2ETRA

Crystal structure of rock i bound to y-27632
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
400
structure length
400
Chain Sequence
SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 1
publication title The Structure of Dimeric ROCK I Reveals the Mechanism for Ligand Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 121
structure length 400
sequence length 400
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2etrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2etrA01
4IDTA 2UZVA 4GW8A 1JSUA 2EXMA 4Y72A 4ZS4A 3VS0A 3JYAA 4BBMA 5KMMA 3AD6A 1M52A 3KULB 5HE3A 2PVYA 2X8DA 4IMYA 3GT8A 4QMOA 3RPRA 5C9CA 4A9TA 5C27A 4CEGA 5CLPA 4EKLA 4BDGA 3C0HA 2J4ZA 3QRIA 3CSVA 2GFSA 3CC6A 4FTLA 4EOPA 1ND4A 3PVGA 3PXYA 2DYLA 4MXAA 5HIBA 3QZIA 2QI8A 4IH8A 4ACDA 4NYEA 1I44A 5IU2A 3EQBA 4Y95A 2W06A 3QXPA 3FY2A 3NAYA 3OP5A 1WAKA 2O2UA 3DFAA 5IQBA 2A19B 3EQFA 5JRQA 1PHKA 3DTWA 3UYTA 2X6EA 4WNPA 2ZDUA 1IR3A 1U4DA 1XKKA 2Y7JA 4MBIA 5E8SA 1CKPA 3HRCA 3OW3A 3NUYA 4LL5A 1QPCA 4WG3A 3VQHA 3VWAA 4BGQA 1K9AA 2G01A 3BBWA 3KU2A 3QD3A 4HYIA 3AMAA 3RI1A 4C57A 3P4KA 3QALE 4UZHA 5F1ZA 1PXPA 5CU0A 4ANOA 4BHNA 2O63A 5B2LA 5LMKC 3LFAA 5BVKA 2RKUA 3ZRMA 2HZ0A 1NVQA 3G6GA 4L3JA 2HELA 3Q6UA 4QMTA 4X2NA 3LFFA 5DBXA 4ENXA 3ATTA 5CYIA 5CSHA 3KN6A 3MB7A 3R7YA 4L43A 4H1JA 4BKJA 3TZMA 3GP0A 3PIZA 3FHRA 4DH5A 1W0XC 3QTSA 2PVJA 1CKJA 1ZOGA 2PHKA 5AM6A 4CFVA 1V1KA 3IQ7A 3R8MA 4A9SA 3G90X 2GNHA 4K6ZA 5BQ0A 5AFVA 1GIHA 3EKNA 2PVNA 2CGXA 3CY3A 2R2PA 3FSFA 3OBJA 4YNEA 4NJ3A 4ACGA 4C62A 5B7VA 4I6QA 2B53A 5HU3A 4CV9A 3ZO4A 5M4UA 2G2IA 4WT6A 3NNXA 2UZWE 4HZRA 2GPHA 4M0YA 4NZWB 4AUAA 1OBGA 4I6HA 4GT3A 4AOIA 2C5VA 5I5ZA 3CCNA 5J1WA 1A48A 3LLAA 5LJJA 3LCOA 3R02A 3BIZA 4RIOA 3GCUA 3I0QA 3VW6A 4EK3A 3WBLA 2VV9A 3KGAA 5FGKA 2CSNA 3PP1A 4EI4A 3QTUA 3Q4TA 4F09A 3PA5A 1JKLA 2BVAA 5HG8A 4BN1A 2AYPA 4DC2A 3VC4A 3EB0A 3V8SA 2VWYA 3CIKA 3G9NA 2OJIA 4ZZMA 4DCAA 3CGFA 2C6OA 4F6UA 3U6JA 2X39A 4W4WA 1FQ1B 3L9MA 2R7IA 5L8KA 4O7YA 4O2ZA 4EZ3A 4OT6A 2X6DA 3SD0A 2RFSA 2AUHA 4C61A 2ZJWA 5K3YA 2OJFE 4C33A 2I0YA 4XG8A 3W8QA 2H9VA 4FTJA 4IAIA 2VZ6A 3MESA 3VBYA 2W1CA 4PTCA 3CP9A 3DY7A 3UMXA 4CLJA 3Q9YA 3A8WA 3OROA 4QYHA 3TACA 4DCEA 4GU9A 3FMJA 5M07A 3VUMA 5EKOA 5EOBA 3L8VA 2VTNA 2HK5A 3FQHA 3R28A 2OG8A 4N6ZA 3VUHA 4CQGA 4DINA 4E73A 4IWQA 3K3IA 4U3YA 3PJ3A 3LFQA 5JRSA 4ZSEA 5J7BA 5KX8A 1ZYCA 4RLLA 4CFXA 5CU3A 2REIA 4XG2A 3V5QA 5FEEA 2C3JA 2IO6A 4QPAA 5GZ9A 1WCCA 3C13A 4FIGA 3DOGA 3BLQA 2QC6A 4K2RA 5EH0A 2Y0AA 2XK8A 3PY3A 4E6QA 3O2MA 4X0MA 5JEBA 1NVSA 1V0PA 5DIAA 1URWA 2WTWA 1OGUA 5AMNA 2R0UA 5IEXA 2I0HA 4XMOA 2VWBA 5AUVA 3TNQB 2OU7A 3WIGA 3ITZA 2W96B 2X7OA 3D2KA 3E8CA 3F88A 3ZRLA 4BZOA 4O7ZA 4ONAA 4IIRA 4HPTE 4OT5A 3KREA 4BR3A 4BGHA 3EQGA 2VNWA 5LCJA 3UQFA 3N4TA 1S9JA 5BUJA 3KK8A 1LR4A 4EOMA 3F7WA 3KULA 3U6IA 1R78A 5LQFA 4OTPA 1RJBA 2XKCA 3CY2A 3DXNA 2KULA 4FSQA 5AUUA 5D7AA 1J7IA 2W1IA 4Z7GA 4EH3A 3GFEA 1IG1A 3JXWA 1H0VA 3R7GA 2WMSA 3ANQA 3DK6A 4KBKA 2BMCA 3THBA 3AMYA 3KKVA 3QWKA 1GIJA 4M97A 5CXZA 2OIBA 4AWIA 4C4IA 4TL0A 4ZY5A 2XM9A 2J90A 4L44A 1PY5A 4YBKA 1XH9A 3E8EA 4CMOA 3TCPA 3LJ2A 3CJGA 2R3IA 2QQ7A 3PSCA 3PY1A 4M69B 2WU6A 2VAGA 4X3JA 3RPOA 5ANIA 5T68A 2P2IA 3RWPA 3FAAA 2O64A 3QKMA 3E63A 1H1SA 5M55A 1FMKA 3DAEA 4IJ9A 1DI8A 2YN8A 1FVVA 1E1XA 2I6LA 1CTPE 3I0OA 2P2HA 2QVSE 3LQ5A 4NTSA 4ZJJA 3V3VA 3IO7A 4NM7A 3KK9A 5LVPA 1LP4A 2ITUA 4IX5A 4YURA 4H1MA 1YWNA 3O8UA 3GU5A 3ID6C 2WKMA 2J6MA 4RGJA 1ZY5A 1W8CA 4WSYA 2X4ZA 1ZY4A 4HYSA 5AWMA 4K18A 4IZ5A 2IW8A 4D9TA 1OBDA 3FL4A 5DN3A 1YOLA 4YHTA 4UXLA 2BKZA 5LWMA 1BKXA 4DYMA 4MTAA 5FM2A 4DH8A 4V01A 4JT3A 4FKUA 3W1FA 5E9EA 2BRBA 2CJMA 4IAZA 2QOIA 4HYHA 3QLFA 4IHPA 5AAEA 1TQMA 4JBPA 3QD4A 2VNYA 4NIFA 1Q62A 4R7HA 4RPVA 5HD7A 5L3AA 4FTOA 3RVGA 2PVLA 3EJ1A 4FKSA 4JL9A 4CFFA 5L8LA 3DXPA 2VTOA 3FLWA 3QHWA 4QO9A 5D12A 4U45A 3UNJA 4WHZA 1G5SA 4FTNA 2IN6A 5CEKA 3R63A 5J95A 2W4JA 5K4IA 2WAJA 4XCUA 1STCE 1QCFA 2P55A 3QA0A 1O6YA 2IVSA 4UB7A 3D2IA 4KS8A 4O7LA 4QYEA 1J1BA 2FA2A 1DS5A 1ZYLA 3EWHA 4OTHA 1FGKA 3DCVA 4O6EA 5FEQA 2ZVAA 1PKDA 5KKRB 3ORTA 4RQVA 4MF1A 1XH4A 4OGRA 3BRBA 3C51A 4APPA 5IQEA 4GUEA 4ZIMA 3NYXA 2UZEA 3BQRA 3BU3A 2YWPA 2ZAZA 3Q4ZA 3MY5A 2GNFA 1XO2B 3H3CA 2A1AB 3IGOA 2IW6A 4FT0A 4EH2A 4G3EA 2GHGA 5AUXA 3DKOA 2JKOA 5AUZA 4UY9A 1E9HA 1MRYA 3O71A 3ZEPA 4ARKA 5HTBA 4IM0A 5HE1A 4USFA 4M8TA 3HAVA 5K0KA 3H10A 3NYNA 3CR0A 2WMWA 3EYHA 4RWIA 4Y85A 3QQKA 1Q3WA 5CT0A 2VGPA 5HCXA 2F7EE 3CBLA 3QC9A 3I60A 4D4YA 3OWLA 4I21A 3WILA 1Z57A 1M17A 3DZQA 4NK9A 4BB4A 2PUPA 5AUTA 3P08A 3UQGA 3WF7A 3SA0A 4BCJA 2HXQA 4XH6A 2FUMA 3FBVA 3FLYA 1TQIA 4O0TA 5CS6A 5A4CA 5I9UA 3QQJA 3VBWA 3DFCB 4IWOA 3OHTA 4CKIA 2W1EA 1PXIA 4MVFA 4PDSA 3CPCA 3BQCA 5FXRA 4FIEA 2VUWA 5JFVA 3DGKA 4G3GA 2VTTA 4XYFA 3HL7A 2WQMA 3R2BA 5EYMA 4DEHA 4X3FA 4D4SA 2PVHA 4TYEA 3FLZA 1PXNA 4XG7A 4C0TA 4XRLA 2C4GA 4JQ7A 2GDOA 5AV3A 3ZFYA 4BTJA 4YHFA 3BYOA 1GZNA 3EH9A 3RCDA 4G6NA 4DEEA 1MRUA 5CEPA 2WO6A 1YHVA 4L46A 2R9SA 4RLKA 4RWJA 5HLPA 5ANOA 5L2IA 2ITQA 3OS3A 2CGWA 5AV1A 2OJGA 3VUGA 2B54A 2YERA 5TR6A 