2ETRA

Crystal structure of rock i bound to y-27632
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
400
structure length
400
Chain Sequence
SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rho-associated protein kinase 1
publication title The Structure of Dimeric ROCK I Reveals the Mechanism for Ligand Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 400
sequence length 400
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2etrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2etrA01
2A19B 4OTIA 3O8PA 2HAKA 4IWQA 2UZOA 4X2NA 3AMBA 4LV8A 4Z55A 1KE5A 5DR2A 2REIA 2HW6A 4FSWA 3RINA 3VO3A 4IC7A 3PXRA 4JBVA 2W7XA 1VYWA 2BFXA 5H8EA 3P86A 2JC6A 5IMEA 3EQGA 1UKIA 4U3YA 3W1FA 4Z7GA 2VWBA 4O7LA 2QR7A 3TZ8A 5JKGA 4U43A 5CX9A 3NMUF 4FV2A 4Q9SA 5H9BA 1OL1A 4EUTA 2WKMA 4B0GA 5EHLA 4JBQA 1SMHA 1PMNA 3R28A 5IQHA 3QRJA 3HV4A 1M7QA 5HBEA 3PFQA 3R7OA 4BL1A 4CFXA 3ZOSA 3TJCA 4UX9A 2Z7RA 2OZAA 1GOLA 3B2TA 3QKKA 5M09A 5HG9A 3SD0A 4II5A 4XLIA 5CAOA 5IF1A 3PSCA 4F6WA 1TQPA 4H1MA 2BTSA 2F57A 3FI4A 1RJBA 3G51A 3VBQA 5EQYA 4RX7A 5TO8A 3R8UA 2WFYA 4O38A 3NIEA 4FIGA 5JRSA 4F9AA 4ZLOA 3KY2A 4O2ZA 4I41A 4NIFA 3PXFA 5AV4A 2R3IA 3VS7A 2CPKE 4XV9A 4K2RA 2XUUA 2C5YA 3NNXA 3VJNA 3BHTA 1Y57A 3OW4A 5AADA 4ZS0A 3EL7A 3CD3A 5CWZA 3THBA 2WU7A 3HUCA 5HO7A 1WCCA 4KIPA 3CGOA 3T3VA 3NW6A 4U45A 4CMTA 2YWPA 2W96B 3ORMA 2DUVA 5DG5A 3V01A 4PTEA 5KMIA 4ZZNA 1PXLA 4NK9A 3EYGA 4H36A 3ORZA 4I20A 5AR4A 2BHHA 1QL6A 1ZY5A 2WMWA 3BV3A 3CY3A 2UZLA 3QWJA 4IMYA 3BGPA 5CI6A 3UE4A 3VRYA 2RG5A 4EYMA 5BX0A 1QCFA 3DPKA 2BVAA 4JT3A 3V5JA 4GIIA 3FKLA 3OG7A 3SC1A 2IJMA 2ZM3A 2X2MA 3VQUA 3MWUA 4FKIA 4BDEA 3VS6A 4EHZA 1PW2A 4GFMA 4CGAA 2O64A 5IQBA 3ALOA 5HG5A 4AG8A 2HK5A 3LMIA 4KSPA 4NJ3A 3KB7A 5JH6A 3WF5A 4TNBA 3W16A 5A4TA 5I4NA 3TUBA 4O0TA 4RIYB 4EOOA 1OBGA 5C27A 3S95A 3W32A 1KE6A 3NUSA 3PPZA 1FBNA 2JDOA 5ANIA 4DTKA 5L2WA 3OEZA 3GBZA 3FMKA 3F5GA 2PE0A 3SG9A 1AQ1A 2QO7A 4R3RA 2P2HA 4UMTA 4OBQA 5EM8A 3BWFA 3Q4CA 1IEPA 2WTJA 5JSMA 2BFYA 2JAMA 3G6HA 3RHXA 3RPOA 2HIWA 3PG1A 3EQPA 1F0QA 5TE0A 1Y91A 5FEQA 2R3OA 3BYOA 2F9GA 3OP5A 1WZYA 1UA2A 1DAYA 3ANQA 1BKXA 5JEBA 3ZTXA 4J71A 2VTIA 4WA9A 4OW8A 4RQKA 4O27B 4RJ5A 1VR2A 5KBQA 2OBJA 1YI3A 2JIVA 4I0RA 3LHJA 1OPLA 4U6RA 3CQUA 3Q5IA 5KMKA 4YTCA 2HW7A 3Q9YA 2R0IA 4I4EA 4M8TA 4BCMA 4EOJA 5A9UA 1LP4A 3WF9A 4L46A 3JY9A 3RJCA 4F0GA 4PTCA 2X7FA 2XNNA 2BROA 5DH3A 3R02A 4N4SA 1SVGA 3ID6C 3I79A 4GEOA 5EH0A 2EXCX 4FNYA 4M66A 4L8MA 4KIKB 4F1MA 3PRFA 1R3CA 3D7TA 4USEA 2FB8A 4R7IA 2XEYA 4O7NA 5IA5A 4KRCA 1R1WA 5CXZA 1W7HA 4S32A 1OL6A 4Z9LA 3TIZA 3W2PA 3GOKA 4GKHA 3KN5A 4FVPA 5M57A 2IZUA 2PZRA 2YDJA 3PY1A 4ACHA 3PP1A 4NH1A 3UBDA 3PIXA 4ZTMA 3ZBXA 3QYZA 3QKLA 3UNZA 2WQMA 3DBCA 4U97A 2DYLA 5E9EA 5DT3A 2FSMX 2IW8A 5KZ0A 5CSHA 4WRSA 2FO0A 4OT6A 1CKJA 2FA2A 3DLZA 3PVWA 1NY3A 1YHSA 3FAAA 3DB6A 3OBJA 4EKKA 4NKAA 4FF8A 4DG0E 1H1QA 2BKKA 5CYIA 3NRMA 5DYJA 2BTRA 2WGJA 2I0EA 1JAMA 4M69A 3WE8A 5J5TA 5LVNA 1JWHA 2QURA 3FSFA 4ANNA 2XIXA 3PE1A 1WBPA 2ERKA 4QT1A 3M1SA 4LOQA 4CG9A 2QLUA 4QYHA 2VWWA 2FUMA 4FZDB 4L9IA 4RIOA 2OGVA 1PHKA 4X3FA 3UMWA 3K3JA 3GCQA 4IWOA 3FZTA 2JLDA 1PKGA 3FI3A 4F9WA 2W0JA 2VWYA 3NLBA 4ZLYA 5EQPA 3V5TA 4FI1A 2VAGA 2XRUA 5DR6A 2C5XA 3ZSHA 2B52A 3KRLA 4QQ5A 4QTDA 5M53A 2YCFA 3ANRA 3COKA 5GJDA 2IVVA 4FVQA 4AF3A 4D2SA 2GNJA 4EH8A 1WMKA 4JR3A 2ZOQA 3L9LA 3RGFA 3LXLA 2QU6A 3Q3BA 3QL8A 4JXFA 3PE2A 1H28A 2FVDA 1XJDA 4OGRA 5HVJA 4FG7A 1PXPA 1CM8A 4EH6A 1W8CA 5IA0A 3AGMA 4MF1A 5EG3A 4ZTHA 1OIUA 2Q0BA 3QX2A 3GQIA 3OD6X 4DG2E 4GKIA 3HAVA 4APCA 3OW3A 5D10A 2OFVA 2OKRA 2QKWB 4IAZA 3KMMA 3HRBA 3I4BA 3Q4TA 3SW7A 4CFUA 2H96A 5M4IA 3EFJA 3LMGA 3CQEA 4FTCA 4FV5A 2C6KA 3NWWA 3V04A 5JK3A 4Q5HA 2OU7A 2YM5A 3A60A 4GG7A 2ZV7A 4P4CA 4TNDA 3ATSA 3HP5A 3IOPA 3QD4A 4GW8A 1XQZA 3PJ2A 3PZHA 4APPA 4ANBA 4W9XA 4RWIA 2XK8A 3FEGA 1E1XA 3BHVA 4EK4A 4I5CA 5EQEA 4FEXA 3OY1A 5BYZA 3MH0A 3ROYA 4M97A 2C6DA 3VW8A 4BZOA 2HWPA 4F70A 1WBVA 2XNBA 2BRMA 1U54A 4CQEA 2C6OA 3HECA 3FBVA 4IDTA 3Q53A 2WTDA 3C4WA 4RVMA 3MFTA 4X0MA 4BCPA 3KF4A 3WF6A 3M2WA 3NW5A 2BAQA 3ENHA 4IVDA 3QZHA 3BIZA 3QGWA 2OG8A 3G2FA 4X7QA 5J1VA 3MFUA 4IZ5A 3ORXA 3HMOA 3GU8A 5FTOA 5BMSA 1H01A 2WTIA 3VAPA 5HNGA 3DTWA 4D4SA 1J7IA 3BPRA 4M0YA 4USDA 4B8LA 4FMQA 2OZOA 4NZWB 1WBNA 1H1SA 5C26A 4D5HA 4CCUA 4DG3E 1KSWA 5K4IA 3EQFA 4IX5A 5EYKA 2R2PA 4XX9A 3CTHA 4EEVA 5AP4A 2R4BA 2WB8A 1XWSA 5A4EA 5D12A 4YTIA 4DF3A 2VTPA 2R3RA 3MTFA 4YURA 3TNWA 2YJSA 5B0XA 3VHKA 3B8RA 3GC0A 3ZO3A 3AC4A 4C4EA 1O6LA 5EYMA 4E4NA 5HLNA 1H1RA 4G6OA 4HVGA 3A7HA 2QOFA 2UZBA 2XK4A 3EZRA 4QQJA 1IASA 5AP2A 1WVXA 5IQGA 4MYGA 1XH6A 4R5SA 3A7JA 3U4UA 4R8QA 4V04A 1WBWA 4CYJA 5JN2A 5CXHA 2GHLA 2VWIA 5EHYA 3HV6A 2XMYA 4O0VA 3N4UA 1YXXA 3IONA 3UG2A 4RA5A 4FGBA 4OR5A 2FH9A 3D83A 3ZLWA 1LUFA 2QLQA 2Y8OA 3GEQA 3OWPA 1JSVA 5DRDA 3T9IA 4C4HA 2YZAA 4TYJA 4W8EA 2PE1A 4O21A 3RCDA 3TNQB 3C9WA 3IO7A 4EI4A 4A07A 2WAJA 3DTCA 4MTAA 1GNGA 5BMMA 3VC4A 4MEDA 2WQEA 1V0PA 4RC2A 4CNHA 3U55A 3R71A 3BZ3A 3QD2B 3S0OA 3ZO4A 1BLXA 2JD5A 3QUDA 5IH4A 2XJ1A 2V7OA 3SVVA 4ERWA 2JAVA 