5CSXA

Crystal structure of b-raf in complex with bi 882370
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
273
structure length
261
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATVKSRSGSILWMAPEVIRMQDPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title A Novel RAF Kinase Inhibitor with DFG-Out-Binding Mode: High Efficacy in BRAF-Mutant Tumor Xenograft Models in the Absence of Normal Tissue Hyperproliferation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 261
sequence length 273
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5csxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5csxA01
4UMRA 4UB7A 5ETFA 3UQCA 3SGCA 5DNRA 5L2SA 2BRBA 3EQPA 1Y91A 4LL0A 4MQ1A 4XV1A 2WAJA 3U4UA 2ERZE 4KKGA 4E73A 5AUTA 1PMNA 4QYGA 2Y7JA 4GIIA 3UPXA 4JNWA 2I0EA 3ACKA 1FVVA 2UW6A 3ORZA 2GNIA 3LAUA 4IAYA 2OIBA 2KTYA 3DS6A 1XWSA 3FPQA 3R8LA 3CC6A 3K3IA 3Q04A 4GSBA 1ZY4A 3HL7A 4FSWA 5M08A 4LGHA 3ETAA 1GNGA 4R1YA 4YTHA 3QD3A 2C5XA 4O2ZA 4MD9E 3I60A 3CR0A 3POZA 5A9UA 3NSZA 4XBUA 5L8KA 4DT9A 3HKOA 4NFMA 3R9NA 4YC6A 5CT7A 2J0KA 2V7AA 3IW4A 2ZOQA 4JIKA 1FPUA 2XNNA 1Q24A 3DTWA 2VO6A 1TQIA 3Q6WA 4C58A 3C4FA 5KBRA 4KKEA 1W84A 2YHVA 1BL7A 3DB6A 4XV3A 4ZP5A 2JIVA 4C3RA 1SNXA 5AP3A 3QA8A 3P7CA 5DT3A 2X8IA 3TZMA 3AMBA 3R7GA 5KCVA 4CKIA 1W82A 2XNMA 3TNIA 4BDIA 4EH8A 2QOKA 2F57A 3BWJA 1U54A 3GENA 1M52A 4TWNA 3VHKA 5EYMA 3ZO1A 4QTDA 4BYIA 3GQIA 3Q4TA 4FV3A 5ANDA 3RPVA 3T3UA 4AGCA 2XJ1A 4FT5A 5HO6A 2C5NA 5HCZA 4PP9A 5DR9A 4J52A 3OZ6A 3NRMA 1OKYA 3NYNA 3TIZA 5AR8A 2PUPA 4O0YA 3FC1X 2VNYA 4BDKA 5AA9A 3OHTA 4MH7A 2J5FA 4N0SA 1KV1A 3Q9XA 5BMSA 1STCE 3SXFA 3V5LA 3BHVA 3U6JA 4FYOA 3ZO2A 5M4UA 3UOJA 3HP2A 3QZIA 4FL2A 3B2TA 1Q8TA 4QMLA 3PY3A 4MNFA 4QMZA 3SKCA 4A9RA 4DH3A 3TT0A 3PXZA 3U54A 5IDPA 2I0HA 3A7IA 5TF9A 2OJIA 2YDKA 3GCUA 3VRZA 3FZSA 5GJFA 4Y46A 2C68A 5L2QA 4EK4A 5M4CA 4RFMA 3I0OA 4U3YA 2CPKE 4BHNA 4J1RA 3EH9A 3GC7A 2UVZA 1P2AA 3BGPA 1OITA 5DYJA 2RFEA 3AQVA 3FC2A 3DTCA 4U0IA 4IWOA 4FYNA 3QRJA 2ZM3A 4ZTMA 1PXMA 2R3MA 2RSVA 2VTIA 1Q99A 4B0GA 5BYYA 3MIAA 3IONA 4EI4A 5CEPA 4RVKA 3JS2A 2OGVA 4J71A 5CSWA 1AQ1A 3CTJA 3LLTA 1YVJA 3GC9A 5CU2A 5FDXA 4E5BA 4XBRA 3CGFA 4TYIA 5CSVA 2I0YA 3K5UA 3ZFYA 5B2LA 3UIMA 3W16A 2B0QA 4L52A 3ZU7A 2OXYA 4FTJA 3DBEA 3TJDA 4K6ZA 2BDJA 3ZRMA 4ASZA 3CLYA 2J7TA 5E1EA 4G6OA 3QUEA 3C4XA 2W1HA 3G0EA 3EQCA 3MVLA 3TXOA 3HV3A 4YJRA 2VWYA 1OECA 1L3RE 5LVPA 3I7BA 4F99A 1PHKA 3PY1A 3RPYA 4DT8A 4IZYA 3GOKA 2XK4A 2CN5A 4O0UA 4U80A 2GPHA 5ETIA 4FKOA 4I0RA 3R1YA 4GVJA 4IB3A 3DBQA 5IEXA 2PE1A 3DZOA 3ZZWA 2W9ZB 5HNBA 1JWHA 4MD7E 3MFRA 4X2FA 4E26A 3OWLA 3FI4A 2OU7A 4NKSA 5DH3A 5M56A 4K8AA 5ICPA 1PJKA 4CZYB 3BCEA 3V8TA 3KMMA 4X7QA 4BDDA 4JI9A 3BBWA 4FIEA 4YJVA 2HXQA 4FKIA 1WVXA 3OEZA 5D7VA 5KHWA 2OZAB 4QMOA 3TV6A 4AOTA 4V01A 4F65A 5DE2A 1RW8A 3EKKA 1GZ8A 1OKWA 3KREA 2BZJA 2EB2A 2P55A 4EHGA 4PMMA 4B99A 2REIA 3PP1A 3LFNA 4BGGA 4QYFA 2XVDA 4O0WA 2YM5A 4I5MA 5M53A 1YI3A 3FKOA 3VRYA 1GIJA 4RWLA 3MS9A 3NAXA 4H1JA 2B7AA 2X0GA 3F3TA 2OH4A 3W32A 3HECA 4ASXA 1P5EA 4HGLA 3HA6A 4ERKA 3VQHA 2C3KA 1JBPE 1VYZA 1FVRA 5AUYA 2UVYA 4EOLA 4KNBA 4RIOA 3MTLA 4ZSGA 4U42A 4BTJA 1APME 4FKLA 4BCHA 3IG7A 5DVRA 3ZCLA 2CJMA 3PIYA 2YEXA 3EQGA 4P90A 5C9CA 5CANA 3O96A 1TQMA 1FMOE 2BZKB 2YJRA 2X8EA 4QMUA 4PP7A 3OTUA 3UMWA 5A4TA 5E7RA 4DFXE 4MEDA 1UNLA 3RJCA 2ITUA 3V3VA 5E8WA 2XYNA 3ZO3A 4HNFA 3ZUUA 4A9SA 2ITZA 3ACJA 3TDVA 3LFSA 2QOQA 3O0GA 4O6LA 5TKDA 2LGCA 3Q9ZA 2C3IB 3KK8A 3S1HA 4YPSA 2VWVA 2JD5A 3F3WA 4WG5A 3T8OA 4AAAA 3WBLA 4XMOA 4EEVA 3LXLA 2RFNA 1LP4A 2XRWA 3M1SA 2R3PA 3FQSA 4I21A 4QMMA 3E3BX 4AX8A 3F2RA 2OXDA 4WG4A 4FK3A 4IAFA 4ANNA 2BTSA 1GOLA 2WTKB 2XK8A 3KA0A 3O8UA 4MBLA 3SXRA 4ZY5A 2JKMA 5IEYA 3ID6C 3AC3A 4QNAA 3TUCA 1H0VA 1ZYCA 4X21A 1GJOA 4C4GA 3BYOA 4O83A 3U87A 2O64A 5B2KA 3ZUVA 1WFCA 3W2OA 2VWXA 2QODA 4G6NA 1ZZ2A 4M0YA 2QVSE 3DLZA 4JR3A 2OXXA 5HGIA 3QUDA 4U9AA 4Q5EA 4EH5A 4F9AA 1H0WA 3NUAA 1MUOA 3JXWA 3WI6A 3UE4A 4DFNA 5B7VA 3N4TA 1S9IA 4PMSA 4F9YA 5KMLA 3BU6A 2B9FA 4FV9A 4QMSA 4EC9A 5M57A 3AC8A 5JRSA 4UZDA 4L7FA 1W8CA 1XR1A 3PJ1A 2EWAA 5T68A 3MV5A 2G01A 4BCFA 4UMUA 4RBLA 3A62A 2H9VA 2YCSA 5GZAA 4LM5A 3NUUA 3QC4A 5E8TA 3HX4A 3MH3A 1TKIA 2O3PA 3NUPA 3SOCA 1J7LA 4GJ2A 2WD1A 3DQWA 3MSSA 5AAEA 4CG8A 2GQSA 4LRMA 5DRBA 3PXKA 4XP0A 5I3OA 5EW3A 3KXMA 3Q52A 3C4ZA 3R9HA 3QYZA 2ZYBA 4UMPA 3WOWA 3C5UA 2HELA 4CLIA 3MTFA 4HVIA 1ZYDA 1YHVA 1BI7A 2QOHA 3F88A 4CSVA 5L3AA 4G3EA 5KUPA 2QU6A 2JEDA 3AGLA 4R78A 3VBQA 1J91A 4FIIA 4C57A 4BVUA 2OO8X 3UO4A 2ESMA 4CMUA 2GNLA 3DJ7A 3DZQA 2VN9A 4IB0A 4G3DA 3VUMA 4G6LA 3F2AA 4BCKA 3QCXA 2NNWB 4DFBA 4BZOA 4CD0A 3JYAA 3DKGA 2BDFA 3LXKA 3R7VA 4ANQA 4BDBA 2FYSA 4KBCA 4JQEA 5AV3A 4ALWA 3OF0A 2C6IA 3CD3A 5D9HA 2PL0A 4D4RA 4M69B 3UZTA 5CZHA 5FP6A 3DFCB 3VBVA 5CEOA 3KEXA 5HNGA 4DA5A 1PXKA 5AMNA 5J5SA 2R7IA 3OXTA 2FVDA 3QHRA 5L8JA 4NL0A 2UW3A 4C2VA 4CNHA 1U54B 3G9NA 4V05A 2YCRA 3BGQA 3P79A 3PWDA 4AE9A 1WBSA 2ITOA 3NLBA 4RFZA 4Z55A 5JN2A 4FKVA 3HGKA 1NY3A 3GC8A 4UMQA 3ZXTA 4AA0A 4D9TA 5J7HA 4ZMFA 2BCJA 2J0IA 4XG4A 4I22A 4CKRA 4O7RA 3D7TA 4R6VA 4WG3A 1ZY5A 