3R8LA 4A4LA 2XB7A 2XJ1A 4FT9A 4G17A 2IJMA 3LHJA 2OXXA 3ZLYA 4B99A 3RAWA 2GHLA 4OR5A 3RK7A 2W4OA 3W33A 3O7LD 5CSVA 4CCBA 3ZO3A 4JXFA 3PZEA 2R3RA 4H05A 1Y6AA 3DBCA 2W5BA 4YBJA 3RGFA 4CGAA 4R7IA 3EQHA 4ZTHA 4PDOA 1IAJA 3V8TA 4MBJA 4AN2A 2F57A 2BRNA 3PFQA 4BDDA 4O96A 3C4WA 4I22A 4G5PA 3B8QA 4IZAA 4JDHA 4E20A 1IAHA 3R9RA 4F63A 1WBSA 2XRUA 4CT2A 3VQUA 3Q32A 5FEDA 2YIXA 4J98A 1VZOA 1YDSE 3JR1A 3PVBA 2YIWA 3R1QA 4AACA 4JR3A 1H08A 4ASZA 1QPJA 2WQEA 4Z7HA 4FVQA 4FV7A 2V5QA 4I94A 4XG6A 5JT2A 2HY0A 3MDYA 4LMNA 4B7TA 4RIYA 2BR1A 4II5A 4DEDA 2JFLA 3P1AA 3NNUA 1W7HA 5AR7A 3CQEA 3RM6A 5CEMA 4CYIA 4OTDA 3GENA 2OI4X 4IAKA 5CAVA 4PDPA 2UZNA 4HGTA 2BZHB 4FK6A 4U41A 2WMTA 3JY0A 4UWCA 4EK5A 2R3OA 2RFNA 4CFUA 1H24A 4CTBA 3AT2A 4K9YA 3Q52A 2WTDA 3DPKA 3G9LX 4EQCA 1W83A 4F6SA 5HTIA 5A6NA 5ANDA 2C5YA 4O1PA 4AN3A 2WIPA 3QQFA 3DJ6A 2WTKB 1F5QA 4DFBA 1LPUA 4M67A 3PRIA 1KOBA 2BFXA 4OW8A 3AGMA 3KMMA 4M13A 1UU7A 4GS6A 5F20A 4RX5A 5CASA 3GOKA 1MUOA 4H39A 2WB8A 3LLTA 1CMKE 2WPAA 3FZSA 2VTMA 2BTRA 4O0RA 3DK3A 3VS4A 3ATSA 4FNYA 4YTCA 4FIIA 2W5AA 2ERKA 3MVMA 2PMIA 5E8WA 4O2PA 3R8UA 5E1EA 5H8GA 3CXWA 1UU8A 4X6QC 1JNKA 3H4JA 3NVKI 2PZ5A 1K2PA 4HYUA 4F65A 4E4MA 4LRJA 4V04A 3U6HA 5EI8A 5JFWA 3G51A 4ZZNA 1XH7A 4LUEA 5GINE 1YDTE 1OIRA 3EMGA 3HV6A 2F4JA 4F1MA 4OBQA 3H9FA 5CSXA 4P90A 1B39A 5AV2A 4Q5EA 2ZB1A 5FP5A 1CDKA 2YA9A 3NCGA 4CTCA 3F3UA 3PE1A 3ZZEA 3MH0A 4IWPA 5HCYA 3V6SA 4G31A 4BCPA 1H26A 2YABA 3Q9XA 4TPTA 5IQHA 5HICA 2IPXA 4D1ZA 2W9FB 3A2CA 3PG3A 5AUWA 4L45A 3PUPA 2VD5A 3H9RA 3PIXA 2J5EA 3WYXA 3F9NA 3HGKA 4KSPA 4CNHA 3GVUA 4I3ZA 2PY3A 4X2JA 4FSWA 5TT7A 4JQEA 2QU6A 3TV4A 2PZIA 2EVAA 1BX6A 4PUZA 4R8QA 3OXIA 4BIDA 1JSTA 4X6RA 2QOFA 4PL5A 4DGGA 5FP6A 3LPBA 4K0YA 4NFNA 4WRSA 2ONLA 4RX9A 3WZEA 4Z16A 2SRCA 4H3PA 2J51A 2JFMA 4FTIA 1PMEA 4YLKA 3EQPA 3PE2A 1R0EA 4O7WA 3K3JA 4F0GA 5D7VA 5IQDA 4UMRA 4FSTA 4KAOA 4YO4A 4L52A 3R1YA 3AT4A 2BTSA 3F2AA 4FC0A 4K8AA 2J9MA 3UGCA 4R5SA 4R7BA 4FKGA 2PE1A 3ROCA 3FI8A 4RJ4A 1L8TA 2X81A 3R73A 3C4ZA 4FOCA 2ZM4A 4B0GA 5BNJA 1RQQA 3SHEA 3BYVA 3M2WA 3RJCA 2WOUA 2JBOA 4AGUA 4DGMA 5LVLA 4NWMA 2YM8A 2A2AA 5KCVA 3AOXA 3CJFA 3GQLA 3UBDA 4KKHA 4NL0A 5J9LA 2PULA 3FJQE 4PPAA 3RCJA 2ITNA 3FE3A 2OGVA 5EFQA 1PXMA 2RSVA 4C59A 3LMHA 5E91A 3QUDA 2OKRA 3QYZA 4YSMA 4E5AX 1E1VA 3UG2A 4F0FA 3ERKA 3ANRA 2RL5A 4V05A 2JDOA 1PJKA 3COMA 4KBAA 2ZV7A 3HV4A 2EWAA 1KE6A 3F2RA 5LCKA 5IQGA 3GU7A 2RG6A 4YR8A 5IUHA 4FZDB 2JDVA 3M42A 4BCMA 5IQAA 1FOTA 4BCIA 2J2IB 3DBQA 4PV0A 3C1XA 4YZBA 5HOAA 5TKDA 3VS3A 3PA3A 2YACA 2ETRA 1HCLA 3F3WA 4PNIA 4G3DA 2BUJA 4BI2A 4IX4A 3FZ1A 4R3RA 1GZOA 3BGZA 4QMPA 4FSZA 4IBMA 2JD5A 3BV2A 1WBTA 5CI6A 4J96A 4YTHA 3WZJA 3AQVA 4O21A 4BTMA 3OOMA 4XOZA 4O86A 4MQ1A 3DQWA 3DKFA 3FMKA 3HA8A 4FG9A 1FVRA 5B2MA 3W55A 4HW7A 4ZAUA 3F5PA 4AOTA 2PVKA 2YDKA 1SVGA 3RBWA 4GYIA 2XNOA 4DA5A 2YIRA 2WGJA 3WE8A 1Q41A 2VO3A 4MAOA 4EHVA 3N9XA 3VBXA 3I79A 5J9YA 4C3RA 3ZO2A 4IVCA 4CFNA 2XNMA 4DT9A 4FICA 4U5JA 3ENMA 4K11A 1BL7A 4U42A 5HO6A 4C4HA 2JLDA 3CS9A 5EDPA 1NW1A 4FG8A 5CAPA 1SVHA 4EH4A 1A9UA 2WTIA 3PY0A 4DEAA 4R77A 3ZO1A 5HZNA 1PXKA 2OZAA 2BRGA 3IONA 5CF8A 3MIYA 3OBGA 2IZSA 3EL8A 1VYWA 4FSYA 2BZKB 3UP2A 3LJ1A 3LIJA 4M3QA 3RK5A 3ZONA 5BX0A 3VW8A 4KKGA 5ITAA 4XG9A 3UODA 3OCSA 5EM6A 4DF3A 4KA3A 3POOA 5DE2A 4I0SA 5BUEA 1OVEA 1OKYA 1Q3DA 3NLBA 3LXPA 4S31A 5CT7A 3BWFA 3BHTA 2CNVA 5I9ZA 3QCSA 3QXOA 3R01A 5K4JA 3MI9A 5D9HA 3CQUA 1UKIA 2VO7A 4BWXA 2CDZA 2HCKA 3P78A 4BZNA 3NUAA 5AV0A 3MVHA 4XX9A 1PMUA 3UPXA 4CKRA 1PW2A 2CCHA 4PDYA 2ACXA 4P5ZA 1ATPE 1SNXA 3NWWA 3KF4A 3MB6A 3R9OA 4BCNA 4MEDA 3E7OA 5I3RA 4PY1A 4ANSA 5IEYA 2UW4A 3R22A 4MHAA 2QHMA 2C6IA 2B1PA 4YJOA 4EBWA 1H28A 5KBQA 5H9BA 5LMKA 5CAOA 4L00A 4QP6A 5M56A 3ZC5A 3JUHA 4DGLC 1GOLA 3ZLSA 2YFXA 2RF9A 4A4XA 4BDKA 2JBPA 4FEUA 3KVWA 1JOWB 3NDMA 4O6LA 2WQBA 3ZCLA 3O7LB 3UJGA 5BVNA 5HG9A 3A61A 4EUUA 1V0BA 2YLFA 2EB3A 3LVPA 2BALA 4YTIA 5EW9A 1S9IA 2BRHA 4EH8A 5KNJA 2IZTA 3SG9A 1BI8A 4KIKA 3P7BA 3VBTA 5LVNA 3BHUA 2QCSA 3QAME 1YI3A 3G2FA 4I24A 5K0XA 2UV2A 3EQIA 3UIXA 1J1CA 1H07A 4U79A 3UTOA 3PXFA 3SRVA 4MX9A 4L68A 2WTCA 1IA9A 2WQOA 3ZTXA 5E8YA 2XRWA 4OUCA 3HMOA 3KL8A 5LARA 2YM3A 3PPJA 3E3BX 5HO7A 3EFLA 2CHLA 4FTAA 1UNGA 3W2QA 5I9XA 5IPJA 4ZJIA 4FSRA 2PK9A 2XBAA 4GT4A 2BAKA 3IDPA 4MD8E 5BMSA 4CCUA 5M08A 5G6VA 3UC4A 1OIQA 4W9XA 4DTKA 1NA7A 1WZYA 4G5JA 4O0XA 2YZAA 3DZOA 4IM3A 3ACJA 2QNJA 1JWHA 3LXKA 2PMLX 4R6VA 5GJFA 3W8LA 2JDTA 4LOOA 2XBJA 2C3IB 3DS6A 5A4QA 3V5JA 4F7LA 3NMUF 5JZJA 2P33A 3D14A 3PRFA 2X9FA 3M11A 5E8ZA 4U8ZA 2PUNA 3MFSA 5HE0A 5M4IA 4IJPA 3Q4UA 5HIDA 1KUTA 1TVOA 4FI1A 5C1QB 2X0GA 4DFUA 5HBEA 4FTKA 4AU8A 5CNNA 4OTRA 4TYJA 5LVOA 1KE7A 1UWHA 3E8NA 2G15A 2HXLA 2VWUA 4FV0A 5L2QA 3F3VA 2J7TA 3D4QA 1FBNA 4BHZA 1SYKA 2C69A 3W10A 4S34A 3R21A 3R71A 4BCHA 3NGAA 3DKCA 4K1BA 2GU8A 3I7BA 4XOYA 2RGPA 4GYGA 5HX6A 2GMXA 2E9UA 4BCQA 4EBVA 4N57A 4U80A 3DU8A 3MTFA 3SLSA 2Z8CA 2DUVA 4OBPA 3B2TA 5BUIA 3NUXA 4FKWA 4IAAA 3WF5A 1BL6A 2JIUA 2W17A 2Y4IB 3A4PA 3POZA 4ALUA 4MXYA 4NIFB 1XBCA 1VEBA 2H34A 3A7JA 4Y83A 4YJUA 3SXRA 5KBRA 3WF6A 