4HCUA

Crystal structure of itk in complext with compound 40
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
WVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Covalent inhibitors of interleukin-2 inducible T cell kinase (itk) with nanomolar potency in a whole-blood assay.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 263
sequence length 263
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hcuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hcuA01
4QP2A 1ZMVA 2GCDA 3BYUA 4GJ2A 4PTGA 3VIDA 3VS3A 2BZKB 4E26A 2R3PA 5CU4A 3MV5A 5JH6A 3GU8A 3NRMA 5AR8A 4DFYA 1KWPA 4AFEA 4E6QA 5EQYA 1OMWA 4QTBA 3LE6A 4AACA 2JKOA 4J53A 3MWUA 5FM3A 5HNGA 2GNGA 3OWPA 3ZRKA 4ASZA 4B6LA 4RIWB 2XK8A 3KC3A 3ZM4A 5A9UA 3OCBA 2WTVA 1ATPE 3O51A 2PZPA 1PYXA 3K54A 4N6YA 5EFQA 1CKIA 5IUHA 2XKEA 3D0EA 4H36A 4RZVA 4YJUA 3UQCA 2I0VA 5ANEA 3ROCA 2PWLA 3VUHA 4AOJA 5JFXA 3LFBA 5J87A 1YKRA 4OTPA 1M17A 3ORMA 1H8FA 3WIGA 5IDPA 2DWBA 4TNDA 5HTIA 2QLUA 3WARA 4PNIA 4BF2A 2C6IA 3UTOA 5A54A 2XNBA 2CNVA 4PPBA 5E8YA 5AX9A 5DLSA 1Q24A 2ZV7A 4XG9A 3NUXA 1SVHA 3P9JA 4P2KA 3EQGA 3GCSA 1YRPA 4LI5A 1JKSA 2GNJA 3GU7A 2P4IA 5L2QA 3QYZA 3SV0A 4Z55A 4FG9A 3PWYA 3SAYA 3U9NA 3I79A 3V04A 2VO0A 3FY0A 4XG4A 4CG8A 2I40A 3FSFA 3UVQA 4MQ2A 2PVJA 1R39A 5CSPA 5CU6A 3CJFA 4JIAA 4LV8A 3EKNA 2XCKA 3H9OA 3MVLA 4YZBA 4C4GA 1YXTA 2I6LA 2R3GA 4K11A 3ZSIA 2FSMX 4AZFA 2J51A 4KKHA 5HG7A 5CEKA 5HX6A 2YZLA 3NS9A 5E4HA 3FPMA 3G9LX 4FR4A 3SRVA 1OUKA 4TL0A 3QQKA 2WOTA 4YZCA 4RA4A 3C4EA 2XJ0A 4EUUA 2ITTA 3PPZA 3F9NA 1BUHA 3F88A 3KMUA 2VTQA 3OCGA 3ALNA 4NCTC 3AC3A 2CJMA 4LQMA 2C5VA 5TO8A 3NAXA 3I0OA 3AC2A 3GP0A 5IMXA 4MCVA 1YXUA 4ASDA 3GXLA 2UZOA 5KNJA 3MH0A 4LRMA 2YAKA 3FBVA 1BLXA 1PXLA 1H0VA 2JKKA 5KMLA 1T46A 3W8QA 3C5IA 3S95A 4E7WA 5CU3A 2QO7A 2VTLA 4PP7A 4OBOA 3LCDA 4U3ZA 4DH8A 2Z02A 3F6XA 5IQCA 3GEQA 5BVDA 4HVIA 4FE2A 3N4UA 5DT4A 3GCVA 4YTFA 4ZTSA 4RIWA 3K2LA 3MY0A 1M14A 4E20A 2WMWA 4KSPA 3OTVA 5DRBA 4A4OA 4IDVA 3RPSA 3JPVA 4JDKA 4FUXA 2JDTA 4QP8A 4AZVA 4DH7A 2XA4A 2PUPA 5EYDA 4FEWA 3HYHA 4QYFA 3LCKA 3QC9A 3R7GA 4WKQA 3PG1A 4YJPA 4L42A 1I44A 3QD0A 4M8TA 3ZFMA 3ZZEA 2OG8A 1Y91A 2Z60A 5HEZA 1JNKA 2HELA 3DBQA 4LGDA 1R78A 2Q0BA 2XB7A 4KBKA 2PVYA 2UVYA 4X0MA 1U5QA 2XK9A 4E1ZA 3PVWA 5CAQA 3UO5A 4J96A 4C4JA 2WMUA 1ZZLA 5HHWA 4FL3A 3KXNA 5ANOA 2VWXA 2PMIA 3BBTB 3DDQA 3VNTA 4E93A 3G51A 2ITXA 1VZOA 4W4YA 5CAUA 2CGWA 1UWHA 5FTOA 4A9YA 2HIWA 1Q8ZA 2XKFA 4E4NA 2HAKA 2VX3A 3E8DA 4O7WA 3Q3BA 3QX2A 1BX6A 4QOXA 5AIKA 4I94A 5E8UA 2ZMCA 5L6WL 3AMAA 4WRGA 4FT9A 4CSVA 4EOOA 1MP8A 2QI8A 3ZO1A 3CGFA 4M13A 3GU5A 3O2MA 2WTJA 1RE8A 4M7IA 2YLEA 3THBA 1Q4LA 4FKOA 4AW2A 3MDYA 4L00A 4P7EA 2W1CA 3VF9A 3A4OX 2BTSA 3AOXA 4FK6A 4BCIA 4YLJA 3V8SA 1IEPA 2XIYA 4FSQA 4G2FA 1KE5A 4X2GA 5HGIA 2LAVA 3VQHA 4EK5A 4QTAA 4J97A 5C26A 1UU9A 5L3AA 3C51A 2RG6A 4QYEA 3WOWA 3C0GA 4AZTA 4N70A 4RA5A 3D5WA 3QCYA 4S30A 4PP9A 5J9ZA 5HG9A 5JEBA 4MBLA 1XKKA 3ZBFA 4JQ7A 4P5ZA 3RNYA 2W06A 3RCJA 4AWIA 2BRGA 5ANDA 4O0RA 4O0YA 4LYNA 4BCPA 2UV2A 4U44A 5DYJA 1AD5A 3QUPA 3O23A 2XK4A 4NW6A 3V5WA 2C6KA 2OFUA 4ALUA 5TKDA 5JFVA 4WT6A 4BYJA 5KKRB 4HCTA 2CMWA 2VTAA 1Y8GA 1IA8A 3QALE 2RFSA 3E64A 1YHWA 3UNZA 3VJNA 3MH2A 4NIFB 4D55A 3TTIA 2WTIA 3ET7A 3LFQA 4TWPA 5IH5A 2RFNA 3KK8A 4ANSA 4R3RA 4AA0A 2OBJA 1IR3A 1LUFA 4H3BA 3R7EA 3FKLA 4EUTA 5CEOA 2HYYA 4DEIA 2G01A 4I0SA 4J98A 3RKBA 3MH1A 4JDJA 3PIXA 2PE0A 3UIMA 4QMNA 5IA1A 3WBLA 4I4FA 2X4ZA 3NR9A 5ANGA 4CRSA 1F3MC 2GQGA 3FMMA 4XRLA 4EKLA 2WELA 4UWCA 4ZSLA 4O96A 5DPVA 4YJVA 5A4LA 2C68A 4O6EA 4XP3A 4I4EA 2J0MB 2R3NA 3R28A 4G6NA 5DE2A 2XP2A 1OPKA 4AOIA 2XM8A 2H34A 3DU8A 3CPCA 4X6RA 5J8IA 4C0TA 1SVEA 5AP7A 3V6SA 4CTCA 4O83A 4IMYA 3D83A 3RAKA 4EOLA 2VUWA 4WA9A 3Q52A 2R3RA 4WSQA 5IA3A 2QOFA 1JKTA 3OWLA 4JS8A 1STCE 5CSWA 3GUBA 4I3ZA 4L7FA 5HO7A 3GI3A 4HYIA 3Q4UA 3HLLA 3RBWA 4C58A 3KF4A 2HK5A 3LVPA 4JAIA 1WCCA 4C61A 4O7YA 3CY2A 3ZC6A 4IH8A 3E8CA 3RP9A 4TWNA 3D4QA 3EIDA 2C47A 5DEWA 3QHRA 4BGHA 3MFTA 1E9HA 4DBNA 3DTCA 3SDJA 3D7ZA 2QCSA 2GQRA 1H01A 5LVLA 5CVGA 3OC1A 3S0OA 3RZFA 3KEXA 2XK6A 3EWHA 4G9CA 4FV6A 4UY9A 5JMSA 1LEWA 3KULB 5DVRA 5A46A 3L9LA 5HG5A 2OZAA 4KA3A 1K3AA 3DOGA 4BI1A 5K9IA 3EFWA 1VR2A 4DEAA 3AGLA 4AN2A 3ORKA 2FVDA 2BFYA 3PY3A 4U40A 4XV1A 4HVHA 5IEVA 5JQ8A 4C7TA 3QKKA 4ENYA 5AR2A 3A8XA 2IZTA 3UZTA 4C34A 4OTQA 3W8LA 5H2UA 2JIIA 4NIFA 3DZOA 5CS6A 3IPHA 1U46A 5FGKA 4CV9A 5EI8A 3D2IA 4MXAA 3DKGA 2H6DA 3U54A 4ZLYA 2OZOA 3RWQA 5LVOA 2FGIA 2XNMA 4WOVA 1SZMA 2XEYA 4L7SA 4O0VA 1J7LA 1FBNA 2F2UA 5LQFA 3OZ6A 3HKOA 3Q96A 3UNKA 1ZLTA 2WQBA 1BKXA 4MAOA 4ZSAA 4D4SA 5GZ9A 4RX5A 1XH5A 3DPKA 5JT2A 4D9UA 3FE3A 4XBRA 5JZNA 4CTBA 3KB7A 3TUDA 1RW8A 3EQIA 5JRSA 3EOCA 5TR6A 3ZCLA 5D10A 3DY7A 5CF4A 5HI2A 5HX8A 1REJA 4PUZA 4Y5QA 5A4TA 2BZJA 3ATTA 3LKMA 3FXXA 5T68A 3NNUA 2CNQA 1OBGA 4FV4A 4ZOGA 2QC6A 3O8UA 2VO7A 3BPRA 5JKGA 5KHXA 1OIQA 3GQLA 3QQLA 3F82A 4GU6A 4PDOA 4AGDA 3MI9A 3VUMA 2OF2A 5E1EA 2YM7A 3LIJA 2EVAA 3OXZA 5F94A 4ZY6A 4DTAA 1XBCA 2C0IA 5M4FA 2WIHA 2WQNA 2A0CX 4ZK5A 3FZPA 5E1SA 4PL5A 4RLLA 4L68A 4UALA 2BRBA 4DGNA 2Y0AA 