3TACA 4X2JA 3QKMA 4FIJA 2QOLA 3L9NA 3QWJA 1OVEA 2Y6OA 4OT6A 1JOWB 4O1PA 4PQNA 4MK0A 4X2KA 4OUCA 3BQRA 5EQPA 3SV0A 4CFFA 3CPBA 4FL3A 3R0TA 4G9RA 5AUUA 2WFYA 3JVRA 3S0OA 2PYWA 1VJYA 3MFSA 4LOPA 2BROA 5JZNA 5IQBA 3Q5ZA 2FB8A 4W4XA 4EZ3A 1OZ1A 3IW8A 3ZOSA 4BFMA 3PDTA 3NNXA 5BYZA 3PVBA 4RIXA 1YRPA 4D58A 5AR4A 3L9LA 5L6PA 2KULA 3KCFA 3MY5A 1REJA 4GEOA 2JBOA 2JDVA 3HUBA 4XJ0A 5DR2A 3O23A 3COMA 3EJ1A 5FRIA 3VUTA 3QGYA 2E9UA 3CPCA 3KB7A 4BB4A 4BDHA 3L9PA 4XG6A 2IW9A 4IWQA 3HA8A 3E5AA 4R5SA 5DN3A 1Z57A 3IQ7A 1BYGA 4BGHA 4DFLA 2X4ZA 4I6BA 4C4EA 3NR9A 5G1XA 3P1AA 1FBNA 3BWFA 3IW6A 1IAHA 4IBMA 2A19B 4N6YA 4BN1A 4DEEA 2VNWA 2C5YA 3QTZA 2E9NA 4DG0E 4F6WA 4F7SA 5CAPA 5HQ0A 4TWPA 5EKNA 4XNEA 3HMIA 3M2WA 3D94A 4C4FA 2QG7A 2X81A 5AUVA 4ZXTA 4FI1A 3IDBA 3GQLA 3G15A 2GFCA 5AWMA 5LVNA 4FKRA 3ZBFA 3BHYA 5EYCA 3FZTA 4WNOA 2OSCA 3IGOA 3MGYA 3ZH8A 5K5XA 2R0IA 4QMPA 5L6OA 4XP2A 3MPTA 4EZ5A 4GL9A 5CVFA 4C3PA 1JLUE 4QPMA 5KKRB 3WE4A 4KRCA 2QI8A 3QTWA 2IZSA 3FLQA 4DEGA 5LVLA 4C59A 4CQGA 4EKLA 1Q8UA 4FZ7A 2VTPA 4S34A 3UGCA 1PF8A 3R02A 4WNKA 1FGIA 4KIOA 3F5PA 3A4OX 1J3HA 4HGEA 2JDTA 3KRRA 3D5VA 3E8EA 4FG9A 3EKNA 4IWPA 3UDBA 3OOMA 4MNEA 5IQAA 4O7NA 4GKHA 4AOJA 3KCKA 4YJQA 5D10A 4S32A 4F6UA 3PIZA 5IQFA 2X7GA 1UA2A 4AZWA 4IX5A 3WYYA 2HIWA 5A54A 3F6XA 4YLLA 2HWPA 3FZ1A 3TG1A 3AT4A 3UNJA 4YTIA 5IA2A 4I94A 4OBOA 4TL0A 2OIQA 3D83A 2B9JA 2Y4IC 3LM5A 1KE5A 3C50A 1Y6BA 4L68A 4YBKA 3TWJA 4MXCA 5J9ZA 3HRCA 4FSQA 3ZRKA 4LRKA 2CGWA 4HVHA 2JAMA 3DFAA 3UPZA 3U6HA 5TE0A 2W1FA 3FMJA 1CTPE 2ZDTA 2XKDA 4RC3A 3OUKA 3IECA 5H8GA 3UYTA 4BCJA 3RWPA 4I24A 3KULA 3EN5A 2R3IA 2F7ZE 1XJDA 3SLSA 4NIFA 2Z7SA 4U81A 3RWQA 4AU8A 2EB3A 3R63A 4IE9A 5HE1A 2YABA 4GFMA 3SG8A 4S30A 4Y72A 2OICA 4DCAA 4YGAA 3LCKA 5EYKA 3TV7A 3ODZX 4D55A 2GDOA 2PK9A 2NO3A 1ZZLA 3NYOA 1Z5MA 4FOCA 4QPSA 3EYGA 2YM7A 4V0GB 5FXSA 2H6DA 5E8VA 2XB7A 3BKBA 4D1SA 3UOKA 2CGUA 3VS4A 5AP6A 4ZZNA 3RMFA 2PULA 5KBQA 2HW6A 2J4ZA 3W2PA 5IQHA 2WMRA 1NXKA 4CQEA 4TWCA 2XKEA 5ETAA 1UV5A 4K0YA 1FMKA 4NM3A 4KS8A 2J6MA 1OL5A 3VVHA 3FY2A 4AW2A 3FYKX 2ITTA 4JXFA 3NW7A 5F4NA 3L9MA 5FTOA 4J97A 4UXLA 1YDTE 3ORPA 3WZEA 4RJ4A 4NM0A 4HGTA 4QYEA 3PSCA 3UVRA 4XG9A 5ACKA 2WU7A 5ANGA 3C0IA 2BPMA 1V0OA 2C6LA 3FL4A 3PY0A 3KK9A 4L6QA 4RWIA 3D2IA 3ZLYA 4L00A 2R3KA 4YURA 4CGAA 2HW7A 3G0FA 5E92A 4X2GA 4C0TA 1UU8A 4Z7GA 2PUNA 1R78A 1B38A 4I0TA 4L45A 5I9VA 1R3CA 3ET7A 5CF8A 3ZTXA 1P4FA 1P14A 3QTSA 4KSQA 3GGFA 3OBGA 2J0MB 4FTTA 5J1VA 2RGPA 4D4VA 3UOHA 1MP8A 3CCNA 4WSYA 3R8UA 3WIKA 1NVQA 3TKUA 3LM0A 4F1MA 3QQUA 3MVJA 4D1ZA 1YOJA 2J2IB 3DKFA 3E8DA 4HW7A 3BV2A 2VO7A 3FLZA 3FZPA 4R7HA 2OBJA 2G1TA 2VWBA 4FTIA 4R7IA 2WHBA 4YZ9A 4BDJA 1W7HA 2FH9A 3UIUA 3G6HA 4Q9ZA 5ANOA 3O8TA 1H25A 5GZ8A 2VWIA 1BL6A 3VO3A 4UY9A 4FA2A 4MVFA 3QKLA 4FSUA 5CEMA 3A61A 2GFSA 3EB0A 4RC2A 3WIGA 1OUKA 3H0YA 5A4QA 4EQUA 4IC8A 4EQCA 4M84A 1O6LA 3RZBA 2PZ5A 4L8MA 3FLYA 2VUWA 3HZTA 3PZHA 4EHVA 4I1ZA 1SVGA 2IWIA 3CTHA 1GIIA 4KBKA 3TKIA 4AT5A 4ZAUA 4L46A 4AN2A 2WMAA 5LMKC 3VAPA 4I6HA 4NTTA 3A7GA 4AF3A 5I3RA 3PJ8A 3HV7A 5DA3A 4E6QA 4NEUA 3CP9A 4TWOA 5HE2A 4ZLYA 5L4QA 2C1BA 5LQFA 4IZAA 1V0PA 4ZTLA 2EXMA 3OWPA 4KA3A 3UP2A 4PDYA 2YDJA 1ZMUA 3E64A 4DGNA 4JL9A 4YZNA 5M55A 2CHLA 3P5KA 1IA8A 3D2KA 3DB8A 1UNGA 3GB2A 4DYMA 1XH9A 3MB7A 4AZTA 1CDKA 4W4YA 2YERA 5FLFA 4EONA 2IZUA 2GS6A 3IDCA 4HJOA 4PL5A 2XIRA 1YOMA 4F4PA 4G3FA 4DFZE 5CI6A 2WQEA 4EYMA 4MXOA 4BIBA 4FKSA 4M12A 3SW4A 2B9IA 5E9EA 2QKRA 4USFA 2EU9A 3BYVA 5KMNA 5HKMA 5M07A 1BLXA 4QYHA 3KVXA 4I0SA 2WKMA 2XK7A 5BVWA 3PJCA 4WNMA 3OW3A 2VD5A 3GCPA 3NVKI 2CGVA 2C6KA 2XNEA 3R7UA 3SC1A 5AJQA 4JG8A 4AQCA 4CV9A 4UN0C 1Q8YA 3PLSA 3DT1A 5JH6A 1WBVA 3FQHA 4JBQA 3VUIA 4BI1A 5KMIA 2V62A 5A3XA 2PVFA 3G90X 4ZJIA 2R64A 1XHAA 2F49A 2WXVA 4RIXB 2UZWE 3QHWA 4R5YA 3RALA 4MF0A 3NNWA 3QTIA 5CYIA 5H2UA 5LMKA 3G9LX 2A27A 3DBFA 4FNXA 3OCBA 4KIQA 3D5XA 4G3CA 5DT0A 3ORLA 1JSTA 1RDQE 3TEIA 5CALA 1M14A 4ZTSA 1PMEA 4FSZA 3WZKA 5AP4A 2C0OA 3EQHA 1OPKA 3RM7A 4YSJA 2J51A 4M8TA 2VU3A 2QLUA 4TRLA 2HZIA 4XG7A 3PJ2A 3VS3A 4BICA 4OTWA 3PA3A 4TW9A 5K0XA 3AGMA 3EL8A 3ZUTA 4DTBA 4PPBA 3RPRA 4QQTA 1SVHA 3FLWA 4HYSA 5C8NA 3LFEA 2CCIA 3TTJA 4FOBA 5IQIA 4UMTA 2XEYA 3PXRA 5EHOA 5AUXA 3ATSA 1SYKA 2WQOA 3QTQA 4I5HA 5CSPA 4FV2A 3BBTB 3PA5A 1Q97A 2UW7A 3P7BA 4DBXA 4PNKA 3BI6A 4BCPA 1YXUA 2DQ7X 5I0BA 4AZSA 4H58A 4RVLA 5EH0A 1YI6A 2YIQA 3KQ7A 4U8ZA 4P5QA 5CVHA 3VC4A 4D4YA 2QLQA 2UVXA 4YHJA 3QQKA 3U8WA 3MJ1A 2YWPA 4WOVA 4FL1A 4CTBA 4J8NA 4A4OA 4OBQA 1OUYA 1ZAOA 4FV5A 4DN5A 4BDEA 5EHLA 2VO0A 2I40A 2CKEA 2WZJA 4MNEB 1K9AA 3FPMA 3GU6A 3QGWA 4RGJA 4AW1A 3DDPA 4V04A 4GVAA 5AV1A 2BR1A 3TL8A 3BX5A 3QAME 4FTAA 4HZSA 5AFVA 4W9XA 4TY1A 4AGWA 5KZIA 3E7VA 2R5TA 3I0QA 4O96A 3FBVA 4TKSA 5L2IA 4GH2A 1KE6A 4D5KA 4CTCA 4D9UA 4ZZOA 2RIOA 2I0VA 5EYDA 4FV8A 3QQLA 3UVPA 4PUZA 3PRIA 4PV0A 2ACXA 4FV0A 2VTHA 3PJ3A 2IVSA 4C37A 1O6KA 4BTKA 3D7ZA 2V7OA 3DK7A 2VV9A 2VX1A 3KULB 3NNVA 3PXYA 4FEWA 3LOKA 2X1NA 5KE0A 4ASEA 4L9IA 3MY1A 2ZB1A 3E87A 3ULIA 3NCZA 2ITXA 2IVUA 3RP9A 4ACHA 3LLAA 2WQNA 4QQCA 3BLRA 2JLDA 3SG9A 4DLIA 4RLLA 3F5GA 4JJRA 4M68A 4U97A 3LFBA 