA 5DWRA 4EH7A 2CN5A 4AZTA 2WMVA 1ZMUA 1XBCA 4J1RA 5ANOA 4EI4A 4AX8A 5KUPA 1O6LA 2ZMCA 5BVDA 2WQOA 2GFCA 2PK9A 2AC3A 2WMTA 3CTQA 3QQLA 4MF0A 3GU7A 2YCQA 4I20A 5EH0A 3MJ1A 4ZIMA 2BDFA 3MY1A 4M7IA 4D28A 5AIRA 5TT7A 2B1PA 2W4OA 5F9EA 1H0WA 2WTWA 4DH1A 4QMOA 3ZEWA 3PWDA 4QPAA 3UYTA 5AAEA 2HCKA 2J50A 2WTKB 5CZHA 2V55A 2IZRA 2I0VA 3I5NA 1IEPA 2ETMA 3QQHA 5AV4A 2FSTX 4FIIA 4UB7A 3UZPA 4BCJA 4LOPA 2PHKA 4II5A 4QP9A 5IEXA 4C7TA 1IASA 2XZSA 3FMMA 3ORXA 1BI7A 4AE6A 4JT3A 4WNMA 2C0IA 4ANOA 1MQBA 5DGZA 1BX6A 4XH6A 3EFWA 2WEIA 3R7UA 5HNGA 3OUKA 5L2QA 5L2IA 5LMBA 1CSNA 2UZBA 1GZNA 3CBLA 3KMUA 3ZFMA 3U4WA 2WO6A 4YP8A 5CVFA 1IAHA 1M2RA 3GCSA 3NUAA 5AR3A 4I5PA 3LFNA 3UVPA 3EN6A 4JBQA 2A1AB 5EK7A 4UZHA 3HRFA 2C5VA 4HCTA 5LVLA 4IADA 3TJCA 4AUAA 5BVWA 4CGAA 4DEHA 3LHJA 4G16A 2B52A 4E8AA 5HX6A 3UIBA 4QRCA 4Y73A 3Q4UA 4IW0A 4ZTNA 4NTTA 4RC3A 2F7XE 2CSNA 1VYZA 2VNYA 3FKOA 4I5CA 4C61A 2WTCA 4F6SA 2BVAA 3PFQA 1XH4A 5M56A 1CTPE 2YACA 4OT5A 4EYMA 3FMHA 3D14A 4EOMA 5HU9A 1RJBA 2R4BA 4CXAA 3F82A 4RJ7A 3NMUF 1ZY4A 4DN5A 3UODA 1TVOA 4CZYB 3V6SA 5LMKC 4DT8A 3CPBA 3DV3A 4TT7A 2YAAA 1JQHA 2J51A 2VNWA 4H1MA 4EOJA 4FV5A 3LZBA 3RWQA 4AN2A 5HE1A 1OVEA 3MFRA 5HLWA 4WG4A 3MPMA 5BUJA 2C5XA 4A4LA 4FKVA 4FNXA 4RJ4A 1ZYJA 3W2OA 2VX0A 4UWYA 4BR3A 4LM5A 2R5TA 3Q6UA 4FA2A 2PMIA 5AP0A 2O5KA 2UZOA 3QKLA 4IFCA 4JIAA 3ATTA 3PG1A 2W1IA 4JBOA 1SZMA 2NNWB 1WBVA 4Q5HA 4AE9A 4F9WA 4F0IA 4BVUA 2ZVAA 2UW4A 4P90A 4RC4A 4XNEA 2VZ6A 5IA2A 2E9PA 2H6DA 3WOWA 2C6EA 4NEUA 4M0ZA 3RVGA 2WEVA 4PTCA 4FX3A 2OIQA 4KA3A 3TNWA 3HGKA 3FPQA 1G8SA 2W1HA 3E5AA 2YWPA 3RHKA 1BMKA 3FXZA 2FGIA 3ZU7A 1RDQE 3KRLA 3R01A 4WKQA 5K3YA 3C4CA 4UMPA 1OZ1A 4L53A 5AUVA 2OZAA 5JRSA 3VQUA 1UWHA 4PNKA 2IN6A 3E7VA 4NU1A 4HVIA 5HU3A 3QL8A 4K6ZA 1M14A 4BDDA 3NW6A 3A8XA 3KK9A 3NYVA 3QX4A 5BVOA 4TZRA 3ZDIA 4BZDA 5CNOA 2C30A 1J91A 4MBLA 4FV4A 3OCBA 4ZLZA 4PDYA 4H3PA 3UDBA 2X2LA 2XF0A 1UVRA 3EQRA 3GU6A 3IPHA 4AGDA 4BTFA 3O2MA 5C4LA 4BRXA 1OIRA 3QD4A 1PXKA 4MQ2A 4XX9A 1L3RE 5FTQA 4CRLA 5AEPA 3BU6A 4AN3A 4CT2A 2XVDA 3PSCA 4DTAA 4RX8A 3IO7A 4ZS4A 3Q9XA 4HPTE 4KSQA 4O81A 5IZFA 4EZ3A 3HMNA 4FTAA 4TYGA 5ANGA 3RCDA 3DT1A 3E3PA 3BGZA 1I09A 4K11A 3UIMA 4RFMA 5D1JA 3WF7A 2V7AA 3TXOA 3ZUVA 1AD5A 4E6CA 3RZBA 3TUCA 5KHXA 1ZYDA 3EQPA 3S00A 4G3FA 3MFTA 3PUPA 3ZLSA 3TV7A 5I0BA 5AFVA 3CIKA 4PRJA 2UW3A 3OY3A 5J7HA 2I40A 3LJ2A 1H0VA 3Q96A 5AM6A 2R0UA 3PVUA 4L52A 3GFWA 4IX6A 2YCRA 5CXHA 1FVVA 3RAHA 4Z16A 1KV1A 4FSQA 3CTJA 4IAZA 2BFXA 4QMPA 4R77A 2FA2A 3LW0A 3POZA 2HZNA 3UZTA 3F69A 1T45A 4FIJA 3U4UA 4K77A 1F0QA 5D11A 1O6YA 