3ZH8A 2FSOX 1MRUA 5FM3A 2PVJA 4ZXTA 4C33A 1V0BA 1Y8YA 3HMIA 3NUUA 2GFSA 4XBUA 4ORKA 3R8ZA 3F3ZA 2OK1A 2PVLA 1URCA 2WTCA 2YN8A 4FVRA 2IZRA 5LMAA 4RX5A 1QPCA 4FK6A 3KULA 2WTKC 4YJQA 4AZEA 5JQ8A 2Z02A 2R64A 3FZOA 4F6SA 2FGIA 2PK9A 5KBRA 3PA5A 3VS0A 3PXKA 4WO5A 2ITZA 1Z9XA 4NM5A 5J79A 4MD8E 3QCYA 4RJ6A 3Q9WA 4S2ZA 1PXJA 3V6SA 5AR3A 3AC8A 1H1WA 1OPKA 3MSSA 5EDQA 1ZYCA 2C30A 1YWVA 3D5VA 3C4CA 4GK4A 2UW9A 4WNOA 4AWIA 2JKMA 5HLWA 4EOKA 5HNBA 4K18A 1K9AA 2XK9A 4NFMA 4RRVA 2Q0NA 1CTPE 5BQ0A 4J96A 5E7RA 4KIQA 1ZARA 4HCUA 4W4YA 5FD2A 4QMVA 3CKWA 5CF8A 4MXCA 4RQVA 4N70A 4V0GB 4X2KA 4D28A 4UMRA 4LMUA 4FT3A 4LRMA 4EWQA 4MX9A 5DOSA 2HELA 3Q2MA 3UZPA 2HENA 2X8EA 2CKQA 4RFMA 3LFNA 3P79A 1JLUE 4DLIA 4KWPA 3N4TA 2Z8CA 4M67A 5J1WA 4C36A 2QNJA 1ZYLA 3PTGA 3FPQA 4C4GA 4NUSA 1H27A 3KRRA 5BVDA 3PWDA 5FTQA 1TQMA 1WVYA 4W4XA 3DQWA 2AUHA 2O2UA 3A7FA 4FTQA 4I1ZA 2VX1A 3QTRA 4MNFA 1OITA 3SOCA 3ITZA 3QX4A 4FSZA 5IKWA 3C0GA 1KOAA 4BF2A 3A61A 4D4RA 4V01A 1BMKA 4DEBA 2ITQA 2Y4PA 1P2AA 3EQCA 4HCVA 1RW8A 5L8JA 4F0FA 3LQ8A 3QGYA 4FTMA 3DKCA 3UQCA 3K54A 4DEDA 2C3KA 5AM7A 4YO6A 4C57A 3K5VA 5HE2A 3W18A 5CENA 3R7EA 3QCQA 5DT0A 4CYIA 3REPA 4GL9A 4YO4A 3C0IA 2VZ6A 4OLIA 3S00A 3UOJA 4D9UA 4HNFA 3NYXA 2H34A 4Y46A 5CTPA 2G15A 4NM7A 4OTRA 5CY3A 5HICA 5CAPA 3VUMA 5F9EA 4OAUC 3W55A 2UZUE 5E92A 2ERZE 4MCVA 3BHUA 3AT2A 3F66A 4QMQA 4BBFA 2BDJA 2WHBA 3QHWA 4BZDA 4M7IA 3WIGA 3W8QA 4CKIA 4MHAA 2UW7A 3QFVA 3KXMA 4I3ZA 5HKMA 5GHVA 4CZYB 1OL2A 2CLQA 1UNHA 2EXMA 2VD5A 3KGAA 3BU3A 3ZO1A 5DI1A 1LEWA 4YJUA 2PUNA 4GG5A 4WBBB 4HYIA 4AE9A 4A06A 3GCUA 1CKPA 4IAIA 3JY0A 3TV4A 3ZLXA 4CKJA 3WZDA 4QNYA 2XM8A 4KS7A 4GFGA 2V55A 2CN8A 4GUBA 1IR3A 1PMEA 2C47A 3HLLA 5H3QA 3TUCA 3FI8A 3O7LD 2GNIA 3R01A 4RIWA 4BBEA 3ULIA 4DBXA 5AUWA 3FL4A 2CKEA 3QA0A 3RMFA 2RG6A 2UW6A 4PPBA 4XJ0A 2I0VA 5EYDA 3RAKA 1OIQA 4YUQA 3KRWA 4QTCA 2ACXA 5D11A 2JEDA 3WF7A 2R3NA 5HTBA 3SLSA 4FEWA 3ATTA 3TACA 2ZMCA 3U9NA 3HDNA 3LJ0A 5A4QA 1FVRA 3MS9A 4CV8A 3HA8A 5C03A 3PXZA 5BVNA 5HE1A 4F9CA 3WARA 3G0FA 3WYYA 4H58A 4P5ZA 5LVPA 2BZIB 4QP9A 4ASDA 1GZ8A 4I5MA 3OF0A 3QYWA 5DPVA 2HYYA 3BELA 3QD3A 4YLKA 3TNIA 3GVUA 4AGCA 4G5PA 2FSTX 3BYVA 3DY7A 3W10A 4C0TA 3UVPA 4C59A 4F9YA 1MRVA 1P14A 3TL8A 4X6QC 4YBKA 5L8LA 2J0IA 1AGWA 2VO7A 3TG1A 2BIKB 2CJMA 4PMMA 5C9CA 3TIYA 3UOKA 3VW6A 1OBDA 2FYSA 5HCXA 5A46A 3UVQA 4MK0A 4K11A 2JGZA 3O8UA 4WG4A 3FY2A 4C34A 4USFA 4TWOA 2OIDA 3H0ZA 4UMQA 4D2PA 5KKRB 2X39A 3U54A 3QQGA 3F7WA 3KRJA 1U4DA 3AMAA 2BRGA 1UVRA 1YHWA 3UOLA 4HPUE 2E9PA 3PVBA 5M06A 1I44A 2G2IA 5LWNA 3QRTA 4GK3A 1XH8A 1UU9A 2Y4IC 5FEDA 5KMLA 4DGOA 1I09A 2QHMA 3W2CA 5A54A 3PJ1A 2O63A 1OVEA 4BKJA 2UW3A 5CSPA 2R0UA 2YCSA 4QQCA 2ETMA 3PVUA 2IW9A 3IDBA 4D2VA 1YQJA 4BDGA 3BLRA 3E3BX 3GXLA 4FODA 3QTSA 3GCPA 4G9CA 5AV1A 4QYFA 4D0WA 3R7VA 3RBWA 1GZNA 1SVEA 3EB0A 5FWKK 5LARA 5C8NA 1M7NA 1URWA 5HORA 2WMVA 3SHEA 3UJGA 4IE9A 4FX3A 3U51A 2R7BA 3EN9A 1MRYA 5DA3A 4MAOA 4DEGA 4G3DA 3ACKA 3JUHA 4GS6A 2Z7LA 4TY1A 3QRUA 2YA9A 4FV3A 4G5JA 3VBWA 4B4LA 4FEQA 4RFYA 5C1QB 1J7LA 4AN3A 3EFWA 4D0XA 1H0VA 4L68A 3VVHA 1UWHA 4R6VA 2BR1A 3ORLA 3PG3A 5T6KA 2WTWA 4E73A 2X9FA 2GPHA 2BDWA 3HAMA 1MUOA 5B2MA 5LWMA 4XH6A 2OXYA 4FA2A 5L6PA 4XP2A 1ZZ2A 2B54A 1L8TA 5C01A 2B7AA 3C4EA 3KXZA 4S31A 2XBAA 3EKNA 2C1BA 4OTQA 3NZ0A 4G3FA 3UIUA 4DBNA 1MP8A 4J7BA 2B9JA 4LUDA 4RWJA 2XKFA 4EH9A 1FINA 3MYGA 5HBJA 4EKLA 4FV0A 2YM6A 3NPCA 3R21A 2CDZA 5HGIA 2WMUA 1IG1A 4U44A 3FC2A 4CTCA 3QA8A 4F1OA 2OO8X 4ZIMA 4IM0A 3LQ5A 4QTBA 5HX8A 4KD1A 4G6LA 1B6CB 2X2LA 4RIXB 1OIYA 1ERKA 3Q60A 1Q97A 3FI2A 3I7CA 1JQHA 3IPHA 4FYOA 2H9VA 4YTHA 3HMPA 4FIFA 4RVKA 4O2PA 2JDSA 2JDRA 1JKTA 3FMMA 4FTRA 4LUEA 3WZUA 4UV0A 3G9LX 3WE4A 5EW9A 2V62A 4GUEA 4KB8A 2ITUA 2WIHA 3AGLA 1ZOEA 3QWKA 4RZVA 3R8LA 3KCFA 4E1ZA 4U8ZA 4JS8A 4XG6A 2ZB1A 2JFMA 3BYSA 4XBRA 4ZSGA 4PX6A 3OWKA 4CZTA 4MNEB 3U6IA 4FTTA 3HUBA 3QTWA 5CZHA 2OWBA 3FC1X 3KKVA 3Q96A 3HRCA 4CFMA 1IA9A 3R04A 4KBCA 5DGZA 5E8TA 5I0BA 2QR8A 3ZLYA 3PJCA 3RPSA 3DZOA 4PMPA 2F2CB 4GT3A 2PWLA 2BHEA 2C68A 2UZDA 4L45A 4D1XA 2VO3A 1K2PA 3QZFA 2ITVA 2Z60A 4PNIA 2YLFA 5J5SA 4YZBA 4E20A 2LGCA 2BDFA 4QP6A 4ZK5A 4G9RA 5CASA 3BI6A 3EQHA 3TWJA 5CSWA 3DAEA 4Y95A 1RQQA 4DC2A 3GI3A 1QPDA 5LQFA 4MBIA 4QMYA 1WVWA 4IACA 3U4WA 2HY0A 4ZSEA 3HNGA 4EK6A 2ZM1A 5ACBC 1KE9A 4FT9A 5L8KA 2YM8A 4I0TA 3CP9A 3LCTA 4GFOA 2AC3A 4RFZA 4IADA 2JITA 3IOKA 4WKQA 2W4JA 3QBNA 4AOIA 3LLAA 5IPJA 4J1RA 4QMTA 4ZTLA 5GZ8A 4AFJA 3FY0A 4S34A 3MVLA 5KUPA 3C5IA 3EOCA 1GIIA 4FUYA 2G01A 3O0GA 4BIDA 4DFXE 4EH4A 3FMNA 3OCSA 2GDOA 5HCYA 1B38A 5HO6A 3RAWA 3SXSA 3ZUUA 4EC8A 2RSVA 3HDMA 3ZXTA 2PL0A 3I5NA 2ZV9A 5D9HA 3TZMA 3VQHA 4BCOA 2XNPA 3OY3A 1ZAOA 4E93A 4UWBA 4E6QA 4IJ9A 2C6IA 4M15A 2LAVA 5K0XA 1WBOA 1XO2B 3COHA 3O23A 5J7HA 3LFBA 2VTMA 4LGGA 3ZHPC 3IDCA 3RK7A 3ZC5A 2GU8A 3TCPA 4JDKA 4AXAA 4OTHA 4LOOA 3NNWA 2XYUA 5TF9A 3HV3A 1STCE 4D55A 5IH5A 5HQ0A 1W98A 2WIPA 3RKBA 2R3FA 4DN5A 4FT5A 4G3EA 4U5JA 1P5EA 3R9NA 1H00A 2J0KA 4O1OA 4BWXA 3RALA 3VUDA 5LVMA 3LFDA 4GIHA 2PE2A 4FZAB 1U5QA 5HTIA 5HU9A 4IX4A 1DI9A 4WIHA 4CFNA 3LQ3A 4NL0A 3C5UA 