4EEVA 3R2YA 2VTHA 3KY2A 1NVRA 3D5WA 2PWLA 4JDKA 4MH7A 4YJTA 4L3PA 4FTCA 3R7OA 2QOQA 4UYNA 3UYSA 5DT4A 5BYZA 5EHYA 5L2WA 2W1HA 3QL8A 4GKIA 3DTCA 1XH5A 3BKBA 4MXZA 4Z55A 4BICA 4ZSAA 1SVEA 2ESMA 2B9FA 4YZCA 5LMAA 3FI4A 4BF2A 4RMZA 2JAVA 2Z02A 5M4CA 4GG5A 5CF5A 3FY0A 4IACA 5FWKK 4CRSA 4B8MA 4C2WA 2B0QA 2XM8A 4ERWA 3MFTA 5E4HA 4L01A 2WMVA 2R3NA 3CQWA 1GJOA 1SM2A 3FWQA 3PXKA 1OZ1A 2QO2A 4IFGA 4UALA 4XJ0A 3CE3A 2QOKA 2X8EA 3QRKA 4IVDA 1OUKA 2XMYA 3EZVA 4KIQA 3PTGA 3WZUA 3P5KA 3ZRKA 5FDPA 2Y8OA 4FV3A 4QP4A 3IS5A 3RAIA 1SZMA 3P7CA 4XG4A 2JKMA 5DR9A 3MN3A 4QRCA 3ZYAA 4F9BA 5DT3A 3TJDA 3DNDA 4AOJA 2B9IA 2OJ9A 4QMMA 5C4LA 5KMOA 2VWWA 2NNWB 5FXQA 4F64A 1GNGA 5IA0A 3GB2A 4EC8A 1LEZA 5E8UA 3RPSA 3WF9A 1OL1A 3QZHA 5DGZA 5AR2A 4GH2A 4QYGA 5CNOA 5E8VA 2LAVA 5KUPA 3I5ZA 1QMZA 5CU6A 3UZPA 3NCZA 2E9NA 4FV6A 3R83A 4BDFA 5C8KA 4BDIA 4DBXA 3FXZA 4EH5A 1KE9A 4H3BA 3HDMA 4F4PA 3F61A 3ORXA 2PUUA 1YRPA 4AF3A 4E6AA 3GQIA 3E87A 3MVLA 3O23A 4MXXA 5IISA 4X3FB 3HV7A 1P4FA 2WEIA 3MW1A 3R9NA 1L3RE 2G9XA 3DT1A 3Q6WA 3R00A 5CAQA 3PXQA 1QPEA 2WTVA 4D9UA 2VX3A 2HIWA 5JH6A 5CSPA 2YIQA 5KO1A 2Q83A 4R5YA 3D83A 4TNBA 3ALNA 5AP5A 4BY9E 3NYVA 4P5QA 3MIAA 4N70A 3GC0A 5IA4A 4FEXA 5DLSA 3NAXA 4WNOA 1RW8A 1Y8GA 3QZGA 4JS8A 2VGOA 2JC6A 1B38A 2XCHA 4QD6A 3Q53A 4U40A 4F9AA 3UO5A 1H1QA 4PTEA 4MCVA 4TWCA 4QQTA 5EG3A 4UMUA 3L8SA 3NUNA 4LMUA 3F82A 4NW5A 3RZFA 1YOJA 4G6LA 3VS6A 3QYWA 2JITA 5CALA 2UW5A 3PJ8A 1XH8A 2XNBA 4JAIA 2XJ0A 4HCTA 5DH3A 3AC4A 3SW4A 4TZRA 1U5RA 2XNNA 1GZKA 2WEVA 3LXNA 4U44A 5DG5A 5M09A 3DA6A 4ANLA 3F5GA 1ZOEA 3ODYX 4E4NA 3HP5A 5BVOA 4EL9A 1TQPA 1DI9A 3LFBA 1BI7A 4JNWA 2OH0E 2PVMA 4QT1A 3CKXA 5IUIA 3G6HA 3R1NA 3A7IA 5KHXA 4M84A 4RIYB 4XHKB 3IW7A 5J87A 5IZFA 4OLIA 3NW7A 2YCRA 1OB3A 3GU6A 3M1SA 4WOVA 4AX8A 3MGYA 4BFMA 4DEBA 4E4LA 2J5FA 4ZOGA 3BV3A 3Q5IA 4LOQA 2HZNA 5G1XA 4EOIA 3C50A 5FTGA 4IDVA 3H9OA 4GIHA 1PF8A 2ZV2A 4G9CA 4ZP5A 4O81A 4C02A 3FUPA 2W99B 3NSZA 4GT5A 4X2FA 5CSWA 1W98A 3BWJA 4X7QA 4AZSA 5CZHA 3OFMA 3MFRA 4RQKA 2YDJA 3BYMA 5CVFA 4DG0E 1U46A 4O84A 5L6PA 5AP2A 5EKNA 3PDTA 3KRRA 4QMSA 4IX6A 4UMQA 5CU2A 3I6WA 5DR2A 4FVRA 4UMTA 3SVVA 4I5CA 3SQQA 4O0VA 3VO3A 4GVJA 5FD2A 2PTKA 4S30A 2UW0A 4FBXA 3DJ5A 4G34A 4YZMA 5ANEA 3UOKA 2C0TA 1DM2A 4NKSA 2QOHA 2RFEA 4EZ7A 2VO0A 3AGLA 4FK3A 4FE2A 1Q8UA 4E6CA 1MRVA 3QUPA 4I6FA 4QP2A 3ZH8A 1Z5MA 2YITA 5HEZA 1HCKA 5EW8A 5K5XA 3W2RA 3HX4A 3NNWA 4NFMA 5HG7A 2PU8A 5HKMA 5A6OA 4JR7A 2UZBA 4WBOA 4E8AA 4ZZOA 1JVPP 3WARA 2X2KA 3DAKA 5IQIA 5EHLA 4IM2A 2OO8X 4FIHA 1JQHA 2I0VA 3KCFA 3VF8A 4LRKA 5H8EA 4F1TA 4RVLA 5DFPA 1LUFA 4IAFA 4YLJA 3LKMA 4PMPA 3A4OX 1JKTA 5TF9A 1ZMWA 1BUHA 1FMOE 1YI6A 4K77A 4B8LA 4ALVA 5JMSA 4DITA 5FUTA 1PMNA 4B4LA 3FLNC 2OF4A 4UXQA 1OKVA 2WELA 4ANBA 1M7NA 3FZOA 4FV4A 3SW7A 2YISA 3NPCA 4GVAA 4RIXA 3VBQA 4DFXE 4FYOA 3BPRA 3TXOA 3D94A 4L9IA 2CN8A 5IA2A 2V7AA 3QQHA 4GG7A 1PKGA 3I4BA 4PMTA 4YJQA 3SV0A 4D1SA 3EFJA 3C0GA 3EYGA 3EOCA 1OL2A 1ZMVA 3FQEA 4FODA 3MV5A 5DI1A 1BLXA 3BHHA 5HNIX 4WO5A 2B52A 3DBDA 4S2ZA 5FLFA 4F99A 3C7QA 4OTIA 3R7EA 4FV9A 4AGCA 4C37A 2VX1A 4E1ZA 5HD4A 4YNOA 1YQJA 3D15A 4R1VA 3R7IA 3TDVA 3RK9A 2BROA 2YJRA 4BCFA 2W1ZA 4M68A 4J52A 5H3QA 4TYIA 4EH9A 1KSWA 4RG0A 4AW0A 4BGGA 3NVMB 2YHVA 3G5DA 2XIYA 3NW6A 3FKNA 4GFOA 4GCJA 4MQ2A 3K5UA 4PPCA 2YAKA 4JVGA 2ITYA 1YXTA 2CKEA 5E90A 4BCGA 3GOPA 1ZZ2A 4O83A 5EOLA 1H01A 5DMZA 2XKDA 5L6OA 5KZIA 3PLSA 4CG9A 4JQ8A 4NSTA 3Q3BA 4MWIA 4PMSA 3ZFMA 4A9YA 3PPZA 4QQJA 1PRYA 1ZWSA 3BEAA 5DT0A 4D2RA 1YWVA 5HI2A 1AD5A 5GZ8A 3NUSA 3ENHA 3N4VA 3UO4A 2XYUA 4ZTNA 3PPKA 2UVZA 1FPUA 4JG8A 3OG7A 4GK4A 4I0RA 4BYIA 4C2VA 1DAWA 4L7SA 4YP8A 2VX0A 4AS0A 4YJPA 4KWPA 1IEPA 4E93A 2GNIA 5ETCA 2NRUA 3Q60A 4BBFA 2JIIA 4NM5A 5GIPE 1U5QA 3UZRA 4AAAA 2JDSA 1J3HA 2VTAA 2CMWA 4QQ5A 3SOCA 2EB2A 2FO0A 2C6KA 2NPQA 4F9WA 2XIXA 4JOAA 3GCSA 4N4SA 5AX3A 5HCZA 1WBWA 4HGSA 2EUFB 3BELA 3S4QA 4IEBA 1YXXA 4C3PA 4ITJA 1XBAA 5KE0A 3HUBA 4QTDA 2IWIA 5HHWA 4DE4A 3KCKA 3VS7A 2QODA 3ROYA 4G16A 3V5WA 1OL7A 4FNXA 5CAUA 5BMMA 4BWPA 3HLLA 2QO9A 5AV4A 3NIEA 2CGUA 4FTTA 1JKKA 3E93A 3UNZA 3QD0A 5I9WA 2XK6A 4U43A 2XKEA 5TOZA 4A07A 2CN5A 4ZS0A 4FA2A 4Z9LA 3VAPA 3RHXA 4CSVA 2IZRA 3FXWA 3DXQA 4C8BA 1CM8A 4ZTLA 3EN4A 3O17A 3F7ZA 1XR1A 3MS9A 3R6XA 4FT7A 4G3CA 1CSNA 1P5EA 2B55A 3QGYA 1Q97A 3DLZA 3U54A 4OTWA 3E88A 2R5TA 2XF0A 2JGZA 5HX8A 3QTZA 5JGBA 2WTJA 3FMNA 5JQ5A 2W1FA 1KV1A 2QOLA 2H8HA 5E1SA 4O27B 4M0ZA 3WYYA 4YU2A 4B6LA 5HLWA 5HU9A 4OAVB 4FZFB 5EQPA 3HUCA 4O1OA 5F94A 4APCA 4E26A 4FGRA 2OXDA 1T46A 3QZFA 4C36A 2WMQA 3QA8A 1H27A 2VN9A 3HVCA 3B2WA 2BILB 1P2AA 5K9IA 4KRCA 2R3LA 2OZAB 2XNGA 4I5PA 2ZDTA 3TN8A 1RE8A 3BYUA 3MH3A 4WG5A 4Z3VA 1YDRE 3MPTA 4IX3A 4YGAA 5TE0A 3V5PA 4QP8A 4FL1A 5AP0A 2UVYA 4ZY4A 4TYHA 2FSOX 4X2KA 3V04A 3L9LA 2GTNA 2GTMA 3ZS5A 4AFJA 2WQNA 3EN7A 5JGDA 2NP8A 5EQYA 3QRJA 1OITA 2VWXA 3GI3A 2OJJA 4I5HA 4ZSLA 1Q5KA 4YZDA 4ZSGA 2AC3A 2ITPA 2XVDA 4MBLA 4GK2A 3IPHA 3FZTA 3OT3A 4FZ6A 3EN9A 1PYXA 4RJ6A 3BLRA 3ZHPC 2HZ4A 3BE9A 4QP3A 4J71A 3LFNA 5HBJA 4AN9A 1Z9XA 3HKOA 4HOKA 4O22A 2HY81 3TJCA 5BVFA 2O5KA 1UNHA 