5CSXA

Crystal structure of b-raf in complex with bi 882370
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
273
structure length
261
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATVKSRSGSILWMAPEVIRMQDPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase B-raf
publication title A Novel RAF Kinase Inhibitor with DFG-Out-Binding Mode: High Efficacy in BRAF-Mutant Tumor Xenograft Models in the Absence of Normal Tissue Hyperproliferation.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 261
sequence length 273
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5csxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5csxA01
1J7UA 3MFUA 5JMSA 5E8ZA 5JFWA 4DEEA 2CCHA 3Q9WA 3WIKA 2Q0BA 3CPBA 4ZSGA 3WYXA 4D4YA 3RWPA 3IDPA 5FBOA 4AG8A 2PUIA 4OTIA 5HHWA 2IVUA 3OXIA 3HDMA 5DI1A 4O7YA 2QOHA 3G33A 4IB3A 3PZHA 4C61A 4KIKA 5CXHA 1W8CA 2C5VA 2WAJA 3RPOA 3I79A 4NUSA 1FPUA 4X2FA 3DXQA 4IB0A 4QMMA 4QMLA 5HZNA 2FH9A 3IW6A 4TY1A 5AV4A 5CWZA 1IA9A 4QQJA 5FEQA 5E8WA 3B2WA 2C3LA 2BMCA 2B9FA 4S33A 3UP7A 4ANMA 4C4IA 3PFQA 4HNFA 1XWSA 3REPA 3SXSA 3RAKA 4BTKA 1OL2A 1B38A 3FQSA 3W8QA 4PRJA 4EQMA 2C5NA 1PKDA 4CTBA 3HEGA 4D5HA 3WZDA 3NYVA 3R7UA 1SM2A 3D5VA 4TNBA 4KBAA 4C02A 4LGHA 4YNOA 2EXCX 4A9SA 1GZKA 2WMAA 4XG9A 4YHJA 3S4QA 3NW5A 5B2LA 4N6YA 5HLNA 3S0OA 2R3JA 4IW0A 4BDJA 3Q32A 3ZO2A 4MNEA 4FIGA 5IA0A 1AQ1A 4D1XA 4O7RA 5BYLA 2OF2A 4IVCA 4A7CA 1V1KA 3CE3A 3TI1A 4BHNA 5IMXA 4ACDA 2NRYA 5HKMA 3DK7A 1O6YA 4CFUA 5CEMA 3N51A 5DNRA 2Z7RA 3W55A 1KE7A 3O8TA 4BI1A 3R2BA 2W0JA 4DTKA 3MVMA 2RFEA 4H3BA 2I7QA 2YFXA 2J5FA 1BI8A 2X7GA 4AGDA 4CKRA 3MESA 2ZMCA 4XP3A 4JG6A 4D4RA 5KMIA 4PDPA 4KKEA 3KU2A 2BILB 4FSTA 1ZY4A 5ANIA 1CTPE 2I6LA 4IWDA 2YLFA 3SG9A 5KMJA 3BV3A 3G6HA 2WEIA 3D4QA 4F6WA 3D5WA 3OBJA 4R3RA 5E7RA 3P78A 5J95A 3HRCA 2WMSA 2W7XA 3DLSA 3RHXA 4S34A 2F2CB 2VRXA 4X2NA 4E6DA 4XNEA 5ANKA 3PA4A 2RG5A 4XV3A 4WHZA 3BU6A 4O0XA 4BCQA 4HYHA 4KRCA 5IA3A 4FVRA 3QWKA 4RZVA 4U6RA 5BX0A 2A27A 5CSXA 3UMWA 5A6NA 4YC3A 5CAVA 3GCQA 3QZHA 4J52A 2WU7A 4QMNA 