2Z60A 4YHTA 2QOOA 4OTPA 4RIWB 3ZHPC 4G3GA 1A9UA 1MRVA 5BVEA 3AT3A 3OP5A 5E8UA 2JGZA 2WIHA 4HVHA 2P2HA 2YFXA 4ONAA 5DVRA 2WMWA 5BUIA 4BB4A 1E1VA 1YXUA 4BIBA 3LJ1A 4C2WA 2PVYA 2VTJA 4EK5A 2C6TA 4ASXA 5L8KA 1IA9A 2ACXA 4QQCA 1K3AA 2G1TA 4A9UA 4U0IA 4BCIA 5FBNC 1UNGA 3BU5A 3IW7A 3BCEA 2I0EA 2PVRA 4I5MA 1Q8WA 4U3ZA 3OW3A 2I7QA 3D5WA 3AC3A 3LXPA 3BYOA 1YI4A 3MTFA 3DXPA 4QMWA 2PVMA 3JPVA 3R63A 4YGAA 4RX7A 4DFBA 4DCEA 1WBWA 5CEIA 3UVRA 1UWJA 4XS2A 4FVQA 5HVJA 4E73A 2VWWA 3MFSA 3FUPA 2J0IA 3MA3A 3NYXA 5JQ5A 2B55A 3EL8A 3FLWA 2VX3A 3PE2A 5DI1A 5GZ9A 1W8CA 2G01A 3FQHA 4M67A 3ZSHA 2YLFA 3BE2A 3PTGA 2ZYBA 4RVLA 2C6KA 3ZFXA 1OITA 2CLQA 4G6NA 4FE2A 3E3BX 3QCYA 2W1GA 5HCXA 3Q2JA 3ORZA 3T9IA 3LMGA 5ICPA 5AM7A 3I6UA 5K0KA 4CG8A 5IEVA 3NZ0A 2C1BA 3OWPA 2YCFA 3RZFA 4E6AA 3PIYA 5BMMA 3G9NA 5KBRA 5L4QA 4RWIA 4FV9A 4XLVA 4YZNA 1FOTA 4BDJA 3HAVA 4MXCA 2BAKA 4AZEA 3V8WA 3WF6A 4O7YA 3VAPA 3VBQA 5E8YA 3P79A 3UO6A 3VUGA 5A46A 4PMMA 3TKUA 3CJGA 3ZBXA 4AOJA 2GNLA 1S9IA 5JGAA 4DF3A 3FEGA 4MNEB 3WF5A 2XNMA 5JZNA 1FVRA 2PE1A 3H9FA 4TPTA 4XP3A 5ETAA 4WRGA 4AU8A 3PZEA 4DEIA 1YDRE 3OEZA 3RP9A 1Y57A 4ITHA 5CF4A 4CKRA 2GS7A 4EC9A 2HXQA 3H30A 2XA4A 4ZLOA 4AW0A 5AA8A 4GYGA 4C3PA 4EHZA 2UZNA 3MH2A 5HOAA 2ZV8A 5IH4A 3EOCA 3KY2A 4IWQA 5TF9A 2QC6A 3PJ1A 4YJTA 3R1YA 4YR8A 2OWBA 4EJNA 3QKMA 2QHMA 3C7QA 4HYHA 5EYCA 3U9CA 4CV8A 4MXAA 3D9VA 4EHVA 5FP5A 2PSQA 4QMYA 4FL3A 2PUUA 3UOJA 3UNZA 4IVBA 3BZ3A 3MA6A 3QGWA 1YI6A 3HV3A 2OLCA 4IB3A 3CKWA 2PL0A 3VN9A 2ERKA 3QHRA 2GSFA 4M69A 4WUNA 4RT7A 2R3JA 2A4LA 2F57A 3GCUA 3H9OA 3AGLA 4ZSGA 5KMJA 4UX9A 3RTPA 3TTJA 3S2PA 4R1VA 2QR7A 5IDNA 4I6HA 3L9LA 2XIXA 3MDYA 4IE9A 4OT6A 3LFSA 1OL1A 5DHJA 3R0TA 3G90X 1JSVA 4IZ7A 2PUPA 3PLAE 5GINE 3CXWA 2GHLA 3GENA 3DBFA 2O2UA 4G3CA 2VTMA 2JDRA 5BX0A 4GJ3A 4LUDA 3HL7A 4EK4A 2GNGA 4TNDA 4O7VA 4GCJA 5CAOA 4MXYA 2OFVA 2BTSA 4WD5A 4DCAA 2FYSA 2YJRA 3H0YA 4FVPA 4ZZNA 5L8LA 3LFEA 4BICA 4CFFA 2ITVA 4AZFA 3DY7A 4YUQA 1OPKA 3E62A 5HNBA 5IQIA 4E4LA 1YWVA 5HD4A 5E9EA 5AR7A 1XH6A 3EN7A 2DQ7X 3QLGA 4YLLA 4D58A 5EKNA 1G8AA 3TDWA 2ITYA 5HESA 4U81A 4BDCA 4FTTA 3MFUA 2WQMA 2YIYA 3L9NA 2X6DA 3BHVA 5CU2A 2PPQA 3T8OA 2BDWA 3DLZA 2YIQA 2XBAA 2PZYA 3OOGA 4V0GB 3RI1A 4XG6A 4YZCA 3QUEA 2IWIA 3PPJA 2JDSA 4CYJA 3PVBA 3EQFA 3NW7A 2X7FA 3FXXA 3NEWA 4E20A 4FTIA 4D1ZA 5BVFA 2JBPA 4OAUC 4JX7A 2IO6A 1PRYA 3JY0A 5H2UA 4IXPA 3EN5A 3VRYA 1S9JA 5HORA 3CSVA 3AD4A 1IRKA 1PKDA 4JG6A 4BWKA 4JS8A 5FG8A 1P4OA 4FSZA 3IDBA 4ZY4A 5JSMA 5J79A 3GC0A 2XNGA 3G6HA 3H4JA 1ATPE 4YNEA 1H1WA 2VTIA 2JAVA 2WOUA 3DB6A 2UZEA 4A4XA 