4KBAA

Ck1d in complex with 9-[3-(4-fluorophenyl)-1-methyl-1h-pyrazol-4-yl]-2,3,4,5-tetrahydropyrido[2,3-f][1,4]oxazepine inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
291
structure length
263
Chain Sequence
LRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLRISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-protein interactions of selective casein kinase 1 delta inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Casein kinase I isoform delta
total genus 94
structure length 263
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kbaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kbaA01
5BMSA 2C69A 3QCSA 1J7LA 1MP8A 5HE1A 4ZS0A 1WVXA 2VO7A 1PXNA 4XNEA 2FH9A 2G2FA 4ZY6A 1LEWA 2ITTA 3OWJA 3PY1A 3OCTA 1STCE 3IG7A 4FG7A 4ASXA 5CEMA 1U4DA 3L8PA 4EUUA 2A2AA 1FOTA 2WMVA 3BELA 4PPBA 4U7ZA 2FSTX 3SKCA 3F7ZA 3VQHA 3WZDA 5FXRA 4OW8A 3HA8A 3TXOA 1SVEA 1H26A 3CTJA 3OVVA 5I9VA 4I4FA 2QOHA 1LP4A 2X7FA 4YNEA 2BRMA 1YXXA 3KXZA 2W4JA 3DOGA 4MXYA 4O7SA 2ZM3A 1H0VA 2JFLA 5J9YA 3BU6A 2X7OA 4HCVA 3T3VA 4X2KA 2J0KA 2UZDA 2P2IA 2ZJWA 2A4LA 3ROCA 4MKCA 5IA3A 4CFNA 2QCSA 3FLQA 3R7YA 4ASEA 1M7NA 3H9OA 5BVWA 1IG1A 3UTOA 3SXRA 5IQAA 4IFCA 4MXXA 3A4PA 3DB6A 4BCKA 3O8TA 3KA0A 5IA5A 5HU9A 4M67A 4FYOA 3ZU7A 3QTIA 1FMOE 4DBXA 4BY9E 4O21A 3QD3A 2GU8A 4FKTA 4BZOA 1F5QA 2X4FA 4A9YA 4E6QA 5D9HA 5M4FA 4BTMA 4GYGA 3BGZA 4MD9E 1H1QA 4DGGA 4FT0A 3IDBA 2CGWA 1GZ8A 1XH4A 4FZDB 5EM5A 2PZIA 4PV0A 1I09A 3MB6A 3VUMA 2GNGA 4TYHB 4XG9A 4A4LA 4HVHA 4QRCA 2HENA 2IZRA 3FL4A 4XP0A 5H8BA 3NWWA 4DH3A 3N51A 1J3HA 4E73A 1CTPE 4M68A 3W2RA 4FTKA 1A9UA 1VJYA 3DGKA 4USFA 3PJ1A 4R5YA 2ONLA 3FYKX 3LXNA 3OXIA 1OPLA 1RJBA 3COIA 5CWZA 3U8WA 3MWUA 4X6QC 3VBXA 4YZCA 3VS1A 4JBQA 4IIRA 4C37A 4ZY5A 2XNNA 4P4CA 4Z7HA 3VBQA 2GNJA 3TJDA 5L8JA 4O0XA 3HMNA 2ZAZA 3V8SA 4F7NA 2R3LA 4ZMEA 3CIKA 2FA2A 2I40A 4M69A 3KRWA 4PMSA 4G5PA 1P4FA 2C5YA 4YZMA 1J7IA 4KKHA 4GYIA 2C5VA 4FIGA 4FKRA 4ANQA 4KRDA 3RZFA 4AZVA 5CSPA 3ZLXA 3R8UA 2Y6OA 4IM3A 5J7BA 3HDNA 3IPHA 3E7VA 3MYGA 3QC4A 4HYHA 4K2RA 3VS0A 4BC6A 5CLPA 1YHSA 3G0FA 4QP3A 4IDVA 3JR1A 4R3PA 2Z8CA 4ZLOA 5J79A 4CCBA 4OBPA 4ZLYA 3BEAA 4QMVA 2F49A 4LRKA 2C6LA 3AD5A 3DU8A 3H3CA 4FTCA 5B7VA 2H9VA 5A4EA 3TUBA 2VWYA 2ZYBA 3W33A 3P08A 3HL7A 5M4IA 2ITOA 3MV5A 3RCJA 2OWBA 1OUYA 2XKFA 4FKLA 2R2PA 4G5JA 3NS9A 3BYUA 3S3IA 5FXQA 5JFXA 2GHMA 3L9LA 1H1WA 3NW7A 3QQJA 2FSOX 3MVJA 5BVDA 3GCUA 5FTQA 4O7LA 1FMKA 4YZDA 3QRJA 3QZHA 2RG6A 3W2QA 2WMWA 3PPKA 3C0HA 2ITXA 2XIRA 3WOWA 2ZM1A 4ZLZA 3UZRA 3GP0A 4NM5A 3GBZA 4FTNA 4NKSA 3UYSA 4D58A 5JGDA 4DTAA 4RJ8A 2JKMA 1GIHA 3GT8A 3TZ8A 4YU2A 4TT7A 5F4NA 3MPMA 4E26A 3EOCA 5CSWA 4O1OA 3TZ9A 3QLGA 3KXXA 2YIXA 4GT5A 5KCVA 4K11A 3BV3A 5CS6A 3C5IA 2W4KA 2XIZA 3KULA 3OS3A 4O1PA 4YC8A 5CAOA 5CF5A 3PDTA 5C8NA 4FNWA 3EN4A 4N6ZA 1Y91A 1H08A 4FUXA 4I1ZA 3V01A 2BMCA 2OIDA 4CCUA 4XLVA 4XJ0A 4GG7A 5E8UA 3OW4A 2O65A 3ZO1A 4DTBA 3COHA 4NSTA 3BPRA 5EOLA 4DGNA 3DDQA 2NPQA 4QP8A 5EW8A 4C0TA 1DI8A 3EFWA 4GU6A 4ZAUA 4DA5A 4BVUA 4EOSA 3SOAA 3HMPA 1H4LA 2VTRA 4HGSA 3DJ6A 4YJUA 4OGRA 4I92A 4MBLA 4WSYA 3JYAA 3UMWA 2QOBA 1ZZLA 4U79A 4FIJA 3KVWA 2XUUA 4CT1A 4L42A 2BZJA 4F1OA 3CPBA 3WZKA 4FODA 5HU3A 4BZNA 4F7SA 1IRKA 3OY3A 1ZXEA 4AN3A 4QMXA 1TKIA 4FEQA 1ZOEA 2UVYA 4JG7A 2IVUA 3FLYA 4R1VA 5FQDC 2PY3A 5CAVA 3ZUVA 5A4TA 4DEAA 5KO1A 1V0OA 3Q9YA 3A8WA 4ZSLA 3OCSA 3VS6A 2PU8A 3D94A 4FG9A 3ZRKA 4E8AA 4FKJA 3QTQA 4XCUA 5HOAA 1XO2B 2E9PA 5M51A 4IWOA 4MCVA 3HV4A 4QP4A 3F5PA 3WE4A 3ZEPA 4EK6A 5JRQA 4TWCA 3NVKI 5GNKA 4KS7A 3V5TA 2QODA 1PHKA 4LRMA 5T6KA 5J7HA 4FSNA 3CEKA 2GNHA 3MGYA 4FSTA 3NEWA 4MQ1A 2YDJA 5EHOA 2GQRA 2B1PA 2PVKA 3BU3A 3CQWA 3L9MA 5JGAA 1KWPA 4LUDA 3TUDA 5HGIA 4C33A 5BX0A 3BQCA 2HZNA 5KNJA 2BVAA 3C4CA 3W2OA 3O7LD 3KF4A 1F0QA 1K3AA 5EK7A 3TDVA 3R7IA 4F6UA 1K2PA 4ANNA 3UOJA 4BDFA 2PUIA 2PULA 3NYVA 4FSQA 4RG0A 4IHPA 4L9IA 4ZIMA 4NWMA 2WMQA 4C2VA 3SA0A 1R39A 4O2ZA 2EXMA 4MYGA 4WOVA 4EK4A 2Z7RA 4U3YA 4BCPA 3Q52A 2WAJA 3AGMA 3LVPA 4L68A 3U6HA 4BCMA 4BKYA 4BI0A 3EFKA 2RKUA 4ZJIA 3UPZA 4IM0A 4DEHA 3OZ6A 4PMMA 5C1QB 4AA5A 4X21A 4EKLA 3O8UA 4CQEA 4RJ4A 3EQCA 1VZOA 4V04A 4LQMA 2VGOA 1U54A 3PXKA 3Q6UA 2IVTA 3G9NA 3LM0A 3HV5A 3NW5A 1VYZA 2Z7QA 3ORPA 4G6NA 4IDTA 4QTAA 5D41A 5EQYA 3R83A 5E8XA 4EHVA 3TUCA 2W1IA 4KA3A 1PMUA 2ZDUA 4FKVA 5HVYA 2F57A 3PPZA 1H0WA 2GPHA 5KX8A 1NT2A 3HP2A 2GS2A 3O51A 4EOJA 1NVQA 2DUVA 3BGQA 4H1JA 5HE3A 4DG0E 3I7BA 4U0IA 4PPAA 3TACA 4JBPA 2YISA 3QZGA 4D28A 5HO7A 4I5HA 2XF0A 3SDJA 1RQQA 1NVRA 1OL6A 3BBTB 4QMWA 2CGUA 1ZYJA 4YZ9A 4JLCA 4QQTA 5L2SA 4LG4A 4FKOA 4DEDA 4R8QA 4F9CA 4FSRA 4GT4A 4L43A 3RPOA 4L46A 2XKCA 4A9TA 1KV1A 2A1AB 3R8ZA 4D2WA 2XJ0A 2Y9QA 4TYJA 4FTMA 5EYKA 2VX0A 3CP9A 4DTKA 4FV3A 2GQGA 3F66A 4MQ2A 3EN7A 3GCPA 4U97A 4WRGA 4O0YA 4FT3A 5ANJA 2WKMA 2OH0E 4U5JA 3ANRA 1DAYA 3KRLA 3R7EA 3FY2A 2WEIA 3VC4A 2SRCA 4D2SA 3QFVA 3A4OX 1BL6A 5DLSA 4O7WA 2HIWA 3CTHA 3DKCA 4ZXTA 4LGHA 3VIDA 3ZYAA 4EHGA 4EYMA 1V0BA 2GCDA 3DQWA 4NJ3A 4XBUA 4I5PA 5C03A 3QQFA 4E7WA 3EN5A 4I0RA 5EI6A 4M0ZA 3LFEA 5CVFA 3ZMMA 1YVJA 2CHLA 4DHFA 3S0OA 4MWIA 3OP5A 