3HLLA 4D5KA 3GU5A 3A60A 2E9VA 4FTOA 3OWLA 3NVKI 3KN6A 2CKPA 3DA6A 1ZYSA 3CPCA 3TV4A 4NL0A 3O17A 5LWMA 3QTUA 2W99B 2QR8A 5TOZA 3FLNC 3IW5A 2C0TA 3QRUA 3LMHA 3WIGA 4X21A 1JWHA 1M2QA 5LCKA 4XHKB 4DINA 1JKKA 2PZPA 3TZMA 2CDZA 2R4BA 3DT1A 3UYSA 5EKOA 3HZTA 2C1AA 4DLJA 4F9BA 2X1NA 4R6VA 5CU0A 5J9LA 2YN8A 2J0MB 3VUMA 3GCUA 2JDTA 2ETMA 3D5UA 3Q3BA 4USDA 4C38A 1UWHA 1O6KA 4YSMA 4I5CA 4D28A 4IADA 4W4VA 4FEWA 3FBVA 2UUEA 3OUKA 5GIPE 3BQRA 3EMGA 3BPRA 4XLIA 3KRJA 5JEBA 3DBCA 2J51A 4O22A 3TTJA 4BVUA 3DS6A 4D0XA 3V51A 4B9DA 4FICA 4M15A 3SRVB 4LOOA 4YMJA 1PXIA 5J8IA 4OLIA 3MGYA 4EH4A 4EJ7A 3PXYA 3TM0A 2A1AB 4DH7A 2PHKA 3ENHA 1QPEA 2HZIA 3BCEA 5JRQA 3VC4A 3Q4ZA 4X2GA 3N4UA 1O9UA 1YRPA 1KUTA 4BRXA 4ZY4A 4DH5A 2XNGA 1PYEA 4UMPA 3HUBA 2JDSA 1CKPA 2B1PA 4B0GA 2PMIA 3QXOA 4NM3A 4PL5A 4M84A 2V7AA 3JY0A 2J4ZA 3MPTA 4PMSA 2QOIA 4YHFA 3RINA 1BL7A 3NUXA 1M7NA 4YBKA 4LRJA 3BGPA 4DAWA 3SA0A 4CCUA 4IX6A 3LCDA 1U54B 4DGOA 3LMIA 4JR7A 3FY0A 3SVVA 2A4LA 3KGAA 3FMEA 3FI2A 2YM4A 3LM0A 2FUMA 4I0TA 1OKWA 5KNJA 3NDMA 4TRLA 4GCJA 4IAAA 4NCTC 2VAGA 3WZKA 3QHRA 3BE2A 4DG2E 3MFRA 3R2YA 3EFWA 4JL9A 4AF3A 2XNBA 2ZMDA 1YHVA 3GXLA 3I5ZA 3FYJX 5FP6A 5M09A 2CKEA 3QTXA 2QO9A 4DA5A 4TN6A 3HV3A 4MXAA 4FTKA 4QTCA 4DFUA 4K18A 4A9RA 4AN9A 4GK4A 2UVZA 4UV0A 5CXZA 2FB8A 1FINA 4AAAA 4IB5A 2XM9A 2WELA 4NFNA 3LAUA 3ZRMA 2XK9A 3F82A 4BCMA 2HW7A 3ORXA 3QWJA 3MY1A 5DH3A 1CKJA 2VTTA 1GY3A 5KHXA 3FXXA 4WG5A 2YIWA 4YJUA 3K3IA 5KX8A 2IO6A 3FSKA 3IPHA 3SX9A 2P0CA 3VUHA 3TUBA 3CSVA 5B2MA 2ZYBA 2Y4IC 4IC7A 4TNDA 3V8SA 4F7NA 3I7CA 3MY0A 1QPDA 4E5AX 3RPYA 2W1FA 2WQEA 5HO8A 1OIYA 3HL7A 4JX7A 5M44A 3ALOA 2YDJA 4NIFB 5AMNA 2WMBA 1XH7A 2Z02A 3MVJA 4UYNA 3FHRA 5DT0A 2UVXA 4CRLA 1UNGA 1H25A 4YO6A 4D2PA 3QQKA 3QTWA 2YEXA 4ZJIA 4JQ7A 2X8EA 4O27B 3EB0A 4FNXA 2XB7A 3BGQA 3TEIA 4FTJA 3KK9A 4M69A 4TWNA 4XG4A 4R1VA 4A4XA 1SZMA 1R0EA 5HNBA 2WTCA 3A7HA 3L8XA 1JNKA 1PMEA 3RVGA 1Q61A 4F08A 5LCJA 1J91A 1Q8UA 3G5DA 4W8EA 4GJ3A 2VO3A 4QYYA 4CGAA 1XHAA 3R9NA 4F09A 1A06A 3N4TA 5DLSA 2KTYA 2V62A 3ORTA 3KY2A 2O8YA 