3SOCA 2C3IB 5EKOA 3POOA 2OGVA 5IA4A 2F7XE 4NH1A 4ERWA 2C6EA 4AT5A 1RQQA 2R5TA 3PP0A 4F09A 4DEHA 2IW9A 4MNEB 3PXQA 3VULA 4F9AA 5A6OA 2IN6A 2QOOA 3B2WA 3M11A 3OWJA 4TTHB 3P1AA 2O65A 3KULA 4JRNA 4EH9A 3IS5A 3ATSA 5DOSA 5JN2A 4B8LA 3ZFYA 4ID7A 4CKIA 3FMHA 4QP3A 3VBTA 1GZNA 5BYLA 3ORZA 3UQGA 2W96B 3E8NA 3UBDA 2PVKA 3W2PA 5BVNA 2WOUA 4O91A 1V1KA 2XRWA 4YJOA 4AN3A 4ERKA 3MB6A 3HV6A 4HVGA 5KMKA 4DF3A 1KSWA 1PRYA 4RJ7A 3EN6A 4BWKA 2QKRA 4LMUA 5EYMA 1WBWA 2GSFA 3QD4A 3TEIA 4ZTRA 2VNYA 4F6SA 3OCSA 2QR8A 1Q97A 4FKRA 4BYIA 3MW1A 4ZY5A 1U59A 3HEGA 4AZEA 4FKVA 4U80A 5FTGA 3AG9A 3R2YA 2C0TA 3OXTA 1Y57A 4IX5A 4ZTNA 1IAJA 3SHEA 4F9CA 3P7AA 4LL5A 3R83A 4C37A 3M42A 3PY0A 4UXLA 3BYSA 4DGOA 2PZYA 2PZRA 3QXPA 4IE9A 4FTUA 2YN8A 4MTAA 4NT4A 1H27A 3KXZA 5AP2A 4CZTA 4TWCA 3UVRA 4D9TA 1OIYA 1YOJA 4KKGA 3MA6A 2O5KA 5HE0A 2OXDA 1OIRA 4GG5A 3QGWA 3E93A 5EW3A 2XUUA 4DEGA 4TKSA 2HW6A 2UW8A 4FV0A 4JBPA 4IW0A 5EM5A 2GFSA 4QMXA 3VBVA 4ACMA 5BUEA 1IG1A 2E9PA 3EQDA 5L2TA 3ZEWA 3I4BA 3P86A 3F5XA 3SW4A 3COIA 1Z9XA 2PMNX 3OCTA 4Q2AA 3B8QA 5TT7A 4EYJA 3F2RA 3I5NA 4UV0A 3ODZX 4W8DA 4ANOA 4D2RA 1UVRA 3QTZA 1JVPP 3LJ2A 4OTHA 4QQ5A 4YSMA 3II5A 5DNRA 5ANJA 2CNUA 1PXJA 3OP5A 5CAVA 3DLSA 3BHVA 5FD2A 3D5XA 4ONAA 2OK1A 5M07A 5DA3A 4PDYA 4S34A 3FLSA 3IDCA 2J4ZA 3DDPA 2B53A 5AJQA 5F95A 2VTMA 2Y4IB 3BELA 5CENA 4ZY4A 4QT1A 1FGIA 1QPJA 3LLTA 4QD6A 5T3QA 1YDRE 5CU0A 1ZOEA 4K1BA 4IC7A 5DR9A 3WZEA 4JDIA 2NRYA 3OUKA 4I21A 1R3CA 4OTFA 3OY3A 5JZJA 3LFCA 3NYOA 2BRHA 4FVRA 3V8TA 2UZVA 4NM7A 3ZDUA 5IF1A 3C0IA 1XHAA 2YAAA 1PW2A 3NLBA 4MXYA 3P08A 5KMIA 5KMNA 3GC0A 1NVSA 1H00A 1PXPA 3RI1A 1Q8WA 4BWPA 3VUDA 3HDMA 3NYXA 4QO9A 3VHEA 2IPXA 4A4LA 3FZTA 4LOPA 3ALOA 3LXNA 4ZLOA 4O7ZA 4XP2A 5IA5A 1Q5KA 4YJSA 4WRSA 3DA6A 4FTKA 2EWAA 3FI2A 4PMTA 4BCFA 4MNFA 3FMNA 5KZIA 1PKDA 3DQXA 3DKFA 3LFNA 4FOBA 4G3CA 3FV8A 4YHFA 5I9ZA 5BMMA 2OF4A 2PVRA 4TYHB 3ETAA 4K18A 4RT7A 3RJCA 3WF9A 5E8SA 5LARA 3QQJA 4NM3A 3BHTA 2PHKA 4B8MA 4AGWA 2H9VA 4G6LA 3FHRA 3TNHA 5DG5A 4QP4A 1Q8YA 3DBDA 4GL9A 1OL2A 1UU8A 3MY1A 2C3LA 4FTIA 1FGKA 4K2RA 4KKEA 3NGAA 4WO5A 5CEQA 4AZSA 3L8VA 4LRKA 3UDBA 3IDPA 3HRCA 3ZTXA 3TWJA 4I93A 4LMNA 2OIBA 4EK3A 2YCRA 4DFXE 3HV7A 1M2QA 5L2SA 2VTIA 4RVLA 3VAPA 3LHJA 1M2PA 2JLDA 3QUEA 1H1QA 1NY3A 4DT9A 3UC4A 2G2HA 4AX8A 1KE8A 1QPDA 1WBOA 2W1EA 3CTQA 4L9IA 5EW9A 4UMTA 4LUEA 2W1ZA 2YCSA 4QYGA 3P7CA 3BGPA 1QCFA 2YA9A 3EQHA 3U4WA 3LJ1A 4ANQA 2XF0A 2PZ5A 5D12A 2I7QA 4N57A 2XKCA 4YHJA 1KE9A 2EB3A 5I9YA 3FYJX 5EHOA 4R78A 3GCUA 1ZYSA 2WAJA 4EOQA 3O50A 3KRXA 3G2FA 5E91A 5DGZA 2F7ZE 4GW8A 4FZAB 1S9JA 4IZ5A 1MRYA 3VS2A 3QLFA 4FT5A 2QU6A 3T9IA 4A9TA 4BCQA 5HBEA 4XH6A 3HMOA 3OS3A 2CDZA 5ETIA 3GCPA 1XWSA 3TV4A 3F3TA 1OM1A 3QAME 4BI0A 3DBFA 4KIOA 5CSVA 4HPUE 4AUAA 3HP5A 4XG3A 2GQSA 3FDNA 2QNJA 3N4TA 4CMTA 3QF9A 2FSTX 4X7QA 3WZKA 4KS7A 5CVHA 3UMXA 5HOAA 4C3FA 3PWDA 4DYMA 2BROA 2VO3A 5GZAA 1PY5A 1G3NA 2HW7A 4GFOA 4P4CA 1BI7A 4M66A 5J9LA 4LL0A 4HNFA 3WYXA 3HMPA 1WFCA 1UU7A 2R3QA 4F1OA 2BKZA 3NUYA 5HIBA 5AEPA 5IA2A 5GINE 3A7FA 3KXHA 5LCKA 4K9YA 3SX9A 4YSJA 5L6PA 3GU4A 3HV3A 3OMVA 3R04A 4TYHA 5F1ZA 4ZSGA 4E4LA 3AGMA 1OL6A 4FTTA 2X8DA 4J7BA 2R0UA 5BPYA 2QG7A 2J50A 4F63A 5K0KA 5CF6A 4JQ8A 3A7JA 4HZRA 4ZXTA 3I60A 4RC4A 3I5ZA 4BKJA 5BUIA 2V7AA 2ZVAA 4CLJA 2YCFA 4KIKA 2QD9A 4ITJA 4GEOA 1TQIA 3D94A 1B38A 4AU8A 1ZZ2A 3QBNA 4QMZA 4JX3A 4O38A 4O0XA 4CYJA 3KXMA 3OW4A 1ZMWA 4ZSJA 4DH5A 4GUEA 3CEKA 4FVQA 2VTHA 1DAWA 2JITA 3VC4A 1M7QA 3ZUUA 5GNKA 3NIEA 3BYVA 4B9DA 5FRIA 4DH3A 4F0IA 4FMQA 4FSMA 4IXPA 2UW4A 4DFBA 2ONLA 3R0TA 4G3GA 4GMYA 4PTEA 3ORPA 4DGMA 5HCZA 5IMEA 3R8VA 5CLPA 3PXRA 5KKRC 4CRLA 3JR1A 3FQSA 3U9CA 3GFWA 2VD5A 4JT3A 1CKJA 2YABA 4XOZA 2X2LA 3ZYAA 4FSZA 4U97A 3SRVB 2VX1A 1CM8A 1UNGA 4DLIA 3KRJA 2W1FA 4D2TA 1ND4A 4WNPA 1BMKA 5AIRA 5AV4A 4BGGA 5HO8A 4C35A 5AUVA 3EYGA 4BRXA 5LMAA 5EDRA 3PXZA 4L45A 5EH0A 3QX4A 2R0IA 4FZDB 5HG8A 2WMXA 3OTUA 4MVFA 5FXQA 4V01A 2XEZA 4NZWB 4BDEA 4PL4A 4V05A 2B9FA 3UIUA 2G1TA 4ZLZA 1YHVA 3DV3A 4LFIA 4EKKA 3QZFA 5B0XA 2NNWB 4FTJA 4EWQA 4CD0A 1UNLA 3IQ7A 4RLKA 5ETFA 5IKWA 3AD5A 5F4NA 5IA0A 4DT8A 3SOAA 2C3JA 4ACHA 5JSMA 3BEAA 3MS9A 2E9OA 3FZRA 3GNIB 3LJ0A 3ZMMA 3DAEA 1G5SA 3KQ7A 3MGYA 4AGUA 3UZRA 4RMZA 3U51A 1Q8TA 4QNAA 1XH6A 3R22A 2IW8A 1QPCA 2BILB 4OR5A 3UGCA 3TV7A 3R1SA 1BYGA 5HLPA 2J2IB 4ZZMA 3D2KA 4DG2E 4GG7A 3VS1A 4X3FA 2DQ7X 1O6KA 3U6HA 2C1BA 4LUDA 3Q2MA 4UMQA 2QG5A 3ANRA 3I6UA 3D5VA 3K5UA 4U45A 4ZTHA 2IO6A 4FV1A 3MJ2A 2XBJA 2ITPA 3F61A 3A4PA 1OUYA 3R2BA 3V5TA 3DT1A 4L3JA 5IQIA 1OZ1A 2UVXA 3NPCA 4CFWA 5I4NA 3GFEA 4JDHA 4AQCA 4F7NA 5HLNA 3T8OA 1K9AA 1Y6AA 2FH9A 5B2LA 3QWJA 5LMKA 3HRFA 2VGPA 4EBWA 2C5YA 4KSQA 4QMPA 1W0XC 4QMLA 1OPLA 3IW7A 3PIYA 4IBMA 3VS7A 3K3IA 2ERKA 1E1XA 1TQPA 5AUYA 4ZSEA 4CV8A 5C4KA 2HY0A 4M97A 3SXRA 4FEUA 5IQHA 2W9ZB 4DEDA 2BRNA 3E8EA 4TYGA 2OIQA 1JOWB 3RTPA 2C30A 1G8SA 3QKMA 4R8QA 4FBXA 2V7OA 1ZMUA 1OL1A 4FSTA 3HV4A 4FSNA 4ANNA 4XV2A 3CR0A 5TOZA 5LWMA 4F7SA 2C0OA 3GQIA 5IU2A 3TJCA 4I23A 1WAKA 3FC1X 1DI9A 3UP7A 2I1MA 2JDVA 2XM9A 3QLGA 2A2AA 3VUTA 2PMLX 5C4LA 4ORKA 1F5QA 4BIBA 4D1XA 