3KXXA 4NL0A 2XIRA 3I60A 2EXEA 4XJ0A 1YXSA 3V04A 3RGFA 4DFYA 2HXLA 2XH5A 3ANQA 2X8IA 3BKBA 1OL2A 1UU9A 2IVUA 1OUYA 2W1CA 2YJSA 2JIVA 4PWNA 4XCUA 4YJPA 5DA3A 3RHXA 3CC6A 4BBFA 5IF1A 1R3CA 3CCNA 2VU3A 2PMOX 4CCUA 3LM0A 3QTQA 3W2QA 2P4IA 2ZM1A 4FL1A 2PVLA 4LL5A 5L6PA 2Y7JA 4S34A 2OU7A 3QTSA 4R8QA 3H0ZA 2C6OA 3E8DA 4O84A 4N6YA 5FEQA 4WBOA 4U3YA 5DYJA 4A7CA 1SVEA 2XJ2A 4DHFA 5CYIA 5HG5A 4U7ZA 5KZ0A 3D7ZA 3HMPA 5AAFA 3HNGA 4MXOA 4OGRA 4WNOA 3R73A 1KWPA 5L2WA 3BGPA 5CS6A 4RVMA 4ZJVA 1Z9XA 2XJ1A 4G3DA 3UQGA 3FSFA 3R02A 4D0XA 2X8DA 1ZRZA 2C3KA 2QOQA 4I23A 4GKIA 5DOSA 4G17A 3TV6A 5EM8A 3GC8A 4XG7A 4FT3A 4YZDA 5IQGA 2R3KA 3R04A 1ZARA 3D2IA 4IWPA 2GNFA 1KOAA 1WMKA 2W1EA 2J5FA 4FTRA 4I3ZA 5GIOE 2A0CX 3FMLA 4NM3A 3W1FA 3IOPA 3NLBA 1H08A 5AV0A 1SVGA 3K3JA 4TN6A 3ENMA 4IB0A 4R6VA 5AR4A 3QXOA 3KULA 1GAGA 4H58A 5HD7A 4DGMA 3Q9YA 1OPLA 4O0TA 4O83A 3WE4A 2YIRA 3OVVA 3VF9A 3CY2A 4A4OA 1T46A 4YSMA 3PDTA 4F99A 3BV3A 4Y83A 2J2IB 3C51A 4IZAA 2GCDA 2QOFA 3PIXA 3FLQA 4FTMA 3V5TA 1Q97A 2XIZA 1MP8A 3UG1A 3NR9A 1PW2A 4D55A 4YTHA 2QKWB 3G2FA 3FI2A 2P33A 4JRNA 2O64A 5ETFA 3UOKA 4BDEA 5A6NA 3PPKA 4S30A 3FSKA 3O51A 4KNBA 3KK8A 3S1HA 4BI0A 2UUEA 1PF8A 4YZBA 2JAMA 4S33A 3TNQB 1JVPP 1HCKA 3QXPA 1GJOA 3HRBA 3K54A 2E2BA 3AT4A 4Z9LA 4ZS0A 4FSTA 3GEQA 4ASDA 4TY1A 4R3RA 5HIEA 2XNNA 3GOKA 1LR4A 4GH2A 3EFKA 2ZV9A 4DGLC 1UU3A 4F64A 5M4CA 3NNUA 3QTRA 3ROYA 2XK8A 1CKIA 2PE2A 4FTOA 4OBOA 4YZMA 5IPJA 2WTJA 5AUTA 4R5YA 3FLSA 4WBBB 3MY5A 5EDRA 4C4HA 3CD3A 3G15A 4QTBA 2RFNA 4D4SA 4IM2A 4FGRA 3JVSA 3EB0A 5HG8A 3TL8A 4YC3A 4JLCA 2GQRA 4RIYB 3OWLA 3FMJA 4ZSAA 2OZOA 4ANMA 2W9FB 4NSTA
chains in the Genus database with same CATH superfamily
4DDGA 1BL7A 4JX3A 3IK3A 4Y5QA 1FBNA 3E63A 4G6LA 4ZEGA 5K5XA 2BMCA 2CGWA 5C03A 4J98A 5IQEA 4XV9A 3UDSA 4PP7A 4QD6A 3FYKX 3VO3A 4G2FA 4HZRA 4M15A 4V01A 3AC2A 2IVVA 2RSVA 3D94A 4FG8A 4TYHA 3RMFA 2REIA 4FI1A 4FSMA 4FTKA 4AXCA 2Y4PA 3FMEA 4DEEA 4XLIA 1FVTA 4FEUA 1H1QA 1XBBA 4JVGA 4H05A 3A4PA 5GZ8A 2RIOA 3CLYA 1M17A 5TR6A 4HGSA 3ZEPA 3NVKI 3WBLA 3ANRA 4OLIA 1P14A 3FDNA 1FMKA 3Q52A 5LARA 2BAQA 3DQWA 3SXSA 1QL6A 3PXKA 4BCOA 4QEBA 3M2WA 4GK2A 2XEZA 3R22A 5BUEA 3NVMB 2XYNA 3MPTA 4KBAA 3IW4A 5JEBA 3Q4ZA 2VTTA 4O6LA 3HV5A 1XR1A 2XALA 2SRCA 3D4QA 3KEXA 4HYSA 3K5VA 3FZPA 5F1ZA 5HE0A 2H9VA 4AW5A 3C1XA 4JXFA 4ZTRA 3OUNB 4BI1A 4BZOA 3K5UA 3TNHA 1OM1A 5HBHA 2R3GA 4TL0A 1Q24A 2YA9A 3EYHA 4KRDA 3L8XA 4J95A 1XWSA 5DG5A 4F09A 3UC3A 4B0GA 4YBKA 5F94A 2WIPA 1VEBA 4O2PA 3OG7A 2GMXA 4U8ZA 3TCPA 4AGCA 4NFNA 4FL2A 4F9CA 4WT6A 4I5HA 4AXFA 3JVRA 