4EJ7A 2YEXA 2XA4A 5FBNC 1P4OA 2Z7SA 2ZV8A 3NYOA 2XIKA 4BKZA 2A27A 5GZAA 3QWJA 4AGWA 4JG7A 5IMEA 5J9ZA 3G15A 3F6XA 4FTMA 3T8OA 4CZTA 3OT8A 4WKQA 5J7HA 5CQUA 2R4BA 2FB8A 2UW9A 4GFGA 4M66A 3QHRA 3Q04A 1M2PA 2VWZA 2ZMCA 3KXXA 3TWJA 1M7QA 4UN0C 3RKBA 5AP6A 4Y8DA 5GNKA 4EOSA 4F7SA 3PLAE 2WIHA 4DT8A 1Q8ZA 5GHVA 4FG7A 4FV8A 2HENA 3EIDA 3P23A 4KIKB 3RNYA 3TIZA 4I41A 2QOOA 2UZDA 2A4LA 2QHNA 4CD0A 4DLJA 4QMQA 4BI0A 4FIFA 3HZTA 5IA3A 3SRVB 4AW1A 4MD7E 3HDNA 3W2SA 3JS2A 4GUBA 5J79A 3CTQA 4AXAA 1FINA 4NU1A 3R9HA 2R3KA 4CMTA 3DLSA 3U55A 3TNPC 4D2TA 4DHFA 2WMAA 4BIEA 2OIDA 2C6LA 4Y5QA 5HBHA 4O0SA 3VHEA 5KMIA 2I1MA 1U54B 3I5NA 3QF9A 4I6BA 4J1RA 4EKKA 3ZSIA 4DTBA 3D7TA 3TUDA 2XIRA 2H6DA 1ZYJA 2QLQA 3GGFA 4HCVA 1FVTA 4F08A 3C4EA 5I4NA 3EFWA 3DB8A 5ACBC 2BZJA 3UIBA 3ZFXA 5HORA 5HLNA 3LFSA 4FKOA 3GCQA 2J0MB 2XK9A 5DEYA 4H3QA 1RDQE 4JAJA 3O96A 4PPBA 5KMNA 2J0IA 3ZLXA 3MY1A 4XV2A 5AP4A 2JEDA 4TNDA 5CTPA 4TWPA 5I9VA 3C5IA 4QYFA 4IVAA 4U0IA 2HW6A 1UV5A 3OCGA 4FR4A 4EOJA 1PXOA 3AC2A 5E92A 3W2PA 3MH1A 4TWOA 5D41A 4AZWA 3EQCA 1YHSA 4RZWA 2W5HA 3QLGA 3FV8A 3S0OA 4JDJA 3BHYA 3W2CA 3R30A 3T3VA 3S00A 4GSBA 1PMVA 1JLUE 4FV2A 3U87A 2C3LA 2EU9A 4F7NA 3UZTA 4FVPA 2E9OA 5DRBA 3HRBA 1REKA 2X7GA 3IDCA 4U9AA 1UU9A 3EKKA 3NIZA 4FZ7A 2X1NA 3HP2A 4M7IA 2IW9A 2XP2A 4XEYA 2PPQA 1J91A 3EFKA 4ZTQA 3MYGA 1OL6A 3W16A 3VJNA 3ETAA 3COKA 4K33A 4LV5A 1QL6A 2C30A 4TXCA 4PP7A 2YM7A 4AZEA 3ODZX 4AA4A 4CKJA 4M12A 5CF4A 3FMLA 2V7OA 3FHIA 5HG5A 4C3FA 4D55A 2YM5A 3IKAA 5M44A 3OVVA 3OY3A 4J8NA 4W8DA 3OW4A 5CWZA 3DBEA 4IWDA 4RX8A 4WG4A 1BMKA 5H8BA 4EOQA 5A4TA 5KMLA 3MY0A 4FOBA 1PXJA 2BRMA 3OF0A 5CEOA 5ETFA 5TO8A 5JFXA 2X2MA 3LM0A 4I5MA 3RWQA 4IXPA 3KXZA 4QMLA 4R3CA 2C5XA 4BDBA 3SDJA 4NKAA 3II5A 4O7SA 1REJA 4YC8A 4WRGA 2I0EA 4FNWA 3VHKA 4XBRA 5BPYA 4DTAA 1APME 3S95A 2W1DA 3BYSA 3RPYA 3SXFA 3OCBA 4EQMA 4EWQA 4TY1A 3Q5ZA 2Y6MA 4QPSA 1O6LA 3BEGA 2PSQA 2P3GX 2R3MA 1SNUA 3KRLA 3PVUA 1Y91A 3Q96A 3EN6A 3A7GA 5J5SA 1G8SA 4FEVA 4QP9A 5GIOE 1ZAOA 1H4LA 4UYAA 3RP9A 4A06A 2CKQA 4FEQA 2PZPA 4NM3A 1ERKA 3D5VA 4D2PA 1W82A 4X21A 2QKWB 3KC3A 3SX9A 3KRJA 3QX4A 4D1XA 2B9JA 4AT3A 4UV0A 3C4FA 3E62A 3ORPA 4TRLA 5CY3A 3NR9A 4W9WA 4EK4A 3UQCA 1OPKA 4D28A 1WBVA 5CEQA 2CNQA 5CVHA 4LRMA 3V6RA 3FC1X 2YLEA 4YUQA 3BGQA 4QTCA 1XQZA 3QQUA 5GJGA 3B8RA 4N6YA 3DBFA 4N0SA 3FZRA 3PSDA 4I20A 5AUYA 2VTSA 5AJQA 2WMUA 1ZOHA 4LM5A 2PVFA 2O0UA 1ZRZA 2BIYA 4UWYA 4FL3A 1WVXA 2QOBA 3ULZA 3KRWA 3OOGA 3ORNA 2G2FA 4UX9A 3KF7A 3A7FA 3PZHA 5ANGA 3L8XA 4X2GA 3TTJA 2R3GA 4C38A 3CD3A 2ITVA 4RC3A 2OH4A 4UWBA 2CNUA 5AM7A 1CKIA 4QTAA 2FYSA 3O51A 2ETKA 3K5VA 3T3UA 3BLHA 3LM5A 1H1RA 2WTKC 3OTVA 3MPMA 4BWKA 3ORIA 1Q8WA 4IANA 4RFZA 4HVSA 2RG5A 3DDPA 3LZBA 1ZMUA 3ZSGA 2W4KA 3ZXTA 5A46A 5A4LA 1O6KA 4W4XA 3TKUA 5JQ8A 4WNKA 2AC5A 5BYYA 4BC6A 4FKLA 2O8YA 3UMWA 4LQMA 4ANNA 4AZTA 3E5AA 4ERKA 3FMEA 3IECA 4PTGA 4O0UA 4YSJA 3CPBA 3GU4A 5FQDC 3E8DA 4BKYA 4FNZA 5L8JA 1U54A 2WOTA 4ZTRA 3MJ2A 4I1ZA 4L42A 3ZC6A 4D5KA 3R04A 1UU3A 2JDRA 4DLIA 2ZM1A 4DGNA 3H0YA 4PF4A 4D4VA 3R8VA 4ZMEA 2VTPA 1NT2A 2XK3A 1YWRA 4PP9A 4G9RA 2J0KA 4GU6A 3N51A 1OIYA 2B9HA 5E8XA 5FG8A 5IDPA 1H8FA 3R8PA 2JKKA 4V0GB 3E7VA 4NCTA 4XV3A 4YC6A 3VS2A 5I9YA 2CKPA 3ZUUA 5EM7A 5HE2A 2JKQA 4YJRA 3WI6A 4A4OA 2UZOA 3CTJA 4KRDA 2VTLA 4D2VA 1YHWA 1NY3A 3NW5A 4GJ2A 2YM4A 2V22A 1ZXEA 3W18A 1XHAA 3L9PA 4P4CA 3VS1A 5IF1A 4DFYA 2ZV9A 3LCKA 4OTFA 4ENYA 4CV8A 1Y6BA 3ORLA 5HQ0A 2GNGA 3AD5A 2ITXA 3GUBA 4YMJA 4RFMA 4XNEA 4DGOA 2VTIA 3RHKA 4KIPA 3ZMMA 3RINA 1R39A 2C1AA 2GS6A 1Q24A 4FV5A 2R3HA 4RZVA 5J1VA 3QRTA 3QTRA 4QQCA 4FSNA 5FXSA 3UIUA 4CMUA 4DEGA 5HIEA 3BBTB 2BIKB 3PP0A 4FEWA 3TZ8A 4I0TA 2YIYA 4IW0A 2PMNX 2XH5A 2J50A 4RVMA 3FKLA 4EUTA 5AR8A 4IZ7A 3UPZA 5B2KA 3T9TA 4Y73A 5C03A 3AMBA 3PWDA 5C8MA 1GAGA 1OPLA 2C6EA 5CEIA 1ZZLA 1H00A 2UW3A 3DJ7A 4J99A 5EHOA 2QKRA 2GFCA 1GIIA 1MQ4A 1X8BA 4NEUA 5AP7A 3FYKX 5DPVA 4WD5A 1URCA 3IW8A 4J7BA 1JPAA 4C4EA 4MK0A 4QPMA 3WF8A 4CFMA 2DS1A 4DG3E 3QD2B 4ZLYA 3HAMA 3KA0A 1XWSA 2WNTA 2R3JA 4HCUA 1OMWA 4A9RA 5T3QA 5M4FA 4O82A 2UW8A 2JIVA 2C6MA 3F3TA 4FTRA 5F9EA 5IQFA 2GQSA 2PYWA 4NCTC 3FPQA 3FI2A 3PG1A 4GMYA 4KD1A 1KV2A 5C4KA 4KIOA 3ZLWA 4RIXB 3TV6A 3OCTA 3CD8A 1YOMA 3LCSA 4E4XA 4QOXA 5F4NA 1G3NA 4KINA 4DBNA 1OPJA 3LFDA 4ZLZA 2ITTA 1Q8TA 3AT3A 4XLIA 4W4YA 2GSFA 4C58A 4JG6A 4U7ZA 4UMPA 4L7FA 4FUYA 3LMIA 2OICA 2C6TA 3FLSA 3BU6A 5JK3A 4JRVA 3FKOA 3PJCA 3PXZA 3VNTA 3U9CA 4E7WA 5KMJA 2BHEA 2C0OA 2PE0A 3RALA 4YZNA 4DEIA 5EYCA 3U4WA 4RIWA 3JVSA 2Q0BA 3QTIA 2KTYA 2EXEA 3FSKA 5I0BA 4AT5A 3ZEWA 2F7XE 4TKSA 5EM8A 3SKCA 4QP1A 5CENA 5AR3A 2UUEA 3UVPA 3AC1A 4HVDA 4USDA 4CXAA 4FKRA 1XJDA 2ERZE 2RIOA 3AD4A 4LGDA 1PYEA 5FTQA 3UIMA 3PJ2A 5AADA 5HNBA 3IW6A 3Q9ZA 3BU5A 3QTQA 2FSMX 3L1SA 4BDHA 4RJ5A 4D0XA 3SGCA 2F2CB 4F0IA 1NXKA 3UOJA 5AAGA 2C68A 2X9EA 2HWPA 2BDJA 3O8TA 4F70A 3RAHA 4HZSA 1JKSA 4ZLOA 3UVRA 3ZDUA 1GY3A 3TUCA 4IFCA 3A60A 3PYYA 5HGIA 3V5TA 4BDCA 4QMUA 3AC8A 3V01A 4O7NA 2ETMA 3BI6A 4Y46A 2VWVA 4IB0A 3V51A 5ETIA 5CX9A 2F7ZE 4ZMFA 3R9DA 2XNEA 3UO6A 4YJNA 3COHA 3KMUA 4L67A 4XV1A 2YZLA 