3SD0A 4KIQA 3BIZA 4ZZMA 3ATTA 3R63A 4DH8A 2PVLA 4IQ6A 5K4JA 2H6DA 3ZSGA 4WNKA 5CXHA 4BIDA 1UU8A 4GIHA 4BGHA 5L4QA 4C35A 2WELA 2X8DA 2FSMX 1OKWA 2RSVA 2XJ2A 2X6DA 4TYIA 2PZYA 5AMNA 5IQFA 4UMTA 5CAUA 3BV2A 3VW8A 4C59A 1YOMA 2W96B 4FZ6A 4QYFA 1H24A 4ALVA 4K6ZA 2QU5A 2QKWB 3PXFA 3R2BA 4M8TA 2R3RA 4AT3A 3RM7A 1XJDA 2NNWB 2BUJA 1YDSE 3NUUA 1FQ1B 5AX3A 3GVUA 4PQNA 3BCEA 1Q41A 5LVOA 1W8CA 3CD8A 4ANOA 5K3YA 2Y7JA 5DHJA 2F2CB 4X7QA 4CG9A 3JUHA 5HTIA 3NSZA 1HCKA 2UW3A 5HESA 4IAYA 4EK3A 4F9AA 2BRHA 4DE4A 2WQBA 5EFQA 3OEFX 4OBOA 4FV7A 4ZOGA 5HX6A 3EKNA 5HE2A 4EOOA 2VWBA 2WU7A 2QG7A 1UU3A 3FUPA 2OW3A 4QNYA 5GJGA 4IBMA 1OPKA 1KE6A 3EQPA 4BICA 4Y85A 3FZPA 4NIFA 4GSBA 3QQKA 3NUXA 4IMYA 3RK5A 2G2HA 4DH5A 3LXLA 3JY0A 3QF9A 5FTGA 1ZMVA 3EH9A 2VTQA 2WMAA 4E5AX 5AUTA 2YCRA 3QYZA 4EOKA 4RMZA 4GJ2A 1B6CB 4RIYA 2WQNA 1Q8UA 1YI4A 2YZAA 3VUGA 2R3IA 3C13A 2UW8A 1WBSA 3UDBA 2QOLA 2PMLX 3RINA 2F9GA 4GVJA 2YWVA 3HA6A 3U51A 4FKSA 3ORMA 4O0VA 3Q9WA 4APCA 2YM3A 5CEKA 2XKDA 2IW9A 5IH5A 1CMKE 2VWWA 5CZHA 3A62A 4GVAA 3VRYA 4FSZA 2YJRA 3H9RA 4KIOA 3NR9A 3TJCA 5JZJA 5M4UA 3EKKA 4NTTA 3TEIA 4PTGA 2B54A 4O0SA 5KMLA 1WAKA 5CYIA 4JAIA 4RT7A 5EHYA 4FT9A 5AWMA 2IG7A 5BYLA 4IFGA 2YCQA 5CU2A 2ONLC 4YTHA 3PY0A 1P5EA 4JQ7A 4EH7A 1YWRA 2HZ0A 5I9UA 2ITQA 2OH4A 3AMYA 5JQ5A 3BI6A 4NU1A 1CSNA 3KK9A 3UO6A 3HRBA 4DAWA 5JRSA 1OI9A 4N4SA 4BDAA 4W4XA 3D0EA 4ACGA 4FICA 5KZ0A 4FGBA 3RJCA 3UO4A 4DLIA 1WCCA 3NW6A 2RFSA 4RWJA 4J97A 3TTJA 4WG3A 4FVQA 4ZSAA 4QTDA 4M12A 2Z2WA 4TTHB 4GJ3A 3BYVA 1YXSA 4EKKA 3KEXA 4MX9A 4NM3A 4RWIA 3Q5ZA 5C27A 4AW1A 3CQEA 1R3CA 2XCHA 3UZTA 4KIKB 1URCA 2CKPA 3Q9XA 1ZYCA 4Y46A 3N4VA 1R78A 4ANSA 1ZWSA 4G6LA 4BDHA 2VX1A 4S31A 2EB3A 4OUCA 1H1PA 3E88A 2XK9A 3AT3A 3D5WA 5DWRA 2DS1A 2WIPA 2O3PA 4AA4A 3UE4A 1Q3DA 5D1JA 4A9SA 2VX3A 2QHNA 2WMTA 2UZNA 4BDIA 2KTYA 4YLJA 1Q62A 3RWPA 4CRSA 3R02A 4R77A 3GB2A 1GIIA 4PMTA 1KE5A 2PE1A 3R8VA 4K9YA 2WTCA 4G17A 3DBEA 4FKPA 4RX5A 2W1ZA 4XG3A 2GNLA 1ZMUA 3LFBA 4QYHA 4FTQA 4L8MA 5HO8A 3SQQA 5CI6A 5FEEA 4EH3A 1U59A 4FZ7A 4IJ9A 1XHAA 4J99A 2OICA 2PE0A 3FLNC 4TZRA 1JKSA 3QQGA 3VBWA 2C5OA 3QU0A 5E1EA 4ACHA 3N9XA 1AQ1A 5I9WA 1OITA 2QOOA 2XA4A 4G16A 2JD5A 5IA4A 5F1ZA 1PMVA 4QYYA 2QHMA 3R1QA 4F65A 4O81A 2EB2A 5I9XA 2VO6A 4W9WA 1OKZA 3FQEA 3SXFA 3KY2A 1W83A 3R9NA 3LFSA 3TKUA 3RHXA 3ORNA 3IK3A 5FP6A 2C0IA 2JIVA 2WIHA 2QOFA 3F9NA 3U6JA 2YM8A 2WD1A 4WNMA 1G8SA 5I4NA 4HOKA 4J96A 5KMNA 2Q0BA 4FVRA 4GEOA 3MVHA 3QX2A 4PY1A 3AGLA 2CNUA 4RJ7A 4D2RA 4DFXE 3ENMA 2BILB 3BRBA 4FX3A 4Z9LA 4D4RA 4IEBA 2C6DA 3E3PA 3EQBA 4PTEA 2UW9A 4I93A 5M09A 4MTAA 2QURA 5L8LA 2EWAA 1LUFA 4ZTNA 4AE6A 4O7NA 4EZ7A 3OXTA 2NP8A 3EYHA 1O9UA 2Z7LA 2OZOA 5DT0A 4DFNA 3V5LA 3R7UA 5DEWA 1WVWA 2O8YA 3QTUA 5KUPA 4GU9A 1OM1A 2XMYA 4RSSA 3OCGA 1Y57A 4RQKA 4TYHA 3UYTA 4BFMA 3KN6A 1OVEA 2QD9A 4RZVA 4CZUA 5JEBA 1P2AA 2JIUA 3LZBA 5E9EA 3HX4A 4FKQA 1LR4A 3GFEA 3R28A 4YP8A 3VS5A 4E4MA 4QTCA 2OKRA 3A7JA 5KKRB 3VNTA 4HVGA 3ACKA 5JGBA 2E9OA 3H0ZA 3MH0A 4GG5A 3UC4A 3MH1A 4CSVA 4JR7A 5HLNA 1YWNA 2FUMA 2W99B 3OHTA 2R3HA 1XWSA 2XP2A 3VW6A 3E3BX 4C61A 5E4HA 3KCFA 5E8VA 3W2CA 3POOA 3JY9A 4R7HA 3ORIA 2O5KA 4WBOA 5AV1A 4CVAA 4E6AA 4EJ7A 2BAQA 2C3KA 4U42A 3K3JA 5AM7A 1PXIA 3EFLA 3EN9A 4ACDA 5GZAA 3RPVA 3LE6A 4X3FA 2R3QA 1H8FA 1PYXA 4GIIA 1Q8ZA 1XH8A 1JLUE 2VTMA 3CQUA 5AR5A 4D4SA 1UKHA 3LJ2A 3IGOA 3PSCA 2LAVA 3HAVA 2JC6A 4I6BA 1W7HA 3UG1A 5T3QA 3CSVA 3WF9A 3EZVA 4L3JA 5E92A 3ERKA 3P79A 3Q32A 3UIXA 4C62A 3S1HA 1YRPA 3MJ2A 3KXGA 4QPMA 2UZTA 1PXKA 2AYPA 4I3ZA 1PY5A 1Q3WA 3RCDA 4JR3A 3UODA 4C3RA 5LWNA 2GFSA 1GZOA 3BQRA 3MFRA 2YM4A 3WILA 1CKJA 5LMBA 4EYJA 3ZTXA 1XH6A 4FIFA 2W5AA 4KBAA 4X2NA 4N70A 1URWA 4U9AA 3PJ3A 4XV2A 2JDOA 2JDRA 4FR4A 4YTCA 3WIGA 3GC8A 4B9DA 4TXCA 4O7TA 2W5HA 2VTLA 3IOKA 2CJMA 5G6VA 3ZO2A 5TE0A 2ITWA 4ZP5A 3UBDA 2C0TA 2I7QA 1YHWA 3HUCA 3KRJA 4ANBA 4BDJA 4II5A 3MIAA 5IG1A 1MRUA 3NCGA 1JOWB 2IVVA 4EEVA 3LFDA 1Z5MA 3RNYA 1DM2A 4FOBA 2ITZA 4OT5A 5D12A 5AV3A 4QP2A 5AIRA 3RGFA 2XNBA 2R3FA 3ROYA 4PP9A 2OO8X 2X8EA 4LYNA 3HKOA 4IW0A 2X9FA 5F9EA 3R1YA 3GFWA 1BL7A 4FTAA 4O96A 4I41A 4YLKA 4XBRA 2UZWE 2ERKA 2QNJA 4I6FA 4NW6A 3KK8A 4MAOA 1WVYA 4HJOA 1MUOA 3QKMA 4I6HA 4QMNA 1BLXA 2CKEA 2R3MA 3LFCA 4BI2A 3Q6WA 1OIYA 5BYYA 5IEXA 1UNHA 2JLDA 4F0IA 4K18A 2W9FB 4E4NA 1Q97A 2QO2A 3FXWA 3DXPA 3NMUF 3PVGA 3LMIA 4BCNA 3EHAA 1ZYDA 2IWIA 4CG8A 3AD4A 4EBWA 3U6IA 2O0UA 3Q4TA 3F7WA 2HW7A 4O6EA 3B2TA 4LGDA 4X2FA 3ZM9A 4H58A 4JX7A 3FHRA 2HW6A 2OJIA 3SV0A 3LPBA 3G0EA 4EL9A 1WBPA 5E8YA 3UNJA 2W1DA 4RVLA 1SVHA 4HPTE 2OXXA 2QG5A 4FV4A 2JGZA 4FVPA 4O84A 4LOOA 4R78A 2Y0AA 4AFEA 3MTLA 5L2QA 3K2LA 4X3FC 2PK9A 2UZBA 4USEA 4F9YA 2AUHA 4F09A 4UYNA 2QKRA 4CT2A 4QQJA 1MQBA 3C51A 2QLQA 4EZ5A 3LJ1A 1H28A 3LMGA 4YURA 1IAHA 5I0BA 2BDJA 5CQWA 4MNFA 5TR6A 3QWJA 4WNPA 1EH4A 5HVKA 5FM3A 5BUEA 2XK4A 1PXOA 4JIAA 1KSWA 2GTMA 2Y6MA 3LAUA 1YXTA 4FV5A 1XH9A 2YIYA 3F82A 5K4IA 2C6OA 2DWBA 1TQIA 2QONA 4QOXA 2IW6A 3WIKA 4YC6A 1OKVA 4NM7A 1WMKA 1OIRA 3VHKA 4AAAA 4BCJA 4IB1A 3W1FA 1PMNA 1JNKA 1O6KA 5IMEA 4D9TA 3TDWA 4MF1A 2FGIA 3MI9A 4N0SA 4RWLA 4FL3A 2C30A 4H3BA 