4Y8DA 4HVHA 1T45A 2I1MA 2R64A 3HX4A 2VTSA 3ENMA 2YM8A 4BDCA 2UZWE 4C35A 5LMAA 3WE8A 4O38A 4BGGA 3ZBFA 2C5OA 3D14A 3VVHA 4BGHA 5H8GA 2CNVA 2BIKB 2QD9A 4RC3A 4Y85A 2WQNA 2LGCA 1XH9A 3KN5A 2WMRA 3FLWA 3RK7A 1HCLA 2GNLA 1H01A 1VYWA 3BEGA 3F66A 2YCRA 3K54A 5DG5A 5AR3A 3JY9A 4D2WA 5A4EA 1ZMUA 3COMA 4YJSA 4BIEA 3SOAA 5J1WA 1FQ1B 5EDRA 4BF2A 2QODA 1V0BA 2ERKA 1CKIA 4HYUA 5HIDA 3ORKA 4KKHA 4X3JA 3TJDA 2OIQA 3QCSA 1S9IA 2JFLA 3HRFA 4J8MA 5L8JA 3PSBA 4L3PA 4DG3E 4BYJA 1ZMWA 3VULA 3C0GA 4QMZA 4ZS4A 5CU4A 3TIZA 4IBMA 4UXQA 3FMLA 5HE2A 4AP7A 4BTMA 3AD4A 4RBLA 4RZWA 5AAFA 4A07A 2WMUA 4FNWA 4AZTA 4DITA 2ITNA 4PUZA 5K9IA 4GKIA 3D15A 3PUPA 4C2WA 1ZARA 5ANOA 3DAEA 3QLGA 4FTTA 2R7IA 3DKOA 3LCTA 5CYIA 3IS5A 3CCNA 3FKOA 5ANDA 4BKZA 5M53A 2BDJA 5BUEA 4FVQA 3CKWA 2WD1A 1G3NA 2BCJA 2Y9QA 2VN9A 4MX9A 2R0UA 2VV9A 4DFXE 4JX3A 3WF9A 5HVJA 1OZ1A 2PVNA 3NUPA 3CTJA 3MS9A 3FC1X 3PXZA 3E5AA 3F5XA 4IXPA 3O0GA 2PMLX 4FZFB 4HJOA 4KIQA 4Q9SA 5DBXA 3U9CA 2B7AA 1OIUA 4C4JA 3LFEA 4YC8A 1OM1A 2YM3A 1FGIA 5D41A 3V5QA 5AAEA 3D2KA 4K11A 4UN0C 3CS9A 1YXTA 2CGXA 5IQHA 4JNWA 1OPLA 4FSNA 4L45A 3QXPA 4AS0A 5IQGA 2UW6A 2WZJA 2PE1A 3P23A 4DCAA 4TPTA 4FT3A 3G9NA 4AQCA 3DAJA 2F7ZE 3RNYA 2OFUA 2VNWA 3F7WA 3HMNA 5D7AA 1KE9A 2OZOA 2O0UA 4EZ7A 2YACA 4RC4A 5HLPA 3ZTXA 3U54A 4RJ6A 3IQ7A 3ZOSA 2YJSA 4AA5A 4CNHA 2IVTA 4NM0A 3R63A 2C3JA 2OXDA 3MWUA 3TNIA 5HG8A 5CLPA 3MPAA 4Y5QA 4FTQA 4ZIMA 4U45A 3PXFA 3QX4A 3ZO4A 4Z3VA 5E8YA 3ULIA 4EH6A 3ORPA 3O23A 4FZAB 3IOPA 4YBJA 5EM7A 4O7VA 2X8DA 4EHVA 4MXZA 3PPJA 4YZNA 3TUDA 3Q2JA 4RVTA 4BDBA 2AC3A 5AX9A 4FKQA 4GG7A 2IW8A 3Q96A 1IG1A 1U46A 3E8EA 4KBKA 3EQBA 4I5MA 4LMNA 4M3QA 3VS0A 4D2SA 2X6DA 4XV9A 4F1MA 4QMQA 2PUPA 4QTDA 4ALVA 4H58A 4CZYB 2XP2A 3I1AA 3OOMA 4AE6A 3FYKX 3WBLA 3AMYA 4GRBA 4PX6A 5IZFA 4IJPA 3VS1A 3EN9A 3P7BA 1DM2A 3KC3A 5EHOA 3V5LA 2W5HA 3QQHA 4XUFA 4MTAA 4XRLA 3P86A 5I4NA 4J98A 3R7IA 4DE4A 3COIA 4LRKA 1WVXA 5LOHA 3IKAA 4U79A 5JZNA 1ZWSA 2ITXA 3RWQA 3QA8A 2QO2A 4BCJA 4XLVA 5AV2A 3NS9A 4AFJA 2ETRA 2WXVA 3OCTA 3MFTA 4JAIA 5IQDA 3KCFA 4W9XA 