3HEGA 3KQ7A 4TYGA 4EC9A 1J7UA 3WOWA 3OMVA 4HVGA 4AFEA 5A9UA 3RM7A 3LXLA 3UDBA 3HNGA 1H0WA 4MNEA 4CZUA 1B6CB 4ITHA 4BDAA 1SMHA 4YZ9A 4ALWA 4B9DA 4XP2A 4YJVA 2VO6A 4F1OA 1IA8A 3F69A 4AP7A 3QU0A 1YKRA 1LEWA 1UKHA 5AIRA 1VR2A 3F66A 2R3FA 1WBNA 2G2HA 4OTQA 5DA3A 1I09A 1OECA 2CLXA 5HTCA 3KEXA 4JIAA 3TIYA 4HVHA 4V0GA 4JBQA 2CKOA 5LXMA 3AC5A 4GKHA 3HMNA 4AZVA 5C8NA 5AAFA 2XYNA 4LI5A 4LUDA 3QCXA 4WUNA 4CYJA 2GQRA 2E2BA 3C0IA 2EXCX 3IW4A 3L8PA 1AGWA 2CPKE 2Y6OA 3P0MA 3OXZA 1BYGA 3KVXA 2YCQA 4W8EA 1JBPE 2WD1A 5CU4A 3ULIA 4YHJA 3UP7A 4DN5A 2DQ7X 5M53A 4ZSJA 3VRYA 1KWPA 3NZ0A 4O0YA 5CZIA 2FH9A 4O7TA 4HJOA 2BPMA 3U51A 4RWKA 3FL5A 3BCEA 2HOGA 2QURA 4JLCA 4I4EA 4I4FA 3SAYA 2DWBA 4Q9SA 3GU8A 3Q2JA 3PIYA 4CT1A 2JAMA 3TKIA 5IMXA 4M15A 2ZMDA 4JJRA 4L3LA 5FM3A 4BIBA 4GJ3A 3P79A 4I93A 1HOWA 2IVUA 2FVDA 5A3XA 3QGWA 4LL0A 4OAUC 3DQXA 4IC7A 2G1TA 4KB8A 4CLIA 4AGDA 3MPAA 3FMHA 5HO8A 2F2UA 5ANKA 4TTHB 1A06A 1YXVA 2C1BA 4NUSA 3UOHA 3TDWA 2R7BA 3BHVA 4RSSA 1OKWA 3V5LA 3TUBA 2VWIA 4BYJA 4C35A 2XK7A 2VTQA 2BHHA 4WSQA 3BE2A 4FX3A 2UZLA 3HMIA 3FZPA 2V62A 3R0TA 5FDXA 4I23A 2OIQA 4LYNA 3TT0A 4KKEA 3OWJA 2UZTA 3MSSA 3HRFA 1H1PA 4JBOA 2ZOQA 4XRJA 4BDEA 2IG7A 2WZJA 3MJ1A 3OTUA 4KBCA 3VUTA 4CQEA 4TYHB 2WMRA 1YI4A 3QTXA 4RA5A 3K54A 3OD6X 4NT4A 5EM5A 4D58A 3PJ1A 2W05A 3ET7A 4QMWA 5IQCA 4EHGA 1TKIA 4ITIA 4ACHA 2PZYA 3KXHA 4FSMA 2R3QA 3NNVA 1Q61A 1FGIA 5E7RA 5B0XA 2C5NA 3E3PA 3ORMA 4FGBA 4R1YA 4ZJVA 3TTIA 3I6UA 5IEVA 5CXHA 2V0DA 2XNPA 3SOAA 3DDQA 4UEUA 1UA2A 3IGGA 4XUFA 4ZEGA 5A4EA 3TM0A 3U9NA 4RJ7A 2GNJA 3R1SA 2QR7A 4GEOA 4PX6A 1MP8A 3OEZA 5DHJA 4EOLA 2PE2A 2QG7A 2WMXA 3D7ZA 4Q9ZA 5IUGA 5JKGA 4YO6A 4I92A 4UZDA 2WFYA 3Q2MA 1P14A 4BVUA 2OK1A 2GS7A 3F3ZA 1U59A 3LCDA 4DFNA 4RBLA 3TEIA 2XKFA 4ASEA 4PRJA 2PMOX 3EQDA 3QQLA 4DG2E 3S2PA 2OWBA 5HESA 4C4JA 1OIUA 3OEFX 4XP3A 2WMBA 4RX7A 3FXXA 5J5TA 4EONA 2YDIA 5DOSA 4BBEA 5AR5A 1EH4A 3P7AA 2E9VA 2B4SB 2QG5A 4JIKA 3ZUTA 4QMZA 4NTTA 3TG1A 3GC8A 4L8MA 4BRXA 1WBOA 5EDRA 2V55A 2PZRA 2Y4IC 4BI1A 5FRIA 4PNKA 3MH2A 3C9WA 3Q9WA 4RRVA 4ACCA 2P4IA 5FTOA 5A54A 2QR8A 4NM0A 3RAKA 3EHAA 3C4CA 5AIKA 3DNEA 1KOAA 1YVJA 2VU3A 4IE9A 4LOPA 5T6KA 2Z7RA 3ALOA 4CFWA 2BDFA 4FSUA 4P7EA 3O8PA 4FMQA 3VS5A 3TNWA 4LG4A 3GC7A 5CI7A 3W32A 3FPMA 1W84A 2IZUA 2O3PA 2X2LA 4OBOA 3D7TB 4IVBA 5A14A 4G1WA 3R8ZA 5EYDA 5M06A 5IG1A 4E3CA 3MA6A 5IKWA 3JPVA 2W0JA 3VVHA 2WXVA 3EQRA 4QYYA 5ETAA 4ASXA 3UC3A 5D11A 1M2QA 3RZBA 2XCKA 1MQBA 4QMNA 2BAJA 2R64A 3P86A 4FUXA 4HPUE 4RWLA 4U6RA 2XEZA 5ICPA 2Z2WA 2ITWA 3S1HA 2HAKA 3SC1A 3K2LA 2GQGA 1R0PA 2PVRA 2RFDA 4MWHA 4W4VA 4FTQA 4KS7A 4M69A 2W1GA 5CF6A 3N4UA 4JBVA 4GFMA 3UG1A 3RNIA 3L9NA 3ZZWA 3NX8A 5IA1A 3REPA 2E9PA 5ACKA 3ORZA 3QX2A 3BX5A 3LFCA 3A7HA 4TN6A 4E5BA 1AQ1A 3GEQA 4QNYA 1Q99A 3UVQA 4D0WA 2HYYA 3O0GA 4XG3A 4EORA 2UW6A 2GCDA 4BTKA 4AE6A 3QC4A 5LVMA 5HVKA 3PXRA 4JRNA 3IK3A 4RVKA 3RPVA 1KE8A 4EOKA 3MTLA 4ZXTA 4D5HA 4S33A 4X3FC 4EHEA 4D2SA 3HECA 4EK6A 4JX3A 3LE6A 4MYGA 1K3AA 5M51A 3UE4A 2F49A 4PWNA 5BVWA 5JZNA 2OXYA 4KUJA 4YPSA 1WVYA 1OI9A 4HVIA 4RC2A 4RJ8A 5DEWA 4TT7A 4DAWA 4FF8A 3NUPA 2BCJA 3V8WA 4HGEA 4PQNA 5EW3A 4YPDA 4AW2A 4BZDA 3LQ3A 5DVRA 3W2OA 4O7VA 4EWHA 3ZXZA 5BVDA 3FDNA 1H1WA 4EZ5A 5LWNA 3KRXA 3ZM9A 1XBBA 3FI3A 3FQSA 3VUIA 3VUDA 4F6WA 4EQUA 5KHWA 2ZM3A 3KXGA 3DK7A 4YLLA 1WFCA 5DR6A 4AT4A 5IDNA 3OUNB 5L2SA 3E92A 2YJSA 1Y8YA 4U97A 4RJ3A 3TZ7A 1ZYSA 4F9YA 2XEYA 4L53A 3LW0A 3O50A 2XIZA 4FKVA 3P9JA 5L4QA 2Z7LA 4J8MA 3QRUA 4EH6A 1KE5A 4ZTSA 5J8IA 3I1AA 3NS9A 4FZAB 4HNFA 4ID7A 5CVGA 1M2RA 5C26A 3HA6A 4HNIA 3FYJX 4NW6A 3OWKA 3GFWA 3KMWA 3SG8A 4G2FA 2C0IA 2J0LA 4ZK5A 2OF2A 3RTPA 4FIJA 4FTUA 3QCQA 4EK8A 3LOKA 4USEA 3SXSA 2VTJA 5AA9A 1YXUA 3PSBA 4P2KA 3G0FA 3AC3A 5IA5A 2J0JA 3KFAA 2XZSA 5D1JA 3I81A 4AE9A 5HVJA 3MBLA 4LGHA 4RC4A 4GK3A 3WE4A 2UW7A 2QU5A 4O38A 2BAQA 4KABA 3T9IA 2OFUA 3PVWA 2XS0A 4KNBA 1ZLTA 4GRBA 4CVAA 5JSMA 5DNRA 4IAYA 4Y5HA 3CTHA 1ZYDA 5K5NA 1G8AA 4D4RA 3I7CA 2C3KA 3F5XA 1R3CA 3CEKA 5DRDA 4IB5A 5ANJA 2I7QA 1WVWA 3R7UA 2ITOA 3NUUA 5L2TA 3ZBXA 1F3MC 5JGAA 1Q4LA 3FLQA 1H25A 5M57A 2YCSA 4J97A 4IB1A 3PWYA 3TI1A 4E6DA 2XK4A 3MWUA 3HMPA 4QP7A 4EOOA 3MA3A 4S32A 4GL9A 1XH6A 2B7AA 3VN9A 1VYZA 3VULA 3LQ8A 4JX7A 3ZBFA 3LCTA 4E5WA 3D0EA 4U81A 4DFLA 5JFSA 3ZDIA 4QMXA 5EDQA 3HMMA 2FSTX 4XS2A 3GC9A 3IDBA 3QKLA 4BDJA 1O9UA 4DH7A 3H0ZA 2CGVA 5LMBA 5AR4A 2OBJA 4YJSA 1YXSA 4QMVA 3NEWA 4JDIA 4OTGA 4WIHA 3A62A 4O7RA 3QUEA 5C01A 4RA4A 4C7TA 3WZDA 2BZIB 3OXTA 5KKRC 5DYJA 2YCFA 3F2NA 3AG9A 2Q0NA 3NRMA 4ACMA 4AA5A 3QBNA 2WU7A 4FKQA 4GIIA 3A99A 4DFZE 4GV1A 4NJDA 4XLVA 3CKWA 5BYLA 5I3OA 3UOLA 4EJNA 4R78A 4WBBB 5EYKA 4CZYB 3EZRA 2YAAA 3AXWA 2QLUA 3U8WA 3C5UA 1QPDA 2I40A 4R3PA 3TNHA 1UVRA 4UBAA 1V0OA 2ITZA 4ANQA 3ZUVA 4LGGA 3VRZA 3IOPA 5IH5A 4MF0A 4QMYA 5CQWA 4JI9A 1OUYA 4WNMA 4D2WA 3G0EA 4H58A 4MXOA 1OKZA 3EL7A 2FGIA 2P0CA 3CLYA 3IW5A 5EK7A 3HV3A 4FKIA 5BVEA 3VF9A 3VIDA 4QTEA 3Q4CA 4IQ6A 3C4XA 3VBVA 3GCPA 3LMGA 1Q8YA 2GHMA 3BGPA 3MVJA 5AP3A 4AW5A 3DKGA 4XBUA 3E64A 1M14A 4EYJA 3KXNA 3LAUA 2NO3A 4FKTA 3ZU7A 1YW2A 4EH7A 3IG7A 4EYMA 