4XG2A 5I3OA 3BYMA 4ALWA 2XB7A 3DCVA 3QRUA 4U80A 4FTJA 2WTJA 4NT4A 2WTDA 2YLFA 3OG7A 5CSHA 5FEQA 2ESMA 5J87A 5FBNC 2QU6A 4QMLA 2ZDTA 5I3RA 4I24A 3RPSA 2W05A 3EMGA 4LOPA 3QA0A 4LL5A 4LL0A 1YKRA 2JDVA 4QTEA 4GKIA 1SZMA 3A7HA 3SHEA 3GU5A 3BHHA 2CMWA 3SXSA 3CS9A 3GU8A 3WYXA 1BI7A 1OMWA 1LPUA 2E9UA 1W98A 3HVCA 4UZHA 3U9NA 2FB8A 2OG8A 5BVEA 4J53A 3AC5A 3EL8A 4BHZA 2FYSA 3MDYA 5DPVA 3M2WA 2GNIA 2PMIA 5DMZA 5CNOA 4HNFA 4M13A 4YNOA 4HYIA 3W8QA 3FAAA 4ONAA 1A06A 5LWMA 3MY1A 5FLFA 1K9AA 4FSMA 4D2TA 4KNBA 4DITA 5C26A 2ZB0A 3F2NA 3ZZWA 4XG7A 4CEGA 3G5DA 2XYUA 3UNZA 3JXWA 2VO0A 4G34A 3PVBA 1ZYLA 4LI5A 5IUGA 2C1BA 3P78A 3TL8A 3E92A 4G6OA 4IX5A 5EDRA 3FI4A 5EI2A 4C57A 1NY3A 3KGAA 3M1SA 4F9BA 3UQGA 2YITA 2VAGA 3LOKA 2EVAA 4MVFA 4FEXA 2QC6A 3FL5A 1NW1A 2F4JA 1CDKA 3PG1A 5GZ8A 1UKIA 4M97A 1SM2A 5A6NA 4CNHA 4KAOA 3PA5A 1YI3A 4KIPA 5L8KA 5AA9A 5IISA 3QD0A 4JDKA 4TWNA 3BLHA 4HPUE 4L6QA 4IAKA 4OTDA 4PL4A 2B7AA 4C7TA 3QRKA 4S33A 4CMOA 2BDWA 2GHLA 4PTCA 2B55A 1PXJA 5FTOA 4A06A 4QP9A 4ZTQA 2GNFA 5EDQA 4FOCA 4RA5A 4ZZOA 2XK8A 5B0XA 3BU5A 3PRFA 3UIBA 4QQCA 1M14A 1NVSA 2C6TA 2X6EA 3CGFA 3KCKA 4DN5A 4BKZA 4DFUA 4FKIA 2GFCA 3REPA 3GXLA 3F5XA 4RJ6A 3VUKA 4AN9A 3QQLA 3FMEA 3WF6A 3OROA 2ZV2A 3ZUTA 1OBDA 5M08A 5GINE 5DA3A 2ZOQA 3SAYA 3QHWA 2VGPA 3DKOA 4XOZA 4QMMA 4PF4A 4BTKA 4FIEA 3MFUA 5HQ0A 3B8RA 2BZIB 2YHVA 4FUYA 2YZLA 2XNPA 4WUAA 4D5KA 3RALA 2BROA 4EOIA 2G1TA 3MJ1A 4ZJJA 4EC8A 5LMKA 4AOTA 4Y5QA 4ZTLA 5J1WA 3GEQA 4CYIA 5HCYA 3TV4A 1JSTA 4RIWB 3ZRLA 4NUSA 3TNQB 4I6QA 4BGQA 4D0XA 4F7LA 3P23A 4EH8A 3MFSA 4UALA 5LQFA 3TZ7A 3VUTA 4USDA 3GNIB 5M06A 4FG8A 3R01A 4JDHA 1ZARA 2VRXA 2CDZA 3A7IA 3W8LA 4F0GA 3RMFA 3MS9A 2NRYA 3QKLA 4YGAA 4ZSGA 1JSVA 3RTPA 3ZXTA 2IZTA 3KRXA 4N6YA 2XS0A 4EOLA 4OTGA 4GKHA 5AJQA 3E8CA 4JT3A 1JVPP 3DBFA 4JJRA 4E4LA 1JSUA 3FV8A 3VJOA 4C4JA 4DFLA 1J1BA 3IW8A 3OF0A 4BBFA 4J8MA 2I6LA 1KE7A 2PUNA 2VTTA 4NM0A 5JN2A 5HLWA 2X81A 3CBLA 3MVMA 3FMMA 1MQ4A 2UW5A 3FWQA 4MK0A 3UMXA 4UWYA 2OLCA 3RWQA 2WMRA 3FZTA 4RZWA 3NNXA 3QWKA 4IC8A 4JG6A 1GY3A 2ZV7A 5CX9A 5CEIA 3PFQA 4L01A 3QTWA 4YLLA 4FKWA 3HECA 3QKKA 1QCFA 4EHZA 4EZ3A 3DXNA 4AX8A 4I22A 3KC3A 4D4VA 2R9SA 5EI8A 5A4LA 4MNEB 4B99A 1ZYSA 2X8IA 2Z60A 3D7TA 3AMAA 4RFMA 3DKFA 3CPCA 3FDNA 3OT3A 3R00A 3BHUA 4P90A 4FTTA 4R5SA 5DEYA 4DH1A 2V62A 5BVOA 2HWOA 2B0QA 2C47A 5FDXA 3WZEA 3MESA 4XLIA 3VVHA 4L7SA 4CFUA 3U87A 3OWPA 2C5XA 5KMMA 3LM5A 5L3AA 2C0OA 1SNUA 2I0EA 1ZOGA 4YBJA 1GZNA 3TNIA 4TRLA 3PY3A 1Q5KA 3AC8A 4E93A 3OTUA 2RGPA 5EG3A 5DT4A 4YMJA 4KSQA 4L53A 3R8MA 3P7CA 4OAUC 4RIWA 1KV2A 2Y4IB 5HLPA 3G2FA 1XQZA 5CSVA 5TF9A 2QOKA 4FEWA 2Z7SA 4HCUA 1PRYA 3W18A 3K5UA 3O0GA 4FV2A 5HCZA 3AC2A 3G51A 2E2BA 4HW7A 4QYEA 5HCXA 4DEEA 4K33A 3S2PA 3UG2A 5CEOA 2YWPA 4QP1A 4B8LA 4HVSA 5E1SA 4FV0A 2WMUA 4D1ZA 2H96A 2OXDA 2BALA 3W2PA 5CT7A 4DG3E 4RQVA 3DKGA 5FDPA 2Y4PA 2YEXA 3DAJA 2XIXA 4DC2A 3DDPA 3QHRA 4I5CA 4YZNA 2F7XE 2XNGA 2WQEA 3IONA 4KINA 3S95A 4BCOA 4CFXA 3NRMA 5J9LA 3ODYX 4GK3A 3NUSA 4UN0C 4QP6A 4BCGA 5FD2A 4KWPA 5EDPA 4F64A 4RVKA 3WI6A 4QMQA 3UNKA 3SW7A 3FPMA 2J7TA 5HO6A 1KE8A 4DF3A 2IVSA 4Q9ZA 4MWHA 1L8TA 4UYAA 1QMZA 5LOHA 5IUHA 1BI8A 3Q2MA 5K5XA 4E4XA 4D9UA 2G2IA 2VWVA 2BR1A 2O2UA 4D1XA 3AT2A 4GV1A 5CAQA 3I6UA 4M3QA 2BRBA 5CVGA 2R0IA 4P5QA 4EH4A 4IWQA 3HRCA 4RIXA 1PKDA 2ZB1A 4HYSA 4M84A 3R04A 1FPUA 3OCBA 4Y95A 3T8OA 4DCEA 4F08A 4YTIA 5BPYA 4BCHA 2CKQA 4DFBA 2PL0A 5BYZA 2CNVA 2QO9A 5CVHA 5AM6A 3QUDA 3C5UA 2O63A 4KUJA 3ENHA 4MXOA 1TVOA 2X7GA 3P5KA 4FKGA 5AP3A 3D4QA 3FPQA 4TYGA 2J6MA 4BF2A 5M44A 3CCNA 4L7FA 2JAVA 3IDPA 2EUFB 2ITUA 5DR2A 5CU4A 5JQ8A 5J5TA 4RA4A 2WTKC 4F1TA 3LCSA 4WG4A 5J5SA 3R0TA 3WZJA 5KHWA 1M17A 3OOMA 4I21A 3UIUA 4BB4A 3DQXA 1REKA 2UW6A 5HNIX 3D14A 4AP7A 4C02A 4NFNA 5LVPA 4GCJA 3ALOA 3ZONA 4IB3A 3LLAA 3VJNA 5KBQA 3OY1A 2WTIA 3F6XA 3BEGA 4V0GA 2JDTA 5IQIA 4JNWA 2JKKA 2X4ZA 5E7RA 3WARA 3JVRA 1PJKA 4XV1A 4JRVA 4JI9A 3NX8A 4AU8A 4U44A 3ET7A 5LVNA 3IW7A 4YO4A 2RFDA 4FSYA 3D2KA 3DPKA 4W9XA 5EW3A 5J8IA 3NNUA 3G90X 4RGJA 2PMNX 1U5QA 3PVWA 4XP2A 4ZSEA 4GW8A 3GGFA 2CGXA 2WTKB 1ZY4A 2V5QA 4J95A 3HV6A 4MBIA 3S00A 4EC9A 1X8BA 2X2MA 2YJSA 4IZAA 4X2JA 4KSPA 5C8KA 1J7UA 4Y72A 5DRBA 5FRIA 2HZIA 1H27A 4JDIA 1H07A 3CD3A 3VS3A 5AV4A 1NXKA 5FXSA 4E1ZA 3SLSA 3BHYA 4HVIA 3FKLA 4Z16A 1ERKA 3COMA 4J52A 5AADA 5AIKA 4CXAA 4MF0A 4XUFA 5FP5A 4YJOA 5A46A 5M55A 2R64A 5A4CA 4XV3A 3MH2A 5BQ0A 3A60A 3QL8A 3LKMA 3FXZA 5HBJA 1ND4A 4IACA 3D2IA 5DBXA 2OJ9A 4OTHA 5CT0A 2WGJA 1APME 4WKQA 3R1NA 2AC3A 3P1AA 1PXLA 3D83A 4XS2A 5EHLA 4ANLA 3PLSA 4FBXA 4Q9SA 4TW9A 3PUPA 4FTIA 5C4LA 4K77A 2YM6A 4R7IA 3KF7A 1Y6AA 2OJFE 3AT4A 5AP5A 4EOMA 1P4OA 2X2LA 4R3RA 3ORTA 4M69B 4WBBB 1QPEA 4LMNA 5HBEA 4L44A 3CJFA 5K0XA 3DXQA 5GIOE 2H8HA 3UOLA 2W7XA 4UMPA 4ALUA 4G9CA 5KE0A 2VTHA 5JFSA 2XNOA 4BCIA 2P33A 5AUWA 1YOJA 3GQLA 4G3DA 4I5MA 5DG5A 3DAEA 4AUAA 4DEBA 4D2VA 2DQ7X 4IAIA 2C3LA 5HZNA 3KXNA 3K5VA 3UVRA 4AZFA 4HNIA 2B52A 2W17A 3VAPA 4G3CA 4ZMFA 3F3VA 3BLQA 1FVRA 3HGKA 1Q8TA 2BAKA 2XK3A 4WUNA 5CI7A 5EH0A 3FHIA 3EWHA 3F3ZA 4FV8A 3UOHA 3OD6X 2R3JA 4EBVA 5IMXA 1W84A 3P86A 4I0SA 