1YDTE 3RWPA 4ACCA 2B9HA 4O2ZA 3LPBA 3DPKA 3GB2A 4HZSA 4PTEA 5IUGA 4CFMA 5IUIA 4D0WA 4YJOA 3HMMA 1KUTA 4KSPA 2XANA 3PUFC 4WSQA 4ZOGA 4B8LA 5HGIA 3R7EA 3P23A 3C4ZA 1B39A 3I1AA 4Z7GA 2QOKA 4QNYA 4DEAA 1M2PA 4YJRA 1XQZA 1PMVA 4PUZA 3CTHA 3R28A 4C34A 4DGGA 4L43A 1J3HA 4LGDA 4QP8A 3VC4A 3VF8A 3RCJA 1Q8TA 4L01A 4BDHA 4ZTMA 4FYOA 2JBOA 4FNYA 4GVAA 4E5BA 2UZLA 4JJRA 3D15A 2BRNA 2QLUA 3G6GA 4O4BB 3G0EA 1YXTA 4ALVA 2WXVA 4E5WA 5DN3A 4F9BA 5IH5A 4A07A 2A2AA 5K0XA 4N4SA 4EOLA 4DFNA 4HYUA 5AP7A 5AJQA 3PXQA 4RPVA 2WTKC 2F2UA 3RM7A 3O0GA 4O0XA 3RPRA 1AGWA 4YPSA 2GDOA 4G5JA 3R8MA 3TZ7A 4FZAB 4EC8A 2JLDA 3RPYA 2WMAA 3CQWA 3D7TB 4YJNA 3QUPA 4JAIA 4ZLYA 2WNTA 4EZ7A 2H34A 4BKYA 3E8NA 4Q5EA 3F61A 3KQ7A 1K9AA 4FICA 3IGGA 2ONLA 2EB2A 5FP6A 3BQCA 4DFLA 5CWZA 4K8AA 5B2MA 3QGYA 3DJ5A 5EKOA 3VW8A 3VUIA 4NM0A 5DNRA 3FZOA 2BROA 4AAYA 1Q4LA 4GEOA 3UNJA 2W5AA 3U8WA 4CMOA 2CCIA 1G5SA 4O0VA 3D7TA 2W96B 5JK3A 3D0EA 5B0XA 5KE0A 1XMMA 3KRWA 4JAJA 2YZLA 4OW8A 1NT2A 3DKGA 2XS0A 2X81A 4S32A 4WNKA 3DXNA 3KXGA 4G6OA 5CLPA 4ZAUA 4ORKA 2WTDA 4EOSA 3QF9A 5AMNA 2F2CB 2QURA 2C47A 3DNDA 1L8TA 1VZOA 3MIYA 3OT3A 3R9NA 5J9LA 2ZDTA 2VUWA 2V7OA 3SXFA 1PMUA 2XNBA 4C37A 4RIXB 3UC4A 3GCVA 4GG5A 2Z8CA 3KRXA 4F9AA 3ID6C 2I0YA 4Y95A 2BRHA 3KA0A 4B9DA 4BTMA 5B2LA 2O8YA 2RF9A 1CKJA 2QLQA 3KCFA 5E8SA 3FXWA 4J7BA 5CZIA 4ACHA 5J7BA 1U54A 4FZFB 4F0GA 5C1QB 4OTGA 1XH5A 2ITWA 3BX5A 4PTGA 3MH1A 4I21A 3UYSA 5KMNA 3P7AA 2UW5A 2XIYA 2YM5A 3N51A 2OIDA 2WMXA 3LVPA 4RIXA 1U59A 4RJ5A 5EI6A 4GIIA 4DH3A 4EQMA 1XO2B 2C3IB 3NUYA 3ORLA 3LLAA 5LOHA 1H8FA 4FKSA 4U41A 4BHZA 5AV2A 2PZ5A 4RWLA 4YZ9A 3VQHA 4QDEA 2BILB 2R7BA 4FV1A 1Q8YA 5ANDA 3UO4A 4C33A 4IWDA 3UP7A 2VAGA 2VO6A 4OR5A 3SAYA 4W9XA 3ZO1A 3MN3A 2YERA 1WCCA 4P2KA 3AC4A 3FYJX 2PTKA 4RBLA 2NO3A 2V62A 3QTXA 2UW7A 2Z7RA 3LAUA 3VS6A 4BBMA 1LP4A 4EORA 4LDTA 5AUUA 1CKPA 2PVKA 4D9TA 4GFGA 3ZC5A 1VYWA 1DI8A 5EFQA 4WSYA 5HHWA 5ACKA 3OWKA 3NUUA 4FG7A 5A4EA 1YHWA 5CY3A 2X4ZA 3EMGA 4EQCA 5DMZA 1OPJA 1Y6AA 3A61A 5AV1A 4MYGA 2OSCA 4WO5A 4BWXA 4C3FA 4E26A 4AWIA 2QU6A 4AGUA 1TKIA 2QONA 4KS7A 4C3RA 5ITAA 5CEMA 1VR2A 1F3MC 5HO6A 4BGGA 2R7IA 1H07A 2XMYA 3LCSA 4QMNA 2CPKE 4PL5A 1JPAA 4AACA 2BTRA 3KN5A 3AQVA 4FZ7A 3CGFA 4UY9A 3VNTA 2VTNA 4EOOA 4HNIA 4FYNA 1KE9A 1GOLA 3VUTA 4C8BA 4DEDA 3U6IA 3MS9A 4RJ8A 4IVAA 4YJSA 3SD0A 3VRZA 3ZH8A 1ZXEA 4JR3A 4CVAA 4K33A 1SVHA 3AC5A 2X8EA 4MXXA 5CASA 4O0UA 4FNWA 2RG5A 4L45A 3QTZA 4C59A 4ZK5A 3DKOA 3R7VA 3M42A 4BDBA 1IR3A 3MGYA 3ZO4A 3ZUUA 4DFUA 5EI2A 1WVYA 4XG3A 4BDKA 4CQGA 4BCNA 4YTFA 3ZRLA 3FPMA 4K1BA 4ANNA 