2ETRA

Crystal structure of rock i bound to y-27632
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
400
structure length
400
Chain Sequence
b'SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 1
publication title The Structure of Dimeric ROCK I Reveals the Mechanism for Ligand Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 121
structure length 400
sequence length 400
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2etrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2etrA01
4C33A 5BVDA 1B39A 3RWQA 3AQVA 2UVYA 3VUGA 1R1WA 3JR1A 3RAHA 5KUPA 4BCJA 2PUIA 4X7QA 5CNOA 4ZJIA 2ZB0A 1OIQA 2CCIA 4YJQA 3F3WA 4DH1A 2O0UA 4P5ZA 3RZFA 4FTMA 1YXSA 5DR2A 3BCEA 3ENMA 5ETFA 4BDBA 1Q99A 3QTWA 4CFFA 4RFZA 5K9IA 1OPKA 1Y6AA 4ZY4A 4FF8A 2OI4X 4R7IA 5M4IA 5EKNA 5KX8A 2YDIA 2F2CB 2WFYA 2X7GA 3Q32A 4FSMA 1XH5A 3BHHA 4CKIA 4X3FA 4AFEA 2OSCA 3BLRA 2XRUA 4JR3A 3G90X 3JPVA 2UVZA 1YDRE 4CLIA 4RZWA 3AMBA 3TNHA 1IRKA 2O8YA 4BIBA 4BICA 4OTIA 3OCSA 1GNGA 4O2ZA 1Z5MA 4L01A 5A4TA 1U46A 3F3TA 2WO6A 3SHEA 1KUTA 4FTNA 5AR7A 4JQ7A 4KS8A 4EZ5A 1OKVA 4XP2A 4LGGA 3RALA 4IM2A 4KBKA 5HHWA 4CVAA 2BDJA 3VBVA 2XA4A 3DDQA 3I6WA 2X1NA 4U81A 4AT3A 4IH8A 3NVKI 4AU8A 4HVIA 2V62A 5J1WA 4RJ7A 3RCDA 3P7AA 4FSUA 4HVDA 2OXDA 3R0TA 4JRVA 5DHJA 2XKEA 3RBWA 3M1SA 4FGRA 1J1CA 1KWPA 3DZOA 5DRDA 5J5TA 4F6SA 5L8JA 4OAUC 4FA2A 3AMAA 3C4FA 3R28A 4L68A 4ZP5A 2HK5A 1SVGA 5KHWA 3MYGA 5BMMA 1V0OA 4DG3E 3UG2A 4GT4A 1IA8A 4PTGA 1RQQA 4FNXA 3ZLYA 4ACCA 3P08A 3VC4A 3MI9A 5HG9A 4AN9A 4BCFA 4DG0E 5HE2A 4CMTA 4ZZNA 4GL9A 2C3JA 1CKJA 2C5NA 4FSYA 3AMYA 4GS6A 1R0EA 4S30A 4BVUA 2Q83A 1QPCA 1HOWA 3CPBA 4QP6A 1DAWA 4JDJA 3LCKA 3DXPA 3FLSA 5KNJA 3DDPA 4OT5A 4RT7A 4FBXA 1MUOA 1OKZA 5BVNA 5IUHA 5M4UA 2PULA 4UEUA 5KMJA 3A7JA 4RLLA 5AP0A 4FE2A 4E4MA 4DH8A 4AWIA 5AUYA 2QOOA 3R8LA 4S31A 3EYHA 3EL7A 4NT4A 3ZUVA 4EH4A 5BUEA 3GUBA 5HO7A 3FJQE 3PVUA 5G1XA 4OUCA 2HYYA 3IW8A 4PV0A 1H1QA 4GU6A 2O5KA 4YHTA 4AT5A 3W32A 3R7GA 1WMKA 3FI3A 2YIRA 4WUAA 1ZY4A 3SOAA 1JQHA 1OKWA 4EBVA 5HZNA 4JQEA 3PVWA 5DEWA 5AX9A 5LJJA 2VWXA 5EDQA 1GY3A 4C61A 5LWMA 2QVSE 3U87A 2WD1A 3T8OA 5KMIA 1EH4A 4IW0A 3UOJA 4MNFA 3KXHA 4IC7A 1JLUE 2YWVA 4BI1A 3RZBA 2JKMA 2ZV7A 3ORIA 4RPVA 4KIPA 3ENHA 2JAVA 2C1BA 4RA4A 4DAWA 2BIKB 2WEIA 2JDOA 3ETAA 4IANA 5E90A 3KEXA 5FEEA 2ETKA 4CFXA 3QTQA 4DC2A 1JNKA 2WMAA 3TDWA 1QL6A 1FVVA 1S9IA 5DVRA 2WTKB 4O86A 4NUSA 3DKGA 2PHKA 1YOMA 3F61A 5A6OA 1OI9A 2R3FA 5I3RA 3BQCA 4IE9A 3UC4A 3FXWA 4FTOA 3QZFA 5ANGA 3OZ6A 2OJJA 3RNIA 1ATPE 2WEVA 4FTCA 5CZIA 3Q9XA 2FH9A 3KB7A 4FV5A 2GNGA 2YDKA 5F9EA 1G3NA 3R73A 4KABA 4ERKA 3VW8A 2J5FA 4MCVA 3Q9YA 3L9NA 4FYNA 1F5QA 4YJVA 5AP4A 3S4QA 4AW5A 5BQ0A 3LCDA 4YJOA 3UO5A 3R1NA 2UZVA 3ZZEA 4DGNA 3G5DA 3RHXA 3NNXA 3Q96A 4LYNA 4DLIA 4D2TA 4O91A 4UBAA 4HVSA 3PSDA 1W84A 3DTWA 2HAKA 2ZV9A 1WBVA 2ZJWA 3QCXA 1R39A 4XRJA 4U9AA 3FL4A 4GIHA 2UZTA 3B2WA 4I3ZA 2CN5A 5HEZA 3RMFA 5LVLA 3O50A 4I6FA 3JXWA 4Y95A 3W2QA 4FG9A 1IAJA 3BU3A 4ACGA 4GK4A 5HE3A 3WF6A 4K1BA 3OMVA 4R5SA 4BDFA 3N4TA 5LVPA 3OD6X 4B8MA 2C5XA 3OEZA 3UZTA 2PSQA 2OH4A 5E1SA 4G9RA 4DA5A 4TN6A 5BVEA 2HIWA 4G34A 4O96A 2OG8A 4EK8A 1JKLA 4BDHA 3DJ7A 3CCNA 3QLGA 4QTAA 1UWHA 4GMYA 1P2AA 3FKOA 4FT9A 4IB0A 3E7VA 4QQ5A 3C4ZA 3ATTA 1PXOA 4CV9A 4HCUA 4DINA 5JGAA 3ULIA 4ZTRA 3ZO1A 4O82A 4FT5A 4BDDA 3VRZA 3BGPA 4WA9A 2F7XE 4J98A 3LXNA 4AOTA 4EORA 4CFMA 4FIIA 2PZYA 4I6HA 4KKGA 2IVVA 4WT6A 3TI1A 4UB7A 3VHKA 4A9SA 3LLTA 3QGWA 2R7IA 3HKOA 2X7OA 3OW3A 4YPSA 4DEHA 3TTJA 3LMHA 4U79A 5ICPA 3BZ3A 2P0CA 3LMGA 4QTEA 3R01A 2X6EA 2GSFA 2C1AA 4HYIA 4EUUA 3LFDA 3DCVA 2YCQA 3LZBA 4MWHA 4N57A 1XWSA 4RJ6A 1XH8A 4JIAA 5ANOA 1Q97A 3RK7A 4D4SA 5HTCA 3F3UA 4FKTA 3KULB 3EQGA 2WTJA 2HOGA 3IS5A 2ESMA 3DBDA 4D9TA 5AP1A 1GIJA 2WTKC 4NH1A 3QLFA 3OXIA 4ANQA 1TQMA 3UP2A 3ZH8A 3KMWA 2QOCA 2RFSA 4YC8A 2X2MA 1CM8A 4BN1A 3EFLA 5DYJA 4BYIA 2JDTA 3U51A 4QMOA 2XK9A 3A2CA 4KIKA 2VWBA 4QT1A 3V3VA 1KE8A 4ALVA 3UTOA 4F0IA 1F3MC 1FMKA 4YTCA 1MP8A 3EJ1A 4YNOA 5M53A 3NDMA 4IAAA 1K9AA 3GC8A 4RIXA 2UV2A 5CENA 3VO3A 3FUPA 2Z7SA 2QR7A 4ONAA 2CKQA 3FZSA 5D1JA 3FWQA 3FL5A 4OLIA 4ANMA 2ZB1A 4IJ9A 4KSPA 4P7EA 5K5XA 3FI4A 3ZHPC 2X9EA 5HLWA 4ZTMA 1O6KA 1OIUA 2OF2A 5JGBA 5FG8A 4L43A 5ANJA 3R9HA 2IZRA 5DT3A 3JS2A 1FVTA 4XLVA 4QTBA 2RL5A 2CLQA 3PXKA 3UOKA 4E1ZA 5CAQA 4WOVA 5FLFA 4PDSA 3MVJA 3G15A 1VZOA 3GB2A 4TNBA 4YMJA 3MIAA 2UZBA 3DBCA 4NIFB 3D15A 2W0JA 3PIXA 4O7YA 3R7UA 2VN9A 3FYJX 5AIKA 1G5SA 5CVFA 4TPTA 3V8SA 3V01A 3VUMA 4DGOA 3AD4A 3OXTA 4H39A 3AXWA 3BBWA 3BELA 4F99A 5IQCA 4DT9A 2XCHA 5AA8A 1YKRA 3I5ZA 1E1XA 4BZNA 4N6ZA 2FYSA 3IQ7A 4M15A 4WUNA 2EUFB 1NA7A 5KKRB 2Z02A 1PHKA 4DTKA 4DFXE 5HE1A 3GGFA 3GFWA 3PFQA 1QPEA 5AADA 2W9ZB 2XMYA 3THBA 4ZS4A 1U4DA 4BCMA 5IA2A 5CWZA 3OWJA 2I7QA 4J52A 4R5YA 4AA0A 4CMUA 2BIYA 4ALUA 2V7OA 4NW5A 3VS2A 4BTMA 3NS9A 2ZM4A 3AC2A 3R2YA 3QZIA 3UG1A 4FKGA 2GCDA 4KIOA 4CV8A 3ZDUA 4W8EA 1I44A 1VYWA 3CJGA 3DT1A 3I7CA 1ZZLA 5IDNA 1XKKA 4FSWA 2XCKA 1PYXA 2ZM1A 4TTHB 4WNKA 4WG3A 3FMDA 3UQCA 3DJ5A 4GKIA 2OKRA 4FT7A 1T46A 4M8TA 1H28A 4E4NA 4EOKA 2YZAA 2IPXA 