5A6OA 2XJ1A 5IQHA 4GH2A 3O8PA 2W1FA 4NJDA 4OAVB 3Q96A 5D7VA 4O22A 4UWCA 5D10A 2C6IA 2PE2A 4AQCA 5M56A 3MY0A 2HWPA 2XEZA 3PTGA 3V5PA 5AR7A 3E62A 3IDCA 3FEGA 5FM2A 4F99A 3VUDA 3OWKA 4UZDA 1M52A 3P9JA 4ZZNA 3R8LA 2WXVA 3ID6C 1IR3A 3JPVA 3MSSA 1KE9A 4NK9A 3ZCLA 4HZRA 3GOPA 3G33A 1BX6A 2HY81 1HCLA 4LGGA 2F2UA 4YBKA 3CC6A 3KRRA 3VHEA 3FI3A 5DVRA 2B9FA 3VS4A 1OZ1A 3FJQE 2WO6A 3V8TA 2X1NA 3PG3A 4G3GA 3I7CA 1QPCA 1PF8A 2YDIA 2VTSA 4PL3A 5EYCA 3FLZA 4CKJA 4W8DA 4IX4A 4J71A 4GUEA 5C8MA 3QQHA 4QNAA 4UWBA 2YN8A 3EIDA 2R7IA 3OBJA 4OBQA 3LFFA 3NYXA 1W82A 4DGLC 1LEZA 1UU9A 3JVSA 2QLUA 3FE3A 3KXMA 2RFNA 4EQMA 2X9EA 2GS6A 4CZYB 1O6YA 3KU2A 5CEPA 2G01A 4X3FB 4AOIA 4YHJA 2BIYA 4O2PA 2JITA 3OT8A 4I94A 4AE9A 2PVHA 3AC3A 1JWHA 3R21A 3V5WA 4AFJA 5ICPA 5B2KA 4C4FA 1UVRA 4TY1A 3EQFA 4AN2A 2WMSA 4DBNA 4HGEA 3OBGA 3PXQA 4U43A 4EORA 2EU9A 3CXWA 1H1RA 5BVNA 4FT7A 4E20A 4BIEA 5M53A 1RE8A 2WMXA 4X0MA 1JAMA 5ANIA 4CFVA 4NH1A 3HUBA 4FGRA 2F7EE 2PVRA 5JKGA 5HEZA 2PUUA 3BYSA 4BKJA 1M7QA 3T9TA 3QC9A 3LJ0A 5ETCA 2UW0A 2JAMA 3DNDA 4QYGA 3RPRA 3LCOA 5AR2A 4ERWA 4C4IA 5IZFA 2IO6A 5DIAA 4RRVA 2LGCA 4NCTA 4CMUA 4DG2E 2AC5A 4CTBA 1ATPE 3Q04A 2I0HA 3HNGA 3RI1A 5BNJA 3WBLA 1OBGA 3L8VA 2BPMA 3MPTA 3R22A 4AZSA 4ITHA 2QO7A 5I5ZA 4BWPA 1H1SA 4G9RA 4UX9A 4IANA 4ACCA 3C7QA 3Q2JA 3A7FA 4LM5A 2CN8A 3QTSA 1QPJA 2XCKA 4PUZA 4F4PA 4O7YA 3AMBA 4O86A 3R2YA 4YJNA 4KS8A 4JOAA 2ITNA 1CKPA 2BFYA 3O50A 5HNBA 4RLLA 3G6GA 3OUNB 2B53A 4D2PA 5CXZA 3PJCA 2XIYA 3AQVA 5CQUA 3S4QA 3I0OA 3FI2A 3NIEA 4LRJA 2HK5A 3CTQA 1CM8A 4BHNA 2OBJA 3DLSA 4H1MA 3EQHA 5BUIA 1KOAA 2VTPA 2XK6A 4BRXA 2W4OA 4EUTA 1FVTA 2QOCA 5GHVA 1UWJA 3RNIA 3FMNA 1DS5A 5FGKA 3UVPA 3KULB 3CLYA 2BHEA 4H3QA 4RPVA 4CRLA 4B8MA 2VD5A 2GQSA 2XZSA 3DTCA 3IW6A 3L1SA 5EKNA 2GS7A 1W0XC 5H8GA 4CD0A 3QZIA 2HXLA 3QRIA 3FC2A 2W1EA 1FGIA 3II5A 2OK1A 3ZOSA 5JFVA 5CANA 4MEDA 4DGMA 4BDCA 3BKBA 3MBLA 5AUXA 5H3QA 3FLSA 2HYYA 5TKDA 3SOCA 3MIYA 3V51A 3HAMA 3KMMA 2C6EA 5CU0A 5KMJA 2IN6A 1Q8WA 5CSXA 2Q0NA 3Q3BA 4EH2A 5AX9A 2R3GA 2RIOA 2DYLA 3LCDA 3MH3A 3SRVA 3TNWA 3OWLA 4IC7A 5IPJA 5DE2A 3NVMB 2VTJA 4P5ZA 3U54A 3UGCA 3QYWA 4ASZA 5EQPA 4UMRA 3TT0A 4ARKA 5CAPA 3M42A 3D5UA 5M57A 4ZS4A 1WBTA 5IQEA 2EXCX 4OLIA 4FTUA 2A0CX 1OGUA 3W2SA 3DK6A 3FKNA 3GOKA 4I4EA 4PDSA 5HNGA 5LVMA 5M4CA 2CPKE 2HZ4A 3C50A 4YJVA 1AD5A 5EYMA 2J5FA 3Q5IA 3ZH8A 4EWHA 3CE3A 4KBKA 5M07A 3DB8A 1OPJA 4U45A 4B4LA 2OI4X 2C1AA 2I0YA 3D7TB 2Z02A 1NA7A 3UPXA 3QCQA 4RX7A 4PWNA 4O7VA 5DT3A 5HG9A 2ITYA 4RLKA 5DR6A 2CN5A 4KKEA 3R7OA 3WE8A 1V1KA 4BTFA 4QPSA 3TIZA 3R71A 3D5XA 3GQIA 3UZPA 4C4GA 4BBEA 5L6PA 3GUBA 2J0IA 2BIKB 4JIKA 5ACKA 4CYJA 4YUQA 3QAME 4NKAA 2QR8A 5EYDA 3TM0A 4KD1A 4JBVA 1B39A 3QZFA 4JG8A 4S32A 4XG6A 3ORZA 5JK3A 3NYOA 4XMOA 4W4YA 4E3CA 4BIBA 3DAKA 3H10A 3LCTA 1GNGA 2HAKA 4ERKA 4L00A 2ZMDA 4I0TA 1RDQE 5ANGA 4DFZE 5AA8A 3UJGA 5IU2A 3R9OA 4QMZA 3RKBA 3AXWA 5BUJA 3R30A 3VULA 3F2RA 2PVJA 4NTSA 4CZTA 3GCSA 2VNWA 1WBVA 3R7GA 2WZJA 1GZKA 3CKWA 4JX3A 4XHKB 5B2LA 4O7ZA 3OUKA 3DT1A 3V3VA 4JQEA 2QQ7A 3QGYA 5CASA 3EFJA 3UP7A 4HCTA 4KABA 2YCFA 4IVAA 3HLLA 4FI1A 4S30A 3UVQA 5CF4A 2EXEA 4M14A 4D0WA 3ZS5A 5D7AA 4TWPA 2A27A 3I60A 1Y8YA 2C3IB 5H2UA 5BVKA 3F88A 2YIRA 4QQ5A 3MA3A 2OXYA 1PXMA 4G2FA 5ETIA 4RJ3A 2CLQA 4IXPA 4MH7A 1TQPA 3FC1X 5E91A 4IE9A 3DTWA 3GENA 3L8SA 4DH7A 4YJRA 4IWDA 1JPAA 4M7IA 2PVNA 3ZLWA 1G5SA 3BE9A 3P7BA 2V7OA 1KUTA 1P14A 3HMOA 2VV9A 1V0PA 1T45A 3MY5A 4WD5A 4NYEA 3ZO3A 4BYJA 2IZSA 2VO3A 3F3WA 1IAJA 2YACA 3KMUA 4DEIA 2JDSA 3C4XA 3ZM4A 3IS5A 3UQFA 1MRYA 4RVTA 4UY9A 2QOQA 4PL5A 3GCVA 3TV7A 4C4HA 4MD8E 2PTKA 3RAKA 3W55A 4FEUA 4DGOA 2CSNA 5ANDA 4JRNA 3GC9A 2ETRA 5IH4A 2UZOA 4D55A 4ZK5A 2WOTA 2WHBA 4CGAA 2J9MA 5HIDA 2BRNA 1YXUA 5IH6A 4IVBA 4MBJA 3TKIA 4O0UA 3VWAA 3G6HA 5TOZA 5ACBC 3HMIA 1Q99A 3WF7A 2GHGA 3R6XA 4NIFB 5EOBA 4DFYA 3Q4ZA 4DYMA 4EI4A 3A61A 3QTZA 3C0IA 3VS7A 3CKXA 3IQ7A 4BDEA 2OZAB 1T46A 2W1GA 2OF2A 3LXPA 4X2GA 3H9FA 4YJQA 2V7AA 4AOJA 4TYEA 1MRVA 5DN3A 3C4WA 3L9NA 1J91A 3FMKA 3DK3A 4JQ8A 2V0DA 4RIYB 4U6RA 3HZTA 5HHWA 1YQJA 4FT5A 4EH5A 2R3PA 4V0GB 4AXAA 2WPAA 5HBHA 3SC1A 4YR8A 3LFAA 3Q4CA 2XEYA 4ITIA 4E6CA 5IQDA 4DCAA 3QX4A 4PDYA 2P55A 2UZUE 3COKA 1ZY5A 4C8BA 3LQ5A 2VWZA 3PVUA 4UMQA 3OXZA 4A7CA 1OL7A 4L45A 2F7ZE 4KRCA 3BHTA 1SVGA 4YTFA 2CNQA 2WOUA 4R7BA 4CKIA 4O38A 4S2ZA 1OECA 4ID7A 4C3PA 5C4KA 3G9LX 3FI8A 2ETKA 1GJOA 4AA0A 3H4JA 2YIQA 3W32A 5A14A 3OEZA 3PZEA 1G3NA 4H36A 4ZTMA 3DBQA 4RBLA 3T9IA 4E5WA 3SG8A 1PKGA 3QXPA 4JDJA 5LARA 3B8QA 3TNPC 4FNYA 4F1MA 3VBYA 3ZRMA 4KBCA 1XH7A 1G8AA 3T3UA 1GIJA 5E8TA 5B2MA 1Q61A 2J0MB 1SYKA 1S9JA 2UVZA 5FG8A 2P2HA 3PYYA 3U9CA 1XKKA 2IJMA 3F5UA 3FZ1A 2P0CA 4RJ5A 3MW1A 2O64A 4M15A 4I23A 4MNEA 3VF8A 3BHVA 3RM6A 3DZOA 4JS8A 4QO9A 5ANEA 4CQGA 4PMPA 3DY7A 3TWJA 5L2TA 4XRJA 2YA9A 2OIBA 3PE1A 4GK2A 2R4BA 5KBRA 5KMOA 4WRSA 5JMSA 5CF8A 1R1WA 4ASDA 3EN6A 3FMDA 3ORKA 4FV9A 4HYUA 1BYGA 3IKAA 5FEDA 2FVDA 4KKGA 4PPCA 3BZ3A 3KN5A 5J95A 5CU3A 3LQ3A 2VN9A 2UZLA 4N57A 4TNBA 2WQMA 3QUPA 5J1VA 3KQ7A 2J50A 3PXYA 5A9UA 3F3UA 4YJSA 2PVYA 5IA2A 2C5NA 3VBVA 5HIEA 3KFAA 3BLRA 2J5EA 