3QZIA 4BCFA 1V0OA 3QHWA 3VUHA 2W05A 4FSRA 4QYGA 3TNIA 3WZDA 1PMNA 3C4WA 3SW4A 2PVNA 3HV4A 4FOCA 5FM2A 2BKZA 3UBDA 2GS6A 4ACDA 3CR0A 4RZVA 3F5GA 1M7QA 4MVFA 5J9ZA 5JGBA 5FM3A 3SVVA 2H8HA 4FTLA 3KF7A 4F1OA 2OXDA 3NAXA 4D4RA 3LFAA 3UDZA 2BIKB 3P78A 4I92A 4AZVA 5L6OA 2X9EA 1FPUA 3P1AA 3TZ8A 2BZJA 3GOPA 3E64A 3IW5A 1NA7A 2CMWA 1FGKA 5C01A 3W2RA 4HVGA 3IECA 2FB8A 4O38A 3P4KA 4MXZA 3H9RA 4I24A 4DTKA 2XJ0A 4EH5A 3W8QA 3QWJA 1KE5A 1LUFA 5EDQA 3P5JC 2XK6A 3ZLYA 3PJ3A 4AZSA 4CSVA 5JFWA 2R3IA 2JIIA 4FODA 2JKQA 5LVPA 5CU6A 2BZIB 3EH9A 3M1SA 2JKKA 5KKRB 4I0TA 3O8UA 4DBXA 3DTWA 2PE0A 2WB8A 1YRPA 2P55A 2IG7A 4YLKA 2WMQA 5E8TA 4MWHA 3FE3A 5LWMA 5D7VA 4E1ZA 1JWHA 5FTOA 3IG7A 2WQNA 3HP5A 4GIHA 4YJVA 3HRCA 4ZTHA 4BIEA 5IG1A 3BBTB 2GTNA 3MB7A 3QALE 4ERKA 4BDGA 2YABA 5IU2A 4F6UA 3PPZA 4XP2A 4CFVA 2VV9A 2UVXA 1XKKA 3SW7A 3LCOA 1Q8UA 3F2AA 4U79A 5DR2A 4O4FA 3TKHA 3LQ5A 3DK3A 3PY1A 2HZ4A 3DCVA 4UN0C 1QPJA 3FJQE 3EFJA 4EBVA 5I3RA 2KULA 1IAJA 3L9MA 3V5JA 2C5NA 3COKA 3GQLA 1Q8ZA 4UYNA 2HIWA 2J5EA 4YO4A 4D2VA 2ITTA 4AT3A 1H4LA 4EEVA 5I9VA 3KRRA 3I79A 3MSSA 4ZZMA 1J7IA 4UYAA 2F7ZE 3SG8A 3KN6A 4ZP5A 2Z7QA 2XUUA 5L2TA 3KB7A 3IS5A 4CMTA 2GTMA 4GS6A 1Q3WA 2JDVA 4I4FA 3WIGA 3TM0A 4OTWA 4C35A 3NNWA 3U51A 3CQEA 4QYEA 5EG3A 3DQXA 4JDHA 4KB8A 3NFFB 1PJKA 2I0HA 3KIOC 1WBTA 3FLZA 2YAKA 3KXZA 1RW8A 1ZWSA 2C4GA 4BDAA 4FT5A 4J71A 1APME 2QOBA 4LRKA 2RKUA 4TWCA 4GUBA 5C26A 3BRBA 1U5RA 3HDMA 3W10A 5HKMA 2C0OA 4J8NA 5DR9A 2GNJA 3MWUA 3PYYA 4H39A 3ORTA 4OBQA 4OUCA 5CXZA 4ZSEA 2HWOA 4A06A 4F0FA 2O65A 3F2RA 3DFCB 2VGOA 4M84A 4EK6A 1OBGA 2YCSA 4KKGA 4O7WA 4D2RA 3VS4A 3V8TA 4AP7A 4FEWA 2X2MA 4RWJA 4XEYA 1O9UA 4FV8A 2UW6A 5HLPA 4DBNA 5KBQA 3RPSA 1J1BA 3ORPA 4EHEA 1H25A 2J0JA 3F3ZA 4D2WA 4L3JA 4X21A 4IC8A 3VS7A 4FKWA 4HGEA 3DNEA 3DB8A 4AA5A 4KKHA 4EOIA 3RNYA 1BUHA 3WZEA 2YDKA 1OL7A 5IMXA 4W4YA 3GQIA 4BN1A 2A27A 3JY9A 5CU4A 4PY1A 4RIWA 2W99B 4KIOA 5CQWA 5BVNA 1TFFA 2J9MA 2B9FA 2GNIA 5T68A 5EDPA 5AR5A 3LCDA 2E9UA 3ZM4A 2BKKA 2CJMA 4IX5A 3OT8A 1KV2A 4TYEA 3VBWA 3ZYAA 4K0YA 4UMQA 4O1OA 2O0UA 3D2KA 3ORMA 3OWJA 4PV0A 2GU8A 3PXYA 3JS2A 3RPOA 3ZBFA 5CAPA 1OMWA 4V05A 3VS0A 2QHNA 3SDJA 4TKSA 4FKLA 5AP5A 2W1ZA 3W0OA 3VJOA 3JR1A 1OIQA 2ETRA 3BEAA 3NUPA 4RA5A 2ZB1A 5JFVA 5CU3A 3R9RA 1W82A 3FAAA 3Q9WA 1H24A 3FL4A 3QA8A 2YDJA 2HY0A 3KXNA 5FWKK 3NYNA 3W18A 4GK4A 4O0YA 4USFA 5AWMA 1GY3A 1P4FA 4XRJA 1Q3DA 2IZSA 3O50A 1W83A 4FTUA 5B2KA 4AXDA 1WVXA 3EIDA 4APCA 3U6HA 1CMKE 3AXWA 1I44A 4QQJA 3HEGA 3PP1A 4QQTA 4FV7A 3LCTA 4LV8A 4YSJA 3QCSA 4W4WA 3LFFA 3V5PA 2CGUA 1JKSA 4DLIA 