4JDHA 4CYJA 3QX4A 4C33A 3V8WA 1DI9A 1Q61A 4O0XA 1Y8YA 1H27A 5BMMA 3DNDA 3EFWA 3KVWA 3DCVA 3H9OA 3PZEA 3EQFA 3PFQA 3QQJA 3R04A 4EBWA 3E88A 4XX9A 4QP8A 5HBHA 2QO2A 4QP3A 5HU3A 4CKJA 4KABA 3C0HA 1JNKA 3GU7A 3NZ0A 1VR2A 2XH5A 5DPVA 2J0JA 2WTWA 3DGKA 4PDPA 5EFQA 4BWKA 3OTVA 3R21A 4XG8A 4ZSLA 2W1GA 2OJGA 4JBOA 2Z7RA 4U43A 3KU2A 2R3FA 4H39A 4RA5A 4FSNA 2ITPA 4RMZA 5LMAA 2W4JA 2QOIA 4DEIA 4JOAA 2ZV8A 5BVOA 2BFYA 2BIKB 5KO1A 1LEZA 2BIYA 3U6IA 3N51A 4B8MA 3PLAE 4FVQA 5CQWA 2CNQA 3D14A 4IM0A 5IDNA 4DITA 4KD1A 1YXTA 4XG2A 4ZY4A 3GU5A 4U44A 4O7ZA 5FEQA 5E8UA 3TN8A 3PE2A 4NW6A 4QP7A 5J9LA 1HCLA 4UEUA 4BCIA 2YISA 2R3RA 5F94A 4NW5A 4TYGA 2AUHA 1U46A 4IC7A 4AZVA 4ZMEA 2Z8CA 3FL5A 2ZVAA 5EW8A 2GQGA 3VBXA 3RAIA 4FV7A 3QZHA 3IOPA 4FICA 3RAHA 4AGDA 4AUAA 3KC3A 3R28A 4F64A 2NRUA 4ALUA 3OT8A 4TTHB 4EOJA 4USDA 4FSYA 5EG3A 3VJNA 3MN3A 3OUNB 3LMGA 3ORMA 2YITA 3O17A 3OROA 3R01A 4AP7A 4BTMA 2YACA 2IW6A 2R9SA 5HCXA 4EOPA 2WQMA 4LOQA 5DWRA 3VS2A 5AIKA 2J5EA 4EOIA 1DS5A 5CENA 5CI7A 2Y9QA 4CCBA 3SAYA 5E8YA 4BYJA 3BU5A 4FZDB 4FSMA 4K1BA 3TIYA 4Z9LA 1CKPA 4AFJA 3RI1A 2IVTA 4M67A 4EHZA 3FXZA 4WBOA 2IZTA 3BHHA 2X9EA 3DAEA 4FTNA 1YW2A 4IHPA 4UWYA 1GY3A 4IX3A 5HO8A 3V5JA 3QZFA 5LCJA 3DXQA 4BY9E 3QALE 3NDMA 4IAAA 3EN6A 4N4SA 4FR4A 4RQVA 4K33A 3BYSA 4FIGA 2F4JA 1ZXEA 3C4EA 3DJ5A 3GT8A 2EXCX 3ROYA 3UC3A 4CFUA 2YN8A 4A4LA 4LOOA 4A06A 3R73A 1V0BA 3NX8A 1OPJA 1PKGA 3F61A 2PZIA 4IMYA 1AGWA 3VS0A 3D5WA 5JEBA 2QO9A 3QRKA 4ZTHA 3QU0A 1IA9A 4FK6A 2J90A 3EN4A 4NH1A 4E6CA 3IS5A 3BLQA 4OTPA 4N6ZA 2ZV9A 1UKIA 4HYIA 1QPCA 1DAWA 3LW0A 4J96A 4X6QC 5K0KA 3ORNA 1YQJA 3QLGA 3O51A 2BKKA 2RG5A 4AW5A 4EWHA 1UU7A 2OKRA 3CE3A 3N4VA 3MDYA 1YDSE 4LGDA 4MBIA 1XQZA 3UYSA 1X8BA 5HVYA 4J7BA 2JDRA 1LPUA 2P4IA 3JVSA 4J95A 4KIKB 4L67A 4XV9A 2W5HA 2X39A 3W2SA 5BVKA 1Q4LA 1ZMVA 4K11A 1OKVA 1LEWA 3RK7A 3F5XA 5A4LA 5BUJA 2UV2A 2X7OA 2C4GA 4I6FA 4O6EA 4BC6A 4CEGA 4KSPA 4XLIA 2OFUA 3MH2A 2ZB0A 4ONAA 3HP5A 5KX8A 4IX4A 1G8SA 1U4DA 2JBPA 5DT4A 4CFNA 3FI8A 4O82A 1GZKA 3QUPA 3BIZA 3KF4A 3PPZA 1CM8A 3EWHA 4FKWA 3ANRA 4Z7HA 4ASDA 5EI2A 4CT2A 4H3PA 1G5SA 2GSFA 4IM3A 1JKKA 1PMUA 4EORA 3TNWA 1H00A 2LAVA 1OL2A 1ZMWA 3PXFA 4R3RA 3TV4A 4F7LA 4UBAA 4EL9A 1Y6AA 3GUBA 5CU0A 4XH6A 4LQMA 2O2UA 2X2MA 3F66A 4BCQA 4UV0A 1JKSA 1IG1A 1SM2A 1WBTA 2C6TA 2W1CA 3PVGA 4HPUE 3BELA 5J1WA 3C4CA 3HAMA 5GJGA 4BCNA 5HTCA 4FKTA 4B9DA 4OGRA 3Q2MA 4WO5A 3CKWA 4QP1A 4AFEA 4USEA 5M06A 4BR3A 1DAYA 2XK6A 2ETMA 2BRGA 3UNZA 5IEVA 4FEQA 3V51A 2XNGA 3DK3A 1IEPA 4QP2A 3FMDA 4LI5A 2CLXA 5CNOA 4YTFA 4MBJA 3A2CA 2JFLA 2UW8A 3W2QA 1WMKA 5HZNA 1PY5A 5K5NA 3A7JA 1B39A 2WTVA 3NMUF 3E63A 5I9YA 2CN8A 3DV3A 2XNOA 3WZUA 4E20A 1IASA 1KOBA 1H1RA 1W0XC 3NS9A 4RJ3A 3ZONA 3MH0A 2A1AB 4RFYA 4HOKA 3ZM9A 2BZIB 2O0UA 5KKRC 2P0CA 2PE0A 3WF5A 3KY2A 1PW2A 5HICA 1BMKA 2QOOA 4CMOA 5CXZA 3OD6X 3G51A 2PZRA 5BPYA 4KUJA 4O7YA 2XIZA 2PVJA 5E91A 2ITYA 4FNYA 4R3PA 3CBLA 2E9OA 5HE0A 3N9XA 3G6GA 4EJ7A 1ZWSA 3ZXZA 1Q8WA 3KXNA 4D0XA 5EI6A 4M13A 5DI1A 2PMLX 2W7XA 4JBVA 3W55A 2FGIA 4CRSA 2B54A 2VWWA 3HRBA 5M44A 4JQ7A 2PUIA 3FEGA 2BKZA 4P4CA 3LCSA 1PXOA 4IXPA 3RKBA 4BWXA 4ITHA 2C0IA 4C02A 2OJJA 4DH1A 5F1ZA 4QTCA 5AX9A 5BYLA 2G2HA 2VTJA 4M0ZA 3VQUA 3WF6A 3C13A 2ZJWA 5LARA 4ANBA 1XH7A 3LKMA 4DEAA 4QTEA 5JGAA 3V5WA 1W98A 2PVYA 4IAZA 4U40A 3VUGA 5JKGA 2G2FA 5AP5A 3WARA 5IPJA 2DS1A 4A9YA 3FDNA 5A4EA 1PRYA 4QP9A 4MXAA 4OTRA 5T6KA 5CS6A 4JQ8A 3SHEA 4U45A 1WBPA 4RJ5A 5LCKA 3PPJA 4RZVA 2FSOX 5AV4A 4HCVA 3VS5A 3KRLA 3NUSA 1OB3A 3KXHA 1Z9XA 3VNTA 3G2FA 3PG3A 3MVMA 3E8NA 4YC8A 3JPVA 5CEIA 1XH8A 4BWPA 5LXMA 3HNGA 2WU6A 2V22A 2YAAA 4D2WA 1ZARA 2QU5A 2QURA 4EOKA 4F70A 3LFQA 3TUBA 2BVAA 3P23A 4K2RA 4GK4A 4LMNA 3U9CA 3DK6A 4F09A 2XMYA 2EUFB 3LVPA 5IA5A 4O7VA 4EH6A 3QCQA 3R00A 4F0IA 5C4KA 4OAVB 2GNFA 4MCVA 3ZSIA 2XIKA 3SX9A 1H08A 5C01A 4K18A 2XJ0A 4P2KA 4R3CA 5CLPA 3B2WA 4GS6A 5H8EA 3FQEA 4O81A 4RIWA 4E4MA 1UKHA 2XEZA 2GHLA 1PKDA 3VBYA 2ZM4A 3FYJX 2B55A 3Q4UA 3S00A 4ACCA 4G2FA 1OIQA 2XIYA 4YO6A 3HYHA 3MFTA 4RLKA 1L8TA 3R2BA 4BBFA 3R1NA 3D5UA 2YZAA 4Y5QA 1M7QA 3F7WA 1G8AA 3MESA 3LIJA 1GAGA 4IDVA 1Q62A 1I09A 4X3FC 4YMJA 4EOMA 5E1SA 5FD2A 1KWPA 3BE9A 4KB8A 4YNEA 5EM5A 2QHMA 3II5A 5E8SA 4FUXA 3H4JA 4FVPA 4FBXA 3SOAA 2YLEA 2IPXA 3P86A 3VW8A 5HG7A 2BILB 1UVRA 2E9VA 4Q9SA 4R77A 4MWHA 5E8ZA 5AP1A 5AV2A 2PTKA 4WHZA 2X2KA 3Q4ZA 4UWCA 1YDRE 2XA4A 3FLSA 1YWNA 2H96A 4WIHA 4BDFA 4YJPA 5FEEA 4KS7A 2P3GX 1WVYA 3GNIB 3R7IA 1FINA 4MTAA 4ZJVA 4Y73A 4H3QA 1WBWA 4OTFA 4YZBA 5KHXA 3FHRA 5CAUA 3ANQA 2V5QA 1M7NA 4QO9A 4GKIA 2JKOA 4FSTA 3R8VA 2WEVA 4HYUA 1CKJA 3KRWA 4IVDA 4DFYA 4JX3A 5CAOA 4GMYA 2W5BA 3MFUA 4G1WA 5JFXA 4ZTRA 4EUTA 2JIUA 4G34A 4XV2A 5D41A 1UWHA 4YTCA 2ZV2A 3GFWA 5JSMA 2QHNA 4GUEA 5HHWA 5M4IA 4U7ZA 3O7LD 4D4SA 3Q6UA 2WTCA 2VRXA 4NZWB 1VEBA 4TNBA 4WT6A 3MIYA 4UYNA 1RQQA 5DEWA 4AACA 5BNJA 1QPEA 3LMHA 4CFWA 4NCTC 2CMWA 3OFMA 3GCSA 4X3FA 4ANMA 4B7TA 1ZOGA 4FNZA 2PWLA 3L8PA 3FE3A 2XUUA 3NYVA 4NTSA 2XP2A 2PMOX 2WOTA 2GCDA 2WTIA 3HLLA 3OBJA 4QMYA 4WUNA 4WKQA 4AZEA 1CSNA 3KGAA 4CCUA 2VZ6A 4YZDA 4WRGA 4FKJA 4MKCA 1U5QA 1XH6A 2XKCA 4PL4A 5CSHA 