1DAYA 2ITVA 3NNVA 2OW3A 1MUOA 5CZHA 4K6ZA 2XIKA 3A7IA 4EQUA 2R64A 3BYOA 3S3IA 5L4QA 5E8VA 3EJ1A 4CZYB 4U7ZA 4AGCA 4Y72A 1NA7A 4FIHA 4KIPA 3MVMA 5CT7A 4EZ5A 1H08A 5B2MA 5HU3A 2XK7A 4FTMA 4ALWA 4USFA 2C6LA 2RFEA 3H10A 4GVJA 4YURA 4DTBA 4QP7A 5M06A 3ZSHA 4QMOA 4L52A 2VGOA 1JLUE 2B54A 3NYVA 2P33A 3BGQA 5BVKA 3TACA 3NUAA 4IAFA 5I5ZA 5FEEA 3ZUVA 4F7JA 5AP1A 4FIGA 3CC6A 3V8WA 3ORXA 4D5KA 1WZYA 3E7VA 3QTSA 4TN6A 2XIRA 2WNTA 3H30A 4ZMEA 3VUKA 2QOKA 2OJGA 4O0SA 4QYHA 2YWPA 4AG8A 2ITZA 3PVBA 4IVBA 3Q2JA 1WVXA 2EXMA 3BE9A 1PXKA 3AC4A 5IQAA 2WQEA 4FZ6A 4GK2A 3WI6A 5LCJA 3PPJA 4RWJA 4KD1A 1OVEA 4E4XA 4FTLA 3T3VA 2ITUA 1SNUA 4I6QA 1M7NA 2VAGA 2HZNA 3HMMA 2O63A 5AV3A 3PJ2A 3FMKA 5LVPA 4W4WA 3BV3A 2UUEA 2V5QA 3R30A 4IACA 4AFJA 5KBQA 5J5SA 3E7OA 1Y6BA 4RC3A 3R00A 2XJ2A 4AW5A 3HMIA 4C4FA 2JIUA 3AMYA 4IEBA 4QPSA 3WF5A 2AC3A 3A2CA 2VWUA 4S33A 4G3EA 4I6BA 4CVAA 4PV0A 4C8BA 4TW9A 1PMEA 2GS6A 3BBWA 4E3CA 3MPAA 3P7BA 2VU3A 2J90A 4ARKA 3RK7A 4O86A 5ITAA 5HE1A 1V0BA 3DXNA 4EH6A 2NPQA 1OKZA 4F65A 4Y85A 5K0XA 3PJ8A 1YXVA 3PIZA 4IAZA 3PVGA 4Z7GA 1JBPE 2UZDA 5DT3A 2X8IA 3IGOA 2QOLA 2IWIA 2PE2A 5A4QA 2YITA 4X3JA 4AS0A 3H0ZA 2E9NA 3MB7A 3NWWA 4AOTA 3HRBA 4C3RA 4PDSA 3PA4A 3SVVA 3MBLA 3E3BX 4F9WA 4QP9A 3FXWA 2C6MA 4RWIA 3FSKA 4W9WA 3SQQA 4QRCA 3OT8A 3EFJA 1CSNA 3U6JA 1DM2A 1WMKA 4NKSA 4FKJA 3ZS5A 5EKNA 2YM4A 5D9HA 4JNWA 2F7EE 3QCSA 4OTWA 3PTGA 4O84A 3KKVA 4HCUA 3EFLA 4IVCA 4D1SA 5BMSA 3MESA 1KE6A 2JKMA 4QMUA 3TZ8A 2OZAB 4LGGA 1Q41A 5C1QB 4FX3A 4TZRA 3VW6A 3AT2A 4FTNA 5AP5A 4KAOA 3K3JA 4AE9A 3GVUA 2BKKA 4O81A 4CFNA 2IJMA 5B7VA 3UIXA 4X2NA 1VYWA 3A62A 5K3YA 2YISA 3G0FA 2GNIA 3E92A 3EN4A 3QRJA 3AQVA 4WBOA 3BHHA 3ZO2A 4FA2A 5K4IA 3BIZA 3GC7A 3OW3A 2YDJA 2BR1A 3WYYA 4WG3A 4D1ZA 4H3PA 3NZ0A 2X4FA 4JQEA 4WUAA 1AQ1A 2GNLA 4PQNA 4BFMA 5AADA 2W4KA 4ASEA 3SA0A 5AR3A 4DGLC 2IZRA 2R2PA 4I41A 1PMVA 4G5JA 4I0RA 4NUSA 4DCAA 2WMAA 3P5KA 3H4JA 4J99A 3NMUF 3FC2A 2JBPA 5HTBA 2Y4IC 4BICA 3PSCA 4XG7A 3RM6A 3VRZA 3OT3A 2GU8A 4FTQA 3PXKA 2R3OA 3RK9A 4F64A 3CKXA 5IZFA 4E5WA 4L3LA 2FA2A 5CSXA 4DAWA 1PF8A 4FKWA 4IAAA 4IM0A 2QO2A 4F08A 3PA3A 4MXCA 4D58A 2B55A 4RX7A 5CXHA 1I09A 2WMTA 3WF7A 4RJ4A 4AW0A 5BNJA 2PVFA 4LGHA 3TNWA 3BLRA 1H24A 3AT4A 5LVMA 2BFXA 4S31A 2QVSE 2YZAA 2UZLA 3JVRA 3UG2A 3AC5A 5FDPA 4YC3A 2XNOA 2QHNA 3K5VA 4ZJVA 3PZEA 3JYAA 5HE2A 4BZNA 4RFYA 2QODA 3HVCA 5KBRA 1ZYJA 2W05A 4HPTE 5CT0A 3LQ8A 4YZ9A 5CEPA 3F3ZA 2OJFE 2PVMA 3PSBA 4JG7A 3UIBA 4EL9A 4JIKA 4TYEA 1NVQA 4BGQA 3BEGA 2XYUA 2IW6A 1Q99A 1H1SA 3R8LA 4FNYA 2W4JA 4XYFA 3E63A 2OFVA 4NEUA 4FKUA 3C4FA 3IW8A 4QMMA 2W5AA 3A8WA 3F7WA 1JQHA 3NCGA 4A9SA 5CEIA 3QQUA 3KFAA 3D15A 4WUNA 4ENXA 1BI8A 4TYJA 5DMZA 4I20A 1LP4A 4EH7A 1XBAA 3RHXA 1P4OA 1P2AA 3Q6UA 2VTSA 5AM6A 3VUIA 4TRLA 2ZV8A 2VTNA 3CY3A 2QU5A 3P78A 5J79A 3ENMA 3F7ZA 4M69B 3QTQA 4D4RA 4WG5A 3O7LB 5IQBA 1H28A 1U5RA 2YM8A 5BVFA 3IO7A 2HXQA 2XH5A 1J7IA 5DN3A 4GKHA 2WKMA 2B4SB 3PYYA 2C6DA 4EK8A 1ZY5A 2YDIA 3FLQA 3C4CA 3QC4A 4ALVA 2YJRA 4NM5A 4K33A 4D2SA 3C9WA 3C50A 3R63A 4R7IA 3C5UA 3TJDA 2GPHA 2QONA 2ITNA 4NWMA 1CKPA 1H26A 2ETKA 4O2ZA 3TTJA 4G1WA 3W1FA 1JSVA 2WEVA 3MN3A 4BDDA 4RVTA 1J3HA 2EXEA 5CF8A 4HYUA 1M52A 5L8JA 1URCA 2CLXA 3QXOA 4A9RA 4QP6A 1R1WA 4RG0A 2PL0A 2Y4PA 2X1NA 2PSQA 3HL7A 3WZUA 3SLSA 3RM7A 4EK6A 3N51A 4HYSA 2CCIA 4L46A 4MBIA 4BDGA 3HDNA 3BGZA 3G6HA 4FV8A 4XHKB 3GU6A 1YI4A 3I81A 2WHBA 4UZDA 2CGVA 3MPTA 3FLYA 2AUHA 4BDIA 3DK7A 3PJ3A 5JGDA 2BVAA 3BI6A 3HV5A 2SRCA 2RF9A 3O8PA 4O7RA 1OIUA 2H8HA 4FKTA 4HGTA 3ZUTA 5EM6A 2VN9A 3UO4A 2W1GA 3OF0A 2HXLA 2R3JA 4RX9A 4UWBA 5AUXA 3FI3A 4JR3A 3KK9A 4WNKA 4IHPA 3O8TA 4C02A 2PVLA 3IG7A 3R7YA 2X7FA 2RL5A 1UV5A 3U8WA 1JAMA 1PXOA 4YJTA 5E8WA 3U87A 4A07A 2OIDA 1O6LA 4CCBA 5LMBA 2PULA 3MFUA 3ZBXA 2KULA 3H0YA 4XUFA 3Q9YA 4R5SA 5AV1A 1FQ1B 4BBMA 2CN5A 2GNFA 2YJSA 3FUPA 4FZFB 2R4BA 4S2ZA 3S1HA 4UX9A 2HENA 5EQPA 3LFSA 5H3QA 2C1AA 4Y95A 3UZPA 4YJRA 4DN5A 2EU9A 4FVPA 4I0TA 4EH5A 5AX3A 4YU2A 5L8KA 1G8AA 2PUIA 4Q9SA 1F0QA 1UKHA 2F57A 4H39A 4JR7A 4U8ZA 5LMKC 4GFGA 5DIAA 4TY1A 3D7TA 4AE6A 4FZ7A 4RJ8A 1FMOE 1ZAOA 4EJ7A 3BU6A 4EHGA 2WXVA 3V5PA 3M1SA 4M69A 4BWXA 3FMEA 3IK3A 2W0JA 3H9RA 4FL2A 4JBOA 1SYKA 5EI2A 4AXAA 3QD2B 3F3VA 1URWA 1J7UA 4YHTA 2ZDUA 4TXCA 3FY2A 3NUUA 1UNHA 2FUMA 5EOLA 4E4MA 3DGKA 4M15A 4M68A 4RIXA 5DR2A 1SMHA 3VF8A 2P2HA 4O7SA 2A19B 3Q53A 4HGEA 4ACCA 4YBKA 4DFNA 3G6GA 4GV1A 3DKCA 3WIKA 3GB2A 3GBZA 4D2WA 3PE1A 4ZS0A 5C01A 2J6MA 3LPBA 4NJDA 1YWVA 1GZKA 4EH3A 1V0PA 4FIJA 3UPXA 2W17A 3PSDA 4TPTA 4UEUA 2WIPA 3IW4A 4E73A 4N0SA 3HUBA 2HZ0A 2OO8X 1H1RA 3QTIA 2BALA 5E8XA 1AGWA 3P4KA 5A3XA 4AT3A 3UNJA 3I7BA 3DXQA 4JJRA 4HZSA 5CVFA 4RSSA 3C1XA 4FKLA 4K77A 4JAJA 4XV3A 5HO6A 2UW7A 5AUTA 4NCTA 5IDNA 5IEYA 3NUPA 1WBNA 2J0KA 2X81A 4EOSA 1PJKA 1JKKA 3RPOA 4BHZA 4Y5HA 1OKYA 3MTLA 4IB3A 2JAMA 2UW9A 2P3GX 4HCVA 5A6NA 1B39A 3EQRA 3TIZA 2R3KA 4IZAA 3FI8A 2RSVA 4BDBA 4BZOA 2ZB0A 3LFEA 3NUNA 4U0IA 4C3PA 5KZ0A 3PG3A 2PVNA 5JFWA 2EUFB 1OB3A 5ACBC 2ZV2A 3MA3A 2YFXA 4GYGA 3T9TA 5I0BA 1W82A 2HWOA 4MEDA 1WVWA 3BHUA 3FL5A 4BCGA 2O3PA 4CFXA 1RJBA 1ZXEA 4QP1A 