3R21A 3FKNA 2PVKA 3A60A 1FVRA 2PK9A 3DLSA 3UODA 1ZOHA 4IAKA 5DOSA 2OIBA 2C5OA 3LXLA 4FIFA 2C6TA 2UUEA 3QTRA 4YPDA 3KRRA 5I5ZA 3ODYX 5CYIA 2HY81 4U8ZA 1OL7A 3GOKA 4TW9A 3DV3A 5BUJA 1YQJA 3PY3A 5HESA 4NJDA 2CKOA 4NYEA 5CT0A 3G2FA 4CFWA 4DEBA 2ITUA 3R8VA 4XV3A 2QLUA 5HBEA 3R1QA 3B8QA 3RINA 1YWNA 4FTIA 3NMUF 4N70A 1HCKA 3VF9A 1YXTA 3QD0A 4WBBB 3UYSA 2IG7A 2PVFA 3MV5A 1H07A 2B9JA 2F7EE 3UIBA 3C13A 4FODA 5IG1A 5CXHA 5EW8A 3VUHA 5CALA 4TY1A 2XBAA 3POZA 4M66A 4BCIA 3TUCA 3LIJA 4U42A 2P3GX 4Q5HA 1Q62A 4GIIA 1V1KA 2ETMA 2W5AA 4BRXA 5L2SA 3SW7A 3ZM9A 5DEYA 3FZOA 3PXQA 4XG6A 3T9TA 3W2SA 2Y9QA 1M2RA 1OZ1A 3LM0A 2BHEA 5BPYA 2WMRA 3NAYA 2BUJA 1FPUA 4Q9ZA 2OIQA 2V22A 4UWBA 3OOGA 4G3EA 4AQCA 4EH2A 2ITTA 1H24A 4DTBA 4Y72A 5IUGA 2PUNA 4QTDA 4RLKA 4UMQA 3LW0A 3DAKA 1SNUA 3D2IA 3O17A 4DEDA 3MN3A 4PF4A 1O6LA 4BGHA 5EDRA 2QKRA 2C30A 4L00A 2OLCA 4XG2A 4APCA 2J0JA 1YRPA 3RPYA 1Q8TA 1VJYA 4MWIA 5DT4A 4LFIA 4QYEA 5K0XA 4B9DA 3U9CA 5M57A 4FL1A 4MD7E 2QOQA 5KKRC 2QO2A 4BCOA 2C6EA 4OTRA 4QP3A 3ORNA 2JD5A 2EB3A 2Z7RA 4ZTHA 3UNKA 3RAWA 4IHPA 4CFUA 4LOQA 3GQIA 3O8PA 3QRJA 3ZLSA 3U55A 3AGLA 3FEGA 3Q5ZA 1R78A 3OHTA 4ZTSA 5BVFA 1ZYDA 4UMUA 3GBZA 4FV7A 3L8VA 2H96A 4EQUA 3C5IA 3NNWA 3V5TA 2YM3A 4KINA 3F3VA 3FMNA 1P5EA 4FV8A 4HJOA 1GAGA 3QALE 2WIPA 5JFSA 2R4BA 3ZLWA 3BHYA 3S0OA 3Q2MA 2GNHA 4XV2A 4B6LA 4J95A 1REKA 2J6MA 1B38A 2YFXA 4U45A 3DB6A 4M67A 1BUHA 4O6EA 4JRNA 3RK9A 3VS6A 3D7TA 2OICA 3VAPA 4C38A 4DN5A 4F9WA 2VWIA 3COMA 3DXQA 4O81A 5CI7A 3IGGA 5EOBA 4MF1A 3TKHA 3WE8A 2VWWA 4MHAA 4JBVA 5IF1A 3CTHA 4F1OA 4CKRA 4NM7A 2BTSA 1HCLA 1WVYA 2Z8CA 4L52A 1YHWA 2C3KA 1XO2B 2CSNA 5CAPA 3QAME 3HMIA 3OG7A 3ZRKA 2UW5A 1WFCA 2IVUA 4OTHA 2UZOA 3WF5A 4FKJA 4FOBA 4JVGA 2C5YA 3E8NA 4DT8A 4MX9A 1H01A 3MPAA 3QU0A 4A07A 4BI2A 5HNGA 5CVHA 3C4CA 5DWRA 3RPVA 1E9HA 3PJ1A 5EG3A 2WOTA 4FNWA 4D5KA 4C3FA 5HNIX 4BHNA 2VTAA 3VUDA 5DLSA 4BGGA 4YR8A 5EYKA 3CC6A 3RPSA 4FV6A 3KVXA 4D58A 5I9XA 3R8UA 4M69A 4XMOA 4A4OA 3FSKA 4OTGA 5D7AA 4UZHA 4MK0A 4RC2A 4DG2E 5IH4A 5KMLA 2J0KA 3BLHA 4I5HA 1PYEA 3QA8A 5IQBA 1H1RA 5JRQA 1OM1A 3QCQA 2F7ZE 4LUDA 3UP7A 4FTAA 3W8QA 3V6RA 5A4EA 3CSVA 3EN6A 3HAVA 4R8QA 1Y8YA 2I0EA 2R64A 2WQMA 4UMTA 3KCFA 2AC5A 3P7BA 3ZMMA 2QQ7A 4RMZA 3AC5A 3MY5A 4HVGA 5CF6A 1YWRA 3PY0A 1TQIA 1ZLTA 2HZ4A 5EM8A 3MFSA 3QF9A 4CKJA 2CDZA 5D11A 3BLQA 5FM2A 3LPBA 3VWAA 4XG8A 4JG8A 4D1XA 3KXNA 4ZTQA 4ARKA 4E20A 5C26A 2H9VA 1KE5A 4I22A 3TEIA 4W9WA 2JBOA 5FTGA 4AE9A 5DPVA 5B0XA 4DGGA 3RWPA 3IPHA 4KRCA 4QNAA 3UOLA 4IEBA 5HCZA 3CQUA 3D0EA 3EN7A 2NPQA 5IZFA 3GP0A 4QPMA 3MY0A 4DE4A 2CPKE 4R1YA 1F0QA 3GEQA 1YDSE 4C4IA 2FVDA 3D4QA 3H9RA 4TRLA 4YLJA 4AACA 2IZUA 2FO0A 2GTMA 2JEDA 3AOXA 3WI6A 4K33A 4FZDB 4JIKA 5CS6A 5BYYA 5LVNA 2XNEA 3EQFA 4BBMA 3POOA 4EJNA 2B9IA 4XHKB 5T6KA 5M4FA 3EKNA 1G8SA 3BHTA 1M14A 3HZTA 3OBGA 3MFUA 3R02A 4F64A 5L6PA 4FEUA 3F2NA 4A4XA 5HD4A 1Q8YA 4AW2A 3TACA 2B53A 3MDYA 2VTSA 2OFVA 3Q5IA 4FIJA 4HYSA 4Y85A 5CLPA 4BCHA 3TUDA 5HVJA 4WG4A 4RJ8A 5KO1A 4XRLA 3RM7A 4JX7A 4F1TA 4GT3A 1OIYA 2YCSA 4KD1A 3R7YA 5BYLA 1XBCA 3IW5A 1VEBA 5DH3A 5IA4A 4K6ZA 4CYIA 4DF3A 3QTSA 3EFKA 5JQ5A 3ATSA 3E8DA 3NCZA 3R22A 5FEQA 2DYLA 5AEPA 2XVDA 3MWUA 4AW1A 5BNJA 2PU8A 3TN8A 3PIZA 4F9YA 3KQ7A 2E9VA 4IFGA 2ZOQA 3QX4A 2YIWA 3WIGA 1OGUA 1V0PA 5IQDA 1NVRA 2XK7A 1FGIA 3O8TA 3OWLA 2R3NA 4NFNA 4HNFA 3ZZWA 3WZEA 4PMTA 3OT3A 2B9HA 1YI3A 2YHVA 3OFMA 2EXEA 3DKFA 3LCOA 5GJGA 4AG8A 2RFDA 2WMWA 4KBAA 4Y5QA 4Q9SA 3C0HA 4ZJJA 3DKCA 2XK4A 1XBAA 1UU7A 4QNYA 1IAHA 4BKYA 3F2RA 4YGAA 4FSQA 4BIDA 5B2LA 4V01A 5EOLA 5HU9A 3MJ2A 4TL0A 4KIQA 5BVWA 4C2VA 1PKDA 2PE0A 2J0IA 3HDMA 4U43A 4JDKA 5D12A 2EWAA 5C27A 4CZYB 1TVOA 3JY0A 3RAKA 5CEQA 4B0GA 3FZTA 3NNUA 4D2WA 3TM0A 4IDVA 1YXXA 3BV2A 4B99A 4TKSA 1KSWA 3PDTA 4ZSEA 1QMZA 4FG7A 3DKOA 4U40A 4G16A 4TYHA 3Q04A 3R9NA 2R5TA 3SLSA 3TNIA 4RQVA 2X9FA 3D5VA 4IZAA 4RVKA 4PNKA 5J7HA 5JH6A 3U8WA 3CJFA 2F49A 5KMOA 4D4VA 3TZ8A 1O6YA 3W33A 3C0IA 5CXZA 3MGYA 3C4EA 3E8CA 3QCYA 2ERZE 2WQEA 1GZ8A 4I1ZA 4RZVA 4CZTA 2GDOA 4DFZE 4Y83A 5CSPA 5LQFA 4BDKA 5TKDA 5E91A 5EHOA 4I0SA 4EH9A 2UW7A 4DH7A 3DGKA 1FGKA 4IX6A 4DCEA 4ACHA 2ZMDA 4S33A 4EHEA 3N4UA 4ZMFA 4CTCA 2IZTA 2BRBA 2WMXA 2RG6A 3R7OA 4KB8A 4IMYA 1LUFA 4ZS0A 1QPDA 3FLZA 3PXFA 4O0WA 3BI6A 2BMCA 3L1SA 5DR6A 2PZPA 4FKVA 1Q61A 2B55A 5LVOA 5LCKA 2XEYA 3ZEWA 5B2KA 4FNZA 5EI6A 2ITNA 1FMOE 4WSQA 4QP2A 4N4SA 5H8GA 4AS0A 3TNQB 3ZRMA 3PYYA 1U5RA 4M0YA 3D94A 3ZONA 4AP7A 5I9YA 5AR3A 4O0TA 3VUTA 3NYXA 1M7QA 2YIXA 4QPSA 3ODZX 4NSTA 3HV6A 4IIRA 5M06A 1H26A 1P4FA 4FZFB 2DQ7X 2HZNA 3IKAA 3DFAA 3FLYA 3TXOA 4BDGA 2XRWA 4RIYA 4I41A 2JDSA 1SMHA 2QCSA 3CBLA 3F5PA 2BKKA 3ZBXA 5C8MA 3VS1A 2G2IA 3GCPA 5KE0A 4PL4A 4FICA 5CZHA 2IW8A 4A4LA 5DN3A 1UNLA 4GH2A 4HCVA 4O2PA 2BAJA 4CCUA 4CNHA 4YJNA 4IACA 2J50A 5JFXA 5KBRA 2GS2A 1H8FA 3WZUA 4A9UA 3QA0A 3HGKA 3JUHA 2YIQA 2R3MA 1K2PA 2VX0A 5E4HA 3ZSHA 3IO7A 4ERWA 4PRJA 4OBOA 4QYYA 5AAEA 4O7LA 3FMEA 4K2RA 3IGOA 4FIEA 2W1GA 2VTIA 3VW6A 3SG8A 3FDNA 1GZKA 2WNTA 5AUTA 1SNXA 2VTRA 2BCJA 3LLAA 4NEUA 1ZYLA 1Q4LA 4ZY6A 1NT2A 3ORXA 1URWA 4RX8A 3IDCA 2CHLA 