3R1SA 4AZWA 3FQSA 3FXXA 2OZAA 2XVDA 3DBCA 5JFWA 4PDPA 3PRIA 2PUPA 3QD2B 2ETMA 4FMQA 4B0GA 3RHKA 4W4VA 4DEGA 3D9VA 4HGTA 1QPDA 4WG5A 4RFZA 5E8WA 3F69A 4XP3A 3MFTA 5CU6A 1SMHA 2W9ZB 4GMYA 3QA8A 4YSJA 3AD6A 5E8ZA 5ETAA 2XH5A 1OIQA 2XNMA 1OL2A 3LIJA 3OMVA 3POZA 4AT5A 4C58A 1O6LA 5GJFA 3QUEA 2B9IA 1VR2A 4CKRA 2RF9A 3PWDA 5K5NA 2JBOA 3P7AA 4B7TA 5LCKA 4QP7A 4UXLA 3LMHA 2R3NA 4BN1A 1F3MC 2WFYA 3TCPA 4L67A 3L9PA 5A4QA 4ZTHA 4RC3A 1Y6BA 2W06A 2VNYA 3PZHA 3ZZEA 3D15A 3EB0A 4L3PA 2WTWA 3UO5A 1TQMA 1M2RA 1UA2A 1ZMWA 2XK7A 4EJNA 2CCIA 2R3OA 3E93A 3KVXA 5HICA 3QBNA 4ENYA 1GAGA 5FWKK 3QD4A 2YLEA 5ANKA 4UMUA 4FZAB 2ZMCA 2JBPA 4QD6A 5CENA 3ZEWA 1M2QA 2YDKA 1REJA 4YJPA 2GDOA 4ZTRA 4FTRA 2YAKA 3VUIA 4AACA 4BBMA 2J90A 2PZ5A 3KMWA 3C0GA 4C4EA 4CMTA 4XG4A 4O0TA 1PYEA 5TO8A 2PPQA 2JKOA 2YM7A 4EQCA 4NFMA 3ZFXA 4IB5A 3NUYA 4DINA 1WBNA 5DRDA 5KHXA 1PMEA 5HIBA 3ZC5A 3FMLA 3QQUA 3DBDA 3G15A 1Q24A 4FZFB 3AC4A 5AUUA 3CR0A 5IDPA 3B2WA 4E6DA 3ZO4A 5F95A 4YHTA 1ZOHA 2IPXA 4TN6A 4IAAA 1H25A 3HEGA 2BKKA 4IJPA 3DV3A 4CLIA 4PNKA 4Y83A 3ITZA 4XX9A 4XYFA 5LCJA 3R9HA 1OIUA 3MVLA 4X6RA 5IUIA 2G9XA 5JT2A 3RP9A 4MXCA 4YO6A 3HV3A 4LV8A 3R9RA 2ITPA 4YJTA 3FQHA 1DI9A 2OSCA 3DFAA 1E1VA 4JBOA 4AS0A 5L2IA 2VUWA 3E5AA 4GK4A 3CGOA 4O0WA 4PRJA 5HTBA 3F2AA 3RK9A 4AT4A 4IAZA 3ETAA 4C36A 3NYNA 4OTFA 4U8ZA 2ZV8A 5BMMA 2UV2A 3PXRA 4A4OA 1XBCA 1Z57A 4HGLA 4CV9A 4EOPA 4FV6A 4FV1A 2QOIA 2G15A 1YDRE 4PDOA 1U5RA 1FBNA 1YOLA 4D1SA 2R7BA 4J7BA 3D5VA 3VF9A 3UC3A 5AP0A 5LXMA 2VTNA 3K3IA 5KZIA 2XNEA 4XRLA 2XM8A 4BL1A 3TIYA 4UXQA 2OFVA 4WT6A 3ZDIA 5BVFA 3BWJA 1E1XA 4F9WA 4V05A 2XRUA 3PWYA 1YW2A 5AP7A 3EL7A 4LFIA 3KKVA 3V8WA 5IA0A 1L3RE 1HOWA 4RVMA 2I0VA 2OJGA 3U55A 4MXAA 3OW3A 3FZOA 3O7LB 2VWIA 3QRTA 3V6SA 4Q5HA 4X3JA 4D5HA 5IQCA 2YFXA 1PW2A 2J0LA 4O7RA 3I4BA 5HE0A 4XEYA 4BCFA 1M2PA 5EM6A 3VBTA 4A9UA 1A48A 1IA9A 2J0JA 1UNGA 3D7ZA 3EYGA 4FTOA 2OU7A 3BWFA 4YZBA 3VN9A 3ZLSA 1UU7A 2J51A 4C38A 1I44A 3KL8A 5CZIA 5IKWA 3ELJA 4P2KA 5AR8A 3ULZA 2I1MA 5J9ZA 3CY3A 2BFXA 2WNTA 3E8EA 4TPTA 4RX9A 2C3JA 4BGGA 3NNWA 4BWXA 5F20A 3Q60A 3O71A 2WB8A 3PSDA 3C1XA 3QLFA 5IF1A 1XR1A 4B6LA 3AG9A 3NIZA 4F6WA 2BRGA 3QALE 2CKOA 2OIQA 5JH6A 5AR3A 3V04A 4QMYA 3SX9A 4RWKA 5DYJA 3VUHA 5EM7A 1XBBA 4APPA 5GIPE 3R7VA 3ZUUA 4S34A 5AAGA 3PIYA 1YDTE 4WIHA 2NRUA 4FE2A 3LXKA 3PSBA 5CNNA 5IQGA 4IH8A 3GCQA 4XOYA 5L6WL 3ZC6A 3TNHA 3C4FA 2OF4A 1B38A 1OUKA 5L6OA 5FBOA 4ACMA 5FUTA 2ZV9A 3DJ7A 1U54B 3TZMA 3LHJA 5EQEA 4QMUA 3E7OA 5JSMA 4C3FA 4ZEGA 3C4EA 3QCXA 4AZTA 3V6RA 2BCJA 5DR9A 2FO0A 5AV2A 2PSQA 3NUAA 3JS2A 3I0QA 2GSFA 2JKQA 4GFGA 4MD7E 3ACJA 3HRFA 3MTFA 2X39A 4J1RA 4DLJA 4Z3VA 3FSFA 5I9ZA 4WNOA 3RK7A 4IWPA 5AUVA 3W10A 1UV5A 1WFCA 1OL1A 3HV7A 3E87A 3I5NA 3MB7A 4IAFA 3IW4A 3GC7A 5G1XA 4UV0A 4FF8A 2VTIA 4GT3A 3SVVA 4Z55A 3LFNA 2ERZE 3UIMA 2XYNA 4GRBA 3DNEA 4FSWA 1UWHA 5E8SA 5I9YA 3E63A 3GU7A 3E64A 5EW9A 4LMUA 5IA1A 4AGUA 4WO5A 2QI8A 1ZRZA 4FL2A 4BDKA 3RVGA 2HELA 3MPAA 2CLXA 4XH6A 4QMPA 1R0EA 5HX8A 4TNDA 3SW4A 4LUEA 1OL5A 3KXHA 3ZFYA 3RAHA 5D11A 3ZHPC 2XM9A 4H3PA 4PX6A 3F3TA 1CKIA 3F5GA 5H9BA 3R9DA 3EJ1A 3FZRA 2A19B 2E9NA 3DZQA 3TV6A 3PP1A 3ZLYA 3N4TA 4Y5HA 5EM8A 4WSQA 2ZM4A 5AUYA 1FVVA 2YERA 5F94A 4BYIA 2RFEA 2PVMA 4AW0A 2WEVA 2YABA 2CCHA 2VTOA 3DFCB 4QMSA 3FLWA 2ZVAA 5T68A 5IDNA 4M0YA 4NEUA 3NUPA 4QTBA 3ATSA 3FSKA 4K1BA 3NDMA 1BKXA 4LV5A 4O27B 3TTIA 4FEVA 4O91A 3ZDUA 2V22A 2W1CA 1OB3A 4CTCA 3EQIA 3H0YA 4FC0A 4ITJA 2W5BA 2VTAA 1QL6A 3QCYA 4WA9A 3NUNA 1OKYA 4U41A 4OTRA 1DAWA 4XV9A 2XBAA 1JQHA 5EKOA 3ZXZA 3PJ2A 4H05A 3ZBXA 4AWIA 3LQ8A 1S9IA 3IO7A 4AG8A 3F61A 3IOPA 4TKSA 3QGWA 4ZTSA 2QVSE 4G3EA 4IZ7A 4TWOA 3HP5A 3GI3A 2E9VA 3KREA 5HVJA 3NGAA 5GZ9A 4BTJA 1IA8A 2J4ZA 3BX5A 4DT9A 4CFMA 3PP0A 4YPSA 4ZJVA 2WMBA 5LMAA 1YWVA 2XRWA 4JXFA 4IX6A 3RPYA 3GC0A 1JKTA 3VRZA 3VS2A 4BR3A 2X2KA 3I79A 5AP4A 2P3GX 3UOKA 4F7JA 3L8XA 2RG5A 2HCKA 3DK7A 4I20A 5IQBA 4AGDA 4DT8A 2BHHA 5HKMA 2YM5A 4FL1A 2B9JA 4QMTA 1KOBA 3O17A 3PXZA 4UEUA 5DOSA 4ZY4A 2BTRA 4CLJA 2BKZA 4MHAA 2PYWA 3IGGA 3FY0A 3I6WA 2IZUA 3LLTA 2UW4A 1WBOA 3O96A 5HI2A 4R6VA 5K9IA 2B9HA 1GOLA 1XBAA 5CF6A 4NCTC 4BWKA 5CEQA 4F63A 1IASA 4FNZA 4Q2AA 4FA2A 4A9RA 3CJGA 2WTVA 4CV8A 1R0PA 5AAEA 4RC4A 4YHFA 2QR7A 3PA4A 3A2CA 5LMKC 3BYOA 2VU3A 5A3XA 3UP2A 3Q53A 2BZHB 3PE2A 3EZRA 5HG5A 4IX3A 1WBWA 2W0JA 4R1YA 2H34A 4GFMA 4IZ5A 4U3ZA 3QTRA 4V01A 5C9CA 4EONA 3FZSA 5H8EA 2JEDA 2PZPA 5A54A 2VWXA 3BBWA 3EQDA 3V5JA 4A07A 4PP7A 5DFPA 2XIKA 4EH9A 3BGPA 2ACXA 3LCKA 2HY0A 4ANMA 3GU6A 4FIIA 5AFVA 2UW7A 4IVDA 3TN8A 5DI1A 1BMKA 3MN3A 2R5TA 3PA3A 5DNRA 2UZVA 3A8XA 5ETFA 3I81A 2PZRA 3PIXA 2HOGA 1Q8YA 3FYJX 3OTVA 3PJ8A 4G31A 4F0FA 5IEVA 3C4ZA 4P7EA 3VO3A 5HD4A 4QPAA 5AP6A 3ANQA 5TT7A 3SRVB 5AAFA 2C68A 1FINA 3HMMA 5DGZA 1JKKA 4RIOA 4J98A 5HG7A 4FK3A 4JVGA 3THBA 2VWUA 3K54A 1XH5A 4YPDA 1FGKA 2R3KA 4O82A 3NCZA 2UVXA 3C9WA 2C6MA 3E8DA 4WHZA 2PMOX 4GUBA 1JBPE 4OTQA 4HZSA 3KB7A 2Y8OA 3NAXA 4CFFA 3O2MA 4M66A 4C34A 5KKRC 2W1HA 1H00A 2YIWA 3I5ZA 3ZSHA 4O6LA 3ALNA 5AEPA 4BDDA 3SGCA 3ZSIA 4RX8A 3U4WA 3PIZA 4G1WA 3ULIA 4AGWA 2Q83A 4AW2A 3BE2A 