4EQCA 1TQMA 3LXLA 3TXOA 4C2VA 4BBFA 4DFUA 4XLIA 3SG9A 4FKPA 3R6XA 4RGJA 2JD5A 2ZV9A 2YIXA 2I0HA 4F0FA 4OUCA 2OWBA 4BC6A 3AC8A 3LQ5A 4E5BA 4IJPA 5EG3A 4EI4A 3JY0A 4QMVA 2Q0NA 3V5QA 3MH3A 2CPKE 4JXFA 4TWOA 4FTOA 5GJDA 2OKRA 5CYIA 2QHMA 4RVKA 4DFLA 3EN5A 5HCXA 5DI1A 2XS0A 3OFMA 3ORIA 1H1WA 3QTUA 4BTFA 2PU8A 5H8EA 4Y46A 4HYHA 5CXZA 3NW5A 5E9EA 4EZ7A 3DTWA 2IVUA 3QQGA 4N6ZA 4FV9A 2UVZA 4D5HA 5K5NA 3HNGA 3V5LA 5JRQA 4FSWA 4L3PA 4ZS4A 1Y8YA 3RALA 2WTDA 4KIKB 4XS2A 2GHGA 4BCHA 2UW5A 3TNIA 3LCOA 3UG1A 1R0EA 3RWPA 4RZWA 3UE4A 4C4EA 5T6KA 4PMPA 5J7BA 4FT7A 3O17A 3P79A 4EZ3A 4GKIA 4YUQA 3QQHA 1Z57A 3O96A 4Q5EA 3FEGA 2HZIA 3CLYA 3ELJA 4GJ3A 3R7IA 2GFCA 5GJGA 3R71A 4IM2A 4BDCA 1ZYCA 4NU1A 5D7AA 3CJGA 5A4CA 4O2PA 4OBPA 4IANA 2B1PA 3EQPA 4O0WA 4XEYA 4CFUA 3E3PA 3DS6A 3EL8A 4FTRA 4QMQA 5IQGA 4YBJA 2OI4X 3NUSA 3DNDA 3GENA 3QKLA 4U42A 4O1OA 3BLQA 4YZNA 5M09A 4O6LA 4J52A 1IA9A 5KHWA 2VNWA 4KB8A 2PUUA 3MIYA 1RDQE 5IUIA 4EOMA 3BQRA 3W55A 5KUPA 2Z2WA 4O22A 4D2VA 1O9UA 2XNNA 4K8AA 2XNEA 4PY1A 5ETAA 5HE3A 4Z9LA 5D41A 3FMDA 1VJYA 4X2FA 4GK3A 3WE4A 3FMJA 4QPMA 5J9YA 3PY1A 2X6EA 4UMRA 3SC1A 2EB2A 2BUJA 4A9UA 5K5XA 4FIFA 4BY9E 4IB1A 3BHYA 2X0GA 2WQOA 1J91A 3OEFX 3MYGA 4I22A 2YIYA 2YM5A 4LV5A 3IDBA 3LLAA 2VTRA 4MXZA 3GC8A 4FL1A 1UKIA 2VTTA 5M53A 3TCPA 3KMMA 1YOLA 3NSZA 4FNWA 3KGAA 5D11A 2WMVA 3NNWA 5EQEA 1P14A 2R3HA 4JLCA 4FSUA 3UODA 2I0EA 2BAJA 3CTJA 5DR6A 4QMSA 4OW8A 4D4YA 3TNPC 3ENHA 3NW7A 2XCHA 3BRBA 4MYGA 4BI2A 5AP0A 3EZVA 4BDKA 2REIA 2UW6A 3QHWA 3E62A 4EK4A 2YM6A 3SXSA 4MH7A 4CZUA 3KRLA 4ZTLA 3SG8A 5EYCA 1PXMA 5C03A 3SGCA 3QCXA 4NK9A 2W5BA 1DI8A 4YLKA 4ANBA 2UZUE 3ZDIA 4X3FB 3C0HA 3QGYA 2CGUA 4GT5A 3Q5ZA 3WZJA 5HVKA 2YM3A 1PMUA 3MFRA 4FYOA 1XH7A 2YIRA 3QTWA 3VWAA 4BL1A 3ZU7A 4C36A 4IX3A 3COKA 2RKUA 1XO2B 5C27A 2JFLA 5C8NA 3FLNC 3AD6A 3PXFA 3QRIA 4N4SA 3ZFXA 3EL7A 2P55A 2QURA 4YJQA 3QQFA 3W2SA 4DHFA 2NO3A 4QYYA 3HGKA 4F1TA 3BV2A 3KRRA 4DLJA 2Z7RA 3G9NA 3OROA 2IVSA 4DH1A 3PRIA 3LXKA 1U54A 3FL4A 3POZA 2C5XA 3ACJA 3UP2A 5L2IA 3QZGA 1KV1A 1M2RA 3NEWA 4IWQA 3WF6A 4DC2A 5CQWA 4FUYA 4FEVA 1FPUA 3DK6A 3CTHA 3VBWA 2CKQA 4H58A 4FI1A 1L8TA 3HECA 2CKEA 4UMUA 3UYSA 4UN0C 3PPKA 1ZOHA 2PZIA 2WB8A 2R3MA 3W2QA 4BKYA 4NTTA 5G1XA 3A61A 4KRCA 4OT5A 4USDA 1A06A 4QTDA 4U9AA 2VO6A 3R9DA 3P0MA 3FZ1A 3ZONA 5AMNA 3LCTA 5LXMA 3FMLA 2WMRA 4FV3A 2OJIA 5EHLA 4FTAA 4TNBA 1GNGA 4XJ0A 5KCVA 3HAVA 4FGRA 3TZ7A 4U79A 3DFAA 4GSBA 3VBYA 2J5EA 2Y6MA 2C69A 2Y8OA 4LRJA 4HNIA 2OH0E 5FTQA 1WBVA 1XBBA 4EYMA 4PNKA 2B7AA 3CQWA 4QQJA 2GTNA 2X9EA 3PUPA 3QRKA 3QU0A 4KRDA 3R7VA 1PXNA 3G0EA 4W4XA 3QZIA 2C5NA 3RAWA 1JKLA 4ZTMA 4O0TA 1W8CA 2VTOA 4LOOA 4H1JA 1ZRZA 4WNOA 5C8MA 2CHLA 4DCEA 4FKGA 3BQCA 1Q61A 5E92A 2JGZA 3DKOA 3QRTA 4WD5A 3UJGA 4MHAA 4CEGA 4EONA 3CPBA 1Q3DA 2CGXA 3DFCB 3OOMA 3GGFA 2O0UA 3AD4A 5KMMA 1O6YA 4G5PA 4DEBA 3C13A 4G9RA 4BTJA 3R8MA 4G3FA 3ZSGA 4YTHA 3GT8A 3H3CA 4GRBA 4YP8A 4BDJA 2BDFA 4XLVA 4JRVA 3PA5A 3WZDA 4GVAA 4O7LA 4HVSA 3SXFA 1W98A 3O0GA 2HZ4A 2PE1A 2R9SA 2ZYBA 4YGAA 4J71A 5AV0A 3LOKA 3MTFA 1B6CB 4YO6A 3TV6A 4CT1A 3CBLA 2RGPA 3FKNA 4MK0A 2ZDTA 5M4CA 4TT7A 1UA2A 4PF4A 3ZLYA 2OSCA 4IWOA 4ZZOA 4AA4A 3ERKA 4G34A 4CMOA 2GNHA 4MX9A 4YR8A 3BWJA 1LEZA 4NKAA 1XH8A 3F3UA 4FKQA 3RVGA 2E2BA 3QFVA 2ITQA 5DFPA 2OU7A 2GTMA 4O7TA 3M2WA 3AXWA 4FNZA 3C4ZA 4WNMA 3PP1A 3VVHA 4JI9A 4GCJA 4DFZE 3DB6A 1PYEA 3LQ3A 3CQUA 3Q32A 1OI9A 3S4QA 1X8BA 4MKCA 2JBOA 4U5JA 4CCUA 4EHEA 4M12A 4G3DA 2CCHA 5BX0A 5AUZA 4C59A 4D2PA 3R9HA 4ASXA 3G5DA 3R8ZA 3Q4TA 2OJJA 5CZIA 1YXSA 2KTYA 3OXIA 3JUHA 2BCJA 4Q9ZA 2QQ7A 4BDHA 5M44A 4WBBB 2PK9A 5I3OA 3RHKA 5ICPA 3ROYA 4RJ3A 4UZHA 3EMGA 4JX7A 2OJ9A 2PY3A 4LM5A 5HBJA 4OAUC 4EC9A 4RRVA 1U4DA 2V22A 2LGCA 4XCUA 4FF8A 1HCLA 5IUGA 3IOPA 2R3FA 3ZH8A 2X8EA 3ZHPC 4C2WA 1KOBA 1J1BA 1R0PA 1DS5A 1OKWA 1WBSA 2JDOA 2XBAA 3LM5A 3BU5A 4PDPA 2DUVA 4L01A 5HCYA 4E6DA 1P5EA 2G9XA 1W83A 1E1VA 4PMSA 4X2JA 4D0WA 2YIQA 4Z7HA 1NXKA 1LR4A 2R3LA 5C8KA 4RWLA 2G2FA 1OPJA 4R7HA 4I1ZA 2UZBA 3FPQA 2B9IA 1H1PA 1HCKA 3KXXA 3NVMB 5M51A 4GT4A 2YHVA 5M4UA 4FV2A 5CI6A 4MF1A 4ANLA 4USEA 2OH4A 3EN9A 1NT2A 1L3RE 3NW6A 3EQCA 3O7LD 4OGRA 4QTCA 4CQEA 3R21A 4ZMFA 5GZ8A 2BDJA 3NX8A 4RBLA 4HW7A 3D5UA 3Q9ZA 3O71A 3OOGA 3OG7A 4I92A 3UPZA 5J5TA 4LOQA 4BTMA 3MSSA 4W8EA 1KV2A 4ZEGA 2AC5A 2XRUA 3UYTA 3VS6A 4YJNA 3TDVA 3LMHA 3U55A 4M0YA 5J7HA 2WTWA 5LVNA 3AT3A 4IZYA 2WTKB 1UU3A 2Y7JA 3S2PA 3BU3A 4KWPA 4ZZNA 2XIZA 3L9PA 3CD8A 2PPQA 4GYIA 5HORA 5HD7A 3G15A 3PLAE 4QMWA 5BUJA 3TDWA 4HOKA 3S00A 5CTPA 3V3VA 4EORA 4OTDA 1OBDA 3QWKA 5GIPE 5HNIX 2F4JA 4AAAA 5DEYA 4DG0E 2Q83A 4ACDA 5J1WA 3PDTA 4YLLA 2O2UA 2WMBA 3AC1A 3L8XA 3CCNA 5B2KA 1OL7A 3IW5A 4FV7A 3V6RA 1P4FA 3IGGA 4F0GA 2C3KA 1FVRA 4IDTA 4MBJA 3FLWA 5FXSA 3UC3A 3I0QA 5HVYA 3ORLA 1EH4A 3F69A 4IX4A 2WZJA 4J8NA 5L8LA 5HESA 4R1YA 5AP3A 3JY9A 2VWWA 3LFDA 3F5UA 2XVDA 3V51A 2V55A 4FICA 2CKPA 2AYPA 3MY5A 4DGGA 5FBNC 4GIHA 4C4HA 5JFSA 1IAHA 4J1RA 3EKKA 2PTKA 4JG8A 2ESMA 2ZMDA 4IQ6A 5I9WA 1PMNA 1FVVA 1KOAA 5IH6A 2XJ1A 4M67A 5AA9A 4O7NA 2Z7QA 5EK7A 4XBUA 3DJ5A 3ULZA 4C38A 3FLZA 3LZBA 2NP8A 2WO6A 