4NWMA 4O0SA 5AP5A 1PXKA 5IEYA 3VBYA 3FLWA 4DCAA 3RZBA 4C3PA 5AEPA 3EN5A 5FG8A 3IK3A 1YVJA 2PVNA 3JPVA 3LE6A 5AX9A 3UO4A 4FKOA 5FM2A 4FV6A 2XNEA 4ALWA 4R77A 1OI9A 4YGAA 5FDPA 1KE8A 3OT3A 4YU2A 4FNXA 4W4VA 5GZ9A 3SQQA 3IECA 2Z2WA 2Z7QA 4YR8A 2UVXA 2J5FA 1H25A 2ITTA 5B2LA 1NVRA 2X7OA 3CGFA 1R0PA 3KEXA 5AA8A 2DQ7X 3UO6A 4I21A 2PZPA 3EQRA 3ZUVA 2B0QA 4TT7A 4RWLA 4QRCA 4CFWA 4LG4A 4CT1A 4Y5QA 4EOMA 4D2WA 4F09A 4KABA 3UP2A 3GC8A 3FWQA 3NIZA 4CSVA 4NT4A 4G3CA 2XJ0A 5E8UA 3E87A 4WG3A 3BKBA 3VUTA 2QKRA 2B55A 1TQIA 3IQ7A 2XIKA 3F6XA 4DT8A 2ONLC 1GIHA 3DJ7A 3UOHA 2JDVA 3F5XA 3QCXA 3QTQA 3NEWA 3F3UA 3TXOA 4DH3A 2XZSA 1JOWB 4XUFA 3U87A 2A2AA 2QONA 4UYAA 5K5NA 4O7YA 2XIZA 4L52A 4TYHB 4PDYA 2PTKA 3UPZA 1FMKA 2WOUA 4CLJA 1XH5A 4P5QA 3SW4A 2ZV2A 3S2PA 5J7BA 2IVTA 4XYFA 4GK2A 3U6HA 3V6RA 4PNKA 5JFVA 1GZOA 3PP0A 4I6BA 1Q62A 3UZRA 3E5AA 5HIEA 4L67A 2WMXA 4BN1A 3O7LB 4GJ3A 4E4MA 3PXYA 4XRJA 5ANEA 5KCVA 4LOPA 3FLQA 3WBLA 3QC9A 4GSBA 3TV6A 3PY0A 4XG3A 1J1CA 2OJGA 3AC3A 3AXWA 3U9CA 3VS1A 4EOIA 3FYKX 4XG9A 4K0YA 5E8XA 4PV0A 5M44A 1ZWSA 4H1JA 4YNEA 1OKYA 2PVMA 2GHGA 1Q41A 3H9OA 3UTOA 4EZ5A 2ONLA 1NA7A 1UV5A 5DEYA 3R9DA 2UZVA 4FUXA 3P1AA 1Q8ZA 4YJNA 4FSMA 1H26A 1CSNA 1XBBA 4R1YA 2VRXA 4U0IA 3F82A 4B6LA 4QMPA 1U46A 3DXPA 3DNDA 3LM0A 4I0SA 2A27A 3CR0A 4F99A 3BBTB 4YJSA 5AM6A 4BCJA 5IU2A 5JGDA 3CD8A 4R7BA 4JOAA 3TNPC 2UW0A 3AMYA 2BIYA 4FL1A 3RK9A 4AAAA 3E92A 1CDKA 2YM4A 3TTIA 2BRNA 4JQ7A 4O7RA 1W84A 2W4OA 4QP7A 4QP8A 5DRBA 3DKOA 3EN6A 4QD6A 1DS5A 2XF0A 4BDBA 4HVDA 5FEEA 3EH9A 3GT8A 3PVGA 3KXNA 4YJRA 5ETCA 3R7YA 3C13A 2C6LA 4FV7A 3MY5A 4UMUA 4JRNA 2QU5A 4ANQA 1ZYJA 2OI4X 4ACMA 3E8NA 4MH7A 1VEBA 4WSYA 2YHVA 2C6MA 4QOXA 4YZ9A 4ANLA 1J1BA 2PVRA 4M84A 3CLYA 2OIBA 5CEKA 2OZAB 1ZY4A 4MD9E 1K3AA 3OFMA 1OL5A 3FMLA 4YBJA 4CZUA 5AMNA 4IVBA 5I3RA 3ETAA 5AUYA 4ZP5A 1FGKA 3FQSA 4UALA 1XBCA 4KKGA 4BY9E 1FPUA 2C1AA 1M2QA 4WT6A 3BHYA 2XK3A 4BDKA 1OGUA 4DEAA 4AZSA 4AQCA 4F9BA 4BDAA 4BCIA 3SRVA 3DDQA 2X81A 4TWCA 3R83A 2NNWB 2IW6A 3CPBA 3CXWA 3OTVA 3CEKA 4MKCA 3S1HA 2I6LA 5EYCA 3DLSA 4IBMA 4NTTA 5I5ZA 5EOLA 4EH5A 1E1VA 1VYZA 4IW0A 4QPSA 3W2OA 4TYGA 5BUEA 2RFSA 4HCTA 5AX3A 5BPYA 2OSCA 1YXTA 2JFLA 4TYIA 1YOJA 2QCSA 1R39A 4IFGA 3VWAA 1XHAA 3V8TA 4EONA 5M4CA 3QRIA 5C4KA 2W1GA 4PPCA 4UZHA 3GCSA 4ITIA 4PF4A 3MW1A 1BI8A 3D7ZA 1Q24A 3OCTA 3RNIA 4M13A 3LIJA 4MWIA 4GJ2A 4C2WA 3ZZEA 4EBWA 3ZRLA 3JR1A 2HXLA 4RJ4A 1T46A 2WO6A 4C2VA 2RKUA 3QALE 4X21A 3I60A 3F9NA 2CGVA 2YM7A 5HCZA 4OUCA 1JKSA 4TTHB 3L8PA 4DEHA 4FE2A 4OTWA 4ZOGA 2GNFA 4LM5A 1BI7A 3ZZWA 3G0EA 2V22A 5IA1A 5CANA 5HIDA 4LGHA 4FTJA 1FVVA 3QQUA 5AUZA 3S3IA 4EJNA 3ZRKA 2V5QA 3LFQA 2QOOA 5H8GA 4Z3VA 3C4XA 3NS9A 4OTDA 5DN3A 3U8WA 3R73A 5FLFA 2VTLA 4PPAA 1OIRA 4QP3A 4AGWA 3D2IA 3VBTA 2CSNA 2VWVA 3W33A 3A8XA 2WMRA 3UIMA 5H2UA 1TVOA 4RJ3A 4RGJA 4K1BA 3F7ZA 5EM5A 3ZRMA 4O81A 3WZJA 3LOKA 1PYEA 4DT9A 3V5QA 3VF8A 3OOGA 4RVLA 4DLJA 2YEXA 3NDMA 5M4UA 4WOVA 4O86A 3LFFA 4HZSA 5C4LA 5FRIA 2C0IA 4GVAA 4HNIA 1OKVA 5K3YA 4FSQA 3BE2A 4LL0A 5HD4A 3BGQA 3ORNA 4ZSAA 3ZU7A 2P4IA 5HVKA 1NVQA 1P4OA 2VNWA 3ZFXA 5DMZA 5JZJA 1NW1A 3NYNA 3OC1A 1V1KA 1HCLA 3AC2A 3CIKA 3CQWA 2IG7A 2XB7A 5D7AA 3ET7A 5KNJA 3NAXA 1X8BA 3FQEA 3FMDA 3MI9A 3SG8A 3RHKA 4N6ZA 4YJPA 1F3MC 3F88A 3A99A 3F2NA 2XKEA 3KQ7A 3ZSGA 3UQGA 4E4LA 4TWPA 2ETRA 4L42A 3GNIB 4ZAUA 2YDKA 2QO9A 2GSFA 3AOXA 4PMTA 4EWHA 3R00A 3OZ6A 4JG7A 4BTFA 4QO9A 3L8VA 4TN6A 4FSUA 4BDHA 1JSTA 3VBXA 3O50A 4I4FA 1EH4A 5DT4A 2PY3A 3T3UA 3CPCA 5FBNC 4L3JA 1PY5A 4KBKA 4J98A 1YW2A 4ANOA 3ODYX 4BDFA 1CKIA 4E6DA 3BLQA 4FTNA 2OF4A 4J95A 1GY3A 3F5UA 4ITHA 4CRSA 3HEGA 5J87A 3A2CA 4M69B 4AUAA 3CCNA 4YHTA 5K9IA 3CY2A 3I0QA 1ZRZA 4FKJA 1YXUA 4KUJA 3FYJX 3C51A 3UG1A 3OWJA 4IB5A 4FTUA 2ZJWA 2IVUA 4X3FB 3DZQA 4YZMA 4Y72A 3GU4A 4ANSA 3KC3A 3KXHA 2PVKA 4TRLA 2CGXA 4U3ZA 1OZ1A 2X2KA 4ZEGA 5CU3A 5KKRC 2BPMA 2OJ9A 4BCNA 5I9UA 1Q4LA 1QMZA 5L2SA 2XM9A 3EQBA 3ZYAA 3Q4UA 4YLLA 4ENXA 2WQOA 4BR3A 5FXRA 3HZTA 3A7IA 3HMMA 4NEUA 3OS3A 4JRVA 4U41A 2BZKB 3F5PA 2ITNA 3F69A 3QUEA 4JG8A 5F4NA 3OCBA 4EHEA 3OTUA 4ONAA 4AU8A 4O0RA 3IW6A 3ZUTA 2OF2A 4AT5A 4NM3A 2EU9A 4O7TA 1RE8A 2JKKA 2PULA 3K3IA 4AT4A 3H0YA 4Y5HA 4EH3A 2Q83A 4MQ2A 2ZM4A 2HY81 3R63A 4IVCA 4UWCA 4AZVA 5AAEA 3H9RA 3EQDA 3LVPA 5ANGA 4BBMA 3L8XA 4ERKA 3UC4A 1GAGA 2W1CA 2W5HA 2OW3A 3DU8A 2YAKA 5EI6A 1BL7A 4BCFA 1SYKA 3EJ1A 3V5LA 2VX3A 4RA4A 4QMWA 4EOQA 5EM6A 4ARKA 3HVCA 3C50A 5AUVA 4XOYA 5CLPA 2XCKA 5GJGA 2PVHA 3COIA 3CTJA 4E5BA 4R78A 3BX5A 2GTNA 5L2TA 3P9JA 2BAKA 4IM3A 4BWPA 4FSTA 5HX6A 2DS1A 2OJFE 2QG5A 1Z5MA 3FMHA 3KMUA 4GT5A 4O22A 4UYNA 3KK8A 1G5SA 4MBLA 3ULZA 4PP9A 4XEYA 5E91A 4IZ7A 4WUAA 1XR1A 2F4JA 3KVXA 4JX3A 1YI6A 4ASXA 4FTAA 2XKDA 4FKUA 4UBAA 1U54B 4I23A 3L1SA 1WBSA 2RFNA 4UZDA 4R1VA 5FGKA 3TTJA 4D2RA 5K4JA 5JGAA 4J97A 4DTAA 4ASZA 4FZ6A 1YWRA 4AGDA 5A14A 5FXQA 3BQCA 4C62A 3A8WA 2P3GX 4NJDA 1ZZLA 4LYNA 4QMSA 4YLJA 5JGBA 3TDWA 5CVHA 1IA8A 3FZ1A 2QO2A 3I81A 2A4LA 3K5UA 4DGGA 4E6AA 2XNGA 5AAFA 5IDNA 4G6NA 3OXIA 4FSRA 3IS5A 3RZFA 3KU2A 2VTOA 2G1TA 4IQ6A 4CV9A 1H07A 2X8DA 5EK7A 2JKOA 