4E3CA 5HE3A 5AP2A 3ET7A 3OZ6A 3QD3A 1JKKA 3HZTA 4WOVA 3FQEA 4FT7A 2R3FA 4IAFA 4U43A 2XYUA 4TYIA 4GV1A 4FZDB 4YBJA 3KMWA 3ORIA 4ALUA 4O82A 4M0YA 2PWLA 3W0MA 4KIKB 3OXIA 2CCHA 4MNEA 2YM3A 1VJYA 3KKVA 5C27A 3WI6A 5M07A 5E91A 3TKIA 4G9CA 3GGFA 3REPA 3P5KA 3HYHA 5CI7A 3HV7A 5H8BA 3V8SA 4BCHA 5BMSA 4BCKA 2W17A 4C4IA 5LVNA 2QOCA 2CLXA 4OTDA 3PY0A 4DAWA 3KVXA 1U5QA 4Q9ZA 2X0PA 5G1XA 1JAMA 5FTGA 2WQEA 4IEBA 3ZTXA 2QOHA 5CEPA 5CF5A 2QR8A 2PZPA 3EL7A 3A60A 5IEYA 3VS2A 4FEQA 4B7TA 4EH4A 2OBJA 2VWZA 5E8VA 2F4JA 3PVGA 4B6LA 2QO2A 2CDZA 1V0PA 3Q5IA 3ZXZA 4YURA 2OJJA 2CKQA 4DFXE 2C1AA 1YXXA 3ZZWA 4R1YA 1YWNA 5EHYA 4HW7A 4ZXTA 2QO9A 4CYIA 5AX9A 4X2GA 5CX9A 2VTHA 4HJOA 3TDVA 3I81A 4JDIA 2HOGA 5J1WA 3RINA 4LUEA 5DE2A 4JG8A 5A54A 1ZMVA 3F88A 1ND4A 3F6XA 4EOPA 1OL6A 3HV6A 3PXZA 1A06A 4RG0A 4EUTA 5DH3A 2OF4A 4FKOA 4F9YA 5KMIA 1GIIA 4P4CA 5DT3A 4F6WA 2UVZA 2CN8A 3F2NA 2B54A 3LXLA 2XNEA 4FBXA 2PMNX 4WNPA 4UWBA 1B38A 1ZY5A 2R64A 4FT0A 3FL5A 4G5PA 2IW8A 4TWPA 3VULA 4D9UA 3NYOA 2C6DA 3FZRA 2UW9A 3VBYA 2I6LA 4D1SA 3A99A 4YPDA 5HEZA 4E5AX 4FUXA 4MX9A 2DYLA 4KS8A 2QODA 3SRVB 3OD6X 1MRYA 1YOLA 4RMZA 5IA1A 2AC5A 2JKOA 3E93A 4XG8A 4EJ7A 3RAKA 4F78A 2J90A 1H1RA 4HYIA 4QNAA 4ARKA 4FG9A 5TE0A 1ST4A 4FT9A 3VBTA 5HBJA 3ORNA 2B0QA 2Y9QA 4EOQA 3R21A 1PXOA 2CHLA 4O4DA 4ACMA 3OCTA 4V0GA 4BCQA 5GJDA 3GFEA 1BL6A 5A14A 2IPXA 3DJ7A 4RA4A 3QRTA 4QMQA 2BIYA 2NRUA 3HMOA 3VWAA 5M53A 5EQYA 4M3QA 3QQFA 4ACGA 4MHAA 1URWA 3O7LB 5DPVA 3HKOA 2O3PA 4GKHA 3GU8A 1P2AA 4A9YA 4OTHA 2UW0A 4S2ZA 5E92A 3ZXTA 4E93A 2QG7A 3Q32A 2ZAZA 4O91A 1JLUE 1AQ1A 3GCPA 1TQIA 1PY5A 5D7AA 4NCTA 4WUAA 4EHGA 3QC9A 3PRIA 3QQJA 1XH7A 5HIDA 2FH9A 1ZAOA 1BLXA 3FC1X 2BPMA 1H1PA 2P2IA 4IX4A 2WTIA 4DC2A 5IQBA 4XV3A 2PVJA 3PWYA 1WBPA 1Q41A 2C0TA 3C0IA 3DU8A 3FMNA 3R7YA 4BHNA 1UA2A 4WIHA 3C4FA 4N70A 3TIYA 4CTBA 2VD5A 4DLJA 3BLHA 3EWHA 5AA9A 1YOMA 3ORKA 4F7LA 4G34A 5M4FA 2VTAA 3O5AA 4F7JA 4X6QC 3RBWA 3BLQA 4O7TA 4EL9A 3ITZA 2YDIA 3ODYX 3ZDUA 2C68A 4BJJB 1JKLA 4KIPA 3DAJA 5CT7A 3TV4A 3D83A 3FY0A 4X3FB 5FUTA 2GS2A 3ETAA 2PYWA 4USDA 2PZRA 5EW3A 4PMPA 4CLJA 3MH0A 5G6VA 2YWVA 5K4IA 2FSLX 3SX9A 4U97A 4ASEA 2ITQA 2XNOA 2QD9A 4QMSA 5AUZA 4JOAA 4H36A 4XBUA 4AAAA 2EB3A 4NM5A 1WBOA 2ERZE 2IEWA 5BVKA 5A3XA 4RLLA 4LV5A 4EH3A 4BJJA 5CSHA 4KAOA 2HWPA 3GVUA 4X3FA 5JKGA 4XMOA 3AOXA 2XAMA 3CPCA 5LVOA 2UZUE 1ZLTA 5IQDA 2W9ZB 4U40A 4Y85A 5C4KA 3OY1A 5CT0A 2YITA 4UMRA 5HIBA 3FHIA 3PLSA 1YKRA 3BYVA 2VRXA 4IAIA 3C5UA 3RJCA 3ALNA 4I4EA 2JFLA 2JIUA 3B2TA 3BELA 4I22A 4XV1A 3ACKA 3EQHA 2RFEA 2XB7A 5HNIX 2EVAA 3CP9A 