2BMCA 4XG2A 2G15A 3TKUA 3NIZA 3KA0A 2J0JA 3FHIA 3ORTA 4R3CA 3VQUA 4UWYA 1VEBA 3ZLWA 5ANKA 3TUBA 4OLIA 5EYKA 4H3QA 5AAEA 5HQ0A 1YVJA 3KN6A 1QPEA 1YI6A 4C57A 3FYKX 2OLCA 4RC2A 4U41A 5CNNA 2Z7LA 4CT2A 3EYHA 4YZDA 3ZZWA 4F9BA 3ZM9A 3PFQA 4II5A 3RNIA 2BAQA 3OUNB 1W7HA 4IC8A 4G31A 5JGBA 4EC8A 2CN8A 5M4IA 4PPCA 1GJOA 4FT3A 3F66A 3A99A 3W16A 5EW8A 4MXOA 2ETMA 3TL8A 2X2MA 2E9UA 4Z16A 3TN8A 4FEQA 3ZXZA 4BHNA 4AA5A 1V0OA 2X39A 4JBVA 2PYWA 5AP6A 1YDTE 5HIDA 2WGJA 4RJ6A 5F20A 3HAMA 2XNGA 2QO9A 1QL6A 2FB8A 3RAIA 4GIIA 4WSYA 4CYIA 4GU9A 2XYNA 3FWQA 3QYWA 4UB7A 5E8ZA 4D28A 3LMGA 2BRMA 2EXCX 5KX8A 3ODYX 4MF0A 4UYAA 3QD3A 4G16A 1SNXA 4FT0A 3V5JA 4H05A 3QTRA 5AV2A 5HNBA 2BHEA 4QPAA 5LWNA 3L8PA 3KN5A 4XV9A 5AUWA 5D7VA 3QRUA 2GS7A 4ACGA 4E6CA 3FJQE 3EB0A 1OL5A 5CAOA 1YQJA 4F4PA 3TNQB 2VX0A 2PVHA 4KNBA 4X6QC 2WPAA 2BAKA 5EOBA 4NYEA 1Z5MA 3DLZA 4BDAA 3Q4CA 3OBGA 4KIQA 4IFCA 4X21A 3TG1A 5LOHA 3RZBA 4XMOA 5I9UA 2GHLA 3LFFA 4ZIMA 3LW0A 5JGAA 4AW1A 4BTKA 5M56A 2A1AB 4V0GB 4WIHA 4PL3A 4IJ9A 4A06A 5H9BA 4QMTA 1GZOA 2VWVA 4B99A 5IQFA 4FODA 5FBOA 3D7TB 3FQEA 5HVJA 4JG6A 3R7UA 5L6OA 3RINA 3FAAA 3HX4A 3OWKA 4GK4A 4L43A 3DAKA 3ACKA 5HIEA 3L1SA 5JQ5A 4TYIA 3TUCA 1ERKA 3QTXA 4QTEA 4M0ZA 2W1HA 3MPMA 2W4OA 2ONLC 5IH4A 5L2WA 4DE4A 2W1IA 1PHKA 1H07A 3R7OA 4PPAA 2QOCA 4FGBA 5CNOA 4RVMA 2FYSA 5H8GA 2I0YA 5KMOA 4KBCA 3BYMA 5CX9A 3KXGA 2BPMA 4NFNA 4F7LA 2R7BA 4NJ3A 3UOKA 3RPYA 5AR4A 4YPSA 4RIXB 3VRYA 1YWRA 5M08A 5AA8A 3EZRA 5CANA 3DXPA 2JKQA 3PE2A 3R9OA 4A7CA 4L44A 4AF3A 5AR5A 5F9EA 4YTIA 3N4VA 2WU7A 4OT6A 2BIKB 4FV5A 1YW2A 2X6DA 1ZYLA 2VWZA 2GMXA 2ITWA 4NFMA 5KO1A 4W4VA 3DCVA 3BLHA 5DRDA 3EH9A 5FEDA 3VBQA 1H0WA 1TVOA 4KABA 4YO4A 4ITIA 4Y83A 5CI7A 3FKOA 1Q62A 3Q4ZA 1GIJA 4BIEA 2QR7A 3PVUA 3DZQA 4U81A 5DWRA 3JXWA 2XMYA 2VRXA 4ZTQA 4FSYA 3DJ6A 2FSOX 4YNEA 4M14A 3QUDA 2BTRA 4R77A 3F3WA 3B8RA 2VWYA 3PLSA 3Q60A 2R3IA 3L8SA 4J8MA 4JVGA 4M84A 5BVWA 2IVTA 3JS2A 1YI3A 4QQTA 4YNOA 4JBQA 4X2KA 5K4JA 5HD4A 2VWIA 3R02A 1YOMA 4R1VA 5G6VA 2QOBA 2CLQA 3ITZA 3R73A 3UMWA 2BHHA 5A14A 3FZSA 4J95A 3ZLXA 3V01A 3I7CA 2BDWA 2XKDA 4Z3VA 5CWZA 2QKWB 1XR1A 2XNPA 4X3FC 5AWMA 3TI1A 2J7TA 4K0YA 5EDQA 5M57A 4IFGA 5DT0A 2IZSA 5FUTA 4FC0A 5FP6A 4BB4A 2GS2A 2ZM3A 3DBCA 3MVJA 4MQ1A 5E7RA 2B52A 2W1DA 4V0GA 5EDPA 3PJCA 3RMFA 4B7TA 3COMA 4WHZA 4I5HA 4IB0A 3SD0A 3QL8A 3DNEA 4G6OA 4UXQA 1A48A 4OBQA 3ZO3A 1K2PA 5KMJA 3KREA 2JDSA 3KY2A 4U43A 2JFMA 3VHKA 4GFMA 3LMIA 2IG7A 4UYNA 4E8AA 1GAGA 1VYZA 3IW6A 3KU2A 4NSTA 2V62A 5I3RA 2JC6A 3BZ3A 4EH4A 3VS0A 3MFSA 4HGSA 3OD6X 5FWKK 3R01A 3RGFA 4IAKA 3R8UA 1BL6A 2HCKA 3D14A 1UWJA 3UVPA 4NL0A 2WMQA 4EH8A 5BYYA 2WTCA 1IRKA 4O7VA 3CXWA 2DS1A 5IPJA 5HICA 2JIVA 2YACA 1XJDA 3FZOA 5FQDC 5BVEA 5HZNA 3KRWA 1ZARA 4OAVB 4GH2A 3TM0A 1OITA 1ZYDA 2B9JA 4R3PA 3REPA 1GIIA 4O0UA 3W10A 4D0XA 4GUBA 4I24A 4F6UA 2WU6A 3NAYA 3ZC5A 3ZXTA 1HOWA 3MIAA 5HU9A 4Y73A 4EOJA 1GY3A 3DB8A 3VJOA 1Q8UA 3LAUA 3OEZA 4IVDA 2YEXA 4E6AA 5GIOE 4V04A 1FOTA 4G17A 5H8BA 4ANMA 3MVHA 5KE0A 4DTKA 3HP2A 4YC8A 4ZJIA 4C33A 3C4WA 2YLFA 5ACKA 4YC6A 4MD8E 4KS8A 4EOIA 3HMNA 4RWKA 3OBJA 4FNXA 2PUNA 4DEEA 4L67A 4BCNA 2GDOA 2JAVA 3G90X 2ACXA 2BZHB 2JDRA 1JSTA 5FXRA 2Y6OA 3BKBA 3F5PA 3KCFA 2YDKA 4EWHA 4EH2A 3LM0A 4BIDA 2QLQA 4XX9A 2UZNA 2QOQA 4AT4A 3W2OA 4I5CA 2O64A 5I9VA 3ZO4A 1YDSE 4XP0A 4BVUA 2UZEA 2W9FB 3P23A 2WQMA 3ZRLA 2VWBA 2WEIA 1BL7A 3ULIA 2J5FA 3HUCA 4RIOA 5M55A 3TKHA 4EOKA 4I6HA 3UOHA 1H4LA 4EBVA 3W32A 2VZ6A 2CKOA 4CFVA 4PRJA 4NM0A 3ANQA 5E8TA 3Q9XA 4FG8A 4MD7E 1JSUA 1W84A 3F5GA 3BE2A 4BDFA 4BBEA 1GZ8A 3KCKA 4FIEA 2F9GA 4P90A 4YTCA 4FG7A 3E87A 1OKVA 3FQHA 3OY1A 3Q6WA 3W2CA 5LJJA 4AZWA 3CQEA 3W18A 4FTCA 1MQBA 4CNHA 4IM3A 4IX6A 3DK3A 4O21A 4RIYB 3TIYA 5IISA 4APCA 4RFMA 4O1PA 5DHJA 3IECA 4XRJA 5HLWA 4DBXA 4HJOA 5CY3A 3W33A 4MNEA 4CKJA 1APME 3UOJA 3R1QA 3BCEA 4QQCA 2BIYA 3IKAA 2VV9A 4IIRA 2B0QA 4MXXA 2UZTA 4YZMA 1WBPA 4IVAA 4DITA 2C4GA 3U6IA 3E88A 3MJ1A 3KVXA 3FI4A 4OTGA 3L9MA 2W5HA 2ZB1A 4EQMA 3ZLSA 4FKSA 4F70A 2DYLA 2QOHA 3CIKA 3R9NA 4CLIA 5CASA 1NW1A 5AAGA 3T3UA 4B0GA 4A4XA 3SW7A 1TKIA 3F2AA 2VTJA 1SVGA 4RX8A 4F1MA 2FSLX 3ZOSA 4OTIA 5TE0A 3UQFA 3EN7A 4YMJA 2YWVA 5HBHA 3ORNA 5CU2A 1PKGA 4EJNA 4GT3A 3OVVA 3NNXA 3LXPA 3NDMA 4HGLA 4BCMA 4I5MA 1CDKA 2WD1A 4IAIA 4MWIA 3H9FA 2X7GA 2G2IA 4W9XA 1FINA 4QNYA 4RQKA 1U54B 3VUGA 4M3QA 3PXYA 2JEDA 4O27B 1IASA 4AN9A 4DA5A 1YHSA 4FK3A 3AMBA 2X9FA 3Q9WA 3U4UA 4UMPA 4APPA 3CS9A 2XZSA 4DINA 4F6WA 4BCOA 4KBAA 5FG8A 5BQ0A 5JK3A 3GC9A 2RFDA 5FEQA 3W2RA 2YIWA 1MQ4A 4I6FA 5CAPA 3TZ9A 5HTCA 4FSRA 3HA6A 4D4VA 5AM7A 5E90A 3A7GA 3IOKA 1OECA 4ZJJA 4RFZA 1FVTA 5AP4A 4FEXA 1SM2A 2C5OA 4MD9E 1ZOGA 5FP5A 4R5YA 5CQUA 5CF5A 3C4XA 2XK3A 2Y9QA 4BCJA 3Q04A 3D9VA 2E9VA 3QA8A 3VS5A 4PTCA 3PJ1A 4KUJA 3GOKA 5GJFA 2OXYA 3PZHA 3CSVA 2ZM4A 3A60A 4F9YA 5IEXA 3HZTA 4FOCA 1CTPE 1MRVA 2WTKC 1XH9A 3GOPA 5EHYA 5C9CA 3NVKI 4BZDA 3TZMA 2UZWE 3VO3A 2WMSA 2ZOQA 4CFMA 5I9XA 5BVOA 4AP7A 4BKZA 5CEMA 4BR3A 3HA8A 2P2IA 4RIYA 2OICA 3CKWA 4C62A 4GS6A 3I6WA 4QMYA 3EQFA 3RCDA 2Z8CA 4EHZA 3NCZA 2XIXA 1Q3WA 5IQDA 1GIHA 2NRUA 4ZAUA 4IWDA 