2YM4A 5K3YA 2SRCA 3RCDA 3ZC5A 3LFFA 4RVMA 4XG3A 5J79A 4ANOA 4EC8A 3ZMMA 5HORA 3DNEA 4MQ2A 2PPQA 3W10A 2OW3A 3DOGA 4G17A 4C4HA 1JPAA 2UZUE 3F69A 2OZOA 4AG8A 4IX6A 1SZMA 2DWBA 3LE6A 4KKHA 2G2IA 4BGQA 3TDWA 3UQGA 1XBCA 5ANKA 3ZSGA 1JSUA 2PVNA 4WUAA 1O9UA 3EZRA 1ZYLA 4KINA 5EQYA 2C47A 1J1CA 4JX7A 5FGKA 4ACDA 4QOXA 4EOOA 1NT2A 4J53A 4MWIA 5HG5A 2H34A 3KN6A 4YZCA 3WF7A 3DY7A 5A46A 4JRVA 2XF0A 1R39A 5JRQA 2JAVA 1BI8A 2Q0BA 4A4XA 4YHTA 5BUIA 3H0ZA 4O7SA 4BCGA 3IK3A 4P5ZA 3D0EA 5IISA 3A7FA 4W8EA 1O6YA 4F1OA 3WYXA 3F3UA 4FZ6A 1UU9A 4E7WA 2QKWB 2DUVA 2QCSA 4O7LA 3JY0A 3F82A 4I5PA 3KKVA 1OBDA 3QZGA 1BUHA 4NCTA 4QMQA 2QQ7A 3BEGA 3HV6A 5CU6A 4F08A 5LWMA 1ND4A 4M66A 2UW4A 2OFVA 3KXZA 4L3LA 3UP7A 5L2WA 4IEBA 4ZJJA 1M2RA 4O84A 4IZ7A 4G31A 5EW9A 4R8QA 4C4JA 3VUKA 5DGZA 4GRBA 4GFGA 1KUTA 2CKPA 4ZLZA 2WIHA 4C62A 4L53A 5HD4A 2VAGA 3NAYA 5J9YA 4NYEA 3RHKA 3QQFA 1S9JA 1ZLTA 4C7TA 4FT9A 3E8CA 2QNJA 3LQ5A 1XH4A 3ALNA 2A2AA 5FBOA 4BCMA 4CLJA 1JKTA 4RX7A 3QL8A 4O7TA 4AE6A 2UZLA 2UZVA 2VTSA 4C8BA 3K54A 3QXOA 4ITJA 4B6LA 4YJSA 3OG7A 4ARKA 4O91A 3FKNA 3COIA 2R2PA 2Z7LA 2R3QA 3ZDIA 5GZ9A 1YKRA 5A6NA 2R4BA 4IZ5A 4H1MA 4RVTA 5DG5A 3VS6A 1PMVA 2JFMA 3HV5A 5ETCA 5G6VA 4AA5A 4EOSA 2HOGA 1WVWA 2IVVA 3GXLA 1M2QA 4FG8A 3EN9A 4GUBA 4ZTNA 4N70A 3ZRLA 4ZOGA 2WOUA 3ZEPA 4ERWA 2UZEA 3IKAA 5BVEA 5HX8A 3U55A 2FSTX 3H9RA 3I6UA 2R3LA 4WNPA 3R9DA 5AEPA 3P78A 4HYHA 1WBNA 3UZPA 3BHUA 3RNIA 3TM0A 5AIRA 3PUPA 3FKLA 3OXIA 4IVCA 4RJ7A 3IW5A 2C6OA 4C4IA 4FODA 3EOCA 4M97A 4YHFA 4YUQA 1RJBA 2WIPA 3O7LB 5AP0A 3Q9WA 2OZAA 2DYLA 3I5ZA 3W8LA 3ZFMA 4CV8A 4OTQA 4E93A 5CF4A 1QMZA 2PSQA 4DEHA 4ITIA 3FXXA 4EZ7A 2HY81 2B1PA 2VWZA 2WEIA 3AD5A 3EIDA 3RPSA 1KE8A 4JDIA 4JR7A 2WMWA 4XLVA 2WTKC 3V5TA 5KMOA 2HK5A 4OTHA 2GHMA 5DOSA 3JR1A 5M4FA 3F3ZA 2E2BA 3PVUA 3NNUA 2UUEA 2PVHA 2ETKA 3A8WA 3LCOA 3R8PA 5BVFA 3E93A 5M09A 3UG1A 4X3JA 2NRYA 3ENHA 3F5UA 2W1IA 3ULZA 4G3GA 5DMZA 1OL6A 3DXPA 2RL5A 4O21A 2GMXA 5LWNA 4U5JA 5AV0A 3REPA 3C5IA 2VWUA 3N4UA 1T45A 1R0EA 3ROCA 3V04A 3O50A 2W99B 3I6WA 4D2PA 4QPAA 1H8FA 2VX3A 3QLFA 5H3QA 5IG1A 3NVMB 1OI9A 2BMCA 3SQQA 4A7CA 4O22A 5E4HA 5GIOE 3S4QA 2I1MA 5C03A 3R6XA 2ZAZA 3GBZA 3B8QA 4B8LA 3VUDA 4YSMA 3OEFX 3SRVA 5J87A 4UWBA 3AT3A 3TI1A 1XBAA 2JC6A 2ZMDA 3L8XA 3D7TB 4ZEGA 3LJ0A 5ACBC 5HO7A 2BAJA 2BUJA 2XRUA 1LUFA 3A7HA 4FZFB 5HG9A 4C36A 5AAGA 4C38A 4YLKA 2WO6A 2ZDUA 1ZOHA 4IQ6A 3MPAA 5AAFA 4GYIA 3HAVA 4BKZA 4EK3A 2ETRA 2XK3A 1MRVA 2W5AA 4PWNA 2E9PA 3LQ8A 2A0CX 3SXSA 5GINE 4D2TA 5IQCA 3R9OA 4EK8A 5JMSA 4EQMA 4WA9A 5IUIA 4QYYA 4RIWB 1WCCA 3LJ1A 4ZS0A 4IVAA 4RT7A 4JRNA 3Q5IA 1NA7A 3QWKA 2Q83A 3RGFA 3LCDA 2C5VA 3ZLWA 2W96B 4QTAA 2CCHA 3QQGA 4FGBA 4APPA 1IRKA 2WNTA 3OY1A 3UVQA 5BX0A 4ZSJA 4E5WA 4DLJA 4L01A 3KFAA 1SNUA 4WSQA 2YLFA 2AYPA 3FZOA 3TZ8A 5JQ5A 1K3AA 5I9WA 1CMKE 5FDPA 3NWWA 4ACMA 1H1WA 4JS8A 2Z02A 1Q5KA 1PXLA 2FUMA 2OF4A 5AP7A 1FOTA 3NW6A 2YWVA 4MXYA 4D0WA 3DKCA 3EQIA 3VJOA 5AADA 2YCQA 4GU9A 4I93A 3DBCA 3OCSA 2ITQA 4A07A 1F3MC 3ORXA 1MQ4A 4L44A 4X0MA 5BQ0A 2H8HA 3QF9A 2WB8A 2RG6A 3BEAA 3LHJA 3O8PA 3DKOA 4O0VA 2WTJA 3DQXA 3UZRA 3TCPA 4ZLOA 1Y8GA 4QMXA 4EH3A 4PPAA 3ERKA 4O1OA 4JDKA 3VBTA 4FF8A 4ZSAA 4YZMA 1FVTA 5CZIA 3RNYA 3OP5A 5IMEA 4BZDA 5E8XA 3CXWA 5HG8A 5CF6A 2IJMA 5IF1A 2C1AA 3U4WA 4ENXA 2JDSA 4LL5A 3CEKA 4HVSA 1OPLA 4IIRA 3DJ6A 5BUEA 4Y83A 2FA2A 2W06A 3LJ2A 4B4LA 2QONA 1DI8A 4CXAA 2X9FA 5TT7A 4BIDA 4FNWA 1UWJA 3QD2B 4KRDA 5FWKK 3VBWA 4E4LA 3UO5A 2W17A 2HZNA 4M15A 1Y57A 1VYWA 3QD4A 5A4CA 4OTIA 3CJGA 4I5CA 5GNKA 1PXIA 3OVVA 2XJ2A 2NP8A 4X3FB 3FJQE 3BRBA 5HCYA 2IW8A 4F63A 5HVJA 2X6EA 2YA9A 2YIXA 5EDQA 1AD5A 4IH8A 4M69A 2YIYA 1JVPP 1MQBA 4GYGA 4PNIA 3LFDA 3FI2A 4UYAA 1M17A 4HGSA 3AMYA 2B53A 2WMQA 3S2PA 4TYEA 1GIHA 4YO4A 4CG9A 5I9ZA 4BZNA 4YR8A 5LVMA 3FWQA 5EQEA 2HENA 2YIRA 4FV6A 4CFXA 4HVDA 2B9HA 3PYYA 3CQEA 4FV4A 2O8YA 4FKQA 4NIFB 3BLHA 4IACA 2F2CB 4ZS4A 4LYNA 2IO6A 3FHIA 4JIAA 5JGBA 4YJOA 4D28A 4AW0A 5TR6A 3WILA 3MW1A 4XS2A 1Q8ZA 5HESA 2YAKA 1QPDA 1H26A 4NSTA 3NIZA 5HLWA 4FG7A 1BKXA 4RIYA 5HEZA 5GIPE 4QMTA 2OJFE 5K4IA 3CSVA 3UOLA 3FMKA 3QTXA 3Q60A 4JVGA 4DC2A 1GZOA 3PVWA 3BE2A 3PP0A 5FUTA 5C8KA 2QR7A 2WPAA 3QCYA 3UC4A 4ZTQA 2W1EA 3CJFA 3ZDUA 1JKLA 3BZ3A 4FKUA 5KMMA 3VF9A 3FLNC 2QOBA 3PTGA 4DH7A 4RQKA 1A9UA 4YPDA 1UNHA 1I44A 2O65A 3SD0A 2UZDA 4OLIA 4CRLA 4IADA 2VGOA 4EH2A 4MX9A 2BZHB 5CU4A 1YHSA 3ZM4A 3DXNA 3KF7A 2Y4IB 3PSBA 1IAJA 1E1VA 2OIDA 2F7EE 3BYUA 3PPKA 3ZO4A 4FTQA 2EXEA 2GTNA 3VHEA 3O2MA 1YWVA 4ALVA 3MYGA 4TYHA 4IW0A 2P2HA 5IH6A 4X2NA 3RHXA 5HD7A 3ZLXA 3POOA 3FMNA 4XP3A 3AG9A 3C51A 4PTEA 2BRHA 5HIBA 2QOFA 2XNPA 4G5JA 4ANLA 1PYEA 4GT5A 5EOLA 4E3CA 5IZFA 1PXPA 3MPMA 3LMIA 5HBJA 5CX9A 2GNJA 2WELA 3AC2A 2GHGA 2JITA 1R0PA 4L43A 3OOGA 3UJGA 5DBXA 2W4OA 3BU3A 4L3PA 4QT1A 5L6WL 3QQHA 2HY0A 5GHVA 3ZBXA 3OT3A 4F0FA 4GG5A 2UW0A 4DG2E 2PVKA 4F7NA 4IVBA 5EKOA 4CT1A 2IN6A 3A99A 3COHA 2NPQA 3H30A 4LG4A 4NM5A 5HBEA 4LV8A 5LOHA 1F5QA 3FMLA 5DFPA 1MRUA 5EOBA 4U41A 2JKKA 2XS0A 3F2NA 3CTQA 3P0MA 1KE7A 2BRMA 3DAJA 3OW4A 4J99A 3WZJA 4D2VA 4Y5HA 3GU4A 5D12A 4YP8A 1RE8A 3KMWA 4NWMA 3UBDA 3HUCA 3NYXA 