5LJJA 1YXVA 3ORXA 3GU4A 3QTXA 3QXOA 1Y8GA 2FSLX 3TKHA 3W16A 2PHKA 4GS6A 4U40A 3O23A 4OT6A 1UNLA 4W8EA 4E5BA 4ZSJA 2XKEA 3EQGA 4BI1A 5HORA 2ITVA 2OGVA 2GMXA 3NLBA 2OJJA 2Y4IC 3IW5A 2C4GA 5K0KA 5LVLA 2IW8A 3ZFMA 3TG1A 4OTWA 4EQUA 4Q5EA 3FBVA 3DS6A 2PWLA 1U46A 4KB8A 2XBJA 2YAAA 3Q9ZA 5ANOA 3FKOA 3ORLA 4EHEA 4ENXA 3U4UA 3NPCA 3SG9A 1VYWA 4R3CA 4AGCA 4BDBA 2BZKB 3M11A 5L2WA 2RL5A 4J8NA 3PLAE 5JZNA 3IECA 3NZ0A 2J2IB 4Y73A 4BCQA 1SNXA 3UQCA 3A7GA 3NNVA 3VQUA 3RAWA 2NO3A 1IEPA 4AZEA 4HVDA 4W4WA 3R8PA 2P4IA 4FSUA 2CGVA 2UUEA 4FKUA 4AF3A 1ZLTA 5AV0A 4A4XA 4BDGA 3LFQA 4O83A 1AGWA 1YI6A 3OFMA 5HTCA 4OR5A 2BDFA 3N4UA 5KMKA 4U81A 5C01A 2X0GA 4GL9A 4EK5A 1Z9XA 4K0YA 1ZAOA 3PPJA 4F6SA 3RZBA 2YCSA 3A99A 3HYHA 4IM2A 5CTPA 3WF8A 4D4YA 3H30A 4F70A 3NAYA 4QT1A 2JIIA 4ORKA 3DLZA 4H39A 4K8AA 4NZWB 2PVFA 2HXQA 4L3LA 3V5QA 2BTSA 3WYYA 4EOQA 4IB0A 1ZZ2A 2REIA 3FMHA 1Q4LA 5KMIA 2KULA 2R0UA 3E8NA 2B4SB 4Y8DA 2WU6A 4PNIA 5DH3A 3DA6A 5E90A 1VEBA 1H01A 4IADA 4EH6A 3TI1A 5IEYA 4C2WA 3HDMA 5HD7A 4Z7GA 5AR4A 4KIKA 4NL0A 5CY3A 1RW8A 3MA6A 4EK8A 1WZYA 4JAJA 3RBWA 4TL0A 4QMOA 4UB7A 3DJ5A 3FMJA 3RAIA 4NW5A 2OFUA 3Q4UA 4FK6A 4RIXB 4CFWA 4MXZA 4YC3A 3EQRA 4UBAA 3WZUA 4BZDA 3P4KA 5AP1A 1J1CA 3ZBFA 4IZYA 4G3FA 4YSMA 3AOXA 3ODZX 4JL9A 3WF5A 4L52A 5AUZA 4FTLA 2V55A 4FYNA 4LOQA 4O0RA 1YHVA 1JKLA 2JFMA 3AC1A 4RFYA 4IVCA 2VZ6A 3R73A 4GFOA 4RC2A 4XG8A 1E9HA 5CALA 5AP2A 2BAJA 3I1AA 3LW0A 4FIHA 5HG8A 2C6KA 2GTNA 5GJDA 1BUHA 3OOGA 4EWQA 5ITAA 3P0MA 4FNXA 3CY2A 2UZEA 4OTIA 4AW5A 3OC1A 1PXPA 2WQOA 4OTPA
chains in the Genus database with same CATH superfamily
5BMSA 2C69A 3QCSA 1J7LA 1MP8A 5HE1A 4ZS0A 1WVXA 2VO7A 1PXNA 4XNEA 2FH9A 2G2FA 3ML1A 4ZY6A 1LEWA 2ITTA 3OWJA 3PY1A 3OCTA 1STCE 3IG7A 4FG7A 4ASXA 5CEMA 1U4DA 3L8PA 4EUUA 2A2AA 1FOTA 2WMVA 3BELA 4PPBA 4U7ZA 2FSTX 3SKCA 3F7ZA 3VQHA 3WZDA 5FXRA 4OW8A 3HA8A 3TXOA 1SVEA 1H26A 3CTJA 3OVVA 5I9VA 4I4FA 2QOHA 1LP4A 2X7FA 4YNEA 2BRMA 1YXXA 3KXZA 2W4JA 3DOGA 4MXYA 4O7SA 2ZM3A 1H0VA 2JFLA 5J9YA 3BU6A 2X7OA 4HCVA 3T3VA 4X2KA 2J0KA 2UZDA 2P2IA 2ZJWA 2A4LA 3ROCA 4MKCA 5IA3A 4CFNA 2QCSA 3FLQA 3R7YA 4ASEA 1M7NA 3H9OA 5BVWA 1IG1A 3UTOA 3SXRA 5IQAA 4IFCA 4MXXA 3A4PA 3DB6A 4BCKA 3O8TA 3KA0A 5IA5A 5HU9A 4M67A 4O4FA 4FYOA 3ZU7A 3QTIA 1FMOE 4DBXA 4BY9E 4O21A 3QD3A 2GU8A 4FKTA 4BZOA 1F5QA 2X4FA 4A9YA 4E6QA 5D9HA 5M4FA 4BTMA 4GYGA 3BGZA 4MD9E 1H1QA 4DGGA 4FT0A 3IDBA 2CGWA 1GZ8A 1XH4A 4FZDB 5EM5A 4QEBA 2PZIA 4PV0A 1I09A 3MB6A 3VUMA 2GNGA 4TYHB 4XG9A 4A4LA 4HVHA 4QRCA 2HENA 2IZRA 3FL4A 4XP0A 5H8BA 3NWWA 4DH3A 3N51A 1J3HA 4E73A 1CTPE 4M68A 3W2RA 4FTKA 1A9UA 1VJYA 3DGKA 4USFA 3PJ1A 4R5YA 2ONLA 3FYKX 3LXNA 3OXIA 1OPLA 1RJBA 3COIA 5CWZA 3U8WA 3MWUA 4X6QC 3VBXA 4YZCA 3VS1A 4JBQA 4IIRA 4C37A 4ZY5A 3VONA 2XNNA 4P4CA 4Z7HA 3VBQA 2GNJA 3TJDA 5L8JA 4O0XA 3HMNA 2ZAZA 3V8SA 4F7NA 2R3LA 4ZMEA 3CIKA 2FA2A 2I40A 4M69A 3KRWA 4PMSA 4G5PA 1P4FA 2C5YA 4YZMA 1J7IA 4KKHA 4GYIA 2C5VA 3W0OA 4FIGA 4FKRA 4ANQA 4KRDA 3RZFA 4AZVA 5CSPA 3ZLXA 3R8UA 2Y6OA 4IM3A 5J7BA 3HDNA 3IPHA 3E7VA 3MYGA 3QC4A 4HYHA 4K2RA 3VS0A 4BC6A 5CLPA 1YHSA 3G0FA 4QP3A 4IDVA 3JR1A 4R3PA 2Z8CA 4ZLOA 5J79A 4CCBA 4OBPA 4ZLYA 3BEAA 4QMVA 2F49A 4LRKA 2C6LA 3AD5A 3DU8A 3H3CA 4FTCA 5B7VA 3W0PA 2H9VA 5A4EA 3TUBA 2VWYA 2ZYBA 3W33A 3P08A 3HL7A 5M4IA 2ITOA 3MV5A 3RCJA 2OWBA 1OUYA 2XKFA 4FKLA 2R2PA 4G5JA 3NS9A 3BYUA 3S3IA 5FXQA 5JFXA 2GHMA 3L9LA 1H1WA 3NW7A 3QQJA 2FSOX 3MVJA 5BVDA 3GCUA 5FTQA 4O7LA 1FMKA 4YZDA 3QRJA 3QZHA 2RG6A 3W2QA 2WMWA 3PPKA 3C0HA 2ITXA 2XIRA 3WOWA 2ZM1A 4ZLZA 3UZRA 3GP0A 4NM5A 3GBZA 4FTNA 4NKSA 3UYSA 4D58A 5JGDA 3NFGB 4DTAA 4RJ8A 2JKMA 1GIHA 3GT8A 3TZ8A 4YU2A 4TT7A 5F4NA 3MPMA 4E26A 3EOCA 5CSWA 4O1OA 3TZ9A 3QLGA 3KXXA 2YIXA 4GT5A 5KCVA 4K11A 3BV3A 5CS6A 3C5IA 2W4KA 4FJVA 2XIZA 3KULA 3OS3A 4O1PA 4YC8A 5CAOA 5CF5A 3PDTA 5C8NA 4FNWA 3EN4A 4N6ZA 1Y91A 1H08A 4FUXA 4I1ZA 3V01A 2BMCA 2OIDA 4CCUA 2ZFYA 4XLVA 4XJ0A 4GG7A 5E8UA 3OW4A 2O65A 3ZO1A 4DTBA 3COHA 4NSTA 3BPRA 5EOLA 4DGNA 3DDQA 2NPQA 4QP8A 5EW8A 4C0TA 1DI8A 3EFWA 4GU6A 4ZAUA 4DA5A 4BVUA 4EOSA 3SOAA 3HMPA 1H4LA 2VTRA 4HGSA 3P5JC 3DJ6A 4YJUA 4OGRA 4I92A 4MBLA 4WSYA 3JYAA 3UMWA 2QOBA 1ZZLA 4U79A 4FIJA 3KVWA 2XUUA 4CT1A 4L42A 2BZJA 4F1OA 3CPBA 3WZKA 4FODA 2IF8A 5HU3A 4BZNA 4F7SA 1IRKA 3OY3A 1ZXEA 4AN3A 4QMXA 1TKIA 4FEQA 1ZOEA 2UVYA 4JG7A 2IVUA 3FLYA 4R1VA 5FQDC 2PY3A 5CAVA 3ZUVA 5A4TA 4DEAA 5KO1A 1V0OA 3Q9YA 3A8WA 4ZSLA 3OCSA 3VS6A 2PU8A 3D94A 4FG9A 3ZRKA 4E8AA 2NYAA 4FKJA 3QTQA 4XCUA 5HOAA 1XO2B 2E9PA 5M51A 4IWOA 4MCVA 3HV4A 4QP4A 3F5PA 3WE4A 3ZEPA 4EK6A 5JRQA 4TWCA 3NVKI 5GNKA 4KS7A 3V5TA 2QODA 1PHKA 4LRMA 5T6KA 5J7HA 4FSNA 3CEKA 2GNHA 3MGYA 4FSTA 3NEWA 4MQ1A 2YDJA 5EHOA 2GQRA 2B1PA 2PVKA 3BU3A 3CQWA 3L9MA 5JGAA 1KWPA 4LUDA 3TUDA 5HGIA 4C33A 5BX0A 3BQCA 2HZNA 5KNJA 2BVAA 3C4CA 3W2OA 3O7LD 3KF4A 1F0QA 1K3AA 5EK7A 3TDVA 3R7IA 4F6UA 1K2PA 4ANNA 3UOJA 4BDFA 2PUIA 2PULA 3NYVA 4FSQA 4RG0A 4IHPA 4L9IA 4ZIMA 4NWMA 2WMQA 4C2VA 3SA0A 1R39A 4O2ZA 2EXMA 4MYGA 4WOVA 4EK4A 2Z7RA 4U3YA 4BCPA 3Q52A 2WAJA 3AGMA 3LVPA 4L68A 3U6HA 4BCMA 4BKYA 4BI0A 3EFKA 2RKUA 4ZJIA 3UPZA 4IM0A 