2G9XA 4IAZA 3SXFA 2QOHA 5DFPA 4WNPA 4WBOA 5DMZA 5DBXA 5HTBA 1STCE 3BHUA 3FE3A 3ZYAA 4D0XA 2H8HA 4EJ7A 2CGUA 2WMUA 3NUSA 1W0XC 4AUAA 4BCNA 4NL0A 2WTCA 4GFOA 1SVEA 4FSRA 3G51A 3R9OA 3H9OA 2GNJA 1J7UA 3QTUA 2XNBA 2ITZA 4LGHA 4C4FA 4EQCA 2GS6A 2VRXA 3KF7A 3RM6A 3PXRA 4FTKA 3ELJA 1A48A 4NM3A 3EYGA 3HL7A 2UW6A 3DK6A 4MQ1A 4PMMA 2RFEA 2EXMA 3OF0A 4QQCA 4TYEA 2HELA 3COHA 2VO6A 1M7NA 4K0YA 4PP9A 2BTRA 2YLEA 4QOXA 4FR4A 4WRGA 4YZCA 5F4NA 3D14A 3HRBA 2VU3A 3WIKA 2CCHA 5AUZA 4MAOA 4AZWA 3DNEA 5KMMA 4PPBA 2AYPA 3UOHA 4I92A 4KKHA 5LOHA 2RGPA 5EW9A 3UDBA 2O65A 3LFAA 4JT3A 3OCTA 2XIKA 1CKIA 1S9JA 5FGKA 3TUBA 3DA6A 4R7HA 2QOBA 5C9CA 3HA6A 3A4OX 5AIRA 5D10A 4PTCA 4YC3A 3LJ1A 4CQEA 3V51A 3VBWA 1WAKA 4EH6A 4CFVA 4L42A 3P0MA 1CKPA 4QMYA 3LMIA 5GIOE 4D5HA 4ZLOA 5E92A 4XP3A 4AOJA 2VTNA 5IH6A 2HY0A 3VIDA 3KXZA 3LQ5A 4EOPA 3GC9A 4ZTLA 5FDPA 3PSCA 4G3GA 3C0GA 2F9GA 3U6IA 3LFSA 2YAAA 3V5QA 3VS3A 4ANNA 2C4GA 4Z55A 2YJSA 1BL6A 4C4EA 5HU3A 5IEXA 5IDPA 1ZARA 3FZRA 4FTTA 3ACKA 4K18A 1ZAOA 1DI8A 1W83A 5M55A 3S3IA 3U9NA 1R0PA 4WIHA 2WPAA 4AN2A 3MA3A 4X2FA 4MXCA 3UJGA 4LRKA 4K11A 4E8AA 2XJ2A 2R3KA 3PP1A 4QYGA 3E3BX 5JZJA 3VN9A 5EKOA 4QMVA 5CF5A 4C02A 3PIYA 4NU1A 4W4YA 4ACDA 3Q9WA 3NVMB 3AD6A 3QKLA 3OP5A 3PVGA 4X0MA 5C1QB 2XJ1A 4USEA 2HCKA 3LM5A 4FV0A 4R78A 1ZWSA 3PJ8A 3UIXA 5HIEA 2DWBA 2AC3A 4C4GA 3QTIA 2JIIA 2QD9A 2XYNA 3KFAA 3LJ0A 3PJCA 4L7SA 4P4CA 1SYKA 5I9ZA 4LRMA 3CLYA 3QUDA 4L7FA 3MSSA 4RWKA 2WMQA 4JAJA 4JOAA 3NYVA 5HLNA 1OVEA 2VWYA 2YAKA 3GT8A 4FSTA 3IG7A 2J5EA 2UZLA 2IW9A 5I4NA 2J0MB 2WTDA 4EZ3A 3RHKA 3OROA 4BKZA 4FZAB 1DS5A 1YVJA 1BL7A 2X2LA 3E7OA 4OBPA 3AD5A 4ZSAA 5K4JA 1J7LA 2C3LA 2JKKA 4IB5A 3VVHA 4RX9A 3KRXA 4BDEA 2YM4A 4O27B 1Y6BA 4FV2A 1JBPE 4WG5A 4F6WA 2PVRA 3TV4A 1BI7A 1H1SA 2BFXA 4ZSGA 4BTFA 4EHZA 3QFVA 4AGWA 5JZNA 2WQNA 2IVSA 3G0FA 2BR1A 4YZMA 4N6YA 4DEGA 4R3PA 2PPQA 2A27A 3DY7A 2E2BA 2V7AA 3PPZA 4L3JA 2JAMA 3GENA 3QRTA 3Q4ZA 5LCJA 5FXSA 2FGIA 2JITA 1JAMA 5CY3A 3VBTA 5ITAA 4FC0A 3SGCA 2CKEA 2V0DA 4I4EA 3WILA 2YA9A 3DTCA 3R30A 4C34A 5L2WA 3MW1A 5IQAA 2CNVA 3HUCA 4DFBA 3Q60A 4BCPA 4AA4A 5TF9A 3WOWA 3CY2A 4ZZMA 3QUPA 3COIA 4BYJA 3WE4A 1SZMA 4W8DA 4YBJA 2W9FB 4U0IA 3W8LA 5AR5A 2GS7A 4I0TA 5DE2A 2C0IA 3FQSA 4QP7A 1U54A 3ZU7A 4Z7GA 4O7NA 5HE0A 4AE6A 5L4QA 2J9MA 4L3PA 3ACJA 1CDKA 4GW8A 5C01A 5HIBA 2XH5A 4WNMA 3PRFA 3FV8A 5EI2A 4ANOA 2VTQA 3FQEA 3FZPA 5AUVA 2E9PA 2WMBA 1YDTE 3K54A 4O0RA 4XBRA 4MNEA 4DLJA 4M13A 4QMQA 4IQ6A 3FY2A 4CG9A 5LVMA 4EOSA 3NIEA 4YLKA 3B2TA 1J3HA 2C68A 3MJ1A 3O23A 3F5GA 5AUWA 2R3GA 3SV0A 4C35A 1OBGA 1H25A 1SM2A 2CLXA 4EYMA 4NCTA 4E26A 2OZAA 1Z57A 2CNQA 4RIOA 3R2BA 4NTTA 2W7XA 1XH7A 2BFYA 4IVBA 4WO5A 4UXLA 2XIRA 2ZM3A 4PL5A 5FQDC 5CEIA 3EOCA 3PJ2A 5AM6A 2YM7A 5DI1A 3R1SA 3CKXA 3BGZA 4EEVA 3UBDA 3ZUUA 3Q53A 4BCKA 2J7TA 2BZKB 4ZSJA 2BAQA 1OITA 4GK3A 2C6IA 3TV7A 2QHMA 1U5QA 2B7AA 4C58A 2VGOA 1UU3A 3C50A 4FKQA 4ITHA 3ALOA 4R3RA 2GPHA 4WNOA 1YI6A 4AZEA 3SD0A 3PA4A 3F7ZA 3OTUA 5GZ9A 4CLJA 3NW6A 4O6LA 2OXYA 4FVPA 4YU2A 3C5UA 5IEYA 2WAJA 3FHRA 4BTKA 5JK3A 5IU2A 2JKOA 2Z2WA 3I1AA 3H3CA 5I3OA 2QKWB 2GNFA 4LGDA 3UE4A 5EQYA 5TO8A 4HZSA 1CTPE 2QC6A 2VGPA 3LCTA 3OOMA 3CKWA 3Q52A 4DBXA 3E88A 2IWIA 4EH7A 4RIWB 2X39A 5BVOA 5ETCA 2P2HA 3U54A 3S00A 4XV1A 4FTLA 4LUEA 1WBWA 5JGDA 5AAGA 4MH7A 5LMBA 2A1AB 2IN6A 3EQCA 2OJFE 2PVLA 3NRMA 3WYYA 3BRBA 4E6AA 5B2MA 2YIYA 2I40A 3P7CA 4GG7A 4IFCA 4PNIA 4QMZA 3S95A 4BDCA 2CKPA 4EH3A 1JKSA 2BPMA 3RNYA 2W5BA 2X4ZA 3LCSA 4F70A 4OTFA 3EN4A 4D1ZA 4GCJA 4PQNA 4CSVA 2QU6A 2VTPA 2R3QA 3ANRA 3N51A 3NLBA 4YUQA 1PMEA 4F1MA 2YM6A 3BWFA 4C8BA 3E3PA 4MF0A 2QU5A 3IDBA 3NZ0A 4G17A 4TYIA 3FPMA 2ACXA 5I9WA 4Q2AA 1XR1A 2VTLA 3FLQA 4NKSA 2QI8A 5HGIA 4BCGA 3WF7A 4P90A 2I0YA 2UW9A 2B4SB 5AMNA 4XX9A 5K3YA 3E92A 2W1ZA 3ORMA 5AFVA 3KXMA 5CX9A 3F5UA 4H58A 1APME 4UXQA 5F94A 2YN8A 3QCSA 4FIGA 3EHAA 3ZXTA 2RG5A 2IW6A 2W4JA 4TWNA 5T68A 2Z7LA 4HGTA 2HZIA 2YLFA 2VTOA 3HDNA 4E4XA 5GHVA 5BMSA 4PMPA 3CQEA 3QC4A 2XB7A 2HXLA 2IJMA 4BIEA 5F95A 4BZDA 2Y4PA 1BX6A 4CRSA 4ZZOA 1L3RE 3E5AA 4XG9A 4C3RA 3K5VA 5A3XA 4K77A 2XBJA 4O7ZA 4E3CA 1Q3WA 4PDPA 3ZFXA 3NUPA 5K4IA 4O83A 4QMMA 1MQ4A 2R2PA 3L9PA 4H3QA 5A4CA 4HPTE 4XNEA 4O7SA 3CXWA 2FUMA 2HWOA 4XBUA 4EHGA 1H27A 4F6UA 3HV5A 5DRBA 3R00A 2VTJA 5C4KA 3O7LB 2WU6A 5CU2A 3CY3A 4EC9A 4IWOA 3ZEPA 4CT1A 4ZMEA 2BDFA 2PZIA 2VV9A 3PSBA 3PZHA 4FOCA 4FV4A 4UYNA 2RKUA 4DFNA 4XOZA 3ITZA 4C62A 2QO7A 4D55A 4QMLA 2NRUA 3O7LD 4RC4A 3FMKA 2PUPA 4F63A 3V5WA 4NTSA 2JKQA 4IBMA 2OWBA 3OS3A 4E5BA 2QHNA 5A6NA 4H05A 4TXCA 3KULA 3KCKA 2QG5A 4YLLA 2XP2A 3VBXA 4DITA 2REIA 5AAFA 4YURA 3S2PA 1AGWA 4RX5A 3A8XA 4LQMA 2VAGA 2OBJA 3A61A 5EM6A 4F09A 3ZLXA 3I7BA 5H8EA 3O2MA 4HGSA 3VS0A 5GZAA 2VNYA 1XQZA 3A7IA 5L3AA 2JIVA 4D2RA 3PXYA 4QD6A 5KHXA 3PVBA 4TYJA 3TNWA 3A99A 4F65A 3F82A 2YISA 4PDOA 3V8WA 1UU9A 4JDIA 3QQGA 3LAUA 4KSQA 4RGJA 2QOLA 2Y7JA 1IG1A 1JWHA 3D5UA 4EYJA 4Z16A 5C03A 3SKCA 3HRCA 4AGUA 2YACA 4EHVA 4QP4A 2SRCA 5C8NA 3F3ZA 4GV1A 3GC7A 4L46A 3FLWA 3KK9A 5AUXA 3HV4A 3LXPA 5J95A 5LARA 5IA1A 3UQFA 3BV3A 5LMKA 4I6QA 3WBLA 3E8EA 