5IUGA 3MVHA 3MA3A 3Q2JA 4XRLA 4C34A 1XBBA 5HOAA 2JGZA 4NU1A 2XIXA 3FMHA 4JDJA 4PMTA 5I4NA 3R83A 4RWJA 5HU9A 4I41A 3GU8A 2RFSA 4YLJA 4DFUA 3E3PA 1WAKA 3BPRA 4F6SA 3GEQA 4YC3A 3TJCA 4RC4A 3VN9A 3LQ3A 4J98A 3ZC6A 2UW9A 4GIHA 3CKXA 5B0XA 4BTFA 4PDSA 2ZM1A 3UIBA 4E4NA 3RTPA 3U51A 3KN5A 4RG0A 4BDCA 3L8VA 2C5OA 3LPBA 3RCJA 5I9XA 4CMTA 4DGLC 2O5KA 3ZSHA 4I4FA 3I7CA 1DM2A 2UW5A 3NGAA 3V6SA 4FEXA 4GG7A 4S31A 5A14A 3P7AA 4DEBA 4DAWA 4C61A 1TVOA 3FAAA 4U6RA 2RF9A 3LXNA 3R22A 5DHJA 5A6OA 1ERKA 4DTKA 4IB5A 2HAKA 3R2YA 4D5HA 5HIEA 4FKGA 4H05A 5JT2A 4NKAA 5FBNC 2BHHA 4GV1A 5AM6A 1OIYA 4I23A 4EH9A 3FY0A 3R8MA 3FSKA 4PRJA 5BVDA 2CGXA 4G5PA 4J8MA 5DRDA 3SDJA 5LMBA 4FEVA 2PE2A 3LCTA 1ZYJA 2R3OA 1GZNA 4BI0A 1LR4A 3CQUA 3RINA 5ANJA 2HYYA 2YCFA 3SRVB 4LFIA 4D2RA 5E90A 5J8IA 2QC6A 3ENMA 1PYXA 3QFVA 4ANSA 3FMEA 2OI4X 4V0GA 2X4FA 5KMJA 3KL8A 1YOLA 3W2CA 2CDZA 3ZS5A 1OBGA 1P4OA 4RSSA 2XCKA 1F0QA 3I79A 5B2MA 4R7BA 2JDOA 5JK3A 3MJ2A 2J0LA 4WRSA 4RZWA 4YJUA 4XRJA 3CY3A 3OXZA 4N57A 5FM3A 4IM2A 3UIXA 2XYUA 1YWRA 4NM7A 3D9VA 2VGPA 2FO0A 3CQWA 2C6DA 4AN3A 4OR5A 2UZNA 3EFJA 3ZHPC 3RAKA 4GT3A 4FV1A 3T3VA 4F9WA 5IQGA 4I92A 5CVGA 2WMUA 3QBNA 2VTOA 2V55A 3CS9A 3TNQB 2UZBA 4MXZA 2F9GA 2Z60A 5BVNA 5CAQA 5IU2A 4L3JA 5JFWA 3GP0A 3IW7A 2BTRA 5C27A 5CEQA 3RK5A 3UMXA 2XM8A 4GT4A 2XM9A 4FIHA 4YJNA 3Q96A 3IDPA 4TZRA 3F9NA 1IR3A 5AA8A 3HVCA 2ITWA 3BHTA 3RPOA 4ENYA 4IJPA 5FTGA 4LGGA 2B4SB 4AZFA 5IA4A 4AS0A 4OT5A 4ZY6A 4E1ZA 5FXRA 3L1SA 5JQ8A 5AUWA 2YDIA 3AC1A 5J95A 3EQRA 5F9EA 4DINA 3OY3A 1H24A 2OK1A 4ACGA 4EH7A 4XCUA 5EI8A 4GCJA 1YXSA 4GW8A 3DU8A 3OCGA 3LFAA 4P7EA 2GS2A 5DLSA 5EHYA 2ITVA 2WMSA 3LFCA 4TN6A 3DLSA 2R3NA 4DBNA 3MY0A 4XHKB 2PMNX 1J7UA 4BKYA 4RWKA 2GNHA 5DR6A 5CTPA 1ATPE 4KAOA 4F0GA 2QG5A 3T9IA 2YZLA 1WZYA 3ITZA 3BV3A 3FI3A 3QA0A 3AXWA 4RX8A 5CAVA 4BBEA 5HVKA 3R8ZA 3SA0A 4Z16A 4HCUA 2AC5A 2C3JA 4LUEA 3GOPA 3VUHA 2X8DA 3JY9A 3IO7A 4NK9A 3W33A 4F9CA 3E7OA 3R7OA 3ZFXA 4H3BA 2YM6A 1E1XA 3QTUA 4FMQA 4H36A 4I6QA 2I7QA 4JT3A 2UZOA 3FZRA 3TUDA 1H07A 5JZJA 5AR5A 2GTMA 5AP2A 2WGJA 4DEDA 4EK6A 4GK2A 4K77A 3IGGA 5CF5A 1ZRZA 3T9TA 5IUHA 1BX6A 2UZTA 4FZAB 4LUDA 4Q2AA 4O0TA 3QD0A 3EFKA 1TQPA 3VULA 3FMMA 3SVVA 1J7IA 2BFXA 2XBJA 2PZPA 3UG2A 2Z2WA 4DHFA 4E5AX 3MBLA 3TNHA 3OCTA 4FT7A 4UXQA 4BIEA 3AD6A 5JFVA 4DF3A 3DPKA 3VS1A 4AA4A 3AC4A 5CXHA 1JAMA 3Q53A 4U79A 3AC5A 4IDTA 4IFGA 2EVAA 2BRNA 4PMPA 2QOCA 4FIFA 3RVGA 2Y6MA 4M14A 3MI9A 2JKQA 4FT3A 5AR7A 3M42A 2VTLA 4HVGA 3HV4A 5I9UA 2J9MA 3HMMA 1H01A 2W9FB 5HE3A 5HLNA 4RX5A 4II5A 2ITNA 4O0RA 2PHKA 5HTBA 3ALOA 3K2LA 3LZBA 4GK3A 4QD6A 4HNIA 5IQDA 5GJDA 1FQ1B 3ORKA 1URCA 2V0DA 4M3QA 1REKA 1XH5A 5CY3A 1B6CB 2Z7QA 4NUSA 4RIYB 3ZYAA 2R3GA 4Y85A 4IFCA 5FG8A 5C8MA 3WF8A 3GCVA 2GS7A 3FXWA 4FSRA 4I3ZA 4CVAA 3FV8A 4FEUA 1OM1A 2P33A 3QRTA 4MD8E 3FUPA 2Q0NA 3NUXA 3PE1A 4DGMA 5L2TA 4KBAA 1PXJA 3W8QA 3UODA 4D1XA 3GFEA 4CZTA 1H28A 5C26A 4O86A 5AUZA 3CGOA 3ATTA 4U3ZA 3QRUA 4JG7A 3TTIA 4DCEA 4FC0A 4BL1A 3PA4A 1A06A 3QTRA 4XOZA 4I20A 3TKHA 5KNJA 5M51A 4FTOA 4NFNA 5TOZA 1NVSA 2R7BA 5FTQA 5ANIA 2HZ4A 4YNOA 4G16A 3QKKA 2PVLA 3QXPA 2GU8A 3SW7A 2A4LA 4UX9A 3PSDA 3KXGA 4C3FA 3V5QA 4PTCA 3QC9A 5IH5A 3CY2A 3EMGA 4HCTA 1G3NA 4TYHB 3W1FA 2CKQA 3UO6A 4W4WA 2G15A 3OWJA 1OGUA 4TPTA 2C69A 5CT0A 4RA4A 4BBMA 2C30A 3KRJA 4CYIA 4EHEA 4OBPA 1U5RA 5CQUA 4LV5A 2CLQA 1PXNA 2O63A 2IZRA 4KIPA 5D7AA 2OLCA 4EOQA 3OMVA 2AC3A 5IH4A 3I4BA 1YXVA 2ERKA 4AXAA 4JBPA 5EM8A 4EJNA 2C3LA 1ZYSA 3U9NA 4DE4A 2W4KA 1MRYA 4IAIA 1QCFA 3Q4CA 4ZK5A 2WMXA 3HRFA 3UQFA 3EQBA 3C9WA 2C0TA 2J50A 4RX9A 1OKZA 3P4KA 2BHEA 4JAIA 4BCOA 4F7JA 5IA0A 1WBOA 3I5NA 4HPTE 4QP6A 5CSXA 1KOAA 4F9BA 3ZLSA 3O71A 2F7XE 4FTCA 3Q32A 4TNDA 5HX6A 2W05A 4K9YA 3K5VA 3OS3A 5EDPA 4DGGA 2IG7A 5EM7A 2X6DA 5J5TA 4O0SA 3OC1A 4WD5A 2OF2A 3C0GA 1EH4A 2YFXA 4LMUA 4RPVA 1URWA 4UZHA 3V5PA 1OMWA 3G5DA 3L8SA 1OIUA 1R1WA 2R3JA 4NT4A 4QTBA 3RZFA 3QYWA 3WZDA 4GFOA 4EK5A 4IJ9A 4FTRA 1KSWA 1JQHA 4IANA 5KMKA 3C7QA 1ZOEA 5C1QB 1XO2B 4OTDA 5F95A 3KXXA 4AOIA 3M11A 3MWUA 2PVRA 3FSFA 4DH8A 4TXCA 3DAKA 5CU3A 2CSNA 3CD8A 2BAQA 3EL7A 5I5ZA 2XBAA 3ZZEA 1OL1A 3UNKA 1H1QA 2GNGA 4MHAA 4QP4A 3UTOA 3WF9A 5JGDA 2CNVA 4DTAA 2Y0AA 2R0UA 4ID7A 5EDRA 3VIDA 3H3CA 3NPCA 2GQRA 3A60A 1Q3DA 1QPJA 4IB1A 3VW6A 2YJSA 3GC0A 2OWBA 3NUNA 5D11A 3A4PA 5AM7A 2PU8A 2VTAA 2OG8A 5HI2A 4FUYA 2P2IA 5LVOA 5DIAA 2RFDA 1A48A 4FE2A 3D4QA 3HMPA 2Y4PA 5F20A 1SMHA 5IA1A 4OW8A 4QRCA 4D2SA 4MYGA 4E8AA 4ORKA 1YXXA 5IMXA 4W9WA 4CFVA 4O7WA 1HOWA 3PWYA 4FT0A 4YJTA 5K4JA 4L7SA 4RRVA 2C6EA 3PRFA 3HDMA 4JLCA 3IPHA 4W4VA 4FTLA 3NCGA 2PVMA 3R9RA 3WE8A 3R30A 4PPCA 3RM6A 4KWPA 3P08A 3BGZA 2XZSA 3B8RA 4NJDA 4QMVA 4QMNA 4C35A 1OIRA 4E4XA 4QQ5A 2XCHA 2W0JA 4RJ8A 4S2ZA 4BDAA 2ZV7A 2XNBA 1M2PA 2WMVA 1QL6A 3EZVA 5H8BA 4ZSEA 5FEDA 2VX0A 5HTIA 4QNYA 4RJ6A 3NEWA 3NIEA 2VTMA 3ORTA 2YIWA 3S95A 4Y8DA 1Q3WA 4E6AA 1VZOA 2VTNA 2X2LA 4I4EA 4YBJA 3IOKA 4DGOA 2CNUA 3G33A 5JFSA 4UALA 2FSLX 3RBWA 2QO7A 3EQDA 5KZ0A 4PTGA 2PY3A 4Z3VA 2YM3A 3V6RA 4BHZA 4APCA 4XUFA 1Q41A 1J1BA 1UU3A 3R1QA 2WMBA 5AR2A 1NW1A 2F2UA 3E62A 3QCSA 2ONLC 2W1DA 3EHAA 3P9JA 