3LCSA 1XQZA 1KUTA 3WE8A 4CGAA 4CKRA 4WG4A 2QOIA 4L53A 2F2CB 3KF7A 2IVVA 5GHVA 1WVYA 2ITOA 1CMKE 3TKIA 3IONA 4DG3E 4PX6A 4XOYA 2P0CA 4XG8A 1ZWSA 3C7QA 5IG1A 4IADA 2J0IA 1PXIA 1J1CA 4OTRA 3UO6A 1T45A 2O8YA 3QCQA 2YCQA 4L6QA 4MWHA 4U6RA 3QA0A 3RK5A 2J9MA 3SKCA 3BWFA 2W7XA 5TF9A 4B4LA 4HVDA 4R7BA 2H96A 3JVSA 4IWPA 4RJ5A 5AUUA 2ETRA 2BZIB 4CFFA 2V0DA 2ITYA 1NVRA 2GHMA 3I1AA 3QZHA 4CXAA 2A27A 3WF8A 2RG5A 4UBAA 4PWNA 2ZAZA 3DJ7A 3GCQA 4KINA 4LG4A 3TT0A 3UOLA 3ID6C 2X2KA 2HY81 4EHVA 4RQVA 4YPDA 2ZM1A 4ITHA 2IZUA 3EFKA 5BYZA 4EEVA 2W99B 3CP9A 5A4EA 2X7OA 3VW8A 3WILA 3VBXA 5CALA 5J1VA 5J95A 5HKMA 2C6TA 2VTPA 1REKA 5FLFA 1OGUA 3A7HA 3E5AA 3CGOA 4IZ7A 4L8MA 3KL8A 1XH4A 1LPUA 3COHA 3VN9A 5FM2A 3R8PA 1KE7A 5ANIA 4Y8DA 5AAFA 4U3YA 1YWNA 1H25A 4FKIA 2ERZE 4JOAA 2J0LA 1QMZA 2CSNA 3KMWA 4P5QA 4FIIA 4PMMA 5D1JA 4F99A 5FDXA 3N9XA 1FMKA 2PMOX 3VS4A 2B9HA 4NW5A 4RPVA 4S32A 2A4LA 5EM7A 2Z7SA 3B2TA 3ZEPA 3L9NA 4O82A 2UW3A 1ZY4A 3CD3A 5AFVA 3DQWA 4C4IA 3DAJA 3FXZA 3RPVA 2ZJWA 3EHAA 4H1MA 2F49A 4E5AX 1A9UA 3R1NA 4I5PA 4EOPA 2FO0A 4CMUA 4R6VA 3F2NA 3LFAA 1GOLA 4XG6A 3R1YA 3NYNA 5DBXA 1WBTA 5EM8A 2WFYA 3DBEA 4ZP5A 5AR7A 3CE3A 3RPRA 4CQGA 4CG9A 5IQEA 4NTSA 1MRUA 4JL9A 2R7IA 4IB5A 2RIOA 4BCKA 4IAYA 5ETCA 3EQBA 3Q5IA 4XNEA 1S9IA 3G33A 3OHTA 3BX5A 5CSHA 2OXXA 5EI6A 2C6OA 3KVWA 5DH3A 4Q5HA 3RAHA 2HOGA 2HWPA 2UW0A 3PRFA 3R9RA 1YXXA 4FYNA 1JPAA 4BN1A 2YERA 3ZRMA 1JWHA
chains in the Genus database with same CATH superfamily
4QP2A 1ZMVA 2GCDA 3BYUA 4GJ2A 4PTGA 3VIDA 3VS3A 2BZKB 4E26A 2R3PA 5CU4A 3MV5A 5JH6A 1OGYA 3GU8A 3NRMA 5AR8A 4DFYA 1KWPA 4AFEA 4E6QA 5EQYA 1OMWA 4QTBA 3LE6A 4AACA 2JKOA 4J53A 3MWUA 5FM3A 5HNGA 2GNGA 3OWPA 3ZRKA 4ASZA 4B6LA 4RIWB 2XK8A 3KC3A 3ZM4A 5A9UA 3PFYA 3OCBA 2WTVA 1ATPE 3O51A 2PZPA 1PYXA 3K54A 4N6YA 5EFQA 1CKIA 5IUHA 2XKEA 3D0EA 4H36A 4RZVA 4YJUA 3UQCA 2I0VA 5ANEA 3ROCA 2PWLA 3VUHA 4AOJA 5JFXA 3LFBA 5J87A 1YKRA 4OTPA 1M17A 3ORMA 1H8FA 3WIGA 5IDPA 2DWBA 4TNDA 5HTIA 2QLUA 3WARA 4PNIA 4BF2A 2C6IA 3UTOA 5A54A 2XNBA 2CNVA 4PPBA 5E8YA 5AX9A 5DLSA 1Q24A 2ZV7A 4XG9A 1VLRA 3NUXA 1SVHA 3P9JA 4P2KA 3EQGA 3GCSA 1YRPA 4LI5A 1JKSA 2GNJA 3GU7A 2P4IA 5L2QA 3QYZA 3SV0A 4Z55A 4FG9A 3PWYA 4O4EA 3SAYA 3U9NA 3I79A 3V04A 2VO0A 3FY0A 4XG4A 4CG8A 2I40A 3FSFA 3UVQA 4MQ2A 2PVJA 1R39A 5CSPA 5CU6A 3CJFA 4JIAA 4LV8A 3EKNA 2XCKA 3H9OA 3MVLA 4YZBA 4C4GA 1YXTA 2I6LA 2R3GA 4K11A 3ZSIA 2FSMX 4AZFA 2J51A 4KKHA 5HG7A 5CEKA 5HX6A 2YZLA 3NS9A 5E4HA 3FPMA 3G9LX 4FR4A 3SRVA 1OUKA 4TL0A 3QQKA 2WOTA 4YZCA 4RA4A 3C4EA 2XJ0A 4EUUA 2ITTA 1XMMA 3PPZA 3F9NA 1BUHA 3F88A 3KMUA 2VTQA 3OCGA 3ALNA 4NCTC 3AC3A 2CJMA 4LQMA 2C5VA 5TO8A 3NAXA 3I0OA 3AC2A 3GP0A 5IMXA 4MCVA 1YXUA 4ASDA 3GXLA 2UZOA 5KNJA 3MH0A 4LRMA 2YAKA 3FBVA 1BLXA 1PXLA 1H0VA 2JKKA 5KMLA 1T46A 3W8QA 3C5IA 3S95A 4E7WA 5CU3A 2QO7A 2VTLA 4PP7A 4OBOA 3LCDA 4O4FA 4U3ZA 4DH8A 2Z02A 3F6XA 5IQCA 3GEQA 3O5AA 5BVDA 4HVIA 4FE2A 3N4UA 5DT4A 3GCVA 4YTFA 4ZTSA 4RIWA 3K2LA 3MY0A 1M14A 4E20A 2WMWA 4KSPA 3OTVA 5DRBA 4A4OA 4IDVA 3RPSA 3JPVA 4JDKA 4FUXA 2JDTA 3BLAA 4QP8A 4AZVA 3UDTA 4DH7A 2XA4A 2PUPA 5EYDA 4FEWA 3HYHA 4QYFA 3LCKA 3QC9A 3R7GA 4WKQA 3PG1A 4YJPA 4L42A 1I44A 3QD0A 4M8TA 3ZFMA 3ZZEA 2OG8A 1Y91A 2Z60A 5HEZA 1JNKA 2HELA 3DBQA 4LGDA 1R78A 2Q0BA 2XB7A 4KBKA 2PVYA 2UVYA 4X0MA 1U5QA 2XK9A 4E1ZA 3PVWA 5CAQA 3UO5A 4J96A 4C4JA 2WMUA 1ZZLA 5HHWA 4FL3A 3KXNA 5ANOA 2VWXA 2PMIA 3BBTB 3DDQA 3VNTA 4E93A 3G51A 2ITXA 1VZOA 4W4YA 5CAUA 2CGWA 1UWHA 5FTOA 4A9YA 2HIWA 1Q8ZA 2XKFA 4E4NA 2HAKA 2VX3A 3E8DA 4O7WA 3Q3BA 3QX2A 1BX6A 4QOXA 5AIKA 4I94A 5E8UA 2ZMCA 5L6WL 3AMAA 4WRGA 4FT9A 4CSVA 4EOOA 1MP8A 2QI8A 3ZO1A 3CGFA 4M13A 3GU5A 3O2MA 2WTJA 1RE8A 4M7IA 2YLEA 3THBA 1Q4LA 4FKOA 4AW2A 3MDYA 4L00A 4P7EA 2W1CA 3VF9A 3A4OX 2BTSA 3AOXA 4FK6A 4BCIA 4YLJA 3V8SA 1IEPA 2XIYA 4FSQA 4G2FA 1KE5A 4X2GA 5HGIA 2LAVA 3VQHA 4EK5A 4QTAA 4J97A 5C26A 1UU9A 5L3AA 3C51A 2RG6A 4QYEA 3WOWA 3C0GA 4AZTA 4N70A 4RA5A 3D5WA 3QCYA 4S30A 4PP9A 5J9ZA 5HG9A 5JEBA 4MBLA 1XKKA 3ZBFA 4JQ7A 4P5ZA 3RNYA 2W06A 3RCJA 4AWIA 2BRGA 5ANDA 4O0RA 4O0YA 4LYNA 4BCPA 2UV2A 4U44A 5DYJA 1AD5A 3QUPA 3O23A 2XK4A 4NW6A 3V5WA 2C6KA 2OFUA 4ALUA 5TKDA 5JFVA 4WT6A 4BYJA 5KKRB 4HCTA 2CMWA 2VTAA 1Y8GA 1IA8A 3QALE 2RFSA 3E64A 1YHWA 3UNZA 3VJNA 3MH2A 4NIFB 4D55A 3TTIA 2WTIA 3ET7A 3LFQA 4TWPA 5IH5A 2RFNA 3KK8A 4ANSA 4R3RA 4AA0A 2OBJA 1IR3A 1LUFA 4H3BA 3R7EA 3FKLA 4EUTA 5CEOA 2HYYA 4DEIA 2G01A 4I0SA 4J98A 3RKBA 3MH1A 4JDJA 3PIXA 2PE0A 3UIMA 4QMNA 5IA1A 3WBLA 4I4FA 2X4ZA 3NR9A 5ANGA 4CRSA 1F3MC 2GQGA 3FMMA 4XRLA 4EKLA 2WELA 4UWCA 4ZSLA 2X0QA 4O96A 5DPVA 4YJVA 5A4LA 2C68A 4O6EA 4XP3A 4I4EA 2J0MB 2R3NA 3R28A 4G6NA 5DE2A 2XP2A 1OPKA 4AOIA 2XM8A 2H34A 3DU8A 3CPCA 4X6RA 5J8IA 4C0TA 1SVEA 5AP7A 3V6SA 4CTCA 4O83A 4IMYA 3D83A 3RAKA 4EOLA 2VUWA 4WA9A 3Q52A 2R3RA 4WSQA 5IA3A 2QOFA 1JKTA 3OWLA 4JS8A 1STCE 5CSWA 3GUBA 4I3ZA 4L7FA 5HO7A 3GI3A 4HYIA 3Q4UA 3HLLA 3RBWA 4C58A 3KF4A 2HK5A 3LVPA 4JAIA 1WCCA 4C61A 4O7YA 3CY2A 3ZC6A 4IH8A 3E8CA 3RP9A 4TWNA 3D4QA 3EIDA 2C47A 5DEWA 3QHRA 4BGHA 3MFTA 1E9HA 4DBNA 3DTCA 3SDJA 3D7ZA 2QCSA 2GQRA 