3FZTA 3JXWA 4YHFA 4C62A 5BQ0A 3F3UA 3LLTA 2DUVA 1ZYCA 4FV0A 2OJGA 4AFJA 4RGJA 3W8LA 4EK3A 3RNIA 4JIKA 4BWPA 2NPQA 3R83A 1NVRA 1OBDA 2XK7A 4DHJA 1YI3A 4FEXA 3U6JA 3AMYA 3O71A 3LMIA 4PF4A 4MKCA 4H1JA 5KMKA 3W0NA 3P7BA 4CZUA 2XK9A 4OTQA 5CAQA 1HCLA 4AZWA 5CEKA 5HTCA 3QWKA 4EUUA 2FUMA 1SMHA 3TN8A 1DAYA 2VWIA 5BNJA 2R9SA 3C4XA 1K2PA 3DK7A 3OXTA 5FQDC 4RVKA 4P7EA 5GJFA 4EH6A 3PA5A 2J4ZA 3A8WA 4XRLA 5JFXA 3ZSGA 1YXVA 5EQPA 2EU9A 2OO8X 1Q61A 1NXKA 2OG8A 3IQ7A 3TACA 2AYPA 5CNNA 2CNQA 4RRVA 3N9XA 4IX3A 2UW8A 5FGKA 1A48A 2Z2WA 4DFZE 1PXMA 3WILA 4FMQA 1Q99A 4OTFA 3VS5A 1NY3A 5GNKA 4ZY6A 4WG3A 4R5SA 2WOTA 4DEBA 3QTWA 1H1SA 4QPSA 4ZSJA 3W0QA 3NCZA 2OK1A 2WD1A 2BALA 4RIYA 4CFUA 4L9IA 1GIJA 2ONLC 2WGJA 4BFMA 5EI8A 1Y91A 3TYKA 2Q0BA 4BIDA 4QMZA 4IMYA 3MIAA 3UMWA 3SQQA 5ANEA 5A4CA 3AKKA 3IKAA 4DDIA 4G3EA 3IGOA 3BHTA 4Q9SA 3BQRA 4AOTA 3RAIA 4C02A 1PKGA 3ZRMA 4MD7E 4C58A 3DFAA 1MUOA 4I6FA 5I9ZA 2C5YA 2WPAA 1LPUA 3P86A 3TI1A 5C8NA 1NW1A 3MJ2A 3UO5A 2Y6OA 4L7FA 3PJ2A 4FNZA 3DBDA 4PL4A 5M55A 2JDOA 2XP2A 4I41A 4RVTA 3VS3A 3UZRA 3DJ6A 3VIDA 3D5XA 2ZV7A 3I7BA 1OGUA 3FI3A 3FLNC 4FKJA 5J5SA 3ZM9A 4IB5A 1ZMWA 3K2LA 3V3VA 3QZGA 5CF6A 1PYXA 4IB1A 2UVYA 4LRMA 4MD9E 4YJUA 3GI3A 4TYJA 5D9HA 4M97A 4QTDA 4ENYA 5I9YA 5AUWA 4IAAA 4DHIB 4PDSA 4Y72A 4LGGA 1SM2A 4H3BA 5E8WA 4ENXA 2BHHA 2ITNA 1GZKA 4BKJA 2YEXA 3JUHA 3QD0A 3S3IA 1NVQA 2IW9A 5JN2A 3V01A 2J0LA 3VW6A 4KIQA 5M4IA 3U9NA 2Q83A 4CV9A 3WZKA 1IA8A 3WYXA 3RK7A 5L6WL 4AN9A 1UKHA 4CFWA 4FSWA 4AG8A 3FLYA 5EM6A 1W2FA 3NUXA 3M11A 4IM3A 4I93A 3SLSA 5ETIA 3EQGA 3ACJA 4GUEA 5KZIA 3LMHA 2AQXA 2GNHA 5BV3A 3C5IA 5EHLA 4AW2A 4DH7A 4IDTA 4M68A 3ELJA 3B8QA 5DBXA 4B99A 4BCMA 3W0SA 2RFDA 3E88A 4QYHA 5TOZA 4C57A 4TW9A 5J8IA 1R78A 3CE3A 2X2KA 4U6RA 4LG4A 2HY81 4C38A 4O1PA 3EZVA 3EKKA 4IVCA 3DGKA 5HLNA 5ACBC 5K5NA 3BGQA 2JKMA 4UZDA 5HCYA 5M57A 3F3VA 1MQ4A 4FKRA 2BZKB 5F95A 5HX8A 3NPCA 4GFOA 3HMIA 2NRYA 2VTLA 4N57A 4PDPA 3VHEA 4HCUA 4EYJA 3OF0A 4L00A 4O7NA 1UKIA 1BKXA 3HUBA 4M8TA 3G5DA 4FUYA 4MAOA 2H96A 3E87A 3NW5A 4FSNA 3SV0A 3BYUA 4CKIA 4CTCA 2R3PA 2VTQA 5JZJA 4D2PA 2EUFB 3I6WA 2YM6A 3QUDA 3PIZA 3FV8A 3KVWA 3ZS5A 2YIXA 4QP1A 3UVQA 4G9RA 5A4TA 3VBXA 3FI8A 2C3LA 3ZLWA 3SXRA 1OECA 3A4OX 1FQ1B 2A19B 4QQ5A 3V5QA 1V0BA 4U80A 2R3RA 3FZSA 1U46A 3GXLA 3LE6A 3WARA 4X6RA 2LAVA 4I0RA 1PHKA 4QTCA 4U45A 3C0GA 2V22A 4CMUA 2R3MA 4O4EA 4O27B 4U42A 1R39A 4GRBA 2VO3A 2XEYA 1Y6BA 2XNPA 3BHYA 2XKDA 4PP9A 5JFSA 4BTJA 1DS5A 4O6EA 3OFMA 5J95A 4KRCA 2G15A 1REJA 4LYNA 4W8DA 5JGDA 4YTIA 1LEZA 2Y4IB 4B4LA 4BL1A 5EM7A 5IQFA 5L3AA 