3LQ8A 4AZVA 1XBBA 2RF9A 3EQRA 1H1WA 4NFMA 5HX6A 4IAFA 3U6HA 3PPJA 1H0WA 4EWHA 4GKHA 5L2QA 3DB8A 3W18A 2F4JA 2QURA 1T45A 1UKHA 4ID7A 5CAOA 5KCVA 5IQHA 4MXXA 1ZOEA 1BLXA 4EC8A 3MTLA 2ZDTA 1U59A 2E9OA 1Q8ZA 4E93A 3NPCA 4MXYA 5I9VA 4NIFA 2VO3A 4O7VA 3SQQA 5EQPA 5IMEA 4IVDA 4FKOA 5EHLA 4M97A 2XNGA 3O51A 2UW3A 4V0GB 3I6UA 2QOKA 4XG3A 5E9EA 3ANQA 1BI8A 4CG8A 4RFYA 2PYWA 3TTIA 3FKLA 3R83A 4DYMA 4MXZA 1ZYJA 4O0SA 3A8WA 4PTEA 4ZIMA 3L8XA 2OJIA 4G31A 4A9YA 2QOFA 3FY0A 5ANDA 4ZEGA 4EK5A 4YZ9A 4RWIA 5AR4A 3ORZA 5E1EA 5FXRA 3PE1A 3EB0A 3P86A 3KA0A 3QXOA 3AG9A 5AP5A 3O71A 4UYAA 3RKBA 4B8LA 3T9IA 4BBEA 4KAOA 4E4LA 4ZLZA 1WZYA 1PW2A 3NCGA 4AW0A 5AP3A 3FC1X 3BYMA 2XEZA 2GQRA 3QD4A 3PUPA 4JL9A 4ALWA 4F9AA 1BMKA 4D4RA 5HVKA 4IADA 3TKIA 1RJBA 5HIDA 4FTRA 3RVGA 4M3QA 4BB4A 1QCFA 4GK2A 4OR5A 3FBVA 4U7ZA 4GVJA 5AV0A 3DK7A 3DFCB 3LHJA 2XIYA 3BKBA 1UNHA 3Q6WA 4FKPA 4U80A 1FBNA 3P1AA 3CTJA 2W96B 2GU8A 4KRDA 5AP6A 5ANKA 3G9LX 5CSXA 5J9ZA 3C7QA 4J1RA 1V0BA 4XV9A 5HCXA 3SX9A 2C0TA 3AT2A 2O63A 4PPAA 5EQEA 2BVAA 5DG5A 4JG7A 3VRYA 1LP4A 3SA0A 3L9LA 2NRYA 4CGAA 5GJDA 3PP0A 4JR7A 5D41A 1H4LA 2PZRA 1OPLA 4WHZA 1JVPP 3DXNA 1KE6A 4IDTA 4JBOA 3W1FA 5CASA 4NWMA 1WBNA 5FD2A 3KY2A 3ZUTA 3P9JA 4IAYA 4BC6A 2GTNA 3F69A 4FT3A 4NW6A 4YP8A 4EK6A 2BZHB 1AQ1A 4O7RA 2X8EA 4FVRA 3T3UA 4YO4A 1XH6A 3G6GA 4W4XA 3NAXA 4X3FB 4TWOA 2PVYA 3I0QA 5HG8A 2OO8X 3PA5A 4NM5A 4EH8A 4O7WA 1KOBA 4LOOA 3T3VA 4D2SA 5CU0A 3PA3A 4FKIA 4C37A 5LXMA 3EN9A 3IOKA 4MD8E 4MQ2A 4B7TA 2J2IB 3EQIA 3R7IA 2UZNA 4G2FA 3CP9A 4LG4A 5DA3A 5BUIA 4HYHA 3LKMA 3BQRA 3NGAA 3Q6UA 4XG7A 2JLDA 2WXVA 2WELA 2WMVA 2WQBA 2XNMA 3MVHA 4M12A 3UQGA 3QX2A 4FVQA 3EWHA 4ZXTA 3HNGA 4G3CA 2XNPA 5IKWA 1REJA 2ITVA 4XCUA 2RFNA 5CTPA 5J9YA 5G6VA 5IQFA 2ZMCA 2B1PA 3BYUA 2I1MA 4E6CA 5CEOA 4IZ7A 5JRSA 3S1HA 4TNDA 3PG1A 3SC1A 4RJ5A 2BALA 1JSUA 4U3ZA 3R9DA 2W1CA 4GUEA 5FDXA 3MESA 2V5QA 1W98A 1JKTA 1JSTA 2YM5A 3HMNA 3GCVA 2HW7A 3MFTA 5K5NA 3NX8A 4W4WA 5IA0A 3CIKA 4KA3A 1PY5A 3MY1A 4I4FA 4ASZA 4C0TA 3DU8A 1H08A 3NEWA 1J1BA 3TG1A 4CT2A 3LXKA 2JIUA 2BZJA 5CAUA 2ONLC 5FXQA 4PUZA 1UU8A 4YZDA 3ZOSA 4RG0A 1IASA 1L8TA 4K9YA 3WF9A 4RQKA 3EZVA 2KULA 5AX3A 4R6VA 2BRMA 1O9UA 3KU2A 2IVTA 5CEKA 4RVTA 4CQGA 3ZFMA 1UKIA 4LRJA 2A2AA 3ORLA 3KRWA 4IJPA 5AV1A 2VZ6A 5ANEA 4AFJA 4E6DA 2VWZA 4IWQA 4F7NA 5E8WA 2HXQA 4QMPA 1YOLA 4DGMA 1ZZ2A 3M42A 4YTIA 1Z9XA 3DPKA 3QXPA 3AC3A 4LV5A 3NNVA 2AUHA 2H6DA 5HORA 2JC6A 4Z7HA 2BILB 4KS7A 4YSMA 3GCSA 3I4BA 3IK3A 4IVCA 3WYXA 4FIHA 4GSBA 2R3IA 4Y73A 4E5WA 2WGJA 3JVSA 2XK8A 3DOGA 3OT8A 1ZXEA 2PE2A 3MB6A 4L9IA 4RBLA 4AXAA 3DBEA 4HYUA 4RC3A 5CU6A 2GHMA 4FSNA 5HICA 3EQHA 3WZDA 3KREA 1PXKA 3QWJA 4OT6A 4C3PA 4I0RA 5L6WL 5IUIA 3AC4A 3ULZA 3TL8A 1YW2A 3EFWA 4X3FC 4D4YA 4YTFA 2RSVA 4ZSLA 3H4JA 5AR2A 3ORPA 1VR2A 2GHGA 4G3FA 3H10A 4JI9A 2XIZA 4YJPA 3FXXA 3LVPA 3PZEA 2RIOA 4H1MA 2BDWA 3ZCLA 2JBPA 4IX4A 3N9XA 5H2UA 4O1OA 1Q5KA 5GIPE 5CSVA 4I6BA 4JBQA 3C51A 4OW8A 2HZ0A 3HVCA 3PXZA 1ZYSA 3KMMA 5HLPA 5JFWA 3Q2JA 2Q0NA 2X6DA 3I60A 3C4WA 5D7VA 2X8DA 3BYSA 4I5CA 2EXCX 5A4QA 4RVLA 2YZLA 4A06A 2W1HA 5C8KA 3QD3A 3VBYA 4AN3A 4DCAA 2XZSA 3SDJA 1Q24A 2FSLX 3FZ1A 3SAYA 2XIXA 1W7HA 1GZOA 5M09A 1KE7A 4PL3A 4GFMA 4PP7A 3AC8A 4FZ7A 2OJ9A 2VD5A 3QQJA 5AV3A 3UO4A 4H3BA 2BZIB 4KWPA 3VUIA 2XK3A 5KMKA 4S32A 3SOCA 3R7VA 3A7HA 3K3IA 4XP0A 4BHZA 4IX3A 4N0SA 4IB1A 4C36A 5H3QA 4IZ5A 3DJ6A 3RI1A 3IW4A 4JXFA 5FTQA 4GVAA 4LM5A 3JVRA 3UC3A 4KBCA 5AJQA 1UVRA 2Y6OA 4XJ0A 3UVPA 3FPQA 5IEVA 4XH6A 3VF8A 1WBOA 1GZNA 2WZJA 1P4OA 4AF3A 5HO8A 5TT7A 4RJ4A 4UALA 1LEWA 2PMOX 2GMXA 2BAKA 2G15A 3B8RA 5FP6A 4DFUA 3DAEA 4R3CA 3D83A 5B7VA 1DAYA 4ASXA 3H30A 2PE1A 4GG5A 1JPAA 2W1DA 4Y8DA 2XJ0A 4B4LA 3QZHA 4CCBA 3BPRA 2C0OA 4UMPA 3MTFA 1ZYCA 2VO7A 2ITWA 4FZ6A 3GC0A 3RK5A 3SW4A 4EOLA 1FINA 2LGCA 5JT2A 3ROYA 4FL2A 3E93A 5FEDA 4E7WA 2XM8A 4BFMA 5FRIA 2VUWA 2ZVAA 2JDRA 3MVMA 5A14A 4HZRA 2WQOA 4MXOA 2C47A 5I9UA 3OY1A 4BZOA 4C59A 1XJDA 4K8AA 2ITXA 3AT4A 3ZO2A 1FQ1B 3JY9A 1NY3A 3MH0A 3OBJA 4JAIA 2O64A 2QOIA 2BRGA 2LAVA 3AT3A 1U54B 3F7WA 1NVQA 3OCBA 2Z60A 3PLSA 2O2UA 4ACMA 4AZTA 5M4CA 3D7ZA 5HG7A 2R9SA 3OUNB 2CGWA 3CS9A 3KF4A 4GT5A 5BX0A 3R63A 5CF4A 1UA2A 4NJ3A 4UX9A 3E87A 4IAIA 3FMHA 2Z7QA 1ZMUA 4XEYA 4FV3A 4JNWA 3TZ9A 3ZO4A 4MNEB 4KIKB 4KUJA 2I0HA 3EQPA 1I09A 1WCCA 2YEXA 5EH0A 1MRUA 4F4PA 5FWKK 2Q0BA 4ZOGA 3IW7A 3QQKA 1OB3A 5EYMA 2ZV2A 4RIXB 2QO9A 3PTGA 4TWCA 3KMUA 3VHEA 1YXVA 1PXMA 2W05A 3GU5A 2OZAB 4TT7A 3SRVA 2R3JA 2O3PA 4M14A 2Y0AA 4DHFA 2A19B 3LFCA 3QYWA 3MBLA 4L44A 2OW3A 2W17A 4JG6A 5BVKA 5CU4A 5HNBA 4DEEA 3QL8A 2ZV8A 4O22A 4GU9A 4MTAA 4CEGA 2WU7A 3W2RA 3KGAA 4MVFA 4BI0A 2QG7A 2XKDA 3HECA 4GFGA 3JYAA 5LWNA 5KBQA 3HA8A 2PVHA 3IECA 1CSNA 4I94A 5CNNA 2PMLX 4YO6A 3L8SA 1DM2A 3KC3A 4FX3A 1YHSA 4QP8A 4Y46A 3TIZA 3UGCA 4X2GA 3NIZA 4IM3A 4DH3A 4EQMA 3FMJA 3A7GA 2CMWA 3W2PA 4AGDA 4C2WA 1M52A 3UVQA 3HV3A 5H9BA 3UZRA 2FSOX 4RJ3A 2R0UA 4YTHA 4CXAA 2B9FA 3DQWA 2A4LA 4HGEA 3GQLA 4PX6A 3ZC5A 3HAMA 2IZSA 3P23A 1IEPA 3IW6A 4F08A 4HPUE 1WBTA 3SVVA 1OL2A 3DLZA 2QLQA 4II5A 1OBDA 2OGVA 4YZNA 1J7IA 4YHJA 