4QMWA 3V01A 3W18A 3W2RA 1XKKA 3PIXA 3ODYX 3EN7A 3EFLA 5FQDC 4IWDA 4BRXA 3PG1A 3S3IA 4Q5HA 3HDNA 4GU6A 4AGUA 3NW5A 5T3QA 5J7BA 4PX6A 3TNPC 1JSVA 1SVEA 3VF8A 2W1ZA 3BYMA 5HLPA 4EKKA 2FSMX 3KMUA 1YI4A 5AX3A 3HMNA 4O2PA 2CKOA 4R1VA 5DEYA 4GJ3A 5IQEA 5D1JA 2VTTA 3E92A 2WMTA 4O27B 5CWZA 3KRXA 3QX2A 2OJ9A 5ITAA 5FM2A 3DBDA 4AN9A 3MH1A 1H4LA 5IKWA 3PXQA 2BAKA 4FGRA 1YHWA 2XK9A 4JG6A 3RAWA 2B52A 1OL7A 2Y8OA 4EYJA 2PMIA 4L42A 4C2WA 2HWOA 1W83A 5C4LA 3H10A 1V1KA 5LJJA 3AD4A 3JUHA 3K3JA 2XKFA 4OTGA 5FP5A 4HZRA 2R3HA 2JIIA 3TZ7A 4YU2A 3C1XA 2VTRA 3D15A 3I81A 5CEKA 4X6RA 3EYHA 3ORIA 4DG3E 4O38A 4F1TA 3R1SA 1KV2A 4FTUA 4CFMA 4CZUA 4FTMA 1K2PA 4FTKA 4AT3A 4FVRA 2C6MA 3MB6A 2WQBA 3VWAA 4BKJA 3R7EA 2BALA 2HXLA 2ONLA 4LRJA 4KIKA 4TT7A 4A9UA 4E6DA 3COKA 3Q9YA 4EH4A 3BQCA 1CKIA 4EWQA 4BDGA 1KE9A 3AMAA 3RK9A 2QD9A 3CIKA 4ZIMA 2WTDA 1HCKA 3HEGA 4PY1A 5HNIX 4MXXA 4A9TA 4MF1A 4TYJA 3HMOA 3Q3BA 4XYFA 2VO3A 3R71A 3A8XA 4FX3A 5K9IA 4BI2A 2I6LA 4ZZMA 2BDWA 2HZ0A 4MAOA 4XEYA 4EBVA 5IA3A 5EK7A 3VS7A 3GCQA 1FGKA 5CNNA 2G9XA 4BF2A 3DDQA 2HCKA 5ANEA 3H9FA 2PUUA 1T46A 5FXQA 3ZEWA 5L8LA 1NVRA 3TZ9A 4DH5A 3C4WA 4G9CA 5H9BA 4AT4A 5HIDA 4Y95A 3I1AA 2ZMCA 4XOYA 2RKUA 4PDOA 3AT2A 4M7IA 5CASA 4EUUA 4S33A 5EM6A 5AR3A 3F7ZA 3GI3A 3ELJA 3THBA 4FKPA 4JAJA 3F3VA 4OAUC 4WBBB 4W8DA 2OH0E 3AOXA 3LXPA 3DA6A 4AWIA 1U59A 3NUYA 2YM8A 1H1PA 2X7FA 3OWKA 4QQJA 1H1SA 1E9HA 4PL3A 3QRIA 3V8SA 3MA6A 2QR8A 3GVUA 4PF4A 4NJ3A 2PZYA 4IAKA 3R7YA 2VTQA 5TO8A
chains in the Genus database with same CATH superfamily
4UMRA 4UB7A 5ETFA 3UQCA 1ST4A 3SGCA 5DNRA 5L2SA 2BRBA 3EQPA 1Y91A 4LL0A 4MQ1A 4XV1A 2WAJA 1W2CA 2ERZE 4KKGA 3U4UA 4E73A 5AUTA 1PMNA 4QYGA 2Y7JA 4GIIA 3UPXA 4JNWA 2I0EA 3ACKA 1FVVA 2UW6A 3ORZA 2GNIA 3LAUA 4IAYA 2OIBA 2KTYA 3DS6A 1XWSA 3FPQA 3R8LA 3CC6A 3K3IA 3Q04A 4GSBA 1ZY4A 3HL7A 4FSWA 5M08A 4LGHA 3ETAA 1GNGA 4R1YA 4YTHA 3QD3A 2C5XA 4O2ZA 4MD9E 3I60A 3CR0A 3POZA 5A9UA 3NSZA 4XBUA 5L8KA 4DT9A 3HKOA 4NFMA 3R9NA 4YC6A 5CT7A 2J0KA 2V7AA 3IW4A 2ZOQA 4JIKA 1FPUA 2XNNA 1Q24A 3DTWA 2VO6A 1TQIA 3Q6WA 4C58A 3C4FA 5KBRA 4KKEA 1W84A 2YHVA 1BL7A 3DB6A 4XV3A 4ZP5A 2JIVA 4C3RA 1SNXA 5AP3A 3QA8A 3P7CA 5DT3A 2X8IA 3TZMA 3AMBA 3R7GA 5KCVA 4CKIA 1W82A 2XNMA 3TNIA 4BDIA 4EH8A 2QOKA 2F57A 3BWJA 1U54A 3GENA 1M52A 4TWNA 3VHKA 5EYMA 3ZO1A 4QTDA 4BYIA 3GQIA 3Q4TA 4FV3A 5ANDA 3RPVA 3T3UA 4AGCA 2XJ1A 4FT5A 5HO6A 2C5NA 5HCZA 4PP9A 5DR9A 4J52A 3OZ6A 3NRMA 1OKYA 3NYNA 3TIZA 5AR8A 2PUPA 4O0YA 3FC1X 2VNYA 4BDKA 5AA9A 3OHTA 4MH7A 2J5FA 4N0SA 1KV1A 3Q9XA 5BMSA 1STCE 3SXFA 3V5LA 3BHVA 3U6JA 4FYOA 3ZO2A 5M4UA 3UOJA 3HP2A 3QZIA 4FL2A 3B2TA 1Q8TA 4QMLA 3PY3A 4MNFA 4QMZA 3SKCA 4A9RA 4DH3A 3TT0A 3PXZA 3U54A 5IDPA 2I0HA 3A7IA 5TF9A 2OJIA 2YDKA 3GCUA 3VRZA 3FZSA 5GJFA 4Y46A 2C68A 5L2QA 4EK4A 5M4CA 4RFMA 3I0OA 4U3YA 2CPKE 4BHNA 4J1RA 3EH9A 3GC7A 2UVZA 1P2AA 3BGPA 1OITA 5DYJA 2RFEA 3AQVA 3FC2A 3DTCA 4U0IA 4IWOA 4FYNA 3QRJA 2ZM3A 4ZTMA 1PXMA 2R3MA 2RSVA 2VTIA 1Q99A 4B0GA 5BYYA 2AEGA 3MIAA 3IONA 4EI4A 5CEPA 4RVKA 3JS2A 2OGVA 4J71A 5CSWA 1AQ1A 3CTJA 3LLTA 1YVJA 3GC9A 5CU2A 5FDXA 4E5BA 4XBRA 3CGFA 4TYIA 5CSVA 2I0YA 3K5UA 3ZFYA 5B2LA 3UIMA 3W16A 2B0QA 4L52A 3ZU7A 2OXYA 4FTJA 3DBEA 3TJDA 4K6ZA 2BDJA 3ZRMA 4ASZA 3AKLA 3CLYA 2J7TA 5E1EA 4G6OA 3QUEA 3C4XA 2W1HA 3G0EA 3EQCA 3MVLA 3TXOA 3HV3A 4YJRA 2VWYA 1OECA 1L3RE 5LVPA 4QDEA 3I7BA 4F99A 1PHKA 3PY1A 3RPYA 4DT8A 4IZYA 3GOKA 2XK4A 2CN5A 4O0UA 4U80A 2GPHA 5ETIA 4FKOA 4I0RA 3R1YA 4GVJA 4IB3A 3DBQA 5IEXA 2PE1A 3DZOA 3ZZWA 2W9ZB 5HNBA 1JWHA 4MD7E 3MFRA 4X2FA 4E26A 3OWLA 3FI4A 2OU7A 4NKSA 5DH3A 5M56A 4K8AA 5ICPA 4O4EA 1PJKA 4CZYB 3BCEA 3V8TA 3KMMA 4X7QA 4BDDA 4JI9A 3BBWA 4FIEA 4YJVA 2HXQA 4FKIA 1WVXA 3OEZA 5D7VA 5KHWA 2OZAB 4QMOA 3TV6A 4AOTA 4V01A 4F65A 5DE2A 1RW8A 4MUQA 3EKKA 1GZ8A 4AAYA 1OKWA 3KREA 2BZJA 2EB2A 2P55A 4EHGA 4PMMA 4B99A 2REIA 3PP1A 3LFNA 4BGGA 4QYFA 2XVDA 4O0WA 2YM5A 4I5MA 5M53A 1YI3A 3FKOA 3VRYA 1GIJA 4RWLA 3MS9A 3NAXA 4H1JA 2B7AA 2X0GA 3F3TA 2OH4A 3W32A 3HECA 4ASXA 1P5EA 4HGLA 3HA6A 4ERKA 3VQHA 2C3KA 1JBPE 1VYZA 1FVRA 5AUYA 2UVYA 4EOLA 4KNBA 4RIOA 3MTLA 4ZSGA 4U42A 4BTJA 1APME 4FKLA 4BCHA 2X0OA 3IG7A 5DVRA 3ZCLA 2CJMA 3PIYA 2YEXA 3EQGA 4P90A 5C9CA 3W0OA 5CANA 3O96A 1TQMA 1FMOE 2BZKB 2YJRA 2X8EA 4QMUA 4PP7A 3OTUA 3UMWA 5A4TA 5E7RA 4DFXE 4MEDA 1UNLA 3RJCA 2ITUA 3V3VA 5E8WA 2XYNA 3W0MA 3ZO3A 4HNFA 3ZUUA 4A9SA 2ITZA 3ACJA 3TDVA 3LFSA 2QOQA 3O0GA 4O6LA 5TKDA 2LGCA 3Q9ZA 2C3IB 3KK8A 3S1HA 4YPSA 2VWVA 2JD5A 3F3WA 4WG5A 3T8OA 4AQKA 4AAAA 3WBLA 4XMOA 4EEVA 3LXLA 2RFNA 1LP4A 2XRWA 3M1SA 2R3PA 3FQSA 4I21A 4QMMA 3E3BX 4AX8A 3F2RA 2OXDA 4WG4A 4FK3A 4IAFA 4ANNA 2BTSA 1GOLA 2WTKB 2XK8A 3KA0A 3O8UA 4MBLA 3SXRA 4ZY5A 2JKMA 5IEYA 3ID6C 3AC3A 4QNAA 3TUCA 1H0VA 1ZYCA 4X21A 1GJOA 4C4GA 3BYOA 4O83A 3U87A 2O64A 5B2KA 3ZUVA 1WFCA 3W2OA 2VWXA 2QODA 4G6NA 1ZZ2A 4M0YA 2QVSE 3DLZA 4JR3A 2OXXA 5HGIA 3QUDA 4U9AA 4Q5EA 4EH5A 4F9AA 3ML1A 1H0WA 3NUAA 1MUOA 3JXWA 3WI6A 3UE4A 4DFNA 5B7VA 3N4TA 1S9IA 4PMSA 4F9YA 5KMLA 3BU6A 2B9FA 4FV9A 4QMSA 4EC9A 5M57A 3AC8A 5JRSA 4UZDA 4L7FA 1W8CA 1XR1A 3PJ1A 2EWAA 5T68A 3MV5A 2G01A 4BCFA 4UMUA 