5FLFA 3BLAA 1XJDA 4ANLA 4UXLA 3Q4TA 1KOBA 4IAYA 4PMSA 2OXYA 1M2QA 4ANBA 3LFBA 2HYYA 4O4CA 4XOZA 2XKFA 5D12A 3WE8A 4F65A 3KRJA 2J6MA 4QMMA 2VO7A 4C4GA 1WZYA 3UIXA 4CZTA 4MBIA 4KUJA 1BI8A 1YHVA 3UNKA 2CGXA 3LCKA 1W84A 3MVMA 4GJ2A 4LRJA 4XUFA 2R0IA 1OL5A 1YQJA 4NT4A 3Q60A 4U44A 2CGVA 4YJQA 3UQCA 5T3QA 3QZHA 4D2TA 4R78A 2X39A 3AD5A 4MCVA 3BU3A 2PVFA 4I6LA 4F1TA 3RKBA 3S95A 3R8UA 4AFEA 3GC7A 2DWBA 4O7SA 4FKIA 1Q62A 3ZLXA 4D5HA 5LXMA 2C69A 3DAEA 5GJGA 3GP0A 3WF8A 2HW6A 4C0TA 4NYEA 2ITZA 4XBRA 5KKRC 4RQKA 4B8MA 3IOKA 2ZOQA 3MBLA 3A7FA 5J9YA 4L6QA 4QMTA 3C0HA 4OBPA 3GCQA 4FKTA 3IDCA 4N6ZA 4EOKA 5F4NA 4NH1A 3FY2A 4NJDA 4O86A 2CKOA 3F3TA 1REKA 3C13A 2EXCX 3ZC6A 4IJ9A 2HZIA 3OBJA 4PQNA 1GZOA 2W5BA 3B2WA 3HUCA 1YHSA 3LIJA 3BHUA 3PG3A 1YVJA 3QQUA 3UMXA 3ZO3A 1UU8A 5DEYA 4DE4A 4QYYA 5LCKA 3NNXA 4DH8A 4KD1A 5LMAA 3DKFA 4FIEA 2YIWA 3OS3A 1OB3A 3MY0A 4IFGA 1YOJA 3E8EA 3AD6A 3R1SA 3W33A 3OBGA 4PDOA 5K9IA 2F7EE 3AKJA 3PSDA 3R8ZA 4QO9A 5EOLA 2R2PA 1J1CA 5FEDA 2E9OA 3ENHA 2R3OA 4K9YA 4TNBA 3PA3A 4EKLA 5HVKA 2JITA 2R3LA 4M66A 4BGQA 2R3HA 4JQ7A 3ZZEA 3R9OA 1J7LA 3P0MA 3COHA 3FWQA 3KXHA 3W32A 2PZIA 4R3PA 4YO6A 5LCJA 3SA0A 4DT9A 2GPHA 4WRSA 4A9TA 3FI4A 3MVHA 3ULIA 4CRSA 5DT0A 2OJ9A 1B6CB 2HELA 4DG0E 5A6OA 3E8CA 2LGCA 3E92A 4PL3A 3U54A 3R8PA 5AR2A 4MUQA 2Q0NA 4AXAA 1OIUA 1WVWA 1Q5KA 2BUJA 5HBEA 1QCFA 3F7WA 3OEFX 4L68A 5H9BA 1H01A 4AOIA 3FZ1A 4HGTA 5KX8A 2ETKA 2JD5A 3GC9A 2VWYA 2BZHB 4AS0A 3G0FA 2FSOX 5HICA 3TUDA 4RFYA 3LFCA 2YM7A 3CGOA 5AUYA 4FEVA 2X4FA 3QTIA 3ATSA 2XRUA 2IZUA 5I9WA 4PPAA 1ZOGA 2OZAB 4WG5A 1CM8A 4JNWA 5EW9A 5IQAA 2QCSA 1CDKA 3R9HA 4F4PA 4NWMA 4DGOA 4CFXA 3HLLA 5FXRA 1G3NA 5C8KA 4NW6A 3VUKA 5IUHA 3F5PA 4TWOA 4XYFA 1R0PA 4JBVA 4ZTLA 3R2BA 5HQ0A 2P0CA 4JR7A 3ZSIA 2BRBA 2X7OA 3R71A 1WBNA 3KFAA 4CFNA 3OW4A 4OTRA 3UJGA 2ZM4A 4D5KA 4I6QA 2YM4A 2WZJA 4IQ6A 4MQ1A 5FXQA 4ALWA 4RFZA 5AV3A 3FC2A 3L8VA 1UV5A 2EXMA 3ZRKA 2FVDA 3OHTA 4Y8DA 5LQFA 4ZY5A 3W0RA 2Y0AA 4GU6A 3NS9A 1HOWA 4J8MA 4FF8A 4UMUA 4BZNA 3DTCA 2OH4A 3VBVA 4CCBA 3GUBA 3AMAA 4NM7A 5FEEA 3EJ1A 5GIPE 2VN9A 2JC6A 2OW3A 2ZFYA 4O0RA 4FZ6A 4K18A 3BWFA 3OMVA 3ZFYA 4DYMA 3PA4A 3GNIB 5LMKA 3QYWA 4Y46A 3SC1A 2CKPA 2HENA 4FR4A 4RJ6A 3W0PA 1XHAA 1ZZLA 3KC3A 3LFQA 5E1SA 1JOWB 5CSPA 4Z55A 1W0XC 4I1ZA 3GU4A 4NKSA 4CD0A 4CQEA 4TRLA 3SGCA 4ANQA 4CT1A 5DEWA 4QP4A 4QT1A 3QQKA 4IJPA 3G51A 5HTBA 4AF3A 5JT2A 5IQCA 3R7GA 4V04A 5KMMA 1KE8A 2QOIA 4LOQA 4DGNA 2ZJWA 3PY3A 1ZOHA 3HA6A 4N0SA 5CSVA 2UZWE 3O23A 5I4NA 3T3VA 3HVCA 2Z7SA 5DRBA 4RX9A 4W8EA 5ANKA 4YMJA 5AADA 1DAWA 4RC2A 1ZZ2A