3R8MA 2J0LA 4USDA 5M51A 2VTTA 4V05A 3PE2A 3I5NA 4MYGA 5AR8A 2GFCA 3MH1A 5CEMA 5JFVA 2G1TA 2CNUA 2YCRA 1A9UA 4QYFA 4YBKA 2UZDA 5CAVA 2PWLA 2XK6A 1YWVA 3BHVA 5J7BA 3FYKX 4JX3A 5L8LA 3VQHA 2CJMA 5E8UA 4MKCA 2OK1A 4Q5EA 3W55A 5IQIA 4H1JA 5JQ8A 3ZRLA 2P55A 1LEZA 2C6MA 4QP1A 4U44A 1RW8A 4BWKA 3QRKA 1SVHA 3EQBA 3BE2A 3NW5A 4BDIA 3NUNA 1PMUA 2HENA 5TE0A 4FMQA 4A9RA 5FM3A 3Q4UA 1YXUA 3W16A 5AUUA 4FEWA 4EOIA 5DT0A 3LFNA 4X2KA 1PXPA 3FHIA 4QMUA 3VNTA 3R1YA 4R7BA 2W06A 3NUXA 5D9HA 4BWXA 1NXKA 4IC8A 3V8TA 4ENYA 1PXIA 5DGZA 4O0YA 4M68A 3V04A 3UZPA 1Y91A 3OEFX 5A46A 4J71A 5I0BA 4F9BA 4YJRA 4QMNA 3I79A 1B6CB 4YSJA 4IB3A 4NCTC 1H00A 3EH9A 5E8TA 4EWQA 3MH3A 3II5A 3P79A 2FSMX 3FC2A 5E8SA 4ZAUA 2NO3A 3SG9A 5EHYA 1J91A 2UW8A 5HVYA 3VBQA 4OAVB 5HI2A 4X3JA 1TQPA 4BKJA 2J90A 2VX1A 4RRVA 2YABA 1OUKA 3OVVA 2R0IA 3O96A 5M07A 5HG5A 2YM8A 1PRYA 4RSSA 2NNWB 1PMNA 3GFEA 1ZRZA 4CMOA 4EKKA 3DS6A 4YHFA 4ZY5A 4MBLA 3TT0A 4IVAA 3NYNA 4XLIA 3WARA 2CN8A 3BBTB 2PVNA 4D28A 5C4LA 2ZYBA 4BTJA 3OY3A 4F7SA 3TCPA 4DTAA 2GHLA 1E1VA 3P4KA 4ORKA 3ET7A 3PJ3A 2UZEA 4F9CA 5TR6A 4CFNA 3BEGA 2BRHA 4LMNA 2YITA 5ANIA 3GVUA 3HUBA 2YWPA 4WRSA 4EZ7A 4Y5HA 5JN2A 3O0GA 4XYFA 3F9NA 4G6LA 3BU6A 2JGZA 4S34A 5HD7A 2EVAA 3OWPA 4PY1A 4BCQA 1GJOA 2QNJA 3NUYA 4U97A 2WB8A 4NKAA 4C4JA 4D0WA 3HP2A 3OWKA 2W1EA 3OUKA 4LOPA 4ASEA 3TV6A 3LFFA 3F66A 5IH5A 4L45A 3BGQA 1DI9A 5EDPA 5AP7A 1OPJA 5HTIA 2F2UA 1JKKA 2HW6A 2XNNA 3LFEA 4GJ3A 4J8NA 1ZMWA 1BKXA 3KXGA 3FI2A 4USFA 2R7BA 5FP5A 3D7TB 4D2PA 5CF8A 4J53A 3MB7A 3LJ2A 2I0VA 3PRIA 1UWJA 2PVMA 3RCJA 2F57A 5HBJA 3R6XA 1M17A 3KN5A 4FT0A 2R3LA 1YOJA 2PY3A 3QKMA 4YC6A 4C57A 5AWMA 5FTOA 2CGVA 3P78A 4G6NA 4MBIA 3QD2B 4H36A 5F20A 4E73A 5H8BA 3VULA 2VWVA 4FUXA 4EUTA 5T3QA 3BX5A 2HWPA 3CTQA 5HO6A 2DS1A 2ITPA 3W10A 3N4VA 2XM9A 2GNIA 4WSYA 3UPXA 3NWWA 4I24A 5EFQA 3R71A 4ZLYA 3OTVA 3VS5A 3CD8A 3Q4CA 2J51A 1W8CA 1XHAA 4BR3A 4M69B 2C5VA 4H3PA 3R9RA 3DAJA 4PPCA 3ALNA 4LI5A 3UO6A 5ACBC 4Z9LA 5A9UA 3M2WA 3RGFA 2JFLA 1UNGA 4CRLA 3QQLA 3V5LA 4UMRA 1IA9A 4FNYA 4IZYA 3UMXA 3A7FA 4FTJA 4YJSA 4BWPA 3PWYA 3QQFA 3ZM4A 4PDYA 3H9FA 1Q8WA 5CT7A 4U6RA 1QPJA 3PLAE 3WZKA 4U41A 3TWJA 3ZFYA 3HMOA 1PJKA 4DEAA 4QRCA 2E9UA 1OECA 2WTIA 5J8IA 2VX3A 2X0GA 3MPTA 1FOTA 3IDPA 2OJGA 4FEQA 2VNWA 3QHWA 5J9LA 1OKYA 3BE9A 1WBSA 3HRFA 1H1PA 5CI6A 3SXRA 4EOMA 3ORTA 1Q3DA 4ZK5A 2ZDUA 2W1FA 2WMSA 3P5KA 3UVRA 4HOKA 4X2NA 5FBOA 3R8PA 3V5PA 4BBFA 3R7EA 3W2CA 1BYGA 3FSFA 3IOPA 3L9MA 2XNOA 3NSZA 4GJ2A 4ASDA 3DK3A 5IQGA 1KE9A 4APPA 3NUAA 2VO0A 2P2IA 1PMVA 3G0EA 5A54A 4F7LA 4BDJA 3GOPA 4EBWA 1GIHA 5AM7A 2PVJA 3FAAA 4DEIA 3PY1A 3TZMA 4A7CA 3G33A 2YCFA 3LOKA 3TKUA 3AC1A 4LL5A 4AOIA 4EK3A 4QMXA 4I5MA 5K0KA 2BRNA 3LE6A 3QHRA 4W4VA 4AT4A 3VJOA 2ZAZA 3NW7A 4X2JA 4EONA 3BWJA 3UPZA 3DQXA 4O1PA 1TKIA 3GNIB 2B54A 1K3AA 3GU4A 4O38A 3QTZA 4RWJA 5L6OA 4BGQA 1OL1A 3FQHA 2CGXA 3K2LA 4R77A 5LMKC 3DBQA 4UWCA 2GQSA 2XYUA 3BYOA 4FEVA 5IPJA 1KV1A 4DBNA 1KV2A 3HP5A 4J97A 4KNBA 4XUFA 3EZRA 2Y4IB 1MRYA 4GYGA 4U5JA 3OXZA 4HNIA 3F88A 5IISA 2OIDA 3ORKA 4AGCA 3I81A 3GI3A 2BROA 2J4ZA 2B52A 4A9TA 3R04A 4YJUA 3VS4A 4NM0A 2WOUA 1RDQE 3GU8A 3Q9ZA 3QGYA 4J7BA 5AV2A 4JS8A 2PL0A 3UIMA 4ENXA 4IWPA 2X2KA 5L2TA 5CSWA 4F0GA 4D9UA 1CMKE 1LR4A 2PMNX 3M11A 5DR9A 3BYVA 3KRLA 3TIYA 4RVMA 5L8KA 3C4XA 2G2FA 4GUBA 3D9VA 3G6HA 3MVLA 4AX8A 3MFRA 4HW7A 3HX4A 4YZBA 4FL3A 3ID6C 4BY9E 2UVXA 3LFBA 4UN0C 2QONA 2GNLA 3I0OA 1OL6A 2XS0A 3DZQA 5CU3A 2VTHA 4CTBA 2XUUA 2JDVA 4L3LA 3FI8A 4FKWA 3C9WA 5GINE 3ZS5A 4P5QA 4FYOA 2P4IA 3TNPC 4J8MA 4DH5A 4GRBA 4QMWA 3ZSGA 4IWDA 4FV9A 1WVWA 2XF0A 2W5HA 3CR0A 4G9CA 5ETIA 4O0UA 4QMSA 1UV5A 3ZBFA 3LQ3A 4D2VA 3EIDA 1P14A 2PMIA 2W1IA 4ITIA 4G5PA 3QWKA 4RA5A 3VS7A 5TOZA 3HV7A 2UZWE 4OBQA 5AP2A 5IA5A 1Q8UA 3RP9A 4E5AX 2ITOA 3FMLA 1ND4A 4OTPA 3QQUA 4GYIA 3TJCA 5A4LA 5HBHA 4EL9A 4JDHA 4MXAA 4ZTNA 2X7FA 4IXPA 3GU7A 5EW3A 3VUKA 4S2ZA 5DIAA 4O84A 3EQDA 3PG3A 3FMMA 1URCA 4FV1A 4JBPA 5KMNA 3TDVA 3OW4A 4I23A 2EU9A 1M2QA 1JOWB 2UW0A 4TYHB 1LPUA 4G5JA 5CQWA 3RJCA 4I5PA 5IA3A 4M0ZA 1A06A 3UNJA 4RIWA 4L6QA 4HVHA 2A0CX 2I6LA 4FTQA 4DGLC 4LMUA 4BL1A 4OTQA 4P2KA 5AA9A 3GCQA 3QZGA 5ETAA 3CD3A 3QRIA 5BYZA 4CYJA 4AAAA 4XG4A 2BHHA 2UW4A 3W2OA 5CQUA 3HEGA 4BDAA 3KVWA 4O21A 5E8YA 4AZSA 3EL8A 5EYCA 4J96A 3HMMA 2WTWA 3DBFA 4BF2A 2PZ5A 4MEDA 4EK4A 3EN5A 5EK7A 4J99A 3UYTA 4F0FA 3H0YA 5LMAA 4W9XA 2QODA 4RWLA 4FK6A 2QR8A 2Y4IC 3F2AA 4L53A 3V5JA 4ANLA 4ANBA 1JSVA 1Y57A 4M7IA 4TZRA 3RPOA 3WZJA 5IQEA 4D1SA 4FKLA 2UZUE 5JEBA 2YERA 4QMTA 5E8XA 3RAIA 3QBNA 2GQGA 4FG8A 4WD5A 2C69A 4XOYA 4Z3VA 1WVXA 2E9NA 3BIZA 2OU7A 5IMXA 2WHBA 3G9NA 3KN6A 4DFYA 4V04A 5HQ0A 1M2PA 3ROCA 2WIHA 4FSZA 4RFMA 4EH5A 5J5SA 1R3CA 1PXNA 2PUUA 2B0QA 2FA2A 3QYZA 5CANA 5M44A 2EB2A 5CVGA 4EOJA 3RTPA 1OMWA 2ERKA 3HMPA 1GIIA 3UMWA 4RIYB 5GJFA 3H0ZA 3EFJA 2OFUA 5DNRA 3OCGA 2W4KA 3CGFA 3F5XA 2G01A 4U3YA 4OTDA 1ZMVA 3MPMA 1IR3A 2X81A 4QO9A 3SXSA 3ZC6A 3V6SA 3MIYA 2C3IB 3LFQA 4M84A 5F1ZA 2OH0E 5E7RA 2XKFA 4OTWA 3O8UA 1Y8GA 3CGOA 5M08A 4CZUA 4MD9E 2GFSA 4XS2A 4C4HA 2KTYA 2ETRA 3ZXZA 5E8VA 3E63A 3COKA 