5EQEA 5CSVA 3UDBA 2XKCA 2C6TA 4EK4A 3A4PA 3LQ8A 3A8WA 4BDIA 3MH2A 1Z9XA 1GOLA 3MW1A 3EZVA 4RVKA 3MA6A 3RTPA 4EH2A 4FA2A 5CVFA 3KRLA 3CGFA 3WOWA 5BVDA 3OCSA 3TNWA 3R22A 4FL3A 4FV5A 5FM2A 3PJ2A 3W2RA 4H36A 2XIYA 5E1SA 5LMKA 4AGUA 1M7QA 3CQEA 3ID6C 1M2RA 1FBNA 5E9EA 4AU8A 1E9HA 3C50A 4Y46A 4WO5A 3NCZA 3HAVA 3MSSA 4L9IA 4RA5A 3QQLA 2GNHA 2XIKA 4GMYA 4BKJA 4FYNA 4ENYA 2GQSA 4AN3A 1NVQA 2ONLA 2XBJA 4MH7A 5DOSA 1KE5A 3BYVA 4I4FA 3FEGA 4IZ5A 1SYKA 4JBQA 2JEDA 4IAFA 1Q99A 4WUAA 4C59A 1Y8YA 3EN4A 3TG1A 4ITIA 4V04A 3P0MA 4IFCA 4TWPA 2YZLA 3II5A 2WGJA 2UZBA 5J9ZA 2PK9A 2UZEA 4X0MA 5EDQA 3CXWA 4O96A 2HIWA 3QGYA 1GZ8A 3LFCA 4XH6A 3W16A 3GI3A 4BICA 1KWPA 2YAAA 2ITOA 3COKA 4IZAA 2CCIA 2J50A 2RGPA 4U42A 4YURA 4PNKA 3FZ1A 2YWPA 4FT7A 4FSWA 1OBDA 3GCSA 5LVOA 3U4UA 4ANNA 4FIIA 4PPBA 2HK5A 3RJCA 1JKSA 4D2VA 3IW7A 3R8UA 4KUJA 4LUEA 4HPTE 4N6ZA 2YDKA 3W2SA 5D12A 5EYCA 3HDNA 3VRYA 1E1XA 1YQJA 3ZSHA 4PMMA 5LXMA 3PXRA 4FTMA 3UQFA 4X7QA 3FQEA 4JDJA 3CP9A 4HYIA 4XG3A 3DV3A 4FKLA 5ETIA 5CANA 3KF4A 4EOIA 3UZRA 1PF8A 1UA2A 3Q5ZA 2OJGA 3E3PA 4FKTA 5FXQA 5BVWA 5KMLA 3ZUTA 1SNXA 4TT7A 4WSYA 4ASZA 3P7AA 4RIOA 2GPHA 4C3RA 4UMRA 2Y4PA 3OTUA 3RAWA 4RLLA 3U9NA 5FTOA 3PA3A 4E93A 4ACGA 3I81A 1JQHA 5I3OA 3VQUA 3F2AA 3R8PA 1FMOE 4DC2A 2YA9A 5D7VA 4RQKA 3SV0A 5C03A 2GHLA 4Z7GA 4EUUA 4B7TA 2YM5A 3DJ5A 3TT0A 2JDOA 3UIBA 5EH0A 2QHMA 3ZC5A 1TQPA 3DFAA 2QU6A 1JPAA 3JXWA 4P5QA 4J7BA 4DEBA 3C4XA 3LMGA 3O8UA 3PPZA 3DGKA 2PPQA 3BEAA 4YJOA 3WE4A 2XBAA 3R01A 4DFBA 2XK7A 2BRNA 1HCKA 1SVEA 3HVCA 5C27A 4ZSAA 2G1TA 1GJOA 1KV1A 1RQQA 2R3PA 4PQNA 3V8TA 4FMQA 4LRMA 5CEKA 3UNZA 3FZOA 3VAPA 4QYGA 4BFMA 5AADA 2JIIA 2P2HA 2UW8A 3R8LA 3NNUA 5F4NA 5AR2A 4DH1A 4XG6A 1H1SA 4WG4A 3LFQA 4JXFA 3PG1A 2WMWA 2YDIA 2UW9A 3MDYA 3QRJA 4APCA 3DTCA 4MQ2A 1UNLA 5FG8A 4C58A 4E6CA 3LFSA 3NYXA 1RDQE 2UZUE 4C33A 3NUNA 2GTNA 5HE0A 5I9WA 2QKWB 3A7JA 5CAOA 5I3RA 4GJ2A 4QRCA 5LJJA 4FKRA 4RIWA 2ZDTA 3P4KA 4NM7A 3C5IA 2NO3A 1ZZLA 2QI8A 3PWDA 3FZTA 4W4YA 5C9CA 2IJMA 3NZ0A 5M55A 4FV9A 4O7SA 2X4FA 5IQBA 3ZM4A 2GQRA 