1H01A 5LVLA 5CVGA 3OC1A 3S0OA 3RZFA 3KEXA 2XK6A 3EWHA 4G9CA 4FV6A 4UY9A 5JMSA 1LEWA 3KULB 5DVRA 5A46A 3L9LA 5HG5A 3W0OA 2OZAA 4KA3A 1K3AA 3DOGA 4BI1A 5K9IA 3EFWA 1VR2A 4DEAA 3AGLA 4AN2A 3ORKA 1ST0A 2FVDA 2BFYA 3PY3A 4U40A 4XV1A 4HVHA 5IEVA 5JQ8A 4C7TA 3QKKA 4ENYA 4DHIB 5AR2A 3A8XA 2IZTA 3UZTA 4C34A 4OTQA 3W8LA 5H2UA 2JIIA 4NIFA 3DZOA 5CS6A 3BL9A 3IPHA 1U46A 5FGKA 4CV9A 5EI8A 3D2IA 4MXAA 3DKGA 2H6DA 3U54A 4ZLYA 2OZOA 3RWQA 5LVOA 2FGIA 2XNMA 4WOVA 1SZMA 2XEYA 4L7SA 4O0VA 1J7LA 1FBNA 2F2UA 5LQFA 3OZ6A 3HKOA 3Q96A 3UNKA 1ZLTA 2WQBA 1BKXA 4MAOA 4ZSAA 4D4SA 5GZ9A 4RX5A 1XH5A 3DPKA 5JT2A 4D9UA 3FE3A 4XBRA 5JZNA 4CTBA 3KB7A 3TUDA 1RW8A 3EQIA 5JRSA 3EOCA 5TR6A 3ZCLA 5D10A 3DY7A 2AEGA 5CF4A 5HI2A 5HX8A 1REJA 4PUZA 4Y5QA 5A4TA 2BZJA 3ATTA 3LKMA 3FXXA 5T68A 3NNUA 2CNQA 1OBGA 4FV4A 4ZOGA 2QC6A 3O8UA 2VO7A 3BPRA 5JKGA 5KHXA 1OIQA 3GQLA 3QQLA 3F82A 3BL7A 4GU6A 4PDOA 4AGDA 3MI9A 3VUMA 2OF2A 5E1EA 2YM7A 3LIJA 2EVAA 3OXZA 5F94A 4ZY6A 4DTAA 1XBCA 2C0IA 5M4FA 2WIHA 2WQNA 2A0CX 4ZK5A 3FZPA 5E1SA 4PL5A 4RLLA 4L68A 4UALA 2BRBA 4DGNA 2Y0AA 3SOCA 2C3IB 5EKOA 3POOA 2OGVA 5IA4A 2F7XE 4NH1A 4ERWA 2C6EA 4AT5A 1RQQA 2R5TA 3PP0A 4F09A 4DEHA 2IW9A 4MNEB 3PXQA 3VULA 4F9AA 5A6OA 2IN6A 2QOOA 3B2WA 3M11A 3OWJA 4TTHB 3P1AA 2O65A 3KULA 4JRNA 4EH9A 3IS5A 3ATSA 5DOSA 5JN2A 4B8LA 3ZFYA 4ID7A 4CKIA 3FMHA 4QP3A 3VBTA 1GZNA 5BYLA 3ORZA 3UQGA 2W96B 3E8NA 3UBDA 2PVKA 3W2PA 5BVNA 2WOUA 4O91A 1V1KA 2XRWA 4YJOA 4AN3A 4ERKA 3MB6A 3HV6A 4HVGA 5KMKA 4DF3A 1KSWA 1PRYA 4RJ7A 3EN6A 4BWKA 2QKRA 4LMUA 5EYMA 1WBWA 2GSFA 3QD4A 3TEIA 4ZTRA 2VNYA 4F6SA 3OCSA 2QR8A 1Q97A 4FKRA 4BYIA 3MW1A 4ZY5A 1U59A 3HEGA 4AZEA 4FKVA 4U80A 5FTGA 3AG9A 3R2YA 2C0TA 3OXTA 1Y57A 4IX5A 4ZTNA 1IAJA 3SHEA 4F9CA 3P7AA 4LL5A 3R83A 4C37A 3M42A 3PY0A 4UXLA 3BYSA 4DGOA 2PZYA 2PZRA 3QXPA 4IE9A 4FTUA 2YN8A 4MTAA 4NT4A 1H27A 3KXZA 5AP2A 4CZTA 4TWCA 3UVRA 4D9TA 1OIYA 1YOJA 4KKGA 3MA6A 2O5KA 5HE0A 2OXDA 1OIRA 4GG5A 3QGWA 3E93A 5EW3A 2XUUA 4DEGA 4TKSA 2HW6A 2UW8A 4FV0A 4JBPA 4IW0A 5EM5A 2GFSA 4QMXA 3VBVA 4ACMA 5BUEA 1IG1A 2E9PA 3EQDA 5L2TA 3ZEWA 3I4BA 3P86A 3F5XA 3SW4A 3COIA 1Z9XA 2PMNX 3OCTA 4Q2AA 3B8QA 5TT7A 4EYJA 3F2RA 3W0MA 3I5NA 4UV0A 3ODZX 4W8DA 4ANOA 4D2RA 1UVRA 3QTZA 1JVPP 3LJ2A 4OTHA 4QQ5A 4YSMA 3II5A 5DNRA 5ANJA 2CNUA 1PXJA 3OP5A 5CAVA 3DLSA 3BHVA 5FD2A 3D5XA 4ONAA 2OK1A 5M07A 5DA3A 4PDYA 4S34A 3FLSA 3IDCA 2J4ZA 3DDPA 2B53A 5AJQA 5F95A 2VTMA 2Y4IB 3BELA 5CENA 4ZY4A 4QT1A 1FGIA 1QPJA 3LLTA 4QD6A 5T3QA 1YDRE 5CU0A 1ZOEA 4K1BA 4IC7A 5DR9A 3WZEA 4JDIA 2NRYA 3OUKA 4I21A 1R3CA 4OTFA 3OY3A 5JZJA 3LFCA 3NYOA 2BRHA 4FVRA 3V8TA 2UZVA 4NM7A 3ZDUA 5IF1A 3C0IA 1XHAA 2YAAA 1PW2A 3NLBA 4MXYA 3P08A 5KMIA 5KMNA 3GC0A 1NVSA 1H00A 1PXPA 3RI1A 1Q8WA 4BWPA 3VUDA 3HDMA 3NYXA 4QO9A 3VHEA 2IPXA 4A4LA 3FZTA 4LOPA 3ALOA 3LXNA 4ZLOA 4O7ZA 4XP2A 5IA5A 1Q5KA 4YJSA 4WRSA 3DA6A 4FTKA 2EWAA 3FI2A 4PMTA 4BCFA 4MNFA 3FMNA 5KZIA 1PKDA 3DQXA 3DKFA 1ST4A 3LFNA 4FOBA 4G3CA 3FV8A 4YHFA 5I9ZA 5BMMA 4FRFA 2OF4A 2PVRA 4TYHB 3ETAA 4K18A 4RT7A 3RJCA 3WF9A 5E8SA 5LARA 3QQJA 4NM3A 3BHTA 2PHKA 4B8MA 4AGWA 2H9VA 4G6LA 3FHRA 3TNHA 5DG5A 4QP4A 1Q8YA 3DBDA 4GL9A 1OL2A 1UU8A 3MY1A 2C3LA 4FTIA 1FGKA 4K2RA 4KKEA 3NGAA 4WO5A 5CEQA 4AZSA 4LDTA 3L8VA 4LRKA 3UDBA 3IDPA 3HRCA 3ZTXA 3TWJA 4I93A 4LMNA 2OIBA 4EK3A 2YCRA 4DFXE 3HV7A 1M2QA 5L2SA 2VTIA 4RVLA 3VAPA 3LHJA 1M2PA 2JLDA 3QUEA 1H1QA 1NY3A 4DT9A 3UC4A 2G2HA 4AX8A 1KE8A 1QPDA 1WBOA 2W1EA 3CTQA 4L9IA 5EW9A 4UMTA 4LUEA 2W1ZA 2YCSA 4QYGA 3P7CA 3BGPA 2XARA 1QCFA 2YA9A 3EQHA 3U4WA 3LJ1A 4ANQA 2XF0A 2PZ5A 5D12A 2I7QA 4N57A 2XKCA 4YHJA 1KE9A 2EB3A 5I9YA 3FYJX 5EHOA 4R78A 4QDEA 3GCUA 1ZYSA 2WAJA 4EOQA 3O50A 3KRXA 4JMQA 3G2FA 5E91A 5DGZA 2F7ZE 4GW8A 4FZAB 1S9JA 3AKLA 4IZ5A 1MRYA 3VS2A 3QLFA 4FT5A 2QU6A 3T9IA 4A9TA 4BCQA 5HBEA 4XH6A 3HMOA 3OS3A 2CDZA 5ETIA 3GCPA 1XWSA 3TV4A 3F3TA 1OM1A 3QAME 4BI0A 3DBFA 4KIOA 5CSVA 4HPUE 4AUAA 3HP5A 4XG3A 2GQSA 3FDNA 2QNJA 3N4TA 4CMTA 3QF9A 2FSTX 4X7QA 3WZKA 4KS7A 5CVHA 3UMXA 3UDZA 5HOAA 4C3FA 3PWDA 4DYMA 2BROA 2VO3A 5GZAA 1PY5A 1G3NA 2HW7A 4GFOA 4P4CA 1BI7A 4M66A 5J9LA 4LL0A 4HNFA 3WYXA 3HMPA 1WFCA 1UU7A 2R3QA 4F1OA 2BKZA 3NUYA 5HIBA 5AEPA 5IA2A 5GINE 3A7FA 3KXHA 5LCKA 4K9YA 3SX9A 4YSJA 5L6PA 3GU4A 3HV3A 3OMVA 3R04A 4TYHA 5F1ZA 4ZSGA 3W0NA 4E4LA 3AGMA 1OL6A 4FTTA 2X8DA 4J7BA 2R0UA 5BPYA 2QG7A 2J50A 4F63A 5K0KA 5CF6A 4JQ8A 3A7JA 4HZRA 4ZXTA 3I60A 4RC4A 3I5ZA 4BKJA 5BUIA 2V7AA 2ZVAA 4CLJA 2YCFA 4KIKA 2QD9A 4ITJA 4GEOA 1TQIA 3D94A 1B38A 4AU8A 1ZZ2A 3QBNA 4QMZA 4JX3A 4O38A 4O0XA 4CYJA 3KXMA 3OW4A 1ZMWA 4ZSJA 4DH5A 4GUEA 3CEKA 4FVQA 2VTHA 1W2CA 1DAWA 2JITA 1M7QA 3VC4A 5GNKA 3ZUUA 4BJJA 3NIEA 3BYVA 4B9DA 5FRIA 4DH3A 4F0IA 4FMQA 4FSMA 4IXPA 2UW4A 4DFBA 2ONLA 3R0TA 4G3GA 4GMYA 4PTEA 3ORPA 4DGMA 5HCZA 5IMEA 3R8VA 5CLPA 3PXRA 5KKRC 4CRLA 3JR1A 3FQSA 3U9CA 3GFWA 2VD5A 4JT3A 1CKJA 2YABA 4XOZA 2X2LA 3ZYAA 4FSZA 4U97A 3SRVB 2VX1A 1CM8A 1UNGA 4DLIA 3KRJA 2W1FA 4D2TA 1ND4A 4WNPA 1BMKA 5AIRA 5AV4A 4BGGA 5HO8A 4C35A 5AUVA 3EYGA 4BRXA 5LMAA 5EDRA 3PXZA 4L45A 5EH0A 3QX4A 2R0IA 4FZDB 5HG8A 2WMXA 3W0RA 3OTUA 4MVFA 