3GU6A 5HKMA 2OXXA 4X6QC 5J1VA 3A4PA 3Q3BA 4QQJA 3IONA 1OIRA 3NR9A 4GEOA 4O7TA 4IX5A 3QKKA 4KKEA 3ZO3A 2W99B 3KKVA 2P33A 3Q4TA 2C6OA 4OGRA 3WF8A 4I21A 4MBJA 1RE8A 3KRJA 4QYHA 4EI4A 2ITYA 3QC9A 4G3DA 4HCTA 3UNZA 5CEPA 3NYOA 4L67A 5J87A 3KXXA 3U6JA 4FTUA 1YI4A 4JJRA 3KK8A 5JMSA 4F7JA 4EOOA 3VQUA 1XH9A 3PWDA 2X8IA 3D5XA 4FK3A 4ZJVA 1W82A 2R3PA 3TZ7A 4QQTA 4LV8A 3D2KA 4HGLA 2YJRA 3QRUA 5L2IA 3ZDIA 4DFLA 4WKQA 3EKKA 2DUVA 3KL8A 3MA6A 5M56A 2Y8OA 5GZ8A 1NW1A 3RPRA 2C6LA 4ITJA 1X8BA 3UIUA 4X6RA 4I20A 5CSHA 5GNKA 1YHVA 2BKZA 4O0VA 4UV0A 1ZY5A 4YJTA 4G1WA 4TYGA 2G2HA 1G8AA 1PXJA 3ERKA 2IO6A 4FKUA 5ACKA 3BU5A 4ANSA 4FI1A 4G6OA 5AV4A 3AGMA 3QUEA 4L8MA 1PXLA 3SRVB 1H0VA 4EKLA 1KOAA 2PTKA 4PWNA 3MS9A 4FKRA 4TWPA 3QTXA 3ZTXA 4QTCA 5JSMA 4YNEA 5FBNC 5HX8A 2R3HA 3E62A 3EMGA 4IM0A 1OUYA 2VWUA 4E6QA 3E64A 2VTMA 1PF8A 3HLLA 3QQHA 3GXLA 3CEKA 2R3RA 3A62A 4O0XA 3MH2A 4JQ8A 3FLNC 4UZDA 4R1VA 3D5WA 2FSTX 3U4UA 1GOLA 4UY9A 5KZ0A 2XKCA 4QP9A 3CQWA 5EM5A 1OL5A 4V0GA 4NK9A 2WMTA 5HOAA 5J79A 4QPAA 2H34A 4FUYA 1ERKA 2X4FA 3FXZA 4EOQA 4AA5A 2ITQA 4CD0A 3OC1A 5HCYA 3DNDA 3NUUA 4JLCA 2WKMA 2OZOA 4C7TA 3VJNA 4FKSA 1XH4A 3BEAA 5E8ZA 2WTVA 1MQBA 3F6XA 4AZFA 1NVSA 1VYZA 3K3JA 4PMSA 1ZOGA 2C6KA 2JFMA 2W4OA 4RX7A 4I93A 2R3OA 5EM7A 2V55A 2NP8A 2ONLA 2Y6MA 3HYHA 3U4WA 5EYDA 4FGBA 3REPA 1Q41A 3K5UA 3TJDA 4FEXA 1PKGA 1MRVA 3C1XA 4UWYA 1WBPA 3PPKA 2YDJA 3L8PA 2C6DA 3CPCA 2FB8A 3CE3A 1AD5A 5EI8A 4NZWB 2OF4A 3R8ZA 3GCUA 5KZIA 4X21A 5JKGA 4LL0A 3ZSIA 5FUTA
chains in the Genus database with same CATH superfamily
4C33A 5BVDA 1B39A 3RWQA 3AQVA 2UVYA 3VUGA 1R1WA 3JR1A 3RAHA 5KUPA 4BCJA 2PUIA 4O4CA 4X7QA 5CNOA 4ZJIA 2ZB0A 1OIQA 2CCIA 4YJQA 3F3WA 4DH1A 2O0UA 4P5ZA 3RZFA 4FTMA 1YXSA 5DR2A 3BCEA 3ENMA 5ETFA 4BDBA 3BL7A 1Q99A 3QTWA 4CFFA 4RFZA 5K9IA 1OPKA 1Y6AA 4ZY4A 4FF8A 2OI4X 4R7IA 5M4IA 5EKNA 2NYAA 5KX8A 2YDIA 2F2CB 2WFYA 2X7GA 3Q32A 4FSMA 3PFYA 1XH5A 3BHHA 4CKIA 4X3FA 4AFEA 2OSCA 3BLRA 2XRUA 4JR3A 3G90X 3JPVA 2UVZA 1YDRE 4O4BB 4CLIA 4RZWA 3AMBA 3TNHA 1IRKA 2O8YA 4BIBA 4BICA 4OTIA 3OCSA 1GNGA 4O2ZA 1Z5MA 4L01A 5A4TA 1U46A 3F3TA 2WO6A 3SHEA 1KUTA 4FTNA 5AR7A 4JQ7A 4KS8A 4EZ5A 1OKVA 4XP2A 4LGGA 3RALA 4IM2A 4KBKA 5HHWA 4CVAA 2BDJA 3VBVA 2XA4A 3DDQA 3I6WA 2X1NA 4U81A 4AT3A 4IH8A 3NVKI 4AU8A 4HVIA 2V62A 5J1WA 4RJ7A 3RCDA 3P7AA 4FSUA 4HVDA 2OXDA 3R0TA 4JRVA 5DHJA 2XKEA 3RBWA 3M1SA 4FGRA 1J1CA 1KWPA 3DZOA 5DRDA 5J5TA 4F6SA 5L8JA 4OAUC 4FA2A 3AMAA 3C4FA 3R28A 4L68A 4ZP5A 2HK5A 1SVGA 5KHWA 3MYGA 5BMMA 1V0OA 4DG3E 3UG2A 4GT4A 1IA8A 4PTGA 1RQQA 4FNXA 3ZLYA 4ACCA 3P08A 3VC4A 3MI9A 5HG9A 4AN9A 4BCFA 4DG0E 5HE2A 4CMTA 4ZZNA 4GL9A 2C3JA 1CKJA 2C5NA 4FSYA 3AMYA 4GS6A 1R0EA 4S30A 4BVUA 2Q83A 1QPCA 1HOWA 3CPBA 4QP6A 1DAWA 4JDJA 3LCKA 3DXPA 3FLSA 5KNJA 3DDPA 4OT5A 4RT7A 4FBXA 1MUOA 1OKZA 5BVNA 5IUHA 5M4UA 2PULA 4UEUA 5KMJA 3A7JA 4RLLA 5AP0A 4FE2A 4E4MA 4DH8A 4AWIA 5AUYA 2QOOA 3R8LA 4S31A 3EYHA 3EL7A 4NT4A 3ZUVA 4EH4A 5BUEA 3GUBA 5HO7A 3FJQE 3PVUA 5G1XA 4OUCA 2HYYA 3IW8A 4PV0A 1H1QA 4GU6A 2O5KA 3O5AA 4YHTA 4AT5A 3W32A 3R7GA 1WMKA 3FI3A 2YIRA 4WUAA 1ZY4A 3SOAA 1JQHA 1OKWA 4EBVA 5HZNA 4JQEA 3PVWA 5DEWA 5AX9A 5LJJA 2VWXA 5EDQA 1GY3A 4C61A 5LWMA 2QVSE 3U87A 2WD1A 3T8OA 5KMIA 1EH4A 4IW0A 3UOJA 4MNFA 3KXHA 4IC7A 1JLUE 2YWVA 4BI1A 3RZBA 2JKMA 2ZV7A 3ORIA 4RPVA 4KIPA 3ENHA 2JAVA 2C1BA 4RA4A 4DAWA 2BIKB 2WEIA 2JDOA 3ETAA 4IANA 5E90A 3KEXA 5FEEA 2ETKA 4CFXA 3QTQA 4DC2A 1JNKA 2WMAA 3TDWA 1QL6A 1FVVA 1S9IA 5DVRA 2WTKB 4O86A 4NUSA 3DKGA 2PHKA 1YOMA 3F61A 5A6OA 1OI9A 1W2DA 2R3FA 5I3RA 3BQCA 4IE9A 3UC4A 3FXWA 4FTOA 3QZFA 5ANGA 3OZ6A 2OJJA 4AAYA 3RNIA 1ATPE 2WEVA 4FTCA 5CZIA 3Q9XA 2FH9A 3KB7A 4FV5A 2GNGA 2YDKA 5F9EA 1G3NA 3R73A 4KABA 4ERKA 3VW8A 2J5FA 4MCVA 3Q9YA 3L9NA 4FYNA 1F5QA 4YJVA 5AP4A 3S4QA 4AW5A 5BQ0A 3LCDA 4YJOA 3UO5A 3R1NA 2UZVA 3ZZEA 4DGNA 3G5DA 3RHXA 3NNXA 3Q96A 4LYNA 4DLIA 4D2TA 4O91A 4UBAA 4HVSA 3PSDA 1W84A 3DTWA 2HAKA 2ZV9A 1WBVA 2ZJWA 3QCXA 1R39A 4XRJA 4U9AA 3FL4A 4GIHA 2UZTA 3B2WA 4I3ZA 2CN5A 5HEZA 3RMFA 5LVLA 3O50A 4I6FA 3JXWA 4Y95A 3W2QA 4FG9A 1IAJA 3BU3A 4ACGA 4GK4A 5HE3A 3WF6A 4K1BA 3OMVA 4R5SA 4BDFA 3N4TA 5LVPA 3OD6X 4B8MA 2C5XA 3OEZA 3UZTA 2PSQA 2OH4A 5E1SA 4G9RA 3NFFB 4DA5A 4TN6A 5BVEA 2HIWA 4G34A 4O96A 2OG8A 4EK8A 1JKLA 4BDHA 3DJ7A 3CCNA 3QLGA 4QTAA 1UWHA 4GMYA 1P2AA 3FKOA 4FT9A 4IB0A 3E7VA 4QQ5A 3C4ZA 3ATTA 1PXOA 4CV9A 4HCUA 4DINA 5JGAA 3ULIA 4ZTRA 3ZO1A 4O82A 4FT5A 4BDDA 3VRZA 3BGPA 4WA9A 2F7XE 4J98A 3LXNA 4AOTA 4EORA 4CFMA 4FIIA 2PZYA 4I6HA 4KKGA 2IVVA 4WT6A 3TI1A 4UB7A 4JMQA 3VHKA 4A9SA 3LLTA 3QGWA 2R7IA 3HKOA 2X7OA 3OW3A 4YPSA 4DEHA 3TTJA 3LMHA 4U79A 5ICPA 3BZ3A 2P0CA 3LMGA 4QTEA 3R01A 2X6EA 2GSFA 2C1AA 4HYIA 4EUUA 3LFDA 3DCVA 2YCQA 3LZBA 4MWHA 4N57A 1XWSA 4RJ6A 1XH8A 4JIAA 5ANOA 1Q97A 3RK7A 4D4SA 5HTCA 3F3UA 4FKTA 3KULB 3EQGA 2WTJA 2HOGA 3IS5A 2ESMA 3DBDA 3VONA 4D9TA 5AP1A 1GIJA 2WTKC 4NH1A 3QLFA 3OXIA 4ANQA 1TQMA 3UP2A 3ZH8A 3KMWA 2QOCA 2RFSA 4YC8A 2X2MA 1CM8A 4BN1A 3W0OA 3EFLA 5DYJA 4BYIA 2JDTA 3U51A 4QMOA 2XK9A 3A2CA 4KIKA 2VWBA 4QT1A 3V3VA 1KE8A 4ALVA 3UTOA 4F0IA 1F3MC 