2R2PA 3MB6A 4PMTA 4AXAA 4D4SA 5AUXA 2G2FA 5FP5A 3FL4A 2Y6OA 2ZJWA 4MF0A 4BWPA 5EKNA 4TYHB 2H6DA 3BKBA 4IM0A 4XX9A 2QKRA 5L6PA 4FIEA 3MIAA 3ZO3A 4YLJA 5AV3A 2QO7A 4FKWA 3IDCA 3DCVA 4FIHA 4YJNA 1OIRA 4UWYA 2CNUA 5JFVA 3HV4A 4IAKA 3PYYA 3ZO1A 2XS0A 2O5KA 5AM6A 4MYGA 1H1QA 5JQ5A 3E8DA 3BRBA 1LP4A 4NKAA 3PP0A 3QL8A 4MBIA 4RMZA 3H4JA 5DR9A 4FTCA 4A9UA 1IA8A 4D1ZA 4EI4A 3AC4A 4O7ZA 4QOXA 4D9UA 4F70A 3ZXTA 1UVRA 3H9OA 3FMJA 4U7ZA 2J9MA 3HECA 3RCDA 5CAPA 1ZOEA 3RKBA 2OH0E 2OW3A 3D7ZA 3ZZEA 4BDAA 1R39A 3GC7A 1W7HA 3QD2B 4L3JA 3TZ8A 2JLDA 4L7FA 4RIYB 5IKWA 5IEXA 5HCZA 4GUEA 1YWVA 3H0YA 3LM5A 4YJQA 4AACA 4D4VA 3M11A 5EG3A 4S32A 2PE2A 1KE8A 5AP1A 2RFNA 4FEQA 4LMUA 3ODYX 4RX8A 3I0OA 2DYLA 2OJIA 4U5JA 2C68A 3I7BA 2I0VA 2C6IA 2UZTA 4KKGA 5IQCA 4ANLA 5EW8A 3L9PA 4R7IA 5HIBA 3AD5A 5DRDA 3DNDA 2YCQA 2VTLA 5EW9A 3ITZA 4F6UA 1A48A 1RJBA 3AC1A 3BHTA 5JT2A 5I5ZA 1P4OA 4DFLA 2R3LA 3V6SA 4GT3A 5AA8A 2YLEA 3PRIA 2QQ7A 4QP6A 5C8NA 3OP5A 4WUNA 5EFQA 5JQ8A 4DT9A 3NCGA 2UZNA 3NNXA 3BIZA 4M69B 4DGMA 4AOJA 3VBQA 4JIAA 4KWPA 5KZ0A 4F7SA 2HZ0A 4QP9A 4I41A 2ITPA 2R0IA 2VWIA 2J0LA 4EOPA 4IC8A 1ZOHA 2NNWB 3FI8A 4ZLOA 3FMNA 4NTTA 3UBDA 3Q53A 2X81A 2GS7A 1LR4A 2VO7A 3FLZA 4ZTNA 4F1OA 4FZ6A 3HP2A 4ONAA 3W18A 4UX9A 3PJCA 2XH5A 5BUIA 4Z7HA 4IVAA 3BLRA 2O63A 5IA5A 1OL5A 2JKMA 5FQDC 3CTHA 4JOAA 2O65A 3EHAA 3CLYA 3RALA 4A06A 4C8BA 2O3PA 4M68A 2CKQA 2JBPA 3PWYA 4CFWA 3PP1A 4ZTRA 2ZM3A 2CPKE 3D5XA 4K0YA 4B6LA 2HWPA 4YC6A 3VJNA 4ACMA 4BCOA 1STCE 3ZONA 4GVAA 4MNFA 2YISA 4FT0A 3RGFA 4HCUA 4F9AA 1YDSE 1W0XC 2HZNA 2QHNA 4GH2A 4BKYA 2OJ9A 1DI9A 3F2NA 5E1EA 4AX8A 2HY0A 5JGBA 4G9CA 2B0QA 3F3WA 2YIYA 3EQPA 1NY3A 2RFDA 3HV7A 5CALA 4BZOA 2YAKA 4CD0A 1H07A 1XH4A 2OIDA 5JRSA 4QD6A 4E26A 3MI9A 1GNGA 1ND4A 4DEHA 2H8HA 1BL6A 2FA2A 4TTHB 4IE9A 4R7BA 2PTKA 2P55A 3KMUA 4I23A 5HBEA 5KUPA 4M0YA 1XJDA 3FSFA 4S2ZA 4GVJA 3WF6A 5HCYA 2ACXA 3OZ6A 4HCTA 1YVJA 4F65A 2QOCA 2XK3A 4J95A 3TV7A 3BU5A 3PIYA 4YJTA 3ZSIA 3ORZA 4C3PA 5M51A 2FVDA 2XCKA 4GV1A 3QFVA 4FZDB 4O7TA 5EM5A 3NPCA 3I4BA 4NW5A 3W2PA 