5FBOA 3FEGA 3GBZA 2PUIA 1IASA 4BCOA 4BL1A 4M14A 5AA8A 4BCKA 4TWNA 2Z7QA 5EQEA 3ZM4A 3G33A 4QNAA 1WMKA 4EHZA 4G6OA 3FMDA 2ONLC 2OFVA 3BZ3A 5KZ0A 2F9GA 5KMKA 3OY1A 1ZARA 3OWPA 2FSLX 3MFUA 1F0QA 5E8TA 1UWJA 2XUUA 3KB7A 2R0IA 2QO7A 3FMMA 3GXLA 3HYHA 2C6DA 2GS2A 4FT5A 3TL8A 2VRXA 4QTBA 4MD9E 4Q2AA 3GNIB 4PL4A 1PXLA 5AP1A 3S3IA 3A8XA 5H2UA 1JAMA 5IH4A 4IADA 3TV7A 4J95A 3DB6A 5L6WL 2WHBA 4A7CA 3QTWA 2BDWA 4LFIA 5EI2A 4DH1A 1T45A 1R1WA 3CGOA 2GNLA 4NH1A 4TW9A 4G3FA 4F7JA 3ORKA 4FKJA 3WIKA 2OW3A 4RFYA 1DAYA 4O0WA 3QQGA 4H36A 2X8IA 4PL3A 2ZB0A 2PL0A 4LV8A 2Y4PA 4Q5HA 3DAJA 3R7VA 3RMFA 4F9CA 5LOHA 4FT3A 3PA4A 3ZSHA 2W7XA 3DV3A 4WA9A 1WBPA 4IZYA 2C5OA 2VTRA 2XJ2A 3HV5A 4AG8A 4FL2A 3KXMA 2H96A 5GJDA 3QFVA 3EN5A 2YM6A 5HNGA 2QD9A 1OM1A 2O65A 4AZFA 3VUKA 4ZY6A 5F95A 3TKHA 3D5UA 1GZ8A 1IRKA 3FC2A 3OUKA 4RIWB 2A0CX 3JY9A 2QOCA 5AX9A 4ASDA 3D5XA 3IOKA 5D10A 2CCIA 5EI6A 3GCVA 3LJ0A 3ACKA 4CRLA 4XP0A 4MNFA 1OL5A 2OZOA 4C34A 4L6QA 3LFEA 4MXCA 3U4UA 4IB3A 2LGCA 2HZIA 4RT7A 4ORKA 4J53A 1JSVA 2R3PA 2QONA 4C4GA 1VJYA 3QKKA 3OC1A 2UZUE 4DH3A 2C47A 2CLQA 2OSCA 4FYNA 4MKCA 4AA0A 4YTFA 5CANA 4FV1A 5DWRA 4C4FA 4O91A 4ANMA 3JVRA 4KSQA 2BFYA 4XV9A 3H30A 2Y9QA 1UNLA 3UNKA 3QCYA 4CG8A 3ELJA 3F5UA 4RVTA 2HWOA 4PMMA 2IVTA 5AEPA 1J7LA 2YWVA 3VJOA 4A9UA 2IVVA 4BTFA 2NRYA 3KN5A 4YC3A 4WUAA 3TNIA 5IH6A 4U3ZA 4AQCA 2HW7A 2X4FA 5HVYA 2OLCA 2BKKA 4FKPA 1Y57A 2X7FA 2ZYBA 2W9ZB 3COIA 3OZ6A 5JN2A 3TZ9A 3WZKA 4MNEB 2Z60A 4IC8A 2UVXA 3ZOSA 4ZTMA 3D9VA 4HGLA
chains in the Genus database with same CATH superfamily
4IDTA 2UZVA 4GW8A 1JSUA 2EXMA 4Y72A 4ZS4A 3VS0A 3JYAA 4BBMA 5KMMA 3AD6A 1M52A 3KULB 5HE3A 2PVYA 2X8DA 4IMYA 3GT8A 4QMOA 3RPRA 5C9CA 4A9TA 5C27A 4CEGA 5CLPA 4EKLA 4BDGA 3C0HA 3BLAA 2J4ZA 3QRIA 3CSVA 2GFSA 3CC6A 4FTLA 4EOPA 1ND4A 3PVGA 3PXYA 2DYLA 4MXAA 5HIBA 3QZIA 2QI8A 4IH8A 4ACDA 4NYEA 1I44A 5IU2A 3EQBA 4Y95A 2W06A 3QXPA 3FY2A 3NAYA 3OP5A 1WAKA 2O2UA 3DFAA 5IQBA 2A19B 3EQFA 5JRQA 1PHKA 3DTWA 3UYTA 2X6EA 4WNPA 2ZDUA 1IR3A 1U4DA 1XKKA 2Y7JA 1XMLA 4MBIA 5E8SA 1CKPA 3HRCA 3OW3A 3NUYA 4LL5A 1QPCA 4WG3A 3VQHA 3VWAA 4BGQA 1K9AA 2G01A 3BBWA 3KU2A 3QD3A 4HYIA 3AMAA 3RI1A 4C57A 3P4KA 3QALE 4UZHA 5F1ZA 1PXPA 5CU0A 4ANOA 4BHNA 2O63A 5B2LA 5LMKC 3LFAA 4FRFA 2RKUA 5BVKA 3ZRMA 2HZ0A 1NVQA 3G6GA 4L3JA 2HELA 3Q6UA 4QMTA 4X2NA 3LFFA 5DBXA 4ENXA 3ATTA 5CYIA 5CSHA 3KN6A 3MB7A 3R7YA 4L43A 4H1JA 4BKJA 3TZMA 3GP0A 3PIZA 3FHRA 4DH5A 1W0XC 3QTSA 2PVJA 1CKJA 1ZOGA 2PHKA 5AM6A 4CFVA 1V1KA 3IQ7A 3R8MA 4A9SA 3G90X 2GNHA 4K6ZA 5BQ0A 5AFVA 1GIHA 3EKNA 2PVNA 2CGXA 3CY3A 3AKKA 2R2PA 3TYKA 3FSFA 3OBJA 4YNEA 4NJ3A 4ACGA 4C62A 5B7VA 4I6QA 2B53A 5HU3A 4CV9A 3ZO4A 5M4UA 2G2IA 4WT6A 3NNXA 2UZWE 4HZRA 2GPHA 4M0YA 4NZWB 4AUAA 1OBGA 4I6HA 4GT3A 4AOIA 2C5VA 5I5ZA 3CCNA 5J1WA 1A48A 3LLAA 5LJJA 3LCOA 3R02A 3BIZA 4RIOA 3GCUA 3I0QA 3VW6A 4EK3A 3WBLA 2VV9A 3KGAA 5FGKA 2CSNA 3PP1A 4EI4A 3QTUA 3Q4TA 4F09A 3PA5A 1JKLA 2BVAA 5HG8A 4BN1A 2AYPA 4DC2A 3VC4A 3EB0A 3V8SA 2VWYA 3CIKA 3G9NA 2OJIA 4ZZMA 4DCAA 3CGFA 2C6OA 4F6UA 3U6JA 2X39A 4W4WA 1FQ1B 3L9MA 2R7IA 5L8KA 4O7YA 4O2ZA 4EZ3A 4OT6A 2X6DA 3SD0A 2RFSA 2AUHA 4C61A 2ZJWA 5K3YA 2OJFE 4C33A 2I0YA 4XG8A 3W8QA 2H9VA 4FTJA 4IAIA 2VZ6A 3MESA 3VBYA 2W1CA 4PTCA 3CP9A 3DY7A 3UMXA 4CLJA 3Q9YA 3A8WA 3OROA 4QYHA 3TACA 4DCEA 4GU9A 3FMJA 5M07A 3VUMA 5EKOA 5EOBA 3L8VA 2VTNA 2HK5A 3FQHA 3R28A 2OG8A 4N6ZA 3VUHA 4CQGA 4DINA 4E73A 4IWQA 3K3IA 4U3YA 3PJ3A 3LFQA 5JRSA 4ZSEA 5J7BA 5KX8A 1ZYCA 4RLLA 4CFXA 5CU3A 2REIA 4XG2A 3V5QA 5FEEA 2C3JA 2IO6A 4QPAA 5GZ9A 1WCCA 3C13A 4FIGA 3DOGA 3BLQA 2QC6A 4K2RA 5EH0A 2Y0AA 2XK8A 3PY3A 4E6QA 3O2MA 4X0MA 5JEBA 1NVSA 1V0PA 5DIAA 1URWA 2WTWA 1OGUA 5AMNA 2R0UA 5IEXA 2I0HA 4XMOA 2VWBA 5AUVA 3TNQB 2OU7A 3WIGA 3ITZA 2W96B 2X7OA 3D2KA 3E8CA 3F88A 3ZRLA 4BZOA 4O7ZA 4ONAA 4IIRA 4HPTE 4OT5A 3KREA 4BR3A 4BGHA 3EQGA 2VNWA 5LCJA 3UQFA 3N4TA 4F78A 1S9JA 5BUJA 3KK8A 1LR4A 4EOMA 3F7WA 3KULA 3U6IA 1R78A 5LQFA 4OTPA 1RJBA 2XKCA 3CY2A 3DXNA 2KULA 4FSQA 5AUUA 5D7AA 1J7IA 2W1IA 4Z7GA 4EH3A 3GFEA 1IG1A 3JXWA 1H0VA 3R7GA 2WMSA 3ANQA 3DK6A 4KBKA 2BMCA 3THBA 3AMYA 3KKVA 3QWKA 1GIJA 4M97A 5CXZA 2OIBA 4AWIA 4C4IA 4TL0A 4ZY5A 2XM9A 2J90A 4L44A 1PY5A 4YBKA 1XH9A 3E8EA 4CMOA 3TCPA 3LJ2A 3CJGA 2R3IA 2QQ7A 3PSCA 3PY1A 4M69B 2WU6A 2VAGA 4X3JA 3RPOA 5ANIA 5T68A 2P2IA 3RWPA 3FAAA 2O64A 3QKMA 3E63A 1H1SA 5M55A 1FMKA 3DAEA 4IJ9A 1DI8A 2YN8A 1FVVA 1E1XA 2I6LA 1CTPE 3I0OA 2P2HA 2QVSE 3LQ5A 4NTSA 4ZJJA 3V3VA 3IO7A 4NM7A 3KK9A 5LVPA 1LP4A 2ITUA 4IX5A 4YURA 4H1MA 1YWNA 3O8UA 3GU5A 3ID6C 2WKMA 2J6MA 4RGJA 1ZY5A 1W8CA 4WSYA 4DHIB 2X4ZA 1ZY4A 4HYSA 5AWMA 4K18A 4IZ5A 2IW8A 4D9TA 1OBDA 3FL4A 5DN3A 1YOLA 4YHTA 4UXLA 2BKZA 5LWMA 1BKXA 4DYMA 4MTAA 5FM2A 4DH8A 4V01A 4JT3A 4FKUA 3W1FA 5E9EA 2BRBA 2CJMA 4IAZA 2QOIA 4HYHA 3QLFA 4IHPA 5AAEA 1TQMA 4JBPA 3QD4A 2VNYA 4NIFA 1Q62A 4R7HA 4RPVA 5HD7A 4AQKA 5L3AA 4FTOA 3RVGA 2PVLA 3EJ1A 4FKSA 4JL9A 4CFFA 5L8LA 3DXPA 2VTOA 3FLWA 3QHWA 4QO9A 5D12A 4U45A 3UNJA 4WHZA 1G5SA 4FTNA 2IN6A 5CEKA 3R63A 5J95A 2W4JA 5K4IA 2WAJA 4XCUA 1STCE 1QCFA 2P55A 3QA0A 1O6YA 2IVSA 