1FMKA 4YTCA 1MP8A 3EJ1A 4YNOA 5M53A 3NDMA 4IAAA 1K9AA 3GC8A 4RIXA 2UV2A 5CENA 3VO3A 3FUPA 2Z7SA 2QR7A 4ONAA 2CKQA 3FZSA 5D1JA 3FWQA 3FL5A 4OLIA 4ANMA 2ZB1A 4IJ9A 4KSPA 4P7EA 3UDTA 5K5XA 3FI4A 3ZHPC 2X9EA 5HLWA 4ZTMA 1O6KA 1OIUA 2OF2A 5JGBA 5FG8A 4L43A 5ANJA 3R9HA 2IZRA 5DT3A 3JS2A 1FVTA 4XLVA 4QTBA 2RL5A 2CLQA 3PXKA 3UOKA 4E1ZA 5CAQA 4WOVA 5FLFA 4PDSA 3MVJA 3G15A 1VZOA 3GB2A 4TNBA 4YMJA 3MIAA 2UZBA 3DBCA 4NIFB 3D15A 2W0JA 3PIXA 4O7YA 3R7UA 2VN9A 3FYJX 5AIKA 1G5SA 5CVFA 4TPTA 3V8SA 3V01A 3AKJA 3VUMA 4DGOA 3AD4A 3OXTA 4H39A 3AXWA 3BBWA 3BELA 4F99A 5IQCA 4DT9A 2XCHA 5AA8A 1YKRA 3I5ZA 1E1XA 4BZNA 4N6ZA 2FYSA 3IQ7A 4M15A 4WUNA 2EUFB 1NA7A 5KKRB 2Z02A 1PHKA 4DTKA 4DFXE 5HE1A 3GGFA 3GFWA 3PFQA 1QPEA 5AADA 2W9ZB 2XMYA 3THBA 4ZS4A 1U4DA 4BCMA 5IA2A 5CWZA 3OWJA 2I7QA 4J52A 4R5YA 4AA0A 4CMUA 2BIYA 4ALUA 2V7OA 4NW5A 3VS2A 4BTMA 3NS9A 2ZM4A 3AC2A 3R2YA 3QZIA 3UG1A 4FKGA 2GCDA 4KIOA 4CV8A 3ZDUA 4W8EA 1I44A 1VYWA 3CJGA 3DT1A 3I7CA 1ZZLA 5IDNA 1XKKA 4FSWA 2XCKA 1PYXA 2ZM1A 4TTHB 4WNKA 4WG3A 3FMDA 3UQCA 3DJ5A 4GKIA 2OKRA 4FT7A 1T46A 4M8TA 1H28A 4E4NA 4EOKA 2YZAA 2IPXA 3R21A 3FKNA 2PVKA 3A60A 1FVRA 2PK9A 3DLSA 3UODA 1ZOHA 4IAKA 5DOSA 2OIBA 2C5OA 3LXLA 4FIFA 2C6TA 2UUEA 3QTRA 4YPDA 3KRRA 5I5ZA 3ODYX 5CYIA 2HY81 4U8ZA 1OL7A 3GOKA 4TW9A 3DV3A 4AG8A 5BUJA 2IF8A 1YQJA 3PY3A 5HESA 4NJDA 2CKOA 4NYEA 5CT0A 3G2FA 4CFWA 4DEBA 2ITUA 2IEWA 3R8VA 4XV3A 2QLUA 5HBEA 3R1QA 3B8QA 3RINA 1YWNA 4FTIA 3NMUF 4N70A 1HCKA 3VF9A 1YXTA 3QD0A 4WBBB 3UYSA 2IG7A 2PVFA 3MV5A 1H07A 2B9JA 2F7EE 3UIBA 3C13A 4FODA 5IG1A 5CXHA 5EW8A 3VUHA 5CALA 4TY1A 2XBAA 3POZA 4M66A 4BCIA 3TUCA 3LIJA 4U42A 2P3GX 4Q5HA 1Q62A 4GIIA 1V1KA 2ETMA 2W5AA 4BRXA 5L2SA 3SW7A 3ZM9A 4QEBA 5DEYA 3FZOA 3PXQA 4XG6A 3T9TA 3W2SA 2X0QA 1M2RA 1OZ1A 2Y9QA 3LM0A 2BHEA 5BPYA 2WMRA 3NAYA 2BUJA 1FPUA 4Q9ZA 2OIQA 2V22A 4UWBA 3OOGA 4G3EA 4AQCA 4EH2A 2ITTA 1H24A 4DTBA 4Y72A 5IUGA 2PUNA 4QTDA 4RLKA 4UMQA 3LW0A 3DAKA 1SNUA 3D2IA 3O17A 4DEDA 3MN3A 4PF4A 1O6LA 4BGHA 5EDRA 2QKRA 2C30A 4L00A 2OLCA 4XG2A 4APCA 4DDGA 2J0JA 1YRPA 3RPYA 1Q8TA 1VJYA 4MWIA 5DT4A 4LFIA 4QYEA 5K0XA 4B9DA 3U9CA 5M57A 4FL1A 4MD7E 2QOQA 5KKRC 2QO2A 4BCOA 2C6EA 4OTRA 4QP3A 3ORNA 2JD5A 2EB3A 2Z7RA 4ZTHA 3UNKA 3RAWA 4IHPA 4CFUA 4LOQA 3GQIA 3O8PA 3QRJA 3ZLSA 3U55A 3AGLA 3FEGA 3Q5ZA 1R78A 3OHTA 4ZTSA 5BVFA 1ZYDA 4UMUA 3KIOC 3GBZA 4FV7A 3L8VA 2H96A 4EQUA 3C5IA 3NNWA 3V5TA 2YM3A 4KINA 3F3VA 3FMNA 1P5EA 4FV8A 4HJOA 1GAGA 3QALE 2WIPA 5JFSA 2R4BA 3ZLWA 3BHYA 3S0OA 3Q2MA 2GNHA 4XV2A 4B6LA 4J95A 1REKA 2J6MA 1B38A 2YFXA 4U45A 3DB6A 4M67A 1BUHA 4O6EA 4JRNA 3RK9A 3VS6A 3D7TA 2OICA 3VAPA 4C38A 4DN5A 4F9WA 2VWIA 3COMA 3DXQA 4O81A 5CI7A 2X0OA 3IGGA 5EOBA 4MF1A 3TKHA 3WE8A 2VWWA 4MHAA 4JBVA 5IF1A 3CTHA 4F1OA 4CKRA 4NM7A 2BTSA 1HCLA 1WVYA 2Z8CA 4L52A 1YHWA 2C3KA 1XO2B 2CSNA 5CAPA 3QAME 3HMIA 3OG7A 3ZRKA 2UW5A 1WFCA 2IVUA 4OTHA 2UZOA 3WF5A 4FKJA 4FOBA 4JVGA 2C5YA 3E8NA 4DT8A 4MX9A 1H01A 3MPAA 3QU0A 4A07A 4BI2A 5HNGA 5CVHA 3C4CA 5DWRA 3RPVA 1E9HA 3PJ1A 5EG3A 2WOTA 4FNWA 4D5KA 4C3FA 5HNIX 4BHNA 2VTAA 3VUDA 5DLSA 4BGGA 4YR8A 5EYKA 3CC6A 3RPSA 4FV6A 3KVXA 4D58A 5I9XA 3R8UA 4M69A 4XMOA 4A4OA 3FSKA 4OTGA 5D7AA 4UZHA 4MK0A 4RC2A 4DG2E 5IH4A 5KMLA 2J0KA 3BLHA 4I5HA 1PYEA 3QA8A 5IQBA 1H1RA 5JRQA 1OM1A 3QCQA 2F7ZE 4LUDA 3UP7A 4FTAA 3W8QA 3V6RA 5A4EA 3CSVA 3EN6A 3HAVA 4R8QA 1Y8YA 2I0EA 2R64A 2WQMA 4UMTA 3KCFA 2AC5A 3P7BA 3ZMMA 2QQ7A 4RMZA 3AC5A 3MY5A 4HVGA 5CF6A 1YWRA 3PY0A 1TQIA 1ZLTA 2HZ4A 5EM8A 3MFSA 3QF9A 4CKJA 2CDZA 5D11A 3BLQA 5FM2A 3LPBA 3VWAA 4XG8A 4JG8A 4D1XA 3KXNA 4ZTQA 4ARKA 4E20A 5C26A 2H9VA 1KE5A 4I22A 3TEIA 4W9WA 2JBOA 5FTGA 4AE9A 5DPVA 5B0XA 4DGGA 3RWPA 3IPHA 4KRCA 4QDVA 4QNAA 3UOLA 4IEBA 5HCZA 3CQUA 3D0EA 3EN7A 2NPQA 5IZFA 3GP0A 4QPMA 3MY0A 4DE4A 2CPKE 4R1YA 1F0QA 3GEQA 1YDSE 4C4IA 2FVDA 3D4QA 3H9RA 4TRLA 4YLJA 4AACA 2IZUA 2FO0A 2GTMA 2JEDA 3AOXA 3WI6A 4K33A 4FZDB 4JIKA 5CS6A 5BYYA 5LVNA 2XNEA 3EQFA 4BBMA 3POOA 4EJNA 2B9IA 4XHKB 5T6KA 5M4FA 3EKNA 1XMMA 1G8SA 3BHTA 1M14A 3HZTA 3OBGA 3MFUA 3R02A 4F64A 5L6PA 4FEUA 3F2NA 4A4XA 5HD4A 1Q8YA 4AW2A 3TACA 2B53A 3MDYA 2VTSA 2OFVA 3Q5IA 4FIJA 4HYSA 4Y85A 5CLPA 4BCHA 3TUDA 5HVJA 4WG4A 4RJ8A 5KO1A 4XRLA 3RM7A 4JX7A 4F1TA 4GT3A 1OIYA 2YCSA 4KD1A 3R7YA 5BYLA 1XBCA 3IW5A 1VEBA 5DH3A 5IA4A 4K6ZA 4CYIA 4DF3A 3QTSA 3EFKA 5JQ5A 3ATSA 3E8DA 3NCZA 3R22A 5FEQA 2DYLA 5AEPA 2XVDA 3MWUA 4AW1A 5BNJA 2PU8A 3TN8A 3PIZA 4F9YA 3KQ7A 2E9VA 4IFGA 2ZOQA 3QX4A 4BJJA 2YIWA 3WIGA 1OGUA 1V0PA 4QDEA 5IQDA 1NVRA 2XK7A 1FGIA 3O8TA 3OWLA 2R3NA 4NFNA 4HNFA 3ZZWA 3WZEA 4PMTA 3OT3A 2B9HA 1YI3A 2YHVA 3OFMA 2EXEA 3DKFA 3LCOA 5GJGA 4O4DA 2RFDA 2WMWA 4KBAA 4Y5QA 4Q9SA 3C0HA 4ZJJA 3DKCA 2XK4A 1XBAA 1UU7A 4QNYA 1IAHA 4BKYA 3F2RA 4YGAA 4FSQA 4BIDA 5B2LA 4V01A 5EOLA 3UDZA 5HU9A 3MJ2A 4TL0A 4KIQA 5BVWA 4C2VA 1PKDA 2PE0A 2J0IA 3HDMA 4U43A 4JDKA 5D12A 2EWAA 5C27A 4CZYB 1TVOA 3JY0A 3RAKA 5CEQA 4B0GA 3FZTA 3NNUA 4D2WA 3TM0A 4IDVA 1YXXA 3BV2A 4B99A 4TKSA 1KSWA 3PDTA 4ZSEA 1QMZA 4FG7A 3DKOA 4U40A 4G16A 4TYHA 3Q04A 3R9NA 2R5TA 3SLSA 3TNIA 4RQVA 2X9FA 3D5VA 4IZAA 4RVKA 4PNKA 