5AAGA 4NU1A 4HVHA 3KXGA 4UN0C 2J7TA 3RI1A 3SXRA 4YJTA 2W05A 2HZIA 1OB3A 3O51A 1KOBA 4E6CA 4FIHA 1ZMUA 2UW5A 4KS8A 1V0OA 5AR7A 3R9OA 4AW0A 5IDPA 4AZTA 3DS6A 4IVAA 1QPJA 5HIBA 3UNJA 1G3NA 4DAWA 2J6MA 4WUNA 2OLCA 4DFBA 4IH8A 2XVDA 4R3CA 5M08A 4GCJA 3FLZA 3P7AA 4DEEA 2R3LA 2QODA 5TT7A 3LCDA 3R6XA 4TW9A 1RDQE 5AJQA 2PUPA 2CGUA 5L4QA 1KV2A 3DCVA 4RJ7A 4JDIA 4JVGA 1SNXA 2W17A 3HV7A 3AD5A 3F3TA 4WBOA 2Y7JA 3NSZA 3VUHA 2XRWA 2F7XE 2XK7A 3KCKA 2AYPA 1J91A 4JBOA 2VTQA 4X2FA 5EOBA 4BDIA 3BLHA 5HTCA 4FEVA 3MJ2A 5I9ZA 3LFEA 4RLLA 3LXKA 4O1PA 1M17A 4YP8A 5IA4A 3BRBA 4F63A 4MNEA 2ZMDA 4QMUA 2XNMA 2VUWA 3Q9ZA 3HGKA 4L3LA 5A4CA 4DEIA 1A48A 2HOGA 3OXZA 4H3PA 5ETFA 4D4YA 4C4FA 3E8DA 5I9YA 3AT3A 3G9NA 3JVSA 3NNVA 4XG7A 2YIRA 3UYSA 4AW5A 4C35A 5L2IA 5TOZA 5A3XA 4DFZE 3LCSA 3G33A 4FL3A 2E9NA 4JIKA 3EIDA 2EB3A 4BRXA 3VUGA 2JBOA 2PPQA 4YMJA 4L44A 5HE0A 3SXFA 3UPXA 4D5KA 3HV5A 3OMVA 3TV7A 4PQNA 3EFKA 4QMZA 5G1XA 4JR7A 4RSSA 3ZONA 4IM2A 2I0YA 4FTKA 2YAAA 4JDHA 2BAJA 4O7SA 1KWPA 3EZVA 5ANDA 2EB2A 3KREA 4FR4A 4IAAA 3N51A 3BGZA 4U9AA 5CAVA 3SGCA 5CS6A 4IDVA 3POZA 3KULB 3NYOA 1IAHA 4L3PA 3T8OA 1GZKA 3ALNA 3HA6A 4U42A 3W2RA 5AUTA 5JMSA 4CT2A 4Y83A 2YJRA 2XYNA 4FSYA 4I22A 4F7SA 4IZYA 2I40A 4Z16A 5ANKA 4OTFA 3E93A 4Q5EA 2AC5A 1OL7A 4OBPA 2XJ2A 4ACCA 4IANA 4ZZOA 4IFCA 3OOMA 3V3VA 5M4FA 5G6VA 5KHXA 4IC8A 4EZ7A 5E1SA 5LMKC 4TPTA 4O6LA 1Z57A 2HZNA 3VN9A 1ND4A 3B8QA 3RWPA 4IWPA 1PMVA 3DGKA 3D5UA 3R9HA 4JDJA 1YOMA 3FHRA 3IDPA 2V0DA 3WI6A 4CD0A 1LEZA 4HZRA 1UNLA 4RT7A 5CT7A 3QC4A 1M2RA 2ESMA 5JFXA 2ITPA 2VTAA 4FICA 4W8DA 3G5DA 3TNHA 3GU5A 4MXOA 2UUEA 3FXXA 5M51A 2VTJA 3BYMA 2CLXA 4QMOA 4PTGA 5CSVA 4BIEA 5FP5A 2NRYA 2J0LA 5CU4A 2GQGA 2KULA 4C61A 4J99A 2JDTA 3EHAA 3MVMA 3GU7A 4C3FA 2GS2A 3DV3A 4MVFA 1YWNA 3DKGA 3I1AA 4ZTQA 4RX8A 5IQEA 4NW5A 4C02A 3EL8A 5M56A 5BUJA 4IB3A 2ITXA 1U5RA 5LMKA 3U6JA 4N57A 4MXYA 4XRLA 5AIRA 1PXMA 3Q52A 4FIEA 2QD9A 4F64A 3PLAE 4GU6A 5AUXA 4BDCA 2UZWE 4DFLA 5IQCA 2G2FA 5CVGA 5ICPA 3MPTA 4JAJA 4H3QA 2NRUA 1OECA 4O0YA 1MQBA 1REKA 3PIYA 4EYJA 1H24A 3RP9A 2X1NA 4K33A 5M07A 2VTNA 3E64A 3QXPA 3F3WA 4PL4A 5AV2A 4EH7A 5HI2A 4PL3A 4XS2A 3MFSA 2OXDA 2RIOA 5AIKA 3GFEA 3V5PA 4C8BA 4EK8A 4BC6A 4FNZA 4AN2A 2VWZA 1IAJA 1CMKE 3P78A 4RZWA 4FTOA 4GT4A 5J9LA 1KV1A 4F7NA 3Q32A 3ZEPA 3MH2A 3A7GA 4RIYA 2I0HA 3D2KA 1DAWA 3GC7A 3TZ7A 5IH6A 4AX8A 4FK3A 5EI2A 2C69A 2W1DA 3ZC6A 3ZS5A 2W5AA 2X4FA 3Q04A 5KZIA 5CEOA 2VTTA 5HZNA 5D1JA 3VULA 1FOTA 1Q8WA 4MXZA 3DAKA 4BI0A 4EBVA 5FQDC 2JBPA 3ELJA 4FG8A 1OMWA 3MY1A 3TEIA 3MH3A 3ERKA 2UVYA 4ZTRA 5AFVA 4BHNA 2UW4A 3NR9A 4UB7A 4RC3A 2C3IB 2UZTA 1FGIA 1M52A 3H30A 3KXXA 4FGRA 5EFQA 5H8BA 3ORIA 3ZO2A 3ZXZA 5CNNA 4F08A 4G34A 3NUNA 4XMOA 1YXSA 4RVTA 2F7EE 1R78A 2WMSA 4OBOA 4P90A 2R9SA 1ZYSA 2XP2A 3GUBA 5CU0A 1ZLTA 4YJOA 5IG1A 3ORTA 4FT7A 3R0TA 5HLPA 4BB4A 2J51A 3QTIA 4ENYA 2W4KA 4J52A 5DFPA 4A9RA 3IW8A 3LW0A 5DLSA 4C58A 3LXPA 1XH7A 4EQCA 2P0CA 2YCRA 4AA4A 3VF9A 4RG0A 3FKNA 2YABA 4O91A 4RJ8A 4YZDA 2QQ7A 4FKTA 4QP2A 2W9ZB 2R3HA 3QRKA 3WIKA 4BZNA 4C4JA 3MIAA 2XCHA 5AP3A 3R30A 5FXSA 4M0ZA 5J8IA 3RM7A 4KIKA 4I5PA 4PDPA 4KBAA 3ROCA 3V8WA 5E8VA 4W4WA 3ZFYA 3FL5A 1ZMVA 3QZIA 5CAUA 4CG8A 1FQ1B 4WHZA 3TI1A 3ZCLA 4BKZA 3LMHA 5I9XA 1R0EA 4XLVA 3PY3A 1KE7A 2UV2A 3E7OA 4NM0A 4QYYA 4YHFA 3P5KA 2J4ZA 5FDXA 3CE3A 4A4XA 4FG9A 3FMEA 3W2SA 3P0MA 2Y9QA 3QQJA 4LGDA 2OJIA 5ITAA 4O83A 2UVZA 2NO3A 4TWNA 1YOLA 3F2RA 4JLCA 3OXTA 2QOCA 3QLFA 1WAKA 4FBXA 3P23A 5KE0A 4WRGA 5ANJA 2IPXA 3RAIA 2QHNA 3CBLA 4K8AA 2R3KA 3MESA 3D4QA 1PF8A 4D2TA 3MVJA 5CALA 5AR5A 1FVTA 3R1YA 2GNHA 1MQ4A 2QOQA 1PXOA 2ZVAA 3CTQA 4XHKB 3DT1A 3DNEA 4FZ7A 3ZLSA 4EORA 2GNGA 1APME 2RF9A 3FUPA 2W99B 3NUPA 3ORPA 4FOBA 1W83A 4FNWA 3FDNA 3MBLA 3E8CA 4BGHA 2J0JA 1BYGA 1OKZA 2G2HA 2GQRA 4PP7A 4L53A 3KF7A 3TM0A 1JPAA 5T3QA 5IQFA 4V05A 5AWMA 1LPUA 1P4FA 2UZNA 3TT0A 4EZ3A 3MV5A 2PMNX 4GVJA 3WZEA 4ZJIA 4IX3A 5HEZA 3RWQA 2Y4IB 3DBDA 2UZEA 1Y6BA 1JBPE 2ITYA 4FV9A 2F2UA 2PUUA 5ACKA 3PPJA 3D5XA 4XCUA 2BKZA 2XK6A 3GOPA 2X4ZA 3DBEA 2IWIA 4YPDA 3OROA 5DHJA 4QYEA 4R5YA 1Q8UA 4QYGA 1YHVA 2W9FB 5I3OA 4RMZA 5JRQA 4JNWA 5AR8A 4WG5A 5IUHA 2ZDUA 4D58A 3FLSA 2WQBA 4O6EA 1L3RE 2BRHA 4A9YA 1NVSA 4O82A 5GIPE 4NYEA 3Q6WA 4BHZA 4G1WA 2XS0A 2GS7A 3QKMA 4HOKA 3DAJA 4I6FA 3PSBA 2CHLA 4PY1A 1OUYA 2F49A 2C4GA 4RWKA 4O0XA 5FBOA 4AE6A 1BX6A 3IW7A 4O0UA 2YITA 2BRBA 5AV0A 4RLKA 4BTKA 3HP2A 5EI8A 2HWOA 4AZWA 4BDJA 3DJ6A 1NXKA 3JVRA 3OVVA 2X7GA 4BIBA 4MD7E 4K77A 3EN7A 4UXQA 4E4XA 4Q2AA 4CMOA 1AD5A 5AP1A 4ZLZA 1YDSE 4JL9A 2SRCA 4ASEA 5AP6A 4O7WA 2Y6MA 3AT4A 1W0XC 3C4ZA 3G6GA 4J53A 1J3HA 4IAKA 2W06A 3JYAA 4CLIA 4BTMA 4C7TA 5AA9A 3BWJA 3KFAA 4E3CA 2QVSE 4TXCA 3GGFA 3OHTA 4WNPA 3L9MA 2HZ0A 3PXQA 3R1QA 4QPMA 5E8WA 1Q61A 2OH4A 1GIJA 3E3PA 1SZMA 3L8SA 5AR2A 3P4KA 3O71A 2C0OA 5CF4A 4G2FA 4X6RA 5CT0A 2PSQA 4ZJJA 4PDSA 3H9FA 2UW8A 3UQFA 5HNIX 2W5BA 1XKKA 2NP8A 1IRKA 3PDTA 2XEZA 4EC9A 5CEQA 3ZDIA 1HOWA 3QXOA 2VO0A 2R3QA 5CI7A 3TKHA 3QU0A 4UY9A 1XH9A 3AG9A 4FTLA 4BCKA 5IUGA 4C38A 4EH2A 4ANMA 5ETAA 3ZBFA 4LV5A 3UZTA 3C1XA 1OKWA 1T45A 4YJVA 4TYEA 