4DEHA 3OZ6A 4PMMA 5C1QB 4AA5A 4X21A 4EKLA 3O8UA 4CQEA 4RJ4A 3EQCA 1VZOA 4V04A 4LQMA 2VGOA 1U54A 3PXKA 3Q6UA 2IVTA 3G9NA 3LM0A 3HV5A 3NW5A 1VYZA 2Z7QA 3ORPA 4G6NA 4IDTA 4QTAA 5D41A 5EQYA 3R83A 2XANA 5E8XA 4EHVA 3TUCA 2W1IA 4KA3A 1TFFA 1PMUA 2ZDUA 4FKVA 5HVYA 2F57A 3PPZA 1H0WA 2GPHA 5KX8A 1NT2A 3HP2A 2GS2A 3O51A 4EOJA 1NVQA 2DUVA 3BGQA 4H1JA 5HE3A 4DG0E 3I7BA 4U0IA 4PPAA 3TACA 4JBPA 2YISA 3QZGA 4D28A 5HO7A 4I5HA 2XF0A 3SDJA 1RQQA 1NVRA 1OL6A 3BBTB 4QMWA 2CGUA 1ZYJA 4YZ9A 4JLCA 4QQTA 5L2SA 4LG4A 4FKOA 4DEDA 4R8QA 4F9CA 4FSRA 4GT4A 4L43A 3RPOA 4L46A 2XKCA 4A9TA 1KV1A 2A1AB 3R8ZA 4D2WA 2XJ0A 2Y9QA 4TYJA 4FTMA 5EYKA 2VX0A 3CP9A 4DTKA 4FV3A 2GQGA 1TZDA 3F66A 4MQ2A 3EN7A 3GCPA 4U97A 4WRGA 4O0YA 4FT3A 5ANJA 2WKMA 2OH0E 4U5JA 3ANRA 1DAYA 3KRLA 3R7EA 3FY2A 2WEIA 3VC4A 2SRCA 4D2SA 3QFVA 3A4OX 1BL6A 5DLSA 4O7WA 1G8KA 2HIWA 3CTHA 3DKCA 4ZXTA 4LGHA 3VIDA 3ZYAA 4EHGA 4EYMA 1V0BA 2GCDA 3DQWA 2X0PA 4NJ3A 4XBUA 4I5PA 5C03A 3QQFA 4E7WA 3EN5A 4I0RA 5EI6A 4M0ZA 3LFEA 5CVFA 3ZMMA 1YVJA 2CHLA 4DHFA 3S0OA 4MWIA 3OP5A 3SD0A 4KIQA 3BIZA 4ZZMA 3ATTA 3TMOA 3R63A 4DH8A 2PVLA 4IQ6A 5K4JA 2H6DA 3ZSGA 4WNKA 5CXHA 4BIDA 1UU8A 4GIHA 4BGHA 5L4QA 4C35A 2WELA 2X8DA 2FSMX 1OKWA 2RSVA 2XJ2A 2X6DA 4TYIA 2PZYA 5AMNA 5IQFA 4UMTA 5CAUA 3BV2A 3VW8A 4C59A 1YOMA 2W96B 4FZ6A 4QYFA 1H24A 4ALVA 4K6ZA 2QU5A 2QKWB 3PXFA 3R2BA 4M8TA 2R3RA 4AT3A 3RM7A 1XJDA 2NNWB 2BUJA 1YDSE 3NUUA 1FQ1B 5AX3A 3GVUA 4PQNA 3BCEA 1Q41A 5LVOA 1W8CA 3CD8A 4ANOA 5K3YA 2Y7JA 5DHJA 2F2CB 4X7QA 4CG9A 3JUHA 5HTIA 3NSZA 1HCKA 2UW3A 5HESA 4IAYA 4EK3A 4F9AA 2BRHA 4O4EA 2WQBA 4DE4A 5EFQA 3OEFX 4OBOA 4FV7A 4ZOGA 5HX6A 3EKNA 5HE2A 4EOOA 2VWBA 2WU7A 2QG7A 1UU3A 3FUPA 2OW3A 4QNYA 5GJGA 4IBMA 1OPKA 1KE6A 3EQPA 4BICA 3PUFC 4Y85A 3FZPA 4NIFA 4GSBA 3QQKA 3NUXA 4IMYA 3RK5A 2G2HA 4DH5A 3LXLA 3JY0A 3QF9A 5FTGA 1ZMVA 4F78A 3EH9A 2VTQA 2WMAA 4E5AX 5AUTA 2YCRA 3QYZA 4EOKA 4RMZA 4GJ2A 1B6CB 4RIYA 2WQNA 1Q8UA 1YI4A 2YZAA 3VUGA 2R3IA 3C13A 2UW8A 1WBSA 3UDBA 2QOLA 2PMLX 3RINA 2F9GA 4GVJA 2YWVA 3HA6A 3U51A 4FKSA 3ORMA 4O0VA 3Q9WA 4APCA 2YM3A 5CEKA 2XKDA 2IW9A 5IH5A 1CMKE 2VWWA 5CZHA 3A62A 4GVAA 3VRYA 4FSZA 2YJRA 3H9RA 4KIOA 3NR9A 3TJCA 5JZJA 5M4UA 3EKKA 4NTTA 3TEIA 4PTGA 2B54A 4O0SA 5KMLA 1WAKA 5CYIA 4JAIA 4RT7A 5EHYA 4FT9A 5AWMA 2IG7A 5BYLA 4IFGA 2YCQA 5CU2A 2ONLC 4YTHA 3PY0A 1P5EA 4JQ7A 4EH7A 1YWRA 2HZ0A 5I9UA 2ITQA 2OH4A 3AMYA 5JQ5A 3BI6A 4NU1A 1CSNA 3KK9A 3UO6A 3HRBA 4DAWA 5JRSA 1OI9A 4N4SA 4BDAA 4W4XA 3D0EA 4ACGA 4FICA 5KZ0A 4FGBA 3RJCA 3UO4A 4DLIA 1WCCA 3NW6A 2RFSA 4RWJA 4J97A 3TTJA 4WG3A 4FVQA 4ZSAA 4QTDA 4M12A 2Z2WA 4TTHB 3UDSA 4GJ3A 3BYVA 1YXSA 4EKKA 3KEXA 4MX9A 4NM3A 4RWIA 3Q5ZA 5C27A 4AW1A 3CQEA 1R3CA 3W0SA 2XCHA 3UZTA 4KIKB 1URCA 2CKPA 3Q9XA 1ZYCA 4Y46A 3N4VA 1R78A 4ANSA 1ZWSA 4G6LA 4BDHA 2VX1A 4S31A 2EB3A 4OUCA 1H1PA 3E88A 2XK9A 3AT3A 3D5WA 5DWRA 2DS1A 2WIPA 2O3PA 4AA4A 3UE4A 1Q3DA 5D1JA 4A9SA 2VX3A 2QHNA 2WMTA 2UZNA 4BDIA 2KTYA 4YLJA 1Q62A 3RWPA 4CRSA 3R02A 4LV7A 4R77A 3GB2A 1GIIA 4PMTA 1KE5A 2PE1A 3R8VA 4K9YA 2WTCA 4G17A 3DBEA 4FKPA 4RX5A 2W1ZA 4XG3A 2GNLA 1ZMUA 3LFBA 4QYHA 4FTQA 4L8MA 5HO8A 3SQQA 5CI6A 5FEEA 4EH3A 1U59A 4FZ7A 4IJ9A 1XHAA 4J99A 2OICA 2PE0A 3FLNC 4TZRA 1JKSA 3QQGA 3VBWA 2C5OA 3QU0A 5E1EA 4ACHA 3N9XA 1AQ1A 5I9WA 1OITA 2QOOA 2XA4A 4G16A 2JD5A 5IA4A 5F1ZA 1PMVA 4QYYA 2QHMA 3R1QA 4F65A 4O81A 2EB2A 5I9XA 2VO6A 4W9WA 1OKZA 3FQEA 3SXFA 3KY2A 1W83A 3R9NA 3LFSA 3TKUA 3RHXA 3ORNA 3IK3A 5FP6A 2C0IA 2JIVA 2WIHA 2QOFA 3F9NA 3U6JA 2YM8A 2WD1A 4WNMA 1G8SA 5I4NA 4HOKA 4J96A 5KMNA 2Q0BA 4FVRA 4GEOA 3MVHA 3QX2A 4PY1A 3AGLA 2CNUA 4RJ7A 4D2RA 4DFXE 3ENMA 2BILB 3BRBA 4FX3A 4Z9LA 4D4RA 4IEBA 2C6DA 3E3PA 3EQBA 4PTEA 2UW9A 4I93A 5M09A 4MTAA 2QURA 5L8LA 2EWAA 1LUFA 4ZTNA 4AE6A 4O7NA 4EZ7A 3OXTA 2NP8A 3EYHA 1O9UA 2Z7LA 2OZOA 5DT0A 4DFNA 3V5LA 3R7UA 5DEWA 1WVWA 2O8YA 3QTUA 5KUPA 4GU9A 1OM1A 2XMYA 4RSSA 3OCGA 1Y57A 4RQKA 4TYHA 3UYTA 4BFMA 3KN6A 1OVEA 2QD9A 4RZVA 4CZUA 5JEBA 1P2AA 2JIUA 3LZBA 5E9EA 3HX4A 4FKQA 1LR4A 3GFEA 2A98A 2AQXA 3R28A 4YP8A 3VS5A 4E4MA 4QTCA 2OKRA 3A7JA 5KKRB 3VNTA 4HVGA 3ACKA 5JGBA 2E9OA 3H0ZA 3MH0A 4GG5A 3UC4A 3MH1A 4CSVA 4JR7A 5HLNA 1YWNA 4AXFA 2FUMA 2W99B 3OHTA 2R3HA 1XWSA 2XP2A 3VW6A 3E3BX 4C61A 5E4HA 3KCFA 5E8VA 3W2CA 3POOA 3JY9A 4R7HA 3ORIA 2O5KA 4WBOA 5AV1A 4CVAA 4E6AA 4EJ7A 2BAQA 2C3KA 4U42A 3K3JA 5AM7A 1PXIA 3EFLA 3EN9A 4ACDA 5GZAA 3RPVA 3LE6A 4X3FA 2R3QA 1H8FA 1PYXA 4GIIA 1Q8ZA 1XH8A 1JLUE 2VTMA 3CQUA 5AR5A 4D4SA 1UKHA 3LJ2A 3IGOA 3PSCA 2LAVA 3HAVA 2JC6A 4I6BA 1W7HA 3UG1A 5T3QA 3CSVA 3WF9A 3EZVA 4L3JA 5E92A 3ERKA 3P79A 3Q32A 3UIXA 4C62A 3S1HA 1YRPA 3MJ2A 3KXGA 4QPMA 2UZTA 1PXKA 2AYPA 4I3ZA 1PY5A 1Q3WA 3RCDA 4JR3A 3UODA 4C3RA 5LWNA 2GFSA 1GZOA 3BQRA 3MFRA 2YM4A 3WILA 1CKJA 5LMBA 4EYJA 3ZTXA 1XH6A 4FIFA 2W5AA 4KBAA 4X2NA 4N70A 1URWA 4U9AA 3PJ3A 4XV2A 2JDOA 2JDRA 4FR4A 4YTCA 3WIGA 3GC8A 4B9DA 4TXCA 4O7TA 2W5HA 2VTLA 3IOKA 2CJMA 5G6VA 3ZO2A 5TE0A 2ITWA 4ZP5A 3UBDA 2C0TA 2I7QA 1YHWA 3HUCA 3KRJA 4ANBA 4BDJA 4II5A 3MIAA 5IG1A 1MRUA 3NCGA 1JOWB 2IVVA 4EEVA 3LFDA 1Z5MA 3RNYA 1DM2A 4FOBA 2ITZA 4OT5A 5D12A 5AV3A 