4UB7A 3D2IA 4KS8A 4O7LA 4QYEA 1J1BA 2FA2A 1DS5A 1ZYLA 3EWHA 4OTHA 1FGKA 3DCVA 4O6EA 5FEQA 2ZVAA 1PKDA 5KKRB 3ORTA 4RQVA 4MF1A 1XH4A 4OGRA 3BRBA 3C51A 4APPA 5IQEA 4GUEA 4ZIMA 3NYXA 2UZEA 3BU3A 2ZAZA 2YWPA 3BQRA 3Q4ZA 3MY5A 2GNFA 1XO2B 3H3CA 3KIOC 2A1AB 3IGOA 2IW6A 4FT0A 4EH2A 4G3EA 2GHGA 5AUXA 3DKOA 2JKOA 5AUZA 4UY9A 1E9HA 1MRYA 3O71A 3ZEPA 4ARKA 5HTBA 4IM0A 5HE1A 4USFA 4M8TA 3HAVA 5K0KA 3H10A 3NYNA 3CR0A 2WMWA 3EYHA 4RWIA 4Y85A 3QQKA 1Q3WA 5CT0A 2VGPA 5HCXA 2F7EE 3CBLA 3QC9A 3I60A 4D4YA 3OWLA 4I21A 3WILA 1Z57A 1M17A 3DZQA 4NK9A 4BB4A 2PUPA 5AUTA 3P08A 3UQGA 4O4FA 3WF7A 3SA0A 4BCJA 2HXQA 4XH6A 2FUMA 3FBVA 3FLYA 1TQIA 4O0TA 5CS6A 5A4CA 5I9UA 3QQJA 3VBWA 3DFCB 4IWOA 3OHTA 4CKIA 2W1EA 1PXIA 4MVFA 4PDSA 3CPCA 3BQCA 5FXRA 4FIEA 2VUWA 5JFVA 3DGKA 4G3GA 2VTTA 4XYFA 3HL7A 2WQMA 3R2BA 5EYMA 4DEHA 4X3FA 4D4SA 2PVHA 4TYEA 3FLZA 1PXNA 4XG7A 4C0TA 4XRLA 2C4GA 4JQ7A 3UDTA 2GDOA 5AV3A 3ZFYA 4BTJA 4YHFA 3BYOA 1GZNA 3EH9A 3RCDA 4G6NA 4DEEA 1MRUA 5CEPA 2WO6A 1YHVA 4L46A 2R9SA 4RLKA 3W0NA 4RWJA 4QDVA 5HLPA 5ANOA 5L2IA 2ITQA 3OS3A 2CGWA 5AV1A 2OJGA 3VUGA 2B54A 2YERA 5TR6A 3R8LA 4A4LA 2XB7A 2XJ1A 4FT9A 4G17A 2IJMA 3LHJA 2OXXA 3ZLYA 4B99A 3RAWA 2GHLA 4OR5A 3RK7A 2W4OA 3W33A 3O7LD 5CSVA 4CCBA 3ZO3A 4JXFA 3PZEA 2R3RA 4H05A 1Y6AA 3DBCA 2W5BA 4YBJA 3RGFA 3O5AA 4CGAA 4R7IA 3EQHA 4ZTHA 4PDOA 1IAJA 3V8TA 4MBJA 4AN2A 2F57A 2BRNA 3PFQA 4BDDA 4O96A 3C4WA 4I22A 4G5PA 2IF8A 3B8QA 4IZAA 4JDHA 4E20A 1IAHA 3R9RA 4F63A 1WBSA 2XRUA 4CT2A 3VQUA 3Q32A 5FEDA 2YIXA 4J98A 1VZOA 1YDSE 4XJ0A 3PVBA 2YIWA 3R1QA 3JR1A 4AACA 4JR3A 1H08A 4ASZA 1QPJA 2WQEA 4Z7HA 4FVQA 4FV7A 2V5QA 4I94A 4XG6A 5JT2A 2HY0A 3MDYA 4LMNA 4B7TA 4RIYA 2BR1A 4II5A 4DEDA 2JFLA 3P1AA 1W2DA 3NNUA 1W7HA 5AR7A 3CQEA 3RM6A 5CEMA 4CYIA 4OTDA 3GENA 2OI4X 4IAKA 5CAVA 4PDPA 2UZNA 4HGTA 2BZHB 4FK6A 4U41A 2WMTA 3JY0A 4UWCA 4EK5A 2R3OA 2RFNA 4CFUA 1H24A 4CTBA 3AT2A 4K9YA 3Q52A 2WTDA 3DPKA 3G9LX 4EQCA 1W83A 4F6SA 5HTIA 5A6NA 5ANDA 2C5YA 4O1PA 4AN3A 3W0QA 2WIPA 3QQFA 3DJ6A 2WTKB 1F5QA 4DFBA 1LPUA 4M67A 3PRIA 1KOBA 2BFXA 4OW8A 3AGMA 3KMMA 4M13A 1UU7A 4GS6A 5F20A 4RX5A 5CASA 3GOKA 1MUOA 4H39A 2WB8A 3LLTA 1CMKE 2WPAA 3FZSA 2VTMA 2BTRA 4O0RA 3DK3A 3VS4A 3ATSA 4FNYA 4YTCA 4FIIA 2W5AA 2ERKA 3MVMA 2PMIA 5E8WA 4O2PA 3R8UA 5E1EA 5H8GA 3CXWA 1UU8A 4X6QC 1JNKA 3H4JA 3NVKI 2PZ5A 1K2PA 4HYUA 4F65A 4E4MA 4LRJA 4V04A 3U6HA 5EI8A 5JFWA 3G51A 4ZZNA 1XH7A 4LUEA 5GINE 1YDTE 1OIRA 3EMGA 3HV6A 2F4JA 4F1MA 4OBQA 3H9FA 5CSXA 2AEGA 4P90A 1B39A 5AV2A 4Q5EA 2ZB1A 5FP5A 1CDKA 2YA9A 3NCGA 4CTCA 3F3UA 3PE1A 3ZZEA 3MH0A 4IWPA 5HCYA 3V6SA 4G31A 4BCPA 1H26A 2YABA 3Q9XA 4TPTA 5IQHA 5HICA 2IPXA 4D1ZA 2W9FB 3A2CA 3PG3A 5AUWA 4L45A 3PUPA 2VD5A 3H9RA 3PIXA 2J5EA 3WYXA 3F9NA 3HGKA 4KSPA 4CNHA 3GVUA 4I3ZA 2PY3A 4X2JA 4FSWA 5TT7A 4JQEA 2QU6A 3TV4A 2PZIA 2EVAA 1BX6A 4PUZA 4R8QA 3OXIA 4BIDA 1JSTA 4X6RA 2QOFA 4PL5A 4DGGA 5FP6A 3LPBA 4K0YA 4NFNA 4WRSA 2ONLA 4RX9A 3WZEA 1ST4A 4Z16A 2SRCA 4H3PA 2J51A 2JFMA 4FTIA 1PMEA 4YLKA 3EQPA 3PE2A 1R0EA 4O7WA 3K3JA 4F0GA 2IEWA 5D7VA 5IQDA 4UMRA 4FSTA 4KAOA 4YO4A 4L52A 3R1YA 3AT4A 2BTSA 3F2AA 4FC0A 4K8AA 2J9MA 3UGCA 4R5SA 4R7BA 4FKGA 2PE1A 3ROCA 3FI8A 4RJ4A 1L8TA 2X81A 3R73A 3C4ZA 4FOCA 2ZM4A 4B0GA 5BNJA 1RQQA 3SHEA 3BYVA 3M2WA 3RJCA 2WOUA 2JBOA 4AGUA 4DGMA 5LVLA 4NWMA 2YM8A 2A2AA 5KCVA 3AOXA 3W0OA 3CJFA 3GQLA 3UBDA 4KKHA 4NL0A 5J9LA 2PULA 3FJQE 4PPAA 3RCJA 2ITNA 3FE3A 2OGVA 5EFQA 1PXMA 2RSVA 4C59A 3LMHA 5E91A 2XALA 3QUDA 2OKRA 3QYZA 4YSMA 4E5AX 1E1VA 3UG2A 4F0FA 3ERKA 3ANRA 2RL5A 4V05A 2JDOA 1PJKA 3COMA 4KBAA 2ZV7A 3HV4A 2EWAA 1KE6A 3F2RA 5LCKA 5IQGA 3GU7A 2RG6A 4YR8A 5IUHA 4FZDB 2JDVA 3M42A 4BCMA 5IQAA 1FOTA 4BCIA 2J2IB 3DBQA 4PV0A 3C1XA 4YZBA 5HOAA 5TKDA 3VS3A 3PA3A 2YACA 2ETRA 1HCLA 3F3WA 4PNIA 4G3DA 2BUJA 4BI2A 4QEBA 4IX4A 3FZ1A 4R3RA 1GZOA 3BGZA 4QMPA 4FSZA 4IBMA 2JD5A 3BV2A 1WBTA 5CI6A 4J96A 4YTHA 3WZJA 2X0PA 3AQVA 4O21A 4BTMA 3OOMA 4XOZA 4O86A 4MQ1A 3DQWA 3DKFA 3FMKA 3HA8A 4FG9A 1FVRA 5B2MA 3W55A 4HW7A 4ZAUA 3F5PA 4AOTA 2PVKA 2YDKA 1SVGA 3RBWA 4GYIA 2XNOA 4DA5A 2YIRA 2WGJA 3WE8A 1Q41A 2VO3A 4MAOA 4EHVA 3N9XA 3VBXA 3I79A 5J9YA 4C3RA 3ZO2A 4IVCA 4CFNA 2XNMA 4DT9A 4FICA 4U5JA 3ENMA 4K11A 1BL7A 4U42A 5HO6A 4C4HA 2JLDA 3CS9A 5EDPA 1NW1A 4FG8A 5CAPA 1SVHA 4EH4A 1A9UA 2WTIA 3PY0A 4DEAA 4R77A 3ZO1A 5HZNA 1PXKA 2OZAA 2BRGA 3IONA 5CF8A 3MIYA 3OBGA 2IZSA 3EL8A 1VYWA 4FSYA 2BZKB 3UP2A 3LJ1A 3LIJA 4M3QA 3RK5A 3ZONA 5BX0A 3VW8A 4KKGA 3AKLA 5ITAA 4XG9A 3UODA 3OCSA 5EM6A 4DF3A 4KA3A 3POOA 5DE2A 4I0SA 5BUEA 1OVEA 1OKYA 1Q3DA 3NLBA 3LXPA 4S31A 5CT7A 3BWFA 3BHTA 2CNVA 5I9ZA 3QCSA 3QXOA 3R01A 5K4JA 3MI9A 5D9HA 3CQUA 1UKIA 2VO7A 4BWXA 2CDZA 2HCKA 3P78A 4BZNA 3NUAA 5AV0A 3MVHA 4XX9A 1PMUA 3UPXA 4CKRA 1PW2A 2CCHA 4PDYA 2ACXA 4P5ZA 1ATPE 1SNXA 3NWWA 3KF4A 3MB6A 3R9OA 4BCNA 4MEDA 3E7OA 5I3RA 4PY1A 4ANSA 5IEYA 2UW4A 3R22A 4MHAA 2QHMA 2C6IA 2B1PA 4YJOA 4EBWA 4DDGA 1H28A 5KBQA 5H9BA 5LMKA 5CAOA 4L00A 4QP6A 4I6LA 5M56A 3ZC5A 3JUHA 4DGLC 1GOLA 3ZLSA 2YFXA 2RF9A 4A4XA 4BDKA 2JBPA 4FEUA 3KVWA 1JOWB 3NDMA 4O6LA 2WQBA 3ZCLA 3O7LB 3UJGA 5BVNA 5HG9A 