3UJGA 1JSVA 4AZSA 5ANEA 4ZZNA 3G90X 4ZMEA 4I0SA 2C0IA 3FZRA 3K2LA 3R7VA 3V5TA 3RK5A 3RAHA 4UALA 1NA7A 1ZOGA 4TYEA 2ITYA 2OXYA 5HI2A 3RMFA 4CQGA 3MJ1A 4WSQA 5BQ0A 3B2TA 1XH8A 3UP2A 3DXNA 4PDYA 3M1SA 3CR0A 4RG0A 4WRGA 4WNKA 4MCVA 4IWQA 5AR4A 3BLQA 2OLCA 3KULA 4L46A 2IZUA 3FJQE 3LJ1A 3NWWA 1OBGA 5FDPA 1GIHA 1OPJA 1YI4A 2PL0A 4M12A 3MPMA 2PUUA 1PXNA 2VTJA 4Q5HA 1AD5A 1KV2A 3A61A 1WAKA 3QKKA 4AW2A 5CQUA 3HV6A 4JQEA 4CG9A 1W82A 5LVPA 3H3CA 4AT4A 1NXKA 4DCEA 2QOOA 1Z5MA 5A4LA 4ASEA 4Y95A 3MB7A 3S1HA 1VEBA 3TACA 5JH6A 4YNEA 3NYOA 4QMUA 3NEWA 3V6RA 5FGKA 3O50A 3CY3A 3TJCA 5AIRA 4O86A 3D83A 4XMOA 1OI9A 2C3KA 4DT8A 2GDOA 4LI5A 3PVGA 4G3FA 2VWWA 3HA6A 2PULA 4ZSJA 3BV2A 3FPMA 4QP7A 2UZOA 3PIZA 3QTRA 2I0HA 2V7OA 3C13A 1KOAA 3G2FA 4RFYA 2JKOA 5FD2A 3FPQA 3R1QA 1XR1A 3LFDA 3WZJA 4AA0A 1K2PA 2J0KA 4JVGA 1K9AA 4TYJA 1T46A 2HOGA 4F9WA 3EFKA 5C26A 4O83A 4U9AA 5D11A 1H24A 2VNYA 5BVNA 5M4CA 2QOFA 4EH8A 3RPSA 4FVPA 5M4IA 3OXZA 5HCXA 2JKKA 5AUUA 4O82A 4R77A 2HCKA 4LOPA 4CQEA 5DVRA 3ULZA 5AR7A 2P33A 2ZAZA 4PPCA 1OUKA 3EN6A 5HG5A 3F5UA 4AT3A 4CZUA 2XK4A 5ACBC 3QTZA 3AGLA 3RZFA 3B8RA 3LFNA 3MVHA 3CBLA 2RL5A 1Q8YA 4JLCA 4BZNA 3KKVA 1OL1A 1CM8A 5CEOA 3OUNB 4PNIA 2FYSA 4RX9A 4E6AA 3A7IA 2X9EA 3NYNA 3PIXA 4RLKA 3VUTA 3W2QA 4I6HA 1PHKA 3FKLA 4TKSA 2WMVA 4XOYA 5KBQA 4DTAA 4QMXA 3F2RA 5CSPA 5CZHA 4I94A 3QQJA 4V0GA 4UY9A 3QC9A 4BTJA 3UVQA 4ZTHA 4EZ5A 4JDHA 3GU7A 4R8QA 2ERZE 5CU2A 4MVFA 5AR5A 1Y91A 2G01A 4O91A 3RP9A 3SAYA 5ETAA 2PVLA 3ZFXA 4HW7A 2BIYA 4DG0E 4RA4A 4GKHA 3TZ7A 4FEVA 1AGWA 4KS8A 5CVGA 4P2KA 4YJRA 4K6ZA 2HENA 3P79A 4EK5A 4FYOA 1Q97A 4ZLZA 3MH3A 4FNYA 3Q6WA 3CQWA 2G2HA 4IVDA 4NK9A 2KULA 3DLZA 3PY1A 4XG8A 4AGCA 1CMKE 1H8FA 4ZXTA 4YJVA 3AD6A 1MRVA 1W98A 4WD5A 5IMEA 2VD5A 4ZEGA 3FLSA 4FODA 4G6LA 4G6NA 4BBFA 4QQTA 2PZRA 1R0PA 4E7WA 3OWJA 4PTGA 2XMYA 1DS5A 3JPVA 1UKIA 4OTWA 5F95A 5I9ZA 3A7FA 5DR2A 3DJ6A 2VWBA 3ORIA 5CI6A 3EOCA 2C0OA 2OJJA 3EQFA 2VZ6A 3TDWA 3V01A 3AXWA 4FL1A 3BYOA 3BHVA 2BRHA 2VO0A 4RVMA 1H27A 2X4ZA 4CYIA 2A19B 1XH5A 2CN8A 3TKHA 4C2VA 2BHEA 