4RBLA 3A62A 2H9VA 2YCSA 5GZAA 4LM5A 3NUUA 3QC4A 5E8TA 3HX4A 3MH3A 1TKIA 2O3PA 3NUPA 3SOCA 1J7LA 4GJ2A 2WD1A 3DQWA 3MSSA 5AAEA 4CG8A 2GQSA 4LRMA 5DRBA 3PXKA 4XP0A 5I3OA 5EW3A 3KXMA 3Q52A 3C4ZA 3R9HA 3QYZA 2ZYBA 4UMPA 3WOWA 3C5UA 2HELA 4CLIA 3MTFA 4HVIA 1ZYDA 1YHVA 1BI7A 2QOHA 3F88A 4CSVA 5L3AA 4G3EA 5KUPA 2QU6A 2JEDA 3AGLA 4R78A 3VBQA 1J91A 1G8JA 4FIIA 4C57A 4BVUA 2OO8X 3UO4A 2ESMA 4CMUA 2GNLA 3DJ7A 3DZQA 2VN9A 4IB0A 4G3DA 3VUMA 4G6LA 3F2AA 4BCKA 3QCXA 2NNWB 4DFBA 4BZOA 4CD0A 3JYAA 3DKGA 2BDFA 3LXKA 3R7VA 4ANQA 4BDBA 2FYSA 4KBCA 4JQEA 5AV3A 4ALWA 3OF0A 2C6IA 3CD3A 5D9HA 2PL0A 4D4RA 4M69B 3UZTA 5CZHA 5FP6A 3DFCB 3VBVA 5CEOA 3KEXA 5HNGA 4DA5A 1XMLA 1PXKA 5AMNA 5J5SA 2R7IA 3OXTA 2FVDA 3QHRA 5L8JA 4NL0A 2UW3A 4C2VA 4CNHA 1U54B 3G9NA 4V05A 2YCRA 3BGQA 3P79A 3PWDA 4AE9A 1WBSA 2ITOA 3NLBA 4RFZA 4Z55A 5JN2A 4FKVA 3HGKA 1NY3A 3GC8A 4UMQA 3ZXTA 4AA0A 4D9TA 3TYKA 5J7HA 4ZMFA 2BCJA 4QDVA 2J0IA 4XG4A 4I22A 4CKRA 4O7RA 3D7TA 4R6VA 4WG3A 1ZY5A 3TACA 4X2JA 3W0NA 3QKMA 4FIJA 2QOLA 3L9NA 3QWJA 1OVEA 2Y6OA 4OT6A 1JOWB 4O1PA 4PQNA 4MK0A 4X2KA 4OUCA 3BQRA 5EQPA 3SV0A 4CFFA 3CPBA 4FL3A 3R0TA 4G9RA 5AUUA 2WFYA 3JVRA 3S0OA 2PYWA 1VJYA 3MFSA 4LOPA 1W2DA 2BROA 5JZNA 5IQBA 3Q5ZA 2FB8A 4W4XA 4EZ3A 1OZ1A 3IW8A 3ZOSA 4BFMA 3PDTA 3NNXA 5BYZA 3PVBA 4RIXA 1YRPA 4D58A 5AR4A 3L9LA 5L6PA 2KULA 3KCFA 3MY5A 1REJA 4GEOA 2JBOA 2JDVA 3HUBA 4XJ0A 5DR2A 4BJJB 3O23A 3COMA 3EJ1A 5FRIA 3VUTA 3QGYA 2E9UA 3CPCA 3KB7A 4BB4A 4BDHA 3L9PA 4XG6A 2IW9A 4IWQA 3O5AA 3HA8A 3E5AA 4R5SA 5DN3A 1Z57A 3IQ7A 1BYGA 4BGHA 4DFLA 2X4ZA 4I6BA 4C4EA 3NR9A 5G1XA 3P1AA 1FBNA 3BWFA 3IW6A 1IAHA 4IBMA 2A19B 4N6YA 4BN1A 4DEEA 2VNWA 2C5YA 3QTZA 2E9NA 4DG0E 4F6WA 4F7SA 5CAPA 5HQ0A 3P5JC 4TWPA 5EKNA 4XNEA 3HMIA 3M2WA 3D94A 4C4FA 3BL7A 2QG7A 2X81A 5AUVA 4ZXTA 4FI1A 3IDBA 3GQLA 3G15A 2GFCA 5AWMA 5LVNA 4FKRA 3ZBFA 3BHYA 5EYCA 3FZTA 4WNOA 2OSCA 3IGOA 3MGYA 3ZH8A 5K5XA 2R0IA 4QMPA 5L6OA 4XP2A 3MPTA 4EZ5A 4GL9A 5CVFA 4C3PA 1JLUE 4QPMA 5KKRB 3WE4A 4KRCA 2QI8A 3QTWA 2IZSA 3FLQA 4DEGA 5LVLA 4C59A 4CQGA 4EKLA 1Q8UA 4FZ7A 2VTPA 4S34A 3UGCA 1PF8A 3R02A 4WNKA 1FGIA 4KIOA 3F5PA 3A4OX 1J3HA 4HGEA 2JDTA 3KRRA 3D5VA 3E8EA 4FG9A 3EKNA 4IWPA 3UDBA 3OOMA 4MNEA 5IQAA 4O7NA 4GKHA 4AOJA 3KCKA 4YJQA 5D10A 4S32A 4F6UA 3PIZA 5IQFA 2X7GA 1UA2A 4AZWA 4IX5A 3WYYA 2HIWA 5A54A 3F6XA 4YLLA 2HWPA 3FZ1A 3TG1A 3AT4A 3UNJA 4YTIA 5IA2A 4I94A 4OBOA 4TL0A 2OIQA 3D83A 2B9JA 2Y4IC 3LM5A 1KE5A 3C50A 1Y6BA 4L68A 4YBKA 3TWJA 4MXCA 5J9ZA 3HRCA 4FSQA 3ZRKA 4LRKA 2CGWA 4HVHA 2JAMA 3DFAA 3UPZA 3U6HA 5TE0A 2W1FA 3FMJA 1CTPE 2ZDTA 2XKDA 4RC3A 3OUKA 3IECA 5H8GA 3UYTA 4BCJA 3RWPA 4I24A 3KULA 3EN5A 2R3IA 2F7ZE 1XJDA 3SLSA 4NIFA 2Z7SA 4U81A 3RWQA 4AU8A 2EB3A 3R63A 4IE9A 5HE1A 2YABA 4GFMA 3SG8A 4S30A 4Y72A 2OICA 4DCAA 4YGAA 3LCKA 5EYKA 3TV7A 3ODZX 4D55A 2GDOA 2PK9A 2NO3A 1ZZLA 3NYOA 1Z5MA 4FOCA 4QPSA 3EYGA 2YM7A 4V0GB 1G8KA 5FXSA 2H6DA 5E8VA 2XB7A 3BKBA 4D1SA 3UOKA 2CGUA 3VS4A 5AP6A 4ZZNA 3RMFA 2PULA 5KBQA 2HW6A 2J4ZA 3W2PA 5IQHA 2WMRA 1NXKA 4CQEA 4TWCA 2XKEA 5ETAA 1UV5A 4K0YA 4DHZA 1FMKA 4NM3A 4KS8A 2J6MA 1OL5A 3VVHA 3FY2A 4AW2A 3FYKX 2ITTA 4JXFA 3NW7A 5F4NA 3L9MA 5FTOA 4J97A 4UXLA 1YDTE 3ORPA 3WZEA 4RJ4A 4NM0A 4HGTA 4QYEA 3PSCA 3UVRA 4XG9A 5ACKA 2WU7A 5ANGA 3C0IA 2BPMA 1V0OA 2C6LA 3FL4A 3PY0A 3KK9A 4L6QA 4RWIA 3D2IA 3ZLYA 4L00A 2R3KA 4YURA 4CGAA 2HW7A 3G0FA 5E92A 4X2GA 4C0TA 1UU8A 4Z7GA 2PUNA 1R78A 1B38A 4I0TA 4L45A 5I9VA 1R3CA 3ET7A 5CF8A 3ZTXA 1P4FA 1P14A 3QTSA 4KSQA 3GGFA 3OBGA 2J0MB 4FTTA 5J1VA 2RGPA 4DHJA 4D4VA 3UOHA 1MP8A 3CCNA 4WSYA 3R8UA 3WIKA 1NVQA 3TKUA 3LM0A 4F1MA 3QQUA 3MVJA 4D1ZA 3VONA 1YOJA 2J2IB 3DKFA 3E8DA 4HW7A 3BV2A 2VO7A 3FLZA 3FZPA 4R7HA 2OBJA 2G1TA 2VWBA 4FTIA 4R7IA 2WHBA 4YZ9A 4BDJA 1W7HA 2FH9A 3UIUA 3G6HA 4Q9ZA 5ANOA 3O8TA 1H25A 5GZ8A 2VWIA 1BL6A 3VO3A 4UY9A 4FA2A 4MVFA 4AXEA 3QKLA 4FSUA 5CEMA 3A61A 2GFSA 3EB0A 4O4BB 4RC2A 3WIGA 1OUKA 3H0YA 5A4QA 4EQUA 4IC8A 4EQCA 4M84A 1O6LA 3RZBA 2PZ5A 4L8MA 2AQXA 3FLYA 2VUWA 3HZTA 3PZHA 4EHVA 4I1ZA 1SVGA 2IWIA 3CTHA 1GIIA 4KBKA 3TKIA 4AT5A 4ZAUA 4L46A 4AN2A 2WMAA 5LMKC 3VAPA 4I6HA 4NTTA 3A7GA 4AF3A 5I3RA 3PJ8A 3HV7A 5DA3A 4E6QA 4NEUA 3CP9A 4TWOA 5HE2A 4ZLYA 5L4QA 2C1BA 5LQFA 4IZAA 1V0PA 4ZTLA 2EXMA 3OWPA 4KA3A 3UP2A 4PDYA 2YDJA 1ZMUA 3E64A 4DGNA 4JL9A 4YZNA 5M55A 2CHLA 3P5KA 1IA8A 3D2KA 3DB8A 1UNGA 3GB2A 4DYMA 1XH9A 3MB7A 4AZTA 1CDKA 4W4YA 2YERA 5FLFA 4EONA 1VLRA 2IZUA 2GS6A 3IDCA 4HJOA 4PL5A 2XIRA 1YOMA 4F4PA 4G3FA 4DFZE 5CI6A 2WQEA 4EYMA 4MXOA 4BIBA 4FKSA 4M12A 3SW4A 2B9IA 5E9EA 2QKRA 4USFA 2EU9A 3BYVA 5KMNA 5HKMA 5M07A 1BLXA 4QYHA 3KVXA 4I0SA 2WKMA 2XK7A 5BVWA 3PJCA 4WNMA 3OW3A 2VD5A 3GCPA 3NVKI 2CGVA 2C6KA 2XNEA 3R7UA 3SC1A 5AJQA 4JG8A 4AQCA 4CV9A 4UN0C 1Q8YA 3PLSA 3DT1A 5JH6A 1WBVA 3FQHA 4JBQA 3VUIA 4BI1A 5KMIA 2V62A 5A3XA 2PVFA 3G90X 4ZJIA 2R64A 1XHAA 2F49A 2WXVA 4RIXB 2UZWE 3QHWA 4R5YA 3RALA 4MF0A 3NNWA 3QTIA 5CYIA 5H2UA 5LMKA 3G9LX 2A27A 3DBFA 4FNXA 3OCBA 4KIQA 3D5XA 4G3CA 5DT0A 3ORLA 1JSTA 1RDQE 3TEIA 5CALA 1M14A 4ZTSA 1PMEA 4FSZA 3WZKA 5AP4A 2C0OA 3EQHA 1OPKA 3RM7A 4YSJA 3UDTA 2J51A 4M8TA 2VU3A 2QLUA 4TRLA 