1OUKA 2C0TA 4X3FC 4QNAA 3QTZA 4FV1A 4NFNA 4CXAA 1XH4A 5JT2A 1ZOHA 4CTBA 3IG7A 5EW3A 4FKPA 4GU9A 4NCTC 4DHFA 3R22A 3RVGA 2PZYA 2CNUA 3PA4A 3TZ9A 3B2WA 2QC6A 4U79A 4MWHA 4D1SA 2E2BA 2IVSA 2WTVA 2J9MA 3PPKA 4HGSA 4NIFB 2Y0AA 2O3PA 4KSQA 2R7IA 4ZJVA 1REJA 2H8HA 4B8MA 4KAOA 4FL2A 4P7EA 4IB1A 3FSKA 4FOCA 5HU3A 4AA0A 1PXIA 4IAFA 4N6YA 3VS5A 1G8AA 3RAHA 2EVAA 3H3CA 5IMXA 3IGOA 4DFUA 1JNKA 3W8LA 2VGPA 4GH2A 5HOAA 2OICA 2XKCA 4QMNA 3I6UA 1PRYA 5F95A 3NNUA 4NCTA 3AQVA 5LCKA 3KL8A 3VUIA 4CEGA 4E8AA 2HCKA 1YKRA 4QP1A 3FZRA 2ZYBA 4HYUA 5KMJA 2G9XA 2BUJA 2P33A 2PMLX 3FMJA 4L01A 3NCGA 2O8YA 4DFYA 4PRJA 2X9EA 3DBFA 3I7BA 3ZMMA 4L7FA 4AN9A 3RCJA 2Z7SA 4ZSLA 4UMPA 4G16A 4O7VA 1W82A 3LFAA 2E9VA 2RL5A 5HD7A 3MN3A 2OJJA 3GCVA 4FT0A 2I1MA 2CKPA 4KKEA 4DGLC 4EHVA 5CQWA 5CU2A 4HGEA 4XV3A 3JXWA 1Y6AA 2QOIA 4Y73A 4EOPA 3Q6UA 3JS2A 2J90A 2PUIA 4KRDA 3MPAA 5E1EA 2VO6A 1PXNA 4TKSA 5DE2A 2C3LA 4KKHA 1UKHA 2YZLA 3LFCA 4ZMFA 2OFUA 4YSMA 4G3GA 4X3JA 2VWUA 4C4IA 3CJGA 2YFXA 1Q3WA 4V0GA 1TKIA 3QD0A 4D9TA 3FJQE 4QP4A 1UWJA 4KA3A 5CEPA 3D9VA 2PVFA 1ZOGA 2WMQA 1YXVA 5HE3A 3A4OX 4BCQA 3SDJA 5HO8A 5IZFA 3KMWA 1OPJA 3Q2JA 3O96A 2R3PA 4I92A 4CCBA 4RBLA 3DXQA 2B9HA 2BZHB 3R7UA 3P7BA 3W2QA 4BDDA 4CRLA 2PMIA 3MIYA 2YLEA 2CCIA 3KRXA 3OEFX 1H4LA 2J50A 4DYMA 4PDOA 3OUNB 4E5WA 5HG8A 4ACGA 4IJPA 2W1IA 4HYSA 5J9YA 3TN8A 4YC8A 5CVFA 1JSUA 3I6WA 4R3PA 5A4LA 5B7VA 5E90A 4BGGA 3ZDUA 5CAQA 3CC6A 4J8MA 3PJ8A 5IQAA 3MH1A 3TJDA 4B7TA 4GYIA 4CFFA 1YDRE 3VS2A 3UIXA 3EFLA 4PL5A 3AD6A 5D7VA 3ZM4A 3D7TB 2B9FA 3EQIA 5DEWA 2EWAA 1HCKA 4LL5A 4M14A 5L6OA 2WQNA 5F94A 4H05A 4CFVA 4AW1A 3F2AA 4FZFB 2RGPA 3VHEA 4XV2A 3S4QA 5ANOA 5AP0A 4F0IA 4P2KA 4PWNA 5K0KA 2BMCA 2WMBA 3SA0A 4WNMA 1JKKA 5I9VA 5FP6A 3UYTA 2J5EA 4F7LA 2XIRA 2CNVA 4Y8DA 2DWBA 3AC5A 5L3AA 2PZ5A 3T9TA 4BI2A 4YZNA 2B1PA 2J0MB 4OT5A 2WD1A 5T68A 3WOWA 1DM2A 5KMMA 2ZAZA 2CN5A 2GTMA 4HJOA 1JVPP 2C6EA 5E4HA 4CMUA 1FMOE 3FXZA 3NX8A 4LMNA 4ALUA 1H8FA 2W1EA 1WBTA 3C0HA 2C5VA 3MDYA 3QAME 2HXQA 2WMAA 2R3JA 3UGCA 5EW8A 4AP7A 4BYIA 2W1HA 5KO1A 3NVMB 3ACJA 3H10A 2ITWA 4DFNA 4ITJA 4WSQA 1Q99A 3ENMA 2GNLA 3HMNA 2X6EA 4QPAA 1G8SA 3QTUA 4EJ7A 4XNEA 5CSXA 2C3JA 3UODA 4MXXA 3SX9A 3SRVB 1H1PA 2BALA 2VWXA 2YDIA 3IGGA 4ID7A 4ZTSA 4Q9ZA 4I5HA 4RC4A 3QCSA 3H4JA 4LRKA 4H3BA 3LKMA 1VJYA 4DINA 4YZCA 4IXPA 3E62A 5DWRA 3QQHA 4WD5A 2O5KA 2YCQA 3K2LA 4A9SA 3OWLA 4KIOA 3TKUA 3MGYA 4WNKA 4QQTA 2QOHA 3L9NA 3VNTA 2YERA 4HGTA 3CJFA 2R5TA 3NUXA 2VTHA 4FKLA 4GV1A 3NYVA 4FTIA 4LQMA 5DVRA 3BBWA 4ZSJA 5KMNA 2X8IA 2XBJA 4YHJA 5A6OA 5CEMA 4AT3A 3PJ3A 2CCHA 3DBQA 3FPMA 3KN6A 4FIIA 2VNYA 5CU6A 5IA2A 4YC6A 3GU6A 1A06A 3MB6A 2BILB 4DCEA 5DNRA 5KX8A 3D5WA 3QF9A 5LXMA 3UVRA 4XG2A 1ZXEA 4GYGA 5CQUA 2C5OA 5BVKA 4CQGA 2A1AB 1QPEA 4BCHA 4KNBA 2JIUA 4JIAA 5IEVA 3UP7A 1UU8A 3SV0A 3PLSA 4L7SA 2CKOA 3M11A 3RK5A 3DB8A 1PJKA 4F1TA 4IZAA 3RPRA 3VS3A 3NAYA 2PZIA 3LAUA 1DI8A 1E9HA 3GP0A 4JAIA 2B4SB 4QMMA 1GJOA 3DJ5A 4OTGA 4I24A 3CSVA 2QOKA 3FXWA 3UC3A 5EDRA 4DGNA 2WZJA 4A9TA 4IAYA 4JX7A 3DK3A 2O0UA 5K5XA 3ZSIA 5TR6A 4BYJA 3HYHA 5E8YA 5ETIA 4LFIA 1H08A 2XIYA 3POOA 4GRBA 5EKOA 2PHKA 2W1FA 2YWVA 5A6NA 3P08A 4FKGA 5GIOE 4IB0A 2WNTA 5CNOA 3O2MA 4EK5A 4XP0A 4AGUA 5KMOA 4JQEA 4MXAA 4DITA 1Q8YA 3ZM9A 3V5WA 3LCOA 4S33A 2VV9A 3E8EA 1U59A 2PMOX 5LVLA 2C6TA 4C3RA 5I9WA 4BVUA 3TUDA 3KA0A 4LI5A 3RPVA 5J9ZA 3QTXA 1KUTA 3VJOA 5BVFA 4UEUA 3VIDA 3DQXA 4RPVA 4YPSA 2Y6OA 4U80A 2E9UA 5KHWA 2XNOA 4DE4A 3DK7A 4DH8A 3DK6A 5CEIA 3KK9A 5E8SA 4F6UA 4HW7A 4DGMA 2WOTA 4DTBA 4I93A 1LR4A 3DOGA 3MA6A 3GQLA 3IW5A 3QLGA 2O65A 3TDVA 4CVAA 4DH5A 4UXLA 4U81A 5JFWA 4I6QA 2GCDA 5DBXA 5IQIA 5IISA 2CMWA 3L9PA 3NCZA 3V8SA 4DH1A 3F61A 4NKSA 4ZS4A 3O17A 4ALVA 2R3MA 3D15A 1ZMWA 3LJ1A 3ORKA 2XA4A 4FV4A 4HYHA 4PUZA 3DKFA 3IW4A 4RIXA 4XV1A 3VUKA 1UU3A 3WZKA 2QOBA 3A4PA 4FSNA 3DA6A 4ACDA 2ETKA 3R2BA 2XH5A 4CKRA 4MQ1A 4AS0A 5LJJA 3EWHA 4FYNA 2VTRA 3BEAA 3OT8A 4J8NA 5F20A 3WF8A 2QI8A 5JQ5A 1H0WA 3MFRA 4O7ZA 4TL0A 2OH0E 1OM1A 4EL9A 3QZGA 2YACA 3DFAA 3R7GA 4QMLA 3R8VA 2ZB0A 5LCJA 2IN6A 3FHIA 5BVWA 1Q5KA 4HGLA 5AP7A 3ZFMA 4QMXA 4S30A 4BCGA 3GB2A 4ZY6A 4I6HA 3BE9A 3DXNA 2WMTA 4U40A 3HRFA 4M12A 4YSJA 2NPQA 1SM2A 4LRJA 2RFDA 5D41A 4RX9A 5DR9A 1NT2A 2X0GA 2ZDTA 5AUUA 3BYUA 2GQSA 3LLTA 1Q3DA 3HL7A 5B2KA 4QTAA 4Y85A 3II5A 3COMA 3RPYA 3SAYA 3DDPA 4W9WA 2R3GA 3R9RA 4FKRA 4A4LA 3GFWA 4G31A 3UMXA 5AV3A 4EUUA 3D94A 4NW6A 4YTFA 3EN4A 4XG4A 2IO6A 1BUHA 3FZPA 4HPTE 4B99A 5L6WL 3I0OA 2PU8A 2IZTA 2VN9A 3R1SA 5CF5A 1Y8GA 3HKOA 3NUAA 3R7IA 3MVHA 3G15A 3C7QA 3Q9XA 4L00A 4EOLA 2I7QA 3EYHA 5EDPA 4Z7HA 4IHPA 4HVSA 2ITOA 1SVHA 2QOLA 3PSDA 4K6ZA 3LPBA 5BNJA 2P55A 4PMSA 5BUIA 3UNKA 4IEBA 5EKNA 2OXXA 3NVKI 5HVYA 1O6YA 3BU6A 5JZNA 5E8ZA 4GMYA 2WXVA 1VZOA 1UNGA 1XBAA 2GHMA 4X2JA 4AA5A 3IKAA 3MB7A 4KINA 5C8MA 5JFSA 3O8TA 4L43A 5L2QA 3WYXA 5HG7A 4ZY4A 1JKLA 4O84A 3LXNA 4G17A 4M68A 1A9UA 3QHRA 1F5QA 3UDBA 3FLNC 2YIYA 3PWYA 4EK3A 4IWDA 4JJRA 2GMXA 3OBGA 4FIJA 4F7JA 4OTPA 3QQLA 2VGOA 3FKOA 4FV8A 2WPAA 2VU3A 3PA3A 2EUFB 3D14A 4ZTNA 1WFCA 4TZRA 1M2PA 1O9UA 1BL6A 2PVYA 2WTKB 