2Z7SA 4BB4A 5HTBA 4PP7A 3FV8A 4B8MA 2VX3A 4PTEA 3G15A 4H3QA 4WIHA 4KSQA 5K4IA 2PSQA 5HQ0A 3GENA 4PP9A 3EQGA 1PXLA 2VGOA 3DB6A 2BZHB 4UMTA 2PYWA 3LJ2A 1YXVA 4EH9A 2NPQA 4PTCA 5J5SA 3EFLA 3U87A 4FT9A 3B8QA 4DEGA 4GS6A 2C6OA 2YM7A 5CENA 3NNWA 2GNGA 4OTGA 4GU6A 1OGUA 3FE3A 3PY0A 4MQ1A 4BN1A 4QQ5A 1UKHA 4QP4A 3FLQA 2DWBA 3ZEWA 5E90A 1PMNA 2X8IA 3OW4A 1URCA 2C6LA 2X2MA 2PVHA 4BIBA 3TV6A 2B4SB 4FKVA 4GT4A 3D7TB 4ZK5A 4ZAUA 5HBJA 3NSZA 1H1RA 5EI6A 5H2UA 3V5WA 1YWRA 1YWNA 4NSTA 4DYMA 3UNKA 3QQGA 2JIVA 2OIBA 5CEIA 3ZZWA 1LEWA 2BZIB 4QMYA 1WVYA 3QYWA 3OROA 4DN5A 5KKRB 5DEYA 4H39A 4AZFA 3QKLA 4O6LA 3MH1A 4EJNA 5EHLA 3H30A 2QG7A 3A99A 4F9CA 2RSVA 4QNYA 1Q62A 2OF4A 4QYHA 3LFFA 4KINA 4LGGA 4RIXB 4O84A 2G2IA 3EKNA 2Z2WA 2C1BA 3VRZA 3ZUVA 4GIIA 3AC3A 1FMKA 1F3MC 2WOUA 4FE2A 3AT4A 1RE8A 1ZYDA 3ZFMA 4O0UA 1W84A 3VF8A 4GFOA 5E92A 4MBLA 5DT4A 1MQBA 1OIQA 2PY3A 2QOKA 5AP3A 3G9LX 5TKDA 4BR3A 3IONA 4X2JA 1GAGA 3DU8A 5DGZA 4U0IA 3VIDA 1JBPE 1YI6A 2PVKA 3PLSA 3WF7A 5E91A 2OZAB 3AC5A 3PLAE 4MK0A 5IDNA 3KCKA 4BCNA 3VUDA 3R9OA 3IGOA 2OSCA 4YPDA 3ZMMA 3O51A 4GW8A 3DKFA 2YJRA 4IM2A 2WU6A 2BTRA 4KIOA 3TKIA 3L9LA 5IA2A 2B9JA 2PZIA 3V8WA 3O96A 2QC6A 2YABA 3R71A 1JSUA 4QMWA 2BAJA 5IA1A 5A6OA 5A54A 2E9UA 5BVOA 2VTRA 2Z7LA 4QYEA 4RIWB 4X3FB 2XVDA 2I40A 3CD3A 4FG9A 2QCSA 4FSRA 5HBHA 4E5BA 4K77A 3NIEA 3HA8A 4FV8A 5L2SA 3S3IA 3VUIA 3TIYA 5F9EA 2VTIA 4ACCA 3E88A 4U41A 2GMXA 4BBEA 2F4JA 4ZY6A 4FNZA 2GU8A 3BE9A 4EWQA 5BVEA 4W8DA 2XUUA 4FKJA 4BY9E 5LQFA 5CVHA 5GINE 1QPCA 3PJ1A 5DPVA 4CLJA 5IH6A 5IUIA 4LL5A 5CTPA 3FUPA 5E4HA 2IG7A 3UO4A 3ATTA 3NAYA 3GU6A 3ORLA 4UYAA 3UGCA 1Y6BA 2GTMA 4D1SA 2OU7A 3S2PA 2W9FB 1BLXA 4JS8A 4QMOA 2XIZA 2EWAA 2XNPA 2UZLA 1O6LA 3QHWA 3QALE 1UU3A 4NWMA 3LLAA 3MY5A 2F9GA 3LW0A 3F6XA 4HZRA 4EWHA 4EKLA 4ZTQA 2PVYA 2W1CA 5BMMA 4FTNA 4K33A 5HEZA 4S31A 5BVFA 5BUJA 4JRVA 2W4OA 1BYGA 2OWBA 3P1AA 5AUYA 4W4WA 4EK6A 5IH4A 3WF8A 4G5PA 4IM3A 4QT1A 5M4UA 2VTNA 4BYIA 3U6IA 1TKIA 5FEEA 4P5ZA 5HESA 3HMOA 4B8LA 4QP1A 4K2RA 2GFSA 4USFA 2HXQA 3QX2A 2V22A 2C6MA 