2HZIA 4XG7A 3PJ2A 3VS3A 4BICA 4OTWA 3PA3A 4TW9A 5K0XA 3AGMA 3EL8A 3ZUTA 4DTBA 4PPBA 3RPRA 4QQTA 1SVHA 3FLWA 4HYSA 5C8NA 3LFEA 2CCIA 3TTJA 4FOBA 5IQIA 4UMTA 4AXDA 2XEYA 3PXRA 5EHOA 5AUXA 3ATSA 1SYKA 2WQOA 3QTQA 4I5HA 5CSPA 4FV2A 3BBTB 3PA5A 1Q97A 2UW7A 3P7BA 4DBXA 4PNKA 3BI6A 4BCPA 1YXUA 2DQ7X 5I0BA 4AZSA 4H58A 4RVLA 5EH0A 1YI6A 2YIQA 3KQ7A 4U8ZA 4P5QA 5CVHA 3VC4A 4D4YA 2QLQA 2UVXA 4YHJA 3QQKA 3U8WA 3MJ1A 2YWPA 4WOVA 4FL1A 4CTBA 4J8NA 4A4OA 4OBQA 1OUYA 1ZAOA 4FV5A 4DN5A 4BDEA 5EHLA 2VO0A 2I40A 2CKEA 2WZJA 4MNEB 1K9AA 3FPMA 3GU6A 3QGWA 4RGJA 4AW1A 3DDPA 4V04A 4GVAA 5AV1A 2BR1A 3TL8A 3BX5A 3QAME 4FTAA 4HZSA 5AFVA 4W9XA 4TY1A 4AGWA 5KZIA 3E7VA 2R5TA 3I0QA 4O96A 3FBVA 4TKSA 5L2IA 4GH2A 1KE6A 4D5KA 4CTCA 4D9UA 4ZZOA 2RIOA 2I0VA 5EYDA 4FV8A 3QQLA 3UVPA 4PUZA 3PRIA 4PV0A 2ACXA 4FV0A 2VTHA 3PJ3A 2IVSA 4C37A 1O6KA 4BTKA 3D7ZA 2V7OA 3DK7A 2VV9A 2VX1A 3KULB 3NNVA 3PXYA 4FEWA 3LOKA 4O4DA 2X1NA 5KE0A 4ASEA 4L9IA 3MY1A 2ZB1A 3E87A 3ULIA 3NCZA 2ITXA 2IVUA 3RP9A 4ACHA 3LLAA 2WQNA 4QQCA 3BLRA 2JLDA 3SG9A 4DLIA 4RLLA 3F5GA 4JJRA 4M68A 4U97A 3LFBA 4JDHA 4CYJA 3QX4A 4C33A 3V8WA 1DI9A 1Q61A 4O0XA 1Y8YA 1H27A 5BMMA 3DNDA 3EFWA 3KVWA 3DCVA 3H9OA 3PZEA 3EQFA 3PFQA 3QQJA 3R04A 4EBWA 3E88A 4XX9A 4QP8A 5HBHA 2QO2A 4QP3A 5HU3A 4CKJA 4KABA 3C0HA 1JNKA 3GU7A 3NZ0A 1VR2A 2XH5A 5DPVA 2J0JA 2WTWA 3DGKA 4PDPA 5EFQA 4BWKA 3OTVA 3R21A 4XG8A 4ZSLA 2W1GA 2OJGA 4JBOA 2Z7RA 4U43A 3KU2A 2R3FA 4H39A 4RA5A 4FSNA 2ITPA 4RMZA 5LMAA 2W4JA 2QOIA 4DEIA 4JOAA 2ZV8A 5BVOA 2BFYA 2BIKB 5KO1A 1LEZA 2BIYA 3U6IA 3N51A 4B8MA 3PLAE 4FVQA 5CQWA 2CNQA 3D14A 4IM0A 5IDNA 4DITA 4KD1A 1YXTA 4XG2A 4ZY4A 3GU5A 4U44A 4O7ZA 5FEQA 5E8UA 3TN8A 3PE2A 4NW6A 4QP7A 5J9LA 1HCLA 4UEUA 4BCIA 2YISA 2R3RA 5F94A 4NW5A 4TYGA 2AUHA 1U46A 4IC7A 4AZVA 4ZMEA 2Z8CA 3FL5A 2ZVAA 5EW8A 2GQGA 3VBXA 3RAIA 4FV7A 3QZHA 3IOPA 4FICA 3RAHA 4AGDA 4AUAA 3KC3A 3R28A 4F64A 2NRUA 4ALUA 3OT8A 4TTHB 4EOJA 4USDA 4FSYA 5EG3A 3VJNA 3MN3A 3OUNB 3LMGA 3ORMA 2YITA 3O17A 3OROA 3R01A 4AP7A 4BTMA 2YACA 2IW6A 2R9SA 5HCXA 4EOPA 2WQMA 4LOQA 5DWRA 3VS2A 5AIKA 2J5EA 4EOIA 1DS5A 5CENA 5CI7A 2Y9QA 4CCBA 3SAYA 5E8YA 4BYJA 3BU5A 4FZDB 4FSMA 4K1BA 3TIYA 4Z9LA 1CKPA 4AFJA 3RI1A 2IVTA 4M67A 4EHZA 3FXZA 4WBOA 2IZTA 3BHHA 2X9EA 3DAEA 4FTNA 1YW2A 4IHPA 4UWYA 1GY3A 4IX3A 5HO8A 3V5JA 3QZFA 5LCJA 3DXQA 4BY9E 3QALE 3NDMA 4IAAA 3EN6A 4N4SA 4FR4A 4RQVA 4K33A 3BYSA 4FIGA 2F4JA 1ZXEA 3C4EA 3DJ5A 3GT8A 2EXCX 3ROYA 3UC3A 4CFUA 2YN8A 4A4LA 4LOOA 4A06A 3R73A 1V0BA 3NX8A 1OPJA 1PKGA 3F61A 2PZIA 4IMYA 1AGWA 3VS0A 3D5WA 5JEBA 2QO9A 3QRKA 4ZTHA 3QU0A 1IA9A 4FK6A 2J90A 3EN4A 4NH1A 4E6CA 3IS5A 3BLQA 4OTPA 4N6ZA 2ZV9A 1UKIA 4HYIA 1QPCA 1DAWA 3LW0A 4J96A 4X6QC 5K0KA 3ORNA 1YQJA 3QLGA 3O51A 2BKKA 2RG5A 4AW5A 4EWHA 1UU7A 2OKRA 3CE3A 3N4VA 3TMOA 3MDYA 1YDSE 4LGDA 4MBIA 1XQZA 3UYSA 1X8BA 5HVYA 4J7BA 2JDRA 1LPUA 2P4IA 3JVSA 4J95A 4KIKB 4L67A 4XV9A 2W5HA 2X39A 3W2SA 5BVKA 1Q4LA 1ZMVA 4K11A 1OKVA 1LEWA 3RK7A 3F5XA 5A4LA 5BUJA 2UV2A 2X7OA 2C4GA 4I6FA 4O6EA 4BC6A 4CEGA 4KSPA 4XLIA 2OFUA 3MH2A 2ZB0A 4ONAA 3HP5A 5KX8A 4IX4A 1G8SA 1U4DA 2JBPA 5DT4A 4CFNA 3FI8A 4O82A 1GZKA 3QUPA 3BIZA 3KF4A 3PPZA 1CM8A 3EWHA 4FKWA 3ANRA 4Z7HA 4ASDA 5EI2A 4CT2A 4H3PA 1G5SA 2GSFA 4IM3A 1JKKA 1PMUA 4EORA 3TNWA 1H00A 2LAVA 1OL2A 1ZMWA 3PXFA 4R3RA 3TV4A 4F7LA 4UBAA 4EL9A 1Y6AA 3GUBA 5CU0A 4XH6A 4LQMA 2O2UA 2X2MA 3F66A 4BCQA 4UV0A 1JKSA 1IG1A 1SM2A 1WBTA 2C6TA 2W1CA 3PVGA 4HPUE 3BELA 5J1WA 3C4CA 3HAMA 5GJGA 4BCNA 5HTCA 4FKTA 4B9DA 4OGRA 3Q2MA 4WO5A 3CKWA 4QP1A 4AFEA 4USEA 5M06A 4BR3A 1DAYA 2XK6A 2ETMA 2BRGA 3UNZA 5IEVA 4FEQA 3V51A 2XNGA 3DK3A 1IEPA 4QP2A 3FMDA 4LI5A 2CLXA 5CNOA 4YTFA 4MBJA 3A2CA 2JFLA 2UW8A 3W2QA 1WMKA 5HZNA 1PY5A 5K5NA 3A7JA 1B39A 4DDGA 2WTVA 3NMUF 3E63A 5I9YA 2CN8A 3DV3A 2XNOA 3WZUA 4E20A 1IASA 1KOBA 1H1RA 1W0XC 3NS9A 4RJ3A 3ZONA 3MH0A 2A1AB 4RFYA 4HOKA 3ZM9A 2BZIB 2O0UA 5KKRC 2P0CA 2PE0A 3WF5A 3KY2A 1PW2A 5HICA 1BMKA 2QOOA 4CMOA 5CXZA 3OD6X 3G51A 2PZRA 5BPYA 4KUJA 4O7YA 2XIZA 2PVJA 4O4CA 5E91A 2ITYA 4FNYA 4R3PA 3CBLA 2E9OA 5HE0A 3N9XA 3G6GA 4EJ7A 1ZWSA 3ZXZA 1Q8WA 3KXNA 4D0XA 5EI6A 4M13A 5DI1A 2PMLX 2W7XA 4JBVA 3W55A 2FGIA 4CRSA 2B54A 2VWWA 3HRBA 5M44A 4JQ7A 2PUIA 3FEGA 2BKZA 4P4CA 3LCSA 1PXOA 4IXPA 3RKBA 4BWXA 4ITHA 2C0IA 4C02A 2OJJA 4DH1A 5F1ZA 4QTCA 5AX9A 5BYLA 2G2HA 2VTJA 4M0ZA 3VQUA 3WF6A 3C13A 2ZJWA 5LARA 4ANBA 1XH7A 3LKMA 4DEAA 4QTEA 5JGAA 3V5WA 1W98A 2PVYA 4IAZA 4U40A 3VUGA 5JKGA 2G2FA 5AP5A 3WARA 5IPJA 2DS1A 4A9YA 3FDNA 5A4EA 1PRYA 4QP9A 4MXAA 4OTRA 5T6KA 5CS6A 4JQ8A 3SHEA 4U45A 1WBPA 4RJ5A 5LCKA 3PPJA 4RZVA 2FSOX 5AV4A 4HCVA 3VS5A 3KRLA 3NUSA 1OB3A 3KXHA 1Z9XA 3VNTA 3G2FA 3PG3A 3MVMA 3E8NA 4YC8A 3JPVA 5CEIA 1XH8A 4BWPA 5LXMA 3HNGA 2WU6A 2V22A 2YAAA 4D2WA 1ZARA 2QU5A 2QURA 4EOKA 4F70A 3LFQA 3TUBA 2BVAA 3P23A 4K2RA 4GK4A 4LMNA 3U9CA 3DK6A 4F09A 3UDSA 2XMYA 2EUFB 3LVPA 5IA5A 4O7VA 4EH6A 3QCQA 3R00A 4F0IA 5C4KA 4OAVB 2GNFA 4MCVA 3ZSIA 2XIKA 3SX9A 1H08A 5C01A 4K18A 2XJ0A 4P2KA 4R3CA 5CLPA 3B2WA 4GS6A 5H8EA 3FQEA 4O81A 4RIWA 4E4MA 1UKHA 2XEZA 2GHLA 1PKDA 3VBYA 2ZM4A 3FYJX 2B55A 3Q4UA 3S00A 4ACCA 4G2FA