4QP2A 5AIRA 3RGFA 2XNBA 2R3FA 3ROYA 4PP9A 2OO8X 2X8EA 4LYNA 3HKOA 4IW0A 2X9FA 5F9EA 3R1YA 3GFWA 1BL7A 4FTAA 4O96A 4I41A 1ST4A 4YLKA 4XBRA 2UZWE 2ERKA 2QNJA 4I6FA 4NW6A 3KK8A 4MAOA 1WVYA 4HJOA 1MUOA 3QKMA 4I6HA 4QMNA 1BLXA 2CKEA 2R3MA 3LFCA 4BI2A 3Q6WA 1OIYA 5BYYA 5IEXA 2XAOA 1UNHA 2JLDA 4F0IA 4K18A 2W9FB 4E4NA 1Q97A 2QO2A 3FXWA 3DXPA 3NMUF 3PVGA 3LMIA 4BCNA 3EHAA 1ZYDA 2IWIA 3W0QA 3AD4A 4CG8A 4EBWA 3U6IA 2O0UA 3Q4TA 3F7WA 2HW7A 4O6EA 3B2TA 4LGDA 4X2FA 3ZM9A 4H58A 4JX7A 3FHRA 2HW6A 2OJIA 3SV0A 3LPBA 3G0EA 4EL9A 1WBPA 5E8YA 3UNJA 2W1DA 4RVLA 1SVHA 4HPTE 2OXXA 2QG5A 4FV4A 2JGZA 4FVPA 4O84A 4LOOA 4R78A 2Y0AA 4AFEA 3MTLA 5L2QA 3K2LA 4X3FC 2PK9A 2UZBA 4USEA 4F9YA 2AUHA 4F09A 4UYNA 2QKRA 4CT2A 4QQJA 1MQBA 3C51A 2QLQA 4EZ5A 3LJ1A 1H28A 3LMGA 4YURA 1IAHA 5I0BA 2BDJA 5CQWA 4MNFA 5TR6A 3QWJA 4WNPA 1EH4A 5HVKA 5FM3A 5BUEA 2XK4A 1PXOA 4JIAA 1KSWA 2GTMA 3UDTA 2Y6MA 3LAUA 1YXTA 4FV5A 1XH9A 2YIYA 3F82A 5K4IA 2C6OA 2DWBA 1TQIA 2QONA 4QOXA 2IW6A 3WIKA 4YC6A 1OKVA 4NM7A 1WMKA 1OIRA 3VHKA 4AAAA 4BCJA 4IB1A 3W1FA 1PMNA 1JNKA 1O6KA 5IMEA 4D9TA 3TDWA 4MF1A 2FGIA 3MI9A 4N0SA 4RWLA 4FL3A 2C30A 4H3BA 4XG2A 5BV3A 5I3OA 3BYMA 4ALWA 2XB7A 3DCVA 3QRUA 4U80A 4FTJA 2WTJA 4NT4A 2WTDA 2YLFA 3OG7A 5CSHA 5FEQA 2ESMA 5J87A 5FBNC 2QU6A 4QMLA 2ZDTA 5I3RA 4I24A 3RPSA 2W05A 3EMGA 4LOPA 3QA0A 4LL5A 4LL0A 1YKRA 2JDVA 4QTEA 4GKIA 1SZMA 3A7HA 3SHEA 3GU5A 3BHHA 2CMWA 3SXSA 3CS9A 3GU8A 3WYXA 1BI7A 3W0RA 1OMWA 1LPUA 2E9UA 1W98A 3HVCA 4UZHA 3U9NA 2FB8A 2OG8A 5BVEA 4J53A 3AC5A 3EL8A 4BHZA 2FYSA 3MDYA 5DPVA 3M2WA 2GNIA 2PMIA 5DMZA 5CNOA 4HNFA 4M13A 4YNOA 4HYIA 3W8QA 3FAAA 4ONAA 1A06A 5LWMA 3MY1A 5FLFA 1K9AA 4FSMA 4D2TA 4KNBA 4DITA 5C26A 2ZB0A 3F2NA 3ZZWA 4XG7A 4CEGA 3G5DA 2XYUA 3UNZA 3JXWA 2VO0A 4G34A 3PVBA 1ZYLA 4LI5A 5IUGA 2C1BA 3P78A 3TL8A 3E92A 4G6OA 4IX5A 5EDRA 3FI4A 5EI2A 4C57A 1NY3A 3KGAA 3M1SA 4F9BA 3UQGA 2YITA 2VAGA 3LOKA 2EVAA 4MVFA 4FEXA 2QC6A 3FL5A 1NW1A 2F4JA 1CDKA 3PG1A 5GZ8A 1UKIA 4M97A 1SM2A 5A6NA 4CNHA 4KAOA 3PA5A 1YI3A 4KIPA 5L8KA 4O4DA 5AA9A 5IISA 3QD0A 4JDKA 4TWNA 3BLHA 4HPUE 4L6QA 4IAKA 4OTDA 4PL4A 2B7AA 4C7TA 3QRKA 4S33A 4CMOA 2BDWA 2GHLA 4PTCA 2B55A 1PXJA 5FTOA 4A06A 4QP9A 4ZTQA 2GNFA 5EDQA 4FOCA 4RA5A 4ZZOA 2XK8A 5B0XA 3BU5A 3PRFA 3UIBA 4QQCA 1M14A 1NVSA 2C6TA 2X6EA 3CGFA 3KCKA 4DN5A 4BKZA 4DFUA 4FKIA 2GFCA 3REPA 3GXLA 3F5XA 4RJ6A 3VUKA 4AN9A 3QQLA 3FMEA 3WF6A 3OROA 2ZV2A 3ZUTA 1OBDA 5M08A 5GINE 5DA3A 2ZOQA 3SAYA 3QHWA 2VGPA 3DKOA 4XOZA 4QMMA 4PF4A 4BTKA 4FIEA 3MFUA 5HQ0A 3B8RA 2BZIB 2YHVA 4FUYA 2YZLA 2XNPA 4WUAA 4D5KA 3RALA 2BROA 4EOIA 2G1TA 3MJ1A 4ZJJA 4EC8A 5LMKA 4AOTA 4Y5QA 4ZTLA 5J1WA 3GEQA 4CYIA 5HCYA 3TV4A 1JSTA 4RIWB 3ZRLA 4NUSA 3TNQB 4I6QA 4BGQA 4D0XA 4F7LA 3P23A 4I6LA 4EH8A 3MFSA 2XALA 4UALA 5LQFA 3TZ7A 3VUTA 4USDA 3GNIB 5M06A 4FG8A 3R01A 4JDHA 1ZARA 2VRXA 2CDZA 3A7IA 3W8LA 4F0GA 3RMFA 3MS9A 2NRYA 3QKLA 4YGAA 4ZSGA 1JSVA 3RTPA 3ZXTA 2IZTA 3KRXA 4N6YA 2XS0A 4EOLA 4OTGA 4GKHA 5AJQA 3E8CA 4JT3A 1JVPP 3DBFA 4JJRA 4E4LA 1JSUA 3FV8A 3VJOA 4C4JA 4DFLA 1J1BA 3IW8A 3OF0A 4BBFA 4J8MA 2I6LA 1KE7A 2PUNA 2VTTA 4NM0A 5JN2A 5HLWA 2X81A 3CBLA 3MVMA 3FMMA 1MQ4A 3PFYA 2UW5A 3FWQA 4MK0A 3UMXA 4UWYA 2OLCA 3RWQA 2WMRA 3FZTA 4RZWA 3NNXA 3QWKA 3UDZA 4IC8A 4JG6A 1GY3A 2ZV7A 5CX9A 5CEIA 3PFQA 4L01A 3QTWA 4YLLA 4FKWA 3HECA 3KIOC 3QKKA 1QCFA 4EHZA 4EZ3A 3DXNA 4AX8A 2IEWA 4I22A 3KC3A 4D4VA 2R9SA 5EI8A 5A4LA 4MNEB 4B99A 1ZYSA 2X8IA 2Z60A 3D7TA 3AMAA 4RFMA 3DKFA 3CPCA 3FDNA 3OT3A 3R00A 3BHUA 4P90A 4FTTA 4R5SA 5DEYA 4DH1A 2V62A 5BVOA 2HWOA 2B0QA 2C47A 5FDXA 3WZEA 3MESA 4XLIA 3VVHA 4L7SA 4CFUA 3U87A 3OWPA 2C5XA 5KMMA 3LM5A 5L3AA 2C0OA 1SNUA 2I0EA 1ZOGA 4YBJA 1GZNA 3TNIA 4TRLA 3PY3A 1Q5KA 3AC8A 4E93A 3OTUA 2RGPA 5EG3A 5DT4A 4YMJA 4KSQA 4L53A 3R8MA 3P7CA 4OAUC 4RIWA 1KV2A 2Y4IB 5HLPA 3G2FA 1XQZA 5CSVA 5TF9A 2QOKA 4FEWA 2Z7SA 4HCUA 1PRYA 3W18A 3K5UA 3O0GA 4FV2A 5HCZA 3AC2A 3G51A 2E2BA 4HW7A 4QYEA 2XAMA 5HCXA 4DEEA 4K33A 3S2PA 3UG2A 5CEOA 2YWPA 4QP1A 4B8LA 4HVSA 5E1SA 4FV0A 2WMUA 4D1ZA 4AAYA 2H96A 2OXDA 2BALA 3W2PA 5CT7A 4DG3E 4RQVA 3DKGA 5FDPA 2Y4PA 2YEXA 3DAJA 2XIXA 4DC2A 3DDPA 3QHRA 4I5CA 4YZNA 2F7XE 2XNGA 2WQEA 3IONA 4KINA 3S95A 4BCOA 4CFXA 3NRMA 5J9LA 3ODYX 4GK3A 3NUSA 4UN0C 4QP6A 4BCGA 5FD2A 4KWPA 5EDPA 4F64A 4RVKA 3WI6A 4QMQA 3UNKA 3SW7A 3FPMA 2J7TA 5HO6A 1KE8A 4DF3A 2IVSA 4Q9ZA 4MWHA 1L8TA 4UYAA 1QMZA 5LOHA 5IUHA 1BI8A 3Q2MA 5K5XA 4E4XA 4D9UA 2G2IA 2VWVA 2BR1A 2O2UA 4D1XA 3AT2A 4GV1A 5CAQA 3I6UA 4M3QA 2BRBA 5CVGA 2R0IA 4P5QA 4EH4A 4IWQA 3HRCA 4RIXA 1PKDA 2ZB1A 4HYSA 4M84A 3R04A 1FPUA 3OCBA 4Y95A 3T8OA 4DCEA 4F08A 4YTIA 5BPYA 4BCHA 2CKQA 4DFBA 2PL0A 5BYZA 2CNVA 4MUQA 2QO9A 5CVHA 5AM6A 3QUDA 3C5UA 2O63A 4KUJA 3ENHA 4MXOA 1TVOA 2X7GA 3P5KA 4FKGA 5AP3A 3D4QA 3FPQA 4TYGA 2J6MA 4BF2A 5M44A 3W0NA 3CCNA 4L7FA 2JAVA 3IDPA 2EUFB 2ITUA 5DR2A 5CU4A 5JQ8A 5J5TA 4RA4A 2WTKC 4F1TA 3LCSA 4WG4A 5J5SA 3R0TA 3WZJA 5KHWA 1M17A 3OOMA 4I21A 3UIUA 4BB4A 3DQXA 1REKA 2UW6A 5HNIX 3D14A 4AP7A 4C02A 4NFNA 5LVPA 4GCJA 3ALOA 3ZONA 4IB3A 3LLAA 3VJNA 5KBQA 3OY1A 2WTIA 3F6XA 3BEGA 4V0GA 2JDTA 5IQIA 4JNWA 2JKKA