3E63A 2B9IA 3FV8A 2WEVA 3R1NA 3RM6A 4B9DA 3MY0A 3LFSA 1S9IA 4XOZA 4AOJA 4BWKA 3LM5A 2GFCA 5M55A 3WILA 5GJFA 4UWYA 4M3QA 5HBHA 2FSLX 4BGQA 5LMBA 5FUTA 1O6KA 4YNOA 3R8PA 3MTLA 3SKCA 2VTSA 3D0EA 3N4VA 1J7UA 2OIQA 3DFCB 3EMGA 2BZJA 4QTEA 3QQKA 4XG8A 4JBPA 3MPMA 1YRPA 4JG6A 4AFEA 3Q4ZA 4NTSA 3N9XA 4BFMA 3R2YA 3BEGA 3FZSA 5IEXA 2EXEA 2W1ZA 2IZSA 4X2GA 3VS4A 2CNQA 4FEUA 1S9JA 5BYLA 3CKXA 2JIIA 3LJ2A 3BCEA 4NSTA 3PYYA 5IA3A 4OAVB 4BKYA 3ODZX 2H6DA 5C8KA 4FC0A 3FQHA 2V7AA 1SNUA 4H39A 4O0WA 4YC3A 5J95A 3F3VA 3RTPA 3C4FA 3E7VA 3A62A 3PIZA 1PMUA 2BCJA 3NGAA 4F4PA 3E88A 3NUYA 2E9OA 2ZV8A 5IQDA 2YIWA 1PKDA 3NW7A 5BVEA 4DH7A 2RFEA 2J2IB 3PRIA 3GENA 2PYWA 5DIAA 3FE3A 3HX4A 2WEIA 3V51A 4N0SA 4MF0A 4D1ZA 4O96A 4BI1A 3AC1A 4EOSA 2VX0A 4I94A 2WELA 2YIQA 2F7ZE 3I5ZA 3GC9A 4EQUA 3M42A 2CGWA 3LCKA 3AD4A 5LOHA 5FTGA 1YDTE 3BQRA 1YI4A 1ATPE 2KTYA 4FKWA 3TKIA 5BYYA 2P2IA 4DA5A 4L6QA 5HESA 2QG7A 3VBVA 2YIXA 3FLYA 3BHHA 4U7ZA 5GINE 2GS6A 4R7HA 4BICA 3UO5A 4TYHA 1Q8TA 5TKDA 5CZIA 3VRZA 1B39A 2A0CX 4ZZMA 4XP3A 2X6DA 5EHOA 4FKVA 5BVOA 5LVOA 4RIWB 2C5NA 4K9YA 1ZYDA 4AW2A 2JKQA 3OCGA 4JI9A 4ZY5A 3CS9A 3R8MA 3SOAA 4A4OA 2WU6A 4BTJA 3OUKA 3Q5ZA 3LZBA 5F1ZA 5IUIA 4D4VA 4E5AX 4EQMA 4AACA 3ZEWA 3UIBA 4AOTA 3P7CA 3MJ1A 3MA3A 4FKQA 2YM3A 3EKKA 1PYXA 3KVWA 2HZ4A 2YISA 4MBJA 5GNKA 3RNYA 4A9UA 4C37A 1UU7A 4EHGA 4F65A 3QUPA 3BU5A 4AZFA 4IX6A 4A7CA 2B53A 4JQ8A 5EM7A 3PUPA 5HHWA 4HVIA 3QQFA 5CF6A 4ZMEA 4E7WA 5GZAA 4E26A 3G90X 3PZEA 3BV2A 4IIRA 4FKSA 1M14A
chains in the Genus database with same CATH superfamily
2A19B 4OTIA 3O8PA 2HAKA 4IWQA 2UZOA 4X2NA 3AMBA 4LV8A 4Z55A 1KE5A 5DR2A 2REIA 2HW6A 4FSWA 3RINA 3VO3A 4IC7A 3PXRA 4JBVA 2W7XA 1VYWA 2BFXA 5H8EA 3P86A 2JC6A 5IMEA 3EQGA 1UKIA 4U3YA 3W1FA 4Z7GA 2VWBA 4O7LA 2QR7A 3UDTA 3TZ8A 5JKGA 4U43A 5CX9A 3NMUF 4FV2A 4Q9SA 5H9BA 1OL1A 4EUTA 2WKMA 4B0GA 5EHLA 4JBQA 1SMHA 1PMNA 3R28A 5IQHA 3QRJA 3HV4A 1M7QA 5HBEA 3PFQA 3R7OA 4BL1A 4CFXA 3ZOSA 3TJCA 4UX9A 2Z7RA 2OZAA 1GOLA 3B2TA 3QKKA 5M09A 3P5JC 5HG9A 3SD0A 4II5A 4XLIA 5CAOA 5IF1A 3PSCA 4F6WA 1TQPA 4H1MA 2BTSA 2F57A 3FI4A 1RJBA 3G51A 3VBQA 5EQYA 4RX7A 5TO8A 3R8UA 2WFYA 4O38A 3NIEA 4FIGA 5JRSA 4F9AA 4ZLOA 3KY2A 4O2ZA 4I41A 4NIFA 3PXFA 5AV4A 2R3IA 3VS7A 2CPKE 4XV9A 4K2RA 2XUUA 2C5YA 3NNXA 3VJNA 3BHTA 1Y57A 3OW4A 5AADA 4ZS0A 3EL7A 3CD3A 5CWZA 3THBA 2WU7A 3HUCA 5HO7A 1WCCA 4KIPA 3CGOA 1XMLA 3T3VA 3NW6A 4U45A 4CMTA 2YWPA 2W96B 3ORMA 2DUVA 5DG5A 3V01A 4PTEA 5KMIA 4ZZNA 1PXLA 4NK9A 3EYGA 4H36A 3ORZA 4I20A 5AR4A 2BHHA 1QL6A 1ZY5A 2WMWA 3BV3A 3CY3A 2UZLA 3QWJA 4IMYA 3BGPA 5CI6A 3UE4A 3VRYA 2RG5A 4EYMA 5BX0A 1QCFA 3DPKA 2BVAA 4JT3A 3V5JA 4GIIA 3FKLA 3OG7A 3SC1A 2IJMA 2ZM3A 2X2MA 3VQUA 3MWUA 4FKIA 4BDEA 3VS6A 4EHZA 1PW2A 4GFMA 4CGAA 2XAOA 2O64A 1ST0A 5IQBA 3ALOA 5HG5A 4AG8A 2HK5A 3LMIA 4KSPA 4NJ3A 3KB7A 5JH6A 3WF5A 4TNBA 3W16A 5A4TA 5I4NA 3TUBA 4O0TA 4RIYB 4EOOA 4AXCA 1OBGA 5C27A 3S95A 3W32A 1KE6A 3NUSA 3PPZA 1FBNA 2JDOA 5ANIA 4DTKA 5L2WA 3OEZA 3GBZA 3FMKA 3F5GA 2PE0A 3SG9A 1AQ1A 2QO7A 4R3RA 2P2HA 4UMTA 4OBQA 5EM8A 3BWFA 3Q4CA 1IEPA 2WTJA 5JSMA 2BFYA 2JAMA 3G6HA 3RHXA 3RPOA 2HIWA 3PG1A 3EQPA 1F0QA 5TE0A 1Y91A 5FEQA 2R3OA 3BYOA 2F9GA 3OP5A 1WZYA 1UA2A 1DAYA 3ANQA 1BKXA 5JEBA 3ZTXA 4J71A 2VTIA 4WA9A 4OW8A 4RQKA 4O27B 4RJ5A 1VR2A 5KBQA 2OBJA 1YI3A 2JIVA 4I0RA 3LHJA 1OPLA 4U6RA 4I6LA 3CQUA 3Q5IA 5KMKA 4YTCA 2HW7A 3Q9YA 2R0IA 4I4EA 4M8TA 4BCMA 4EOJA 5A9UA 1LP4A 3WF9A 4L46A 3JY9A 3RJCA 4F0GA 4PTCA 2X7FA 2XNNA 2BROA 5DH3A 3R02A 4N4SA 1SVGA 3ID6C 3I79A 4GEOA 5EH0A 2EXCX 4FNYA 4M66A 4L8MA 4KIKB 4F1MA 3PRFA 1R3CA 3D7TA 4USEA 2FB8A 4R7IA 2XEYA 4O7NA 5IA5A 3W0PA 4KRCA 1R1WA 5CXZA 1W7HA 4S32A 1OL6A 4Z9LA 3TIZA 3W2PA 3GOKA 4GKHA 3KN5A 4FVPA 5M57A 2IZUA 2PZRA 2YDJA 3PY1A 4ACHA 3PP1A 4NH1A 3UBDA 3PIXA 1TFFA 4ZTMA 3ZBXA 3QYZA 3QKLA 3UNZA 2WQMA 3DBCA 4U97A 2DYLA 5E9EA 5DT3A 2FSMX 2IW8A 5KZ0A 5CSHA 4WRSA 2FO0A 4OT6A 1CKJA 2FA2A 3DLZA 3PVWA 1NY3A 1YHSA 3FAAA 3DB6A 3OBJA 4EKKA 4NKAA 4FF8A 4DG0E 1H1QA 2BKKA 5CYIA 3NRMA 5DYJA 1VLRA 2BTRA 2WGJA 2I0EA 1JAMA 4M69A 3WE8A 5J5TA 5LVNA 1JWHA 2QURA 3FSFA 4ANNA 2XIXA 3PE1A 1WBPA 2ERKA 4QT1A 3M1SA 4LOQA 4CG9A 2QLUA 4QYHA 2VWWA 2FUMA 4FZDB 4L9IA 4RIOA 2OGVA 1PHKA 4X3FA 3UMWA 3K3JA 3GCQA 4IWOA 3FZTA 2JLDA 1PKGA 3FI3A 4F9WA 2W0JA 2VWYA 3NLBA 4ZLYA 5EQPA 3V5TA 4FI1A 2VAGA 2XRUA 5DR6A 2C5XA 3ZSHA 2B52A 3KRLA 4QQ5A 4QTDA 5M53A 2YCFA 3ANRA 3COKA 5GJDA 2IVVA 4FVQA 4AF3A 4D2SA 2GNJA 4EH8A 1WMKA 4JR3A 2ZOQA 3L9LA 3RGFA 3LXLA 2QU6A 3Q3BA 3QL8A 4JXFA 3PE2A 1H28A 1XMMA 2FVDA 1XJDA 4OGRA 5HVJA 4FG7A 1PXPA 1CM8A 4EH6A 1W8CA 5IA0A 3AGMA 4MF1A 5EG3A 4ZTHA 1OIUA 2Q0BA 3QX2A 3GQIA 3OD6X 4DG2E 4GKIA 3BL7A 3HAVA 4APCA 3OW3A 5D10A 2OFVA 2OKRA 2QKWB 4IAZA 3KMMA 3HRBA 3I4BA 3Q4TA 3SW7A 4CFUA 2H96A 5M4IA 3EFJA 3LMGA 3CQEA 4FTCA 4FV5A 2C6KA 3NWWA 3V04A 5JK3A 4Q5HA 2OU7A 2YM5A 3A60A 4GG7A 2ZV7A 4P4CA 4TNDA 3ATSA 3HP5A 3IOPA 3QD4A 4GW8A 1XQZA 3PJ2A 3PZHA 4APPA 4ANBA 4W9XA 4RWIA 2XK8A 3FEGA 1E1XA 3BHVA 4EK4A 4I5CA 5EQEA 4FEXA 3OY1A 5BYZA 3MH0A 3ROYA 4M97A 2C6DA 3VW8A 4BZOA 2HWPA 4F70A 1WBVA 2XNBA 