5FXQA 4V01A 2XEZA 4NZWB 4BDEA 4PL4A 4V05A 2B9FA 3UIUA 2G1TA 4ZLZA 1YHVA 3DV3A 4LFIA 4EKKA 3QZFA 5B0XA 2NNWB 4FTJA 4EWQA 4CD0A 1UNLA 3IQ7A 4RLKA 5ETFA 5IKWA 3AD5A 5F4NA 5IA0A 4DT8A 3SOAA 2C3JA 4ACHA 5JSMA 3BEAA 3MS9A 2E9OA 3FZRA 3GNIB 3LJ0A 3ZMMA 3DAEA 1G5SA 3KQ7A 3MGYA 4AGUA 3UZRA 4RMZA 3U51A 1Q8TA 4QNAA 1XH6A 3R22A 2IW8A 1QPCA 2BILB 4OR5A 3UGCA 3TV7A 3R1SA 1BYGA 5HLPA 2J2IB 4ZZMA 3D2KA 4DG2E 4GG7A 3VS1A 4X3FA 2DQ7X 1O6KA 3U6HA 2C1BA 4LUDA 3Q2MA 4UMQA 2QG5A 3ANRA 3I6UA 3D5VA 3K5UA 4U45A 4ZTHA 2IO6A 4FV1A 3MJ2A 2XBJA 2ITPA 3F61A 3A4PA 1OUYA 3R2BA 3V5TA 3DT1A 4L3JA 5IQIA 1OZ1A 2UVXA 3NPCA 4CFWA 5I4NA 3GFEA 4JDHA 4AQCA 4F7NA 5HLNA 3T8OA 1K9AA 1Y6AA 2FH9A 5B2LA 3QWJA 5LMKA 4AAYA 3HRFA 2VGPA 4EBWA 2C5YA 4KSQA 4QMPA 1W0XC 4QMLA 1OPLA 3IW7A 3PIYA 4IBMA 3VS7A 3K3IA 2ERKA 1E1XA 1TQPA 5AUYA 4ZSEA 4CV8A 5C4KA 2HY0A 4M97A 3SXRA 4FEUA 5IQHA 4QEBA 2W9ZB 4DEDA 2BRNA 3E8EA 4TYGA 2OIQA 1JOWB 3RTPA 2C30A 1G8SA 3QKMA 4R8QA 4FBXA 2V7OA 1ZMUA 1OL1A 4FSTA 3HV4A 4FSNA 4ANNA 4XV2A 3CR0A 5TOZA 5LWMA 4F7SA 2C0OA 3GQIA 5IU2A 4MUQA 3TJCA 4I23A 1WAKA 3FC1X 1DI9A 3UP7A 2I1MA 2JDVA 2XM9A 3QLGA 2A2AA 3VUTA 2PMLX 5C4LA 4ORKA 1F5QA 4BIBA 4D1XA 1DAYA 2ITVA 3NNVA 2OW3A 1MUOA 5CZHA 4K6ZA 2XIKA 3A7IA 4EQUA 1TFFA 2R64A 3BYOA 3S3IA 5L4QA 5E8VA 3EJ1A 4CZYB 4U7ZA 4AGCA 4Y72A 1NA7A 4FIHA 4KIPA 3MVMA 5CT7A 4EZ5A 1H08A 5B2MA 5HU3A 2XK7A 4FTMA 4ALWA 4USFA 2C6LA 2RFEA 3H10A 4GVJA 4YURA 4DTBA 4QP7A 5M06A 3ZSHA 4QMOA 4L52A 2VGOA 1JLUE 2B54A 3NYVA 2P33A 3BGQA 5BVKA 3TACA 3NUAA 4IAFA 5I5ZA 5FEEA 3ZUVA 4F7JA 5AP1A 4FIGA 3CC6A 3V8WA 3ORXA 4D5KA 1WZYA 3E7VA 3QTSA 4TN6A 2XIRA 2WNTA 3H30A 4AXCA 3VUKA 2QOKA 4ZMEA 2OJGA 4O0SA 4QYHA 2YWPA 4AG8A 2ITZA 3PVBA 4IVBA 3Q2JA 1WVXA 2EXMA 3BE9A 1PXKA 3AC4A 5IQAA 2WQEA 4FZ6A 4GK2A 3WI6A 5LCJA 3PPJA 4RWJA 4KD1A 1OVEA 4E4XA 4FTLA 3T3VA 2ITUA 1SNUA 4I6QA 1M7NA 2VAGA 2HZNA 3HMMA 2O63A 5AV3A 3PJ2A 3FMKA 5LVPA 4W4WA 3BV3A 2UUEA 2V5QA 3R30A 4IACA 4AFJA 5KBQA 5J5SA 3E7OA 1Y6BA 4RC3A 3R00A 2XJ2A 4AW5A 3HMIA 4C4FA 2JIUA 3AMYA 4IEBA 4QPSA 3WF5A 2AC3A 3A2CA 2VWUA 4S33A 4G3EA 4I6BA 4CVAA 4PV0A 4C8BA 4TW9A 1PMEA 2GS6A 3BBWA 4E3CA 3MPAA 3P7BA 2VU3A 2J90A 4ARKA 3RK7A 4O86A 5ITAA 5HE1A 1V0BA 3DXNA 4EH6A 2NPQA 1OKZA 4F65A 4Y85A 5K0XA 3PJ8A 1YXVA 3PIZA 4IAZA 3PVGA 4Z7GA 1JBPE 2UZDA 5DT3A 2X8IA 3IGOA 2QOLA 2IWIA 2PE2A 5A4QA 2YITA 4X3JA 4AS0A 3H0ZA 2E9NA 3MB7A 3NWWA 4AOTA 3HRBA 4C3RA 4PDSA 3PA4A 3SVVA 3MBLA 3E3BX 4F9WA 4QP9A 3FXWA 2C6MA 4RWIA 3FSKA 4W9WA 3SQQA 1G8JA 4QRCA 3OT8A 3EFJA 1CSNA 3U6JA 1DM2A 1WMKA 4NKSA 4FKJA 3ZS5A 5EKNA 2YM4A 5D9HA 4JNWA 2F7EE 3QCSA 4OTWA 3PTGA 4O84A 3KKVA 4HCUA 3EFLA 4IVCA 4D1SA 5BMSA 3MESA 1KE6A 2JKMA 4QMUA 3TZ8A 2OZAB 4LGGA 1Q41A 5C1QB 4FX3A 4TZRA 3VW6A 3AT2A 4FTNA 5AP5A 4KAOA 3K3JA 4AE9A 3GVUA 2BKKA 4O81A 4CFNA 2IJMA 5B7VA 3UIXA 4X2NA 1VYWA 3A62A 5K3YA 2YISA 3G0FA 2GNIA 3E92A 3EN4A 3QRJA 3AQVA 4WBOA 3BHHA 3ZO2A 4FA2A 5K4IA 3BIZA 3GC7A 3OW3A 2YDJA 2BR1A 3WYYA 4WG3A 4D1ZA 4H3PA 3NZ0A 2IF8A 2X4FA 4JQEA 4WUAA 1AQ1A 2GNLA 4PQNA 4BFMA 5AADA 2W4KA 4ASEA 3SA0A 5AR3A 4DGLC 2IZRA 2R2PA 4I41A 1PMVA 4G5JA 4I0RA 4NUSA 4DCAA 2WMAA 3P5KA 3H4JA 4J99A 3NMUF 2X0OA 3FC2A 2JBPA 5HTBA 2Y4IC 4BICA 3PSCA 4XG7A 3RM6A 3VRZA 3OT3A 2GU8A 4FTQA 3PXKA 2R3OA 3RK9A 4F64A 3CKXA 5IZFA 4E5WA 4L3LA 2FA2A 5CSXA 4DAWA 1PF8A 4FKWA 4IAAA 4IM0A 2QO2A 4F08A 3PA3A 4MXCA 4D58A 2B55A 4RX7A 5CXHA 1I09A 2WMTA 3WF7A 4RJ4A 4AW0A 5BNJA 2PVFA 4LGHA 3TNWA 3BLRA 1H24A 3AT4A 5LVMA 2BFXA 4S31A 2QVSE 2YZAA 2UZLA 3JVRA 3UG2A 3AC5A 5FDPA 4YC3A 2XNOA 2QHNA 3K5VA 4ZJVA 3PZEA 3JYAA 5HE2A 4BZNA 4RFYA 2QODA 3HVCA 5KBRA 4I6LA 1ZYJA 2W05A 4HPTE 5CT0A 3LQ8A 4YZ9A 5CEPA 3F3ZA 2OJFE 2PVMA 3PSBA 4JG7A 3UIBA 4EL9A 4JIKA 4TYEA 1NVQA 4BGQA 3BEGA 2XYUA 2IW6A 1Q99A 1H1SA 3R8LA 4FNYA 2W4JA 4XYFA 3E63A 2OFVA 4NEUA 4FKUA 3C4FA 3IW8A 4QMMA 2W5AA 3A8WA 3F7WA 1JQHA 3NCGA 4A9SA 5CEIA 3QQUA 3KFAA 3D15A 4WUNA 4ENXA 1BI8A 4TYJA 5DMZA 4I20A 1LP4A 4EH7A 1XBAA 3RHXA 1P4OA 1P2AA 3Q6UA 2VTSA 5AM6A 3VUIA 4TRLA 2ZV8A 2VTNA 3CY3A 2QU5A 3P78A 5J79A 3ENMA 3F7ZA 4M69B 3QTQA 4D4RA 4WG5A 3O7LB 5IQBA 1H28A 1U5RA 2YM8A 5BVFA 3IO7A 2HXQA 2XH5A 1J7IA 5DN3A 4GKHA 2WKMA 2B4SB 3PYYA 2C6DA 4EK8A 1ZY5A 2YDIA 3FLQA 3C4CA 3QC4A 4ALVA 2YJRA 4NM5A 4K33A 4D2SA 3C9WA 3C50A 3R63A 4R7IA 3C5UA 3TJDA 2GPHA 2QONA 2ITNA 4NWMA 1CKPA 1H26A 2ETKA 4O2ZA 3TTJA 4G1WA 3W1FA 1JSVA 2WEVA 3MN3A 4BDDA 4RVTA 1J3HA 2EXEA 5CF8A 4HYUA 1M52A 5L8JA 1URCA 2CLXA 3QXOA 4A9RA 4QP6A 1R1WA 4RG0A 2PL0A 2Y4PA 2X1NA 2PSQA 3HL7A 3WZUA 3SLSA 3RM7A 4EK6A 3N51A 4HYSA 2CCIA 4L46A 4MBIA 4BDGA 3HDNA 3BGZA 3G6HA 4FV8A 4XHKB 3GU6A 1YI4A 3I81A 2WHBA 4UZDA 2CGVA 3MPTA 3FLYA 2AUHA 4BDIA 3DK7A 3PJ3A 5JGDA 2BVAA 3BI6A 3HV5A 2SRCA 2RF9A 3O8PA 4O7RA 1OIUA 2H8HA 4FKTA 4HGTA 3ZUTA 5EM6A 2VN9A 3UO4A 2W1GA 3OF0A 2HXLA 2R3JA 4RX9A 4UWBA 5AUXA 3FI3A 4JR3A 3KK9A 4WNKA 4IHPA 3O8TA 4C02A 2PVLA 3IG7A 3R7YA 2X7FA 2RL5A 1UV5A 3U8WA 1JAMA 1PXOA 4YJTA 5E8WA 3U87A 4A07A 2OIDA 1O6LA 4CCBA 5LMBA 2PULA 3MFUA 3ZBXA 2KULA 3H0YA 4XUFA 3Q9YA 4R5SA 5AV1A 1FQ1B 4BBMA 2CN5A 2GNFA 2YJSA 3FUPA 4FZFB 2R4BA 4S2ZA 3S1HA