3A61A 4EUUA 1V0BA 2YLFA 2EB3A 3LVPA 2BALA 4YTIA 5EW9A 1S9IA 2BRHA 4EH8A 5KNJA 2IZTA 3SG9A 1BI8A 4KIKA 3P7BA 3VBTA 5LVNA 3BHUA 2QCSA 3QAME 1YI3A 3G2FA 4I24A 5K0XA 2UV2A 3EQIA 3UIXA 1J1CA 1H07A 4U79A 3UTOA 3PXFA 3SRVA 4MX9A 4L68A 2WTCA 1IA9A 2WQOA 3ZTXA 5E8YA 2XRWA 4OUCA 3HMOA 3KL8A 5LARA 2YM3A 3PPJA 3E3BX 5HO7A 3EFLA 2CHLA 4FTAA 1UNGA 3W2QA 5I9XA 5IPJA 4ZJIA 4FSRA 2PK9A 2XBAA 4GT4A 2BAKA 3IDPA 4MD8E 5BMSA 4CCUA 5M08A 5G6VA 3UC4A 1OIQA 4W9XA 4DTKA 1NA7A 1WZYA 4G5JA 4O0XA 2YZAA 3DZOA 4IM3A 3ACJA 2QNJA 1JWHA 3LXKA 2PMLX 4R6VA 5GJFA 3W8LA 2JDTA 4LOOA 2XBJA 2C3IB 3DS6A 5A4QA 3V5JA 4F7LA 3NMUF 5JZJA 2P33A 3D14A 3PRFA 2X9FA 3M11A 5E8ZA 4U8ZA 2PUNA 3MFSA 5HE0A 5M4IA 4IJPA 3Q4UA 5HIDA 1KUTA 1TVOA 4FI1A 5C1QB 2X0GA 4DFUA 5HBEA 4FTKA 4AU8A 2AQXA 4OTRA 5CNNA 4TYJA 5LVOA 1KE7A 1UWHA 3E8NA 2G15A 2HXLA 2VWUA 4FV0A 5L2QA 3F3VA 2J7TA 3D4QA 1FBNA 4BHZA 1SYKA 2C69A 3W10A 4S34A 3R21A 3R71A 4BCHA 3NGAA 4LDTA 3DKCA 4K1BA 2GU8A 3I7BA 4XOYA 2RGPA 4GYGA 5HX6A 2GMXA 2E9UA 4BCQA 4EBVA 4N57A 4U80A 3DU8A 3MTFA 3SLSA 2Z8CA 2DUVA 4OBPA 3B2TA 5BUIA 3NUXA 4FKWA 4IAAA 3WF5A 1BL6A 2JIUA 2W17A 2Y4IB 3A4PA 3POZA 4ALUA 4MXYA 4NIFB 1XBCA 1VEBA 2H34A 3A7JA 4Y83A 4YJUA 3SXRA 5KBRA 3WF6A 4EEVA 3R2YA 2VTHA 3KY2A 1NVRA 3D5WA 2PWLA 4JDKA 4MH7A 4YJTA 4L3PA 4FTCA 3R7OA 2QOQA 4UYNA 3UYSA 5DT4A 5BYZA 5EHYA 5L2WA 2W1HA 3QL8A 4GKIA 3DTCA 1XH5A 3BKBA 4MXZA 4Z55A 4BICA 4ZSAA 1SVEA 2ESMA 2B9FA 4YZCA 5LMAA 3FI4A 4BF2A 4RMZA 2JAVA 2Z02A 5M4CA 4GG5A 5CF5A 3FY0A 4IACA 5FWKK 4CRSA 4B8MA 4C2WA 2B0QA 2XM8A 4ERWA 3MFTA 5E4HA 4L01A 2WMVA 2R3NA 3CQWA 1GJOA 1SM2A 3FWQA 3PXKA 1OZ1A 2QO2A 4IFGA 4UALA 1TZDA 3CE3A 2QOKA 2X8EA 3QRKA 4IVDA 1OUKA 2XMYA 3EZVA 4KIQA 3PTGA 3WZUA 3P5KA 3ZRKA 5FDPA 2Y8OA 4FV3A 4QP4A 3IS5A 3RAIA 1SZMA 3P7CA 4XG4A 2JKMA 5DR9A 3MN3A 4QRCA 3ZYAA 4F9BA 5DT3A 3TJDA 3DNDA 4AOJA 2B9IA 2OJ9A 4QMMA 3UDZA 5C4LA 5KMOA 2VWWA 2NNWB 5FXQA 4F64A 1GNGA 5IA0A 3GB2A 4EC8A 1LEZA 5E8UA 3RPSA 3WF9A 1OL1A 3QZHA 5DGZA 5AR2A 4GH2A 4QYGA 5CNOA 5E8VA 2LAVA 5KUPA 4AAYA 3I5ZA 1QMZA 5CU6A 3UZPA 3NCZA 2E9NA 4FV6A 3R83A 4BDFA 5C8KA 4BDIA 4DBXA 3FXZA 4EH5A 1KE9A 4H3BA 3HDMA 4F4PA 3F61A 3ORXA 2PUUA 1YRPA 4AF3A 4E6AA 3GQIA 3E87A 3MVLA 3O23A 4MXXA 5IISA 4X3FB 3HV7A 1P4FA 2WEIA 3MW1A 3R9NA 1L3RE 2G9XA 3DT1A 3Q6WA 3R00A 5CAQA 3PXQA 1QPEA 2WTVA 4D9UA 2VX3A 2HIWA 5JH6A 5CSPA 2XANA 2YIQA 5KO1A 2Q83A 4R5YA 3D83A 4TNBA 3ALNA 5AP5A 4BY9E 3NYVA 4P5QA 3MIAA 4N70A 3GC0A 5IA4A 4FEXA 5DLSA 3NAXA 4WNOA 4QDEA 1RW8A 1Y8GA 3QZGA 4JS8A 2VGOA 2JC6A 1B38A 2XCHA 4QD6A 3Q53A 4U40A 4F9AA 3UO5A 1H1QA 4PTEA 4MCVA 4TWCA 4QQTA 5EG3A 4UMUA 3L8SA 3NUNA 4LMUA 3F82A 4NW5A 3RZFA 1YOJA 4G6LA 3VS6A 3QYWA 2JITA 5CALA 2UW5A 3PJ8A 1OGYA 1XH8A 2XNBA 4JAIA 2XJ0A 4HCTA 5DH3A 3AC4A 3SW4A 4TZRA 1U5RA 2XNNA 1GZKA 2WEVA 3LXNA 4U44A 5DG5A 5M09A 3DA6A 4ANLA 3F5GA 1ZOEA 3ODYX 4E4NA 3HP5A 5BVOA 4EL9A 1TQPA 1DI9A 3LFBA 1BI7A 4JNWA 2OH0E 2PVMA 4QT1A 3CKXA 5IUIA 3G6HA 3R1NA 3A7IA 5KHXA 4M84A 4RIYB 4XHKB 3IW7A 3W0SA 5J87A 5IZFA 4OLIA 3NW7A 2YCRA 1OB3A 3GU6A 3M1SA 4WOVA 4AX8A 3MGYA 4BFMA 4DEBA 4E4LA 2J5FA 4ZOGA 3BV3A 2X0QA 3Q5IA 4LOQA 2HZNA 5G1XA 4EOIA 3BL7A 3C50A 2XARA 5FTGA 4IDVA 3H9OA 4GIHA 1PF8A 2ZV2A 4G9CA 4ZP5A 4O81A 4C02A 3FUPA 2W99B 3NSZA 4GT5A 4X2FA 5CSWA 1W98A 3BWJA 4X7QA 4AZSA 5CZHA 3OFMA 3MFRA 4RQKA 2YDJA 3BYMA 5CVFA 4DG0E 4BJJA 1U46A 4O84A 5L6PA 5AP2A 5EKNA 3PDTA 3KRRA 4QMSA 4IX6A 4UMQA 5CU2A 3I6WA 5DR2A 4FVRA 4UMTA 3SVVA 4I5CA 3SQQA 4O0VA 3VO3A 4GVJA 5FD2A 2PTKA 4S30A 2UW0A 4FBXA 3DJ5A 4G34A 4YZMA 5ANEA 3UOKA 2C0TA 1DM2A 4NKSA 2QOHA 2RFEA 4EZ7A 2VO0A 3AGLA 4FK3A 4FE2A 1Q8UA 4E6CA 1MRVA 3QUPA 4I6FA 4QP2A 3ZH8A 1Z5MA 2YITA 5HEZA 1HCKA 5EW8A 5K5XA 3W2RA 3HX4A 3NNWA 4NFMA 5HG7A 2PU8A 5HKMA 5A6OA 4JR7A 2UZBA 4WBOA 4E8AA 4ZZOA 1JVPP 3WARA 2X2KA 3DAKA 5IQIA 5EHLA 4IM2A 2OO8X 4FIHA 1JQHA 2I0VA 3KCFA 3VF8A 4LRKA 5H8EA 4F1TA 4RVLA 5DFPA 1LUFA 4IAFA 4YLJA 3LKMA 4PMPA 3A4OX 1JKTA 5TF9A 1ZMWA 1BUHA 1FMOE 1YI6A 4K77A 4B8LA 4ALVA 5JMSA 4DITA 5FUTA 1PMNA 4B4LA 3FLNC 2OF4A 4UXQA 1OKVA 2WELA 4ANBA 1M7NA 3FZOA 4FV4A 3SW7A 2YISA 3NPCA 4GVAA 4RIXA 3VBQA 4DFXE 4DDIA 4FYOA 3BPRA 3TXOA 3D94A 4L9IA 2CN8A 5IA2A 2V7AA 3QQHA 4GG7A 1PKGA 3I4BA 4PMTA 4YJQA 3SV0A 4D1SA 3EFJA 3C0GA 3EYGA 3EOCA 1OL2A 1ZMVA 3FQEA 4FODA 3MV5A 5DI1A 1BLXA 3BHHA 5HNIX 4WO5A 2B52A 3DBDA 4S2ZA 5FLFA 4F99A 3C7QA 4OTIA 3R7EA 4FV9A 4AGCA 4C37A 2VX1A 4E1ZA 5HD4A 4YNOA 1YQJA 3D15A 4R1VA 3R7IA 3TDVA 3RK9A 2BROA 2YJRA 4BCFA 2W1ZA 4M68A 4J52A 5H3QA 4TYIA 4EH9A 1KSWA 4RG0A 4AW0A 4BGGA 3NVMB 2YHVA 3G5DA 2XIYA 3NW6A 3FKNA 4GFOA 4GCJA 4MQ2A 3K5UA 4PPCA 2YAKA 4JVGA 2ITYA 1YXTA 2CKEA 5E90A 4BCGA 4AXEA 3GOPA 1ZZ2A 4O83A 5EOLA 1H01A 5DMZA 2XKDA 5L6OA 5KZIA 3PLSA 4CG9A 4JQ8A 4NSTA 3Q3BA 4MWIA 4PMSA 3ZFMA 4A9YA 3PPZA 4QQJA 1PRYA 1ZWSA 3BEAA 5DT0A 4D2RA 1YWVA 5HI2A 1AD5A 5GZ8A 3NUSA 3ENHA 3N4VA 3UO4A 2XYUA 4ZTNA 3PPKA 2UVZA 1FPUA 4JG8A 3OG7A 4GK4A 4I0RA 4BYIA 4C2VA 1DAWA 4L7SA 4YP8A 2VX0A 4AS0A 4YJPA 4KWPA 1IEPA 4E93A 2GNIA 5ETCA 2NRUA 3Q60A 4BBFA 2JIIA 4NM5A 5GIPE 1U5QA 3UZRA 4AAAA 2JDSA 1J3HA 2VTAA 2CMWA