2BRMA 1U54A 4CQEA 2C6OA 3HECA 3FBVA 4IDTA 3Q53A 2WTDA 3C4WA 4RVMA 3MFTA 4X0MA 4BCPA 3KF4A 3WF6A 3M2WA 3NW5A 2BAQA 3ENHA 4IVDA 3QZHA 3BIZA 3QGWA 2OG8A 3G2FA 4X7QA 5J1VA 3MFUA 4IZ5A 3ORXA 3HMOA 3GU8A 5FTOA 5BMSA 1H01A 2WTIA 3VAPA 5HNGA 3DTWA 4D4SA 1J7IA 3BPRA 4M0YA 4USDA 4B8LA 4FMQA 1TZDA 2OZOA 4NZWB 1WBNA 1H1SA 5C26A 4D5HA 4CCUA 4DG3E 1KSWA 5K4IA 3EQFA 4IX5A 5EYKA 2R2PA 4XX9A 3CTHA 4EEVA 5AP4A 2R4BA 2WB8A 1XWSA 5A4EA 5D12A 4YTIA 4DF3A 2VTPA 2R3RA 3MTFA 4YURA 3TNWA 2YJSA 5B0XA 3VHKA 3B8RA 3GC0A 3ZO3A 3AC4A 4C4EA 1O6LA 5EYMA 4E4NA 5HLNA 1H1RA 4G6OA 4HVGA 3A7HA 2QOFA 2UZBA 2XK4A 3EZRA 4QQJA 1IASA 5AP2A 1WVXA 5IQGA 4MYGA 1XH6A 4R5SA 3A7JA 3U4UA 4R8QA 3NFFB 4V04A 1WBWA 4CYJA 5JN2A 5CXHA 2GHLA 2VWIA 5EHYA 3HV6A 2XMYA 4O0VA 3N4UA 1YXXA 3IONA 3UG2A 4RA5A 4FGBA 4OR5A 2FH9A 3D83A 3ZLWA 1LUFA 4AAYA 2QLQA 2Y8OA 3GEQA 3OWPA 1JSVA 5DRDA 3T9IA 4C4HA 2YZAA 4TYJA 4W8EA 2PE1A 4O21A 3RCDA 3TNQB 3C9WA 3IO7A 4EI4A 4A07A 2WAJA 3DTCA 4MTAA 1GNGA 5BMMA 3VC4A 4MEDA 2WQEA 1V0PA 4RC2A 4CNHA 3U55A 3R71A 3BZ3A 3QD2B 3S0OA 3ZO4A 1BLXA 2JD5A 3QUDA 5IH4A 2XJ1A 2V7OA 3SVVA 4ERWA 2JAVA 3ZH8A 2FSOX 1MRUA 5FM3A 2PVJA 4ZXTA 4C33A 1V0BA 1Y8YA 3HMIA 3NUUA 2GFSA 4XBUA 4ORKA 3R8ZA 3F3ZA 2OK1A 2PVLA 1URCA 2WTCA 2YN8A 4FVRA 2IZRA 5LMAA 4RX5A 1QPCA 4FK6A 3KULA 2WTKC 4YJQA 4AZEA 5JQ8A 2Z02A 2R64A 3FZOA 4F6SA 2FGIA 2PK9A 5KBRA 3PA5A 3VS0A 3PXKA 4WO5A 2NYAA 4O4BB 2ITZA 1Z9XA 4NM5A 5J79A 4MD8E 3QCYA 4RJ6A 3Q9WA 4S2ZA 1PXJA 3V6SA 5AR3A 3AC8A 1H1WA 2X0PA 1OPKA 3MSSA 5EDQA 1ZYCA 2C30A 1YWVA 3D5VA 3C4CA 4GK4A 2UW9A 4WNOA 4AWIA 2JKMA 5HLWA 4EOKA 5HNBA 4K18A 1K9AA 2XK9A 4NFMA 4RRVA 2Q0NA 1CTPE 5BQ0A 4J96A 5E7RA 4KIQA 1ZARA 4HCUA 4W4YA 5FD2A 4QMVA 4JMQA 3CKWA 5CF8A 4MXCA 4RQVA 4N70A 4V0GB 4X2KA 4D28A 4UMRA 3PFYA 4LMUA 2AEGA 4FT3A 4LRMA 4EWQA 4MX9A 5DOSA 2HELA 3Q2MA 3UZPA 2HENA 2X8EA 2CKQA 4RFMA 3LFNA 3P79A 1JLUE 4DLIA 4KWPA 2XANA 3N4TA 2Z8CA 4M67A 5J1WA 4C36A 2QNJA 1ZYLA 3PTGA 3FPQA 4C4GA 4NUSA 1H27A 3KRRA 5BVDA 3PWDA 5FTQA 1TQMA 1WVYA 4W4XA 3DQWA 2AUHA 2O2UA 3A7FA 4FTQA 4I1ZA 2VX1A 3QTRA 4MNFA 1OITA 3SOCA 3ITZA 3QX4A 4FSZA 5IKWA 3C0GA 1KOAA 4BF2A 3A61A 4D4RA 4V01A 1BMKA 4DEBA 2ITQA 2Y4PA 1P2AA 3EQCA 4HCVA 1RW8A 5L8JA 4F0FA 3LQ8A 3QGYA 4FTMA 3DKCA 3UQCA 3K54A 4DEDA 2C3KA 5AM7A 4YO6A 4C57A 3K5VA 5HE2A 3W18A 5CENA 3R7EA 3QCQA 5DT0A 4CYIA 3REPA 4GL9A 4YO4A 3C0IA 2VZ6A 4OLIA 3S00A 2IF8A 3UOJA 4D9UA 4HNFA 3NYXA 2H34A 4Y46A 5CTPA 2G15A 4NM7A 4OTRA 5CY3A 5HICA 5CAPA 3VUMA 5F9EA 4OAUC 3W55A 2UZUE 5E92A 2ERZE 4MCVA 3BHUA 3AT2A 3F66A 4QMQA 4BBFA 2BDJA 2WHBA 3QHWA 4BZDA 4M7IA 3WIGA 3W8QA 4CKIA 4MHAA 2UW7A 3QFVA 3KXMA 4I3ZA 5HKMA 5GHVA 4CZYB 1OL2A 2CLQA 1UNHA 2EXMA 2VD5A 3KGAA 3BU3A 3ZO1A 5DI1A 1LEWA 4YJUA 2PUNA 4GG5A 4WBBB 4HYIA 4AE9A 4A06A 3GCUA 1CKPA 4IAIA 3JY0A 3TV4A 3ZLXA 4CKJA 3WZDA 2XALA 4BJJA 4QNYA 2XM8A 4KS7A 4GFGA 2V55A 2CN8A 4GUBA 1IR3A 1PMEA 2C47A 3HLLA 5H3QA 3TUCA 3FI8A 3O7LD 2GNIA 3R01A 4RIWA 4BBEA 3ULIA 4DBXA 5AUWA 3FL4A 2CKEA 3QA0A 3RMFA 2RG6A 2UW6A 4PPBA 4XJ0A 2I0VA 5EYDA 3RAKA 1OIQA 4YUQA 3KRWA 4QTCA 2ACXA 5D11A 2JEDA 3WF7A 2R3NA 5HTBA 3SLSA 4FEWA 3ATTA 3TACA 2ZMCA 3U9NA 3HDNA 3LJ0A 5A4QA 1FVRA 3MS9A 4CV8A 3HA8A 5C03A 3PXZA 5BVNA 5HE1A 4F9CA 3WARA 3G0FA 3WYYA 4H58A 4P5ZA 5LVPA 2BZIB 4QP9A 4ASDA 1GZ8A 4I5MA 3OF0A 3QYWA 5DPVA 2HYYA 3BELA 3QD3A 4YLKA 3TNIA 3GVUA 4AGCA 4G5PA 2FSTX 3BYVA 3DY7A 3W10A 4C0TA 3UVPA 4C59A 4F9YA 4AQKA 3BL9A 1MRVA 1P14A 3TL8A 4X6QC 4YBKA 5L8LA 2J0IA 1AGWA 2VO7A 3TG1A 2BIKB 2CJMA 4PMMA 5C9CA 3TIYA 3UOKA 3VW6A 1OBDA 2FYSA 3PUFC 5HCXA 5A46A 3UVQA 4MK0A 4K11A 2JGZA 3O8UA 4WG4A 3FY2A 4C34A 4USFA 4TWOA 2OIDA 3H0ZA 4UMQA 4D2PA 5KKRB 2X39A 3U54A 3QQGA 3F7WA 3KRJA 1U4DA 3AMAA 2BRGA 1UVRA 1YHWA 3UOLA 4HPUE 2E9PA 3PVBA 5M06A 1I44A 2G2IA 5LWNA 3QRTA 4GK3A 1XH8A 1UU9A 2Y4IC 5FEDA 5KMLA 4DGOA 1I09A 2QHMA 3W2CA 5A54A 3PJ1A 2O63A 1OVEA 4BKJA 2UW3A 5CSPA 2R0UA 2YCSA 4QQCA 2ETMA 3PVUA 2IW9A 3IDBA 4D2VA 1YQJA 4BDGA 3BLRA 3E3BX 3GXLA 4FODA 3QTSA 3GCPA 4G9CA 5AV1A 4QYFA 4D0WA 3R7VA 3RBWA 1GZNA 1SVEA 3EB0A 5FWKK 5LARA 5C8NA 1M7NA 1URWA 5HORA 2WMVA 3SHEA 3UJGA 4IE9A 4FX3A 3U51A 2R7BA 3EN9A 1MRYA 5DA3A 4MAOA 4DEGA 4G3DA 3ACKA 3JUHA 4GS6A 2Z7LA 4TY1A 3QRUA 2YA9A 4FV3A 4G5JA 3VBWA 4B4LA 4FEQA 4RFYA 5C1QB 1J7LA 4AN3A 3EFWA 4D0XA 1H0VA 4L68A 3VVHA 1UWHA 4R6VA 2BR1A 3ORLA 3PG3A 5T6KA 2WTWA 4E73A 2X9FA 2GPHA 2BDWA 3HAMA 1MUOA 5B2MA 5LWMA 4XH6A 2OXYA 4FA2A 5L6PA 4XP2A 1ZZ2A 2B54A 1L8TA 5C01A 2B7AA 3C4EA 3KXZA 4S31A 2XBAA 3EKNA 2C1BA 4OTQA 4DHJA 5BV3A 3NZ0A 4G3FA 3UIUA 4DBNA 1MP8A 4J7BA 2B9JA 4LUDA 4RWJA 2XKFA 4EH9A 1FINA 3MYGA 5HBJA 4EKLA 4FV0A 2YM6A 3NPCA 3R21A 2CDZA 5HGIA 2WMUA 1IG1A 4U44A 3FC2A 4CTCA 3QA8A 4F1OA 2OO8X 4ZIMA 4IM0A 3LQ5A 4QTBA 5HX8A 4KD1A 4G6LA 1B6CB 2X2LA 4RIXB 1OIYA 1ERKA 3Q60A 1Q97A 3FI2A 3I7CA 1JQHA 3IPHA 4FYOA 2H9VA 4YTHA 3HMPA 4FIFA 4RVKA 4O2PA 2JDSA 2JDRA 1JKTA 3FMMA 4FTRA 4LUEA 1G8KA 3WZUA 4UV0A 3G9LX 3WE4A 5EW9A 2V62A 4GUEA 4KB8A 2ITUA 2WIHA 3AGLA 1ZOEA 3QWKA 4RZVA 3R8LA 3KCFA 4E1ZA 4U8ZA 4JS8A 4XG6A 2ZB1A 2JFMA 3BYSA 4XBRA 4ZSGA 4PX6A 3OWKA 4CZTA 