5J7HA 5JH6A 3U8WA 3CJFA 2F49A 5KMOA 4D4VA 3TZ8A 1O6YA 3W33A 3C0IA 5CXZA 3MGYA 3C4EA 3E8CA 3QCYA 2ERZE 2WQEA 1GZ8A 4I1ZA 4RZVA 4CZTA 2GDOA 4DFZE 4Y83A 5CSPA 5LQFA 4BDKA 5TKDA 3P5JC 5E91A 5EHOA 4I0SA 4EH9A 2UW7A 4DH7A 3DGKA 1FGKA 4IX6A 4DCEA 4ACHA 2ZMDA 4S33A 4EHEA 3N4UA 4ZMFA 4CTCA 2IZTA 2BRBA 2WMXA 2RG6A 3R7OA 4KB8A 4IMYA 3PUFC 1LUFA 4ZS0A 1QPDA 3FLZA 3PXFA 4O0WA 3BI6A 2BMCA 3L1SA 5DR6A 2PZPA 4FKVA 1Q61A 2B55A 5LVOA 5LCKA 2XEYA 3ZEWA 4AXCA 5B2KA 4FNZA 5EI6A 2ITNA 1FMOE 4WSQA 4QP2A 4N4SA 5H8GA 4AS0A 3TNQB 3ZRMA 3PYYA 1U5RA 4M0YA 3D94A 3ZONA 4AP7A 5I9YA 5AR3A 2X0PA 4O0TA 3VUTA 3NYXA 1M7QA 2YIXA 4QPSA 3ODZX 4NSTA 3HV6A 4IIRA 5M06A 1H26A 1P4FA 4FZFB 2DQ7X 2HZNA 3IKAA 3DFAA 3FLYA 3TXOA 4BDGA 2XRWA 4RIYA 4I41A 2JDSA 1SMHA 2QCSA 3CBLA 3F5PA 2BKKA 3ZBXA 2XAOA 5C8MA 3VS1A 2G2IA 3GCPA 5KE0A 4PL4A 4FICA 5CZHA 2IW8A 4A4LA 5DN3A 1UNLA 4GH2A 4HCVA 4O2PA 2BAJA 4CCUA 4CNHA 4YJNA 4IACA 2J50A 5JFXA 5KBRA 2GS2A 1H8FA 3WZUA 4A9UA 3QA0A 3HGKA 3JUHA 2YIQA 2R3MA 1K2PA 2VX0A 5E4HA 3ZSHA 3IO7A 4ERWA 4PRJA 4OBOA 4QYYA 5AAEA 4O7LA 3FMEA 4K2RA 3IGOA 4FIEA 2W1GA 2VTIA 3VW6A 3SG8A 3FDNA 1GZKA 2WNTA 5AUTA 1SNXA 2VTRA 2BCJA 3LLAA 4NEUA 1ZYLA 1Q4LA 4ZY6A 1NT2A 3ORXA 1URWA 4RX8A 3IDCA 2CHLA 2G9XA 4IAZA 3SXFA 2QOHA 5DFPA 4WNPA 4WBOA 5DMZA 5DBXA 5HTBA 1STCE 3BHUA 3FE3A 3ZYAA 4D0XA 2H8HA 4EJ7A 2CGUA 2WMUA 3NUSA 1W0XC 4O4EA 4AUAA 4BCNA 2WTCA 4GFOA 1SVEA 4NL0A 4FSRA 3G51A 3R9OA 3H9OA 2GNJA 1J7UA 3QTUA 2XNBA 2ITZA 4LGHA 4C4FA 4EQCA 2GS6A 2VRXA 3KF7A 3RM6A 3PXRA 4FTKA 3ELJA 1A48A 4NM3A 3EYGA 3HL7A 2UW6A 3DK6A 4MQ1A 4PMMA 2RFEA 2EXMA 3OF0A 4QQCA 4TYEA 2HELA 3COHA 2VO6A 1M7NA 4K0YA 4PP9A 3W0NA 2BTRA 2YLEA 4QOXA 4FR4A 4WRGA 4YZCA 5F4NA 1ST0A 3D14A 3HRBA 2VU3A 3WIKA 2CCHA 5AUZA 4MAOA 4AZWA 3DNEA 5KMMA 4PPBA 2AYPA 3UOHA 4I92A 4KKHA 5LOHA 2RGPA 5EW9A 3UDBA 2O65A 3LFAA 4JT3A 3OCTA 2XIKA 1CKIA 1S9JA 5FGKA 3TUBA 3DA6A 4R7HA 2QOBA 5C9CA 3HA6A 3A4OX 5AIRA 5D10A 4PTCA 4YC3A 3LJ1A 4CQEA 3V51A 3VBWA 1WAKA 4EH6A 4CFVA 4L42A 3P0MA 1CKPA 4QMYA 3LMIA 5GIOE 4D5HA 4ZLOA 5E92A 4XP3A 4AOJA 2VTNA 5IH6A 2HY0A 3VIDA 3KXZA 3LQ5A 4EOPA 3GC9A 4ZTLA 5FDPA 3PSCA 4G3GA 3C0GA 2F9GA 3U6IA 3LFSA 2YAAA 3V5QA 3VS3A 4ANNA 2C4GA 4Z55A 2YJSA 1BL6A 4C4EA 5HU3A 5IEXA 5IDPA 1ZARA 3FZRA 4FTTA 3ACKA 4K18A 1ZAOA 1DI8A 1W83A 5M55A 3S3IA 3U9NA 1R0PA 4WIHA 2WPAA 4AN2A 3MA3A 4X2FA 4MXCA 3UJGA 4LRKA 4K11A 4E8AA 2XJ2A 2R3KA 3PP1A 4QYGA 3E3BX 5JZJA 3VN9A 5EKOA 4QMVA 1VLRA 5CF5A 4C02A 3PIYA 4NU1A 4W4YA 4ACDA 3Q9WA 3NVMB 3AD6A 3QKLA 3OP5A 3PVGA 4X0MA 5C1QB 2XJ1A 4USEA 2HCKA 3LM5A 4FV0A 4R78A 1ZWSA 3PJ8A 3UIXA 5HIEA 2DWBA 2AC3A 4C4GA 3QTIA 2JIIA 2QD9A 3NFGB 2XYNA 3KFAA 3LJ0A 3PJCA 4L7SA 4P4CA 1SYKA 5I9ZA 4LRMA 3CLYA 3QUDA 4L7FA 3MSSA 4RWKA 2WMQA 4JAJA 4JOAA 3NYVA 5HLNA 1OVEA 2VWYA 2YAKA 3GT8A 4FSTA 3IG7A 2J5EA 2UZLA 2IW9A 5I4NA 2J0MB 2WTDA 4EZ3A 3RHKA 3OROA 4BKZA 4FZAB 1DS5A 1YVJA 1BL7A 2X2LA 3E7OA 4OBPA 3AD5A 4ZSAA 5K4JA 1J7LA 2C3LA 2JKKA 4IB5A 3VVHA 4RX9A 3KRXA 4BDEA 2YM4A 4O27B 1Y6BA 4FV2A 1JBPE 4WG5A 4F6WA 2PVRA 3TV4A 1BI7A 1H1SA 2BFXA 4ZSGA 4BTFA 4EHZA 3QFVA 4AGWA 5JZNA 2WQNA 2IVSA 3G0FA 2BR1A 4YZMA 4N6YA 4DEGA 4R3PA 2PPQA 2A27A 3DY7A 2E2BA 2V7AA 3PPZA 4L3JA 2XALA 2JAMA 3GENA 3QRTA 3Q4ZA 5LCJA 5FXSA 2FGIA 2JITA 1JAMA 5CY3A 3VBTA 5ITAA 4FC0A 3SGCA 2CKEA 2V0DA 4I4EA 3WILA 2YA9A 3DTCA 3R30A 4C34A 5L2WA 3MW1A 5IQAA 2CNVA 3HUCA 4DFBA 3Q60A 4BCPA 4AA4A 5TF9A 3WOWA 3CY2A 4ZZMA 3QUPA 3COIA 4BYJA 3WE4A 1SZMA 4W8DA 4YBJA 2W9FB 4U0IA 3W8LA 5AR5A 2GS7A 4I0TA 5DE2A 2C0IA 3FQSA 4QP7A 1U54A 3ZU7A 4Z7GA 4O7NA 5HE0A 4AE6A 5L4QA 4LDTA 2J9MA 4L3PA 3ACJA 1CDKA 4GW8A 5C01A 5HIBA 2XH5A 4WNMA 3PRFA 3FV8A 5EI2A 4ANOA 2VTQA 3FQEA 3FZPA 5AUVA 2E9PA 2WMBA 1YDTE 3K54A 4O0RA 4XBRA 4MNEA 4DLJA 4M13A 4QMQA 4IQ6A 3FY2A 4CG9A 5LVMA 4EOSA 3NIEA 4YLKA 3B2TA 1J3HA 2C68A 3MJ1A 3O23A 3F5GA 5AUWA 2R3GA 3SV0A 4C35A 1OBGA 1H25A 1SM2A 1ST4A 2CLXA 4EYMA 4NCTA 4E26A 2OZAA 1Z57A 2CNQA 4RIOA 3R2BA 4NTTA 2W7XA 1XH7A 2BFYA 4IVBA 4WO5A 4UXLA 2XIRA 2ZM3A 4PL5A 5FQDC 5CEIA 3EOCA 3PJ2A 5AM6A 2YM7A 5DI1A 3R1SA 3CKXA 3BGZA 4EEVA 3UBDA 3ZUUA 3Q53A 3W0PA 4BCKA 2J7TA 2BZKB 4ZSJA 2BAQA 1OITA 4GK3A 2C6IA 3TV7A 2QHMA 1U5QA 2B7AA 4C58A 2VGOA 1UU3A 3C50A 4FKQA 4ITHA 3ALOA 4R3RA 2GPHA 4WNOA 1YI6A 4AZEA 3SD0A 4MUQA 3PA4A 3F7ZA 3OTUA 5GZ9A 4CLJA 3NW6A 4O6LA 2OXYA 4FVPA 4YU2A 3C5UA 5IEYA 2WAJA 3FHRA 4BTKA 5JK3A 5IU2A 2JKOA 2Z2WA 3I1AA 3H3CA 5I3OA 2QKWB 2GNFA 4LGDA 3UE4A 5EQYA 5TO8A 4HZSA 1CTPE 2QC6A 2VGPA 3LCTA 3OOMA 3CKWA 3Q52A 4DBXA 3E88A 2IWIA 4EH7A 4RIWB 2X39A 5BVOA 5ETCA 2P2HA 3U54A 3S00A 4XV1A 4FTLA 4LUEA 1WBWA 5JGDA 5AAGA 4MH7A 5LMBA 2A1AB 2IN6A 3EQCA 2OJFE 2PVLA 3NRMA 3WYYA 3BRBA 4E6AA 5B2MA 2YIYA 2I40A 3P7CA 4GG7A 4IFCA 4PNIA 4QMZA 3S95A 4BDCA 2CKPA 4EH3A 1JKSA 2BPMA 3BL9A 3RNYA 2W5BA 2X4ZA 3LCSA 4F70A 4OTFA 3EN4A 4D1ZA 4GCJA 4PQNA 4CSVA 2QU6A 2VTPA 2R3QA 3ANRA 3N51A 3NLBA 4YUQA 1PMEA 4F1MA 2YM6A 3BWFA 4C8BA 3E3PA 4MF0A 2QU5A 3IDBA 3NZ0A 4G17A 4TYIA 3FPMA 2ACXA 5I9WA 4Q2AA 1XR1A 2VTLA 3FLQA 4NKSA 2QI8A 5HGIA 4BCGA 3WF7A 4P90A 2I0YA 2UW9A 2B4SB 5AMNA 4XX9A 5K3YA