4MNEB 3U6IA 4FTTA 3HUBA 3QTWA 5CZHA 2OWBA 3FC1X 3KKVA 3Q96A 3HRCA 4CFMA 1IA9A 3R04A 4KBCA 5DGZA 5E8TA 5I0BA 2QR8A 3ZLYA 3PJCA 3RPSA 3DZOA 4PMPA 2F2CB 4GT3A 2PWLA 2BHEA 2C68A 2UZDA 4L45A 4D1XA 2VO3A 1K2PA 3QZFA 2ITVA 2Z60A 4PNIA 2YLFA 5J5SA 4YZBA 4E20A 2LGCA 2BDFA 4QP6A 4ZK5A 4G9RA 5CASA 3BI6A 3EQHA 3TWJA 5CSWA 3DAEA 4Y95A 1RQQA 4DC2A 3GI3A 1QPDA 5LQFA 4MBIA 4QMYA 1WVWA 4IACA 3U4WA 2HY0A 4ZSEA 3HNGA 4EK6A 2ZM1A 5ACBC 1KE9A 4FT9A 5L8KA 2YM8A 4I0TA 3CP9A 3LCTA 4GFOA 2AC3A 4RFZA 4IADA 2JITA 3IOKA 4WKQA 2W4JA 3QBNA 4AOIA 3LLAA 5IPJA 4J1RA 4QMTA 4ZTLA 5GZ8A 4AFJA 3FY0A 4S34A 3MVLA 5KUPA 3C5IA 3EOCA 1GIIA 4FUYA 2G01A 3O0GA 4BIDA 4DFXE 4EH4A 3FMNA 3OCSA 2GDOA 5HCYA 1B38A 5HO6A 3RAWA 3SXSA 3ZUUA 4EC8A 4FJVA 2RSVA 3HDMA 3ZXTA 2PL0A 3I5NA 2ZV9A 5D9HA 3TZMA 3VQHA 4BCOA 2XNPA 3OY3A 1ZAOA 4E93A 4UWBA 4E6QA 4IJ9A 2C6IA 4M15A 2LAVA 5K0XA 1WBOA 1XO2B 3COHA 1OGYA 3O23A 5J7HA 3LFBA 2VTMA 4LGGA 3ZHPC 3IDCA 3RK7A 3ZC5A 2GU8A 3TCPA 4JDKA 4AXAA 4OTHA 4LOOA 3NNWA 2XYUA 5TF9A 3HV3A 1STCE 4D55A 5IH5A 5HQ0A 1W98A 2WIPA 3RKBA 2R3FA 4DN5A 4FT5A 4G3EA 4U5JA 1P5EA 3R9NA 1H00A 2J0KA 4O1OA 4BWXA 3RALA 3VUDA 5LVMA 3LFDA 4GIHA 2PE2A 4FZAB 1U5QA 5HTIA 5HU9A 4IX4A 1DI9A 4WIHA 4CFNA 3LQ3A 4NL0A 3C5UA 4NWMA 4O0SA 5AP5A 1PXKA 5IEYA 3VBYA 3FLWA 4DCAA 3RZBA 4C3PA 5AEPA 3EN5A 5FG8A 3IK3A 1YVJA 2PVNA 3JPVA 3LE6A 5AX9A 3UO4A 4FKOA 5FM2A 4FV6A 2XNEA 4ALWA 4R77A 1OI9A 4YGAA 5FDPA 1KE8A 3OT3A 4YU2A 4FNXA 4W4VA 5GZ9A 3SQQA 3IECA 2Z2WA 2Z7QA 4YR8A 2UVXA 2J5FA 1H25A 2ITTA 5B2LA 1NVRA 2X7OA 3CGFA 1R0PA 3KEXA 5AA8A 2DQ7X 3UO6A 4I21A 2PZPA 3EQRA 3ZUVA 2B0QA 4TT7A 4RWLA 4QRCA 4CFWA 4LG4A 4CT1A 4Y5QA 4EOMA 4D2WA 4F09A 4KABA 3UP2A 3GC8A 3FWQA 3NIZA 4CSVA 4NT4A 4G3CA 2XJ0A 5E8UA 3E87A 4WG3A 3BKBA 3VUTA 2QKRA 2B55A 1TQIA 3IQ7A 2XIKA 3F6XA 4DT8A 2ONLC 1GIHA 3DJ7A 3UOHA 2JDVA 3F5XA 2XAMA 3QCXA 3QTQA 3NEWA 3F3UA 3TXOA 4DH3A 2XZSA 1JOWB 4XUFA 3U87A 2A2AA 2QONA 4UYAA 5K5NA 4O7YA 2XIZA 4L52A 4TYHB 4PDYA 2PTKA 3UPZA 1FMKA 2WOUA 4CLJA 1XH5A 4P5QA 3SW4A 2ZV2A 3S2PA 5J7BA 2IVTA 4XYFA 4GK2A 3U6HA 3V6RA 4PNKA 5JFVA 1GZOA 3PP0A 4I6BA 1Q62A 3UZRA 3E5AA 5HIEA 4L67A 2WMXA 4BN1A 3O7LB 4GJ3A 4E4MA 3PXYA 4XRJA 5ANEA 5KCVA 4LOPA 3FLQA 3WBLA 3QC9A 4GSBA 3TV6A 3PY0A 4XG3A 1J1CA 2OJGA 3AC3A 3AXWA 3U9CA 3VS1A 4EOIA 3FYKX 4XG9A 4K0YA 5E8XA 4PV0A 5M44A 1ZWSA 3VONA 4H1JA 4YNEA 1OKYA 2PVMA 2GHGA 1Q41A 3H9OA 3UTOA 4EZ5A 2ONLA 1NA7A 1UV5A 5DEYA 3R9DA 2UZVA 4FUXA 3P1AA 1Q8ZA 4YJNA 4FSMA 1H26A 1CSNA 1XBBA 4R1YA 2VRXA 4U0IA 3F82A 4B6LA 4QMPA 1U46A 3DXPA 3DNDA 3LM0A 4I0SA 2A27A 3CR0A 4F99A 3BBTB 4YJSA 5AM6A 4BCJA 5IU2A 5JGDA 3UDZA 3CD8A 4R7BA 4JOAA 3TNPC 2UW0A 3AMYA 2BIYA 4FL1A 3W0RA 3RK9A 4AAAA 3E92A 1CDKA 2YM4A 3TTIA 2BRNA 4JQ7A 4O7RA 1W84A 2W4OA 4QP7A 4QP8A 5DRBA 3DKOA 3EN6A 4QD6A 1DS5A 2XF0A 4BDBA 4HVDA 5FEEA 1G8JA 3EH9A 3GT8A 3PVGA 3KXNA 4YJRA 5ETCA 3R7YA 3C13A 2C6LA 4FV7A 3MY5A 4UMUA 4JRNA 2QU5A 4ANQA 1ZYJA 2OI4X 4ACMA 3E8NA 4MH7A 1VEBA 4WSYA 2YHVA 2C6MA 4QOXA 4YZ9A 4ANLA 1J1BA 2PVRA 4M84A 3CLYA 2OIBA 5CEKA 2OZAB 1ZY4A 4MD9E 1K3AA 3OFMA 1OL5A 3FMLA 4YBJA 4CZUA 5AMNA 4IVBA 5I3RA 3ETAA 5AUYA 4ZP5A 1FGKA 3FQSA 4UALA 1XBCA 4KKGA 4BY9E 1FPUA 2C1AA 1M2QA 4WT6A 3BHYA 2XK3A 4BDKA 1OGUA 4DEAA 4AZSA 4AQCA 4F9BA 4BDAA 4BCIA 3SRVA 3DDQA 2X81A 4TWCA 3R83A 2NNWB 2IW6A 3CPBA 3CXWA 3OTVA 3CEKA 4MKCA 3S1HA 2I6LA 5EYCA 3DLSA 4IBMA 4NTTA 5I5ZA 3W0NA 5EOLA 4EH5A 4AXEA 1E1VA 1VYZA 4IW0A 4QPSA 3W2OA 4TYGA 5BUEA 2RFSA 4HCTA 5AX3A 5BPYA 2OSCA 1YXTA 2JFLA 4TYIA 1YOJA 2QCSA 1R39A 4IFGA 3VWAA 1XHAA 3V8TA 4EONA 5M4CA 3QRIA 5C4KA 2W1GA 4PPCA 4UZHA 3GCSA 4ITIA 4PF4A 3MW1A 1BI8A 3D7ZA 1Q24A 3OCTA 3RNIA 4M13A 3LIJA 4MWIA 4GJ2A 4C2WA 3ZZEA 4EBWA 3ZRLA 3JR1A 2HXLA 4RJ4A 1T46A 2WO6A 4C2VA 2RKUA 3QALE 4X21A 3I60A 3F9NA 2CGVA 2YM7A 5HCZA 4OUCA 1JKSA 4TTHB 3L8PA 4DEHA 4FE2A 4OTWA 4ZOGA 2GNFA 4LM5A 1BI7A 3ZZWA 3G0EA 2V22A 5IA1A 5CANA 5HIDA 4LGHA 4FTJA 1FVVA 3QQUA 5AUZA 3S3IA 4EJNA 3ZRKA 2V5QA 3LFQA 2QOOA 5H8GA 4Z3VA 3C4XA 3NS9A 4OTDA 5DN3A 3U8WA 3R73A 5FLFA 3W0MA 2VTLA 4PPAA 1OIRA 4QP3A 4AGWA 3D2IA 3VBTA 2CSNA 2VWVA 3W33A 3A8XA 2WMRA 3UIMA 5H2UA 1TVOA 4RJ3A 4RGJA 4K1BA 3F7ZA 5EM5A 3ZRMA 4O81A 3WZJA 3LOKA 1PYEA 4DT9A 3V5QA 3VF8A 3OOGA 4RVLA 4DLJA 2YEXA 3NDMA 5M4UA 4WOVA 4O86A 3LFFA 4HZSA 5C4LA 5FRIA 2C0IA 4GVAA 4HNIA 1OKVA 5K3YA 4FSQA 3BE2A 4LL0A 5HD4A 3BGQA 3ORNA 4ZSAA 3ZU7A 2P4IA 5HVKA 1NVQA 1P4OA 2VNWA 3ZFXA 5DMZA 5JZJA 1NW1A 3NYNA 3OC1A 1V1KA 1HCLA 3AC2A 3CIKA 3CQWA 2IG7A 2XB7A 5D7AA 3ET7A 5KNJA 3NAXA 1X8BA 3FQEA 3FMDA 3MI9A 3SG8A 3RHKA 4N6ZA 4YJPA 1F3MC 3F88A 3A99A 3F2NA 2XKEA 3KQ7A 4O4CA 3ZSGA 3UQGA 4E4LA 4TWPA 2ETRA 4L42A 3GNIB 4ZAUA 2YDKA 2QO9A 2GSFA 3AOXA 4PMTA 4EWHA 3R00A 3OZ6A 4JG7A 4BTFA 4QO9A 3L8VA 4TN6A 4FSUA 4BDHA 1JSTA 3VBXA 3O50A 4I4FA 1EH4A 5DT4A 2PY3A 3T3UA 3CPCA 5FBNC 4L3JA 1PY5A 4KBKA 4J98A 1YW2A 4ANOA 3ODYX 4BDFA 1CKIA 4E6DA 3BLQA 4FTNA 2OF4A 4J95A 1GY3A 3F5UA 4ITHA 4CRSA 3HEGA 4DDGA 5J87A 3A2CA 4M69B 4AUAA 3CCNA 4YHTA 5K9IA 3CY2A 3I0QA 1ZRZA 4FKJA 1YXUA 4KUJA 3FYJX 3C51A 3UG1A 3OWJA 4IB5A 4FTUA 2ZJWA 2IVUA 4X3FB 3DZQA 4YZMA