1JAMA 1MRUA 5GZAA 4IIRA 3UOJA 3KRXA 3PPKA 5HD7A 3P9JA 1ZLTA 3QUEA 2W4KA 4O2ZA 2X2LA 4OW8A 4UXLA 5F1ZA 3R8MA 1NT2A 3GC8A 4F4PA 2CNQA 3PVUA 4GYGA 2GS6A 3VBTA 4I5HA 1PXMA 3OBGA 3R04A 4JDKA 1YHSA 2XRUA 3GFWA 4X6QC 3QF9A 1PXJA 3JYAA 5GNKA 3ZUUA 1BUHA 3MJ2A 3F5PA 4A9YA 1UU8A 3SRVA 1PY5A 1URWA 4KS7A 1WBSA 1GIIA 4KIKB 3AMBA 3BELA 2YIQA 2WTKB 3TCPA 2V0DA 3QUPA 2PZYA 4XCUA 5DMZA 4CTCA 2XZSA 3WZUA 1MQ4A 2R5TA 5FM3A 3W2OA 4RVLA 4EHGA 4TXCA 3KEXA 5M07A 5AV1A 4R1YA 1VZOA 2H34A 4FI1A 3I6UA 5K5NA 4I6BA 4ITHA 1WBVA 3W32A 1J1BA 4EYMA 3OC1A 3DBEA 3JS2A 3OT8A 4W9WA 3VBWA 3VUGA 2J7TA 4S30A 2GHMA 4F7JA 5L8KA 4L01A 4L42A 1PMVA 2BFXA 2GHGA 5DR6A 1E1VA 2OBJA 4XEYA 4O0TA 4KD1A 4PF4A 3LCOA 4XBUA 4E4MA 4OAVB 2UW4A 4DH3A 1G5SA 3F88A 4L44A 5AFVA 3F3VA 3U6JA 4F63A 1X8BA 2JC6A 4CFNA 3FMMA 3AQVA 2W5AA 1TQMA 4MNEB 4V05A 1P2AA 5L2IA 2WO6A 5AX3A 3OWKA 3CEKA 3OG7A 3QC4A 1F5QA 5ICPA 2VTPA 3E62A 3CC6A 4WNMA 2XK8A 2WNTA 1Y8GA 2BTSA 1PMUA 3BWFA 3O8PA 3F5GA 5KMNA 4H3PA 4RRVA 4AFEA 3OTVA 4QMSA 1WBTA 4R3CA 3NW7A 3FLYA 5C01A 3TTIA 3TN8A 3VS5A 4CG8A 3E92A 1XKKA 4MWIA 4O0SA 5FTQA 3ROCA 2ZM1A 4ORKA 2YM6A 4J96A 5KE0A 5L6WL 3RBWA 3DKCA 3DKGA 4G6OA 4N57A 4IZYA 4LV8A 2CSNA 3LXKA 3QRKA 3EYGA 4JJRA 4AWIA 4U97A 3NMUF 2Z7QA 3E63A 4L52A 2GSFA 4D58A 3G0FA 4FKIA 1H28A 1QL6A 4I6FA 2W4JA 4JDIA 5H3QA 3UO5A 5HTCA 3W10A 4QP3A 2C6DA 3LQ5A 1BI7A 2J90A 2B9HA 2UW3A 4ZOGA 4IMYA 3CJFA 4FUXA 3ZSGA 5IQIA 4FF8A 4NIFA 1YXXA 5AP2A 2BVAA 3M2WA 3MH0A 4JG7A 4L7SA 4KNBA 3MIYA 1ERKA 3E8CA 3DOGA 4BCFA 1OKYA 3KULB 4YZDA 2IWIA 4Z9LA 4AOIA 2BRGA 1NVRA 3QAME 4FOCA 3SLSA 4IAYA 3NGAA 4XP0A 3ZCLA 4D55A 5HTIA 1M2PA 3A8XA 5LMKC 2ITTA 3A62A 1OPKA 4M13A 1GZOA 5M08A 3OMVA 5TT7A 1XQZA 3DDQA 4DGNA 4RJ4A 5CI7A 3UODA 3KVXA 4MKCA 2JAVA 2E9NA 4CFVA 4F0GA 3EL8A 2A0CX 4IJ9A 4CFMA 2YZAA 3Q4UA 4IEBA 3E87A 2ONLC 4OTDA 4XBRA 4AN2A 3WILA 1P4FA 4RWJA 4USEA 3MVLA 4G2FA 3POOA 2W96B 5C8MA 3SGCA 4J99A 2ZV8A 4DEIA 3R83A 3COHA 1L8TA 4C0TA 4EBWA 3F3ZA 5HD4A 1JOWB 2YIRA 3F69A 2X2KA 4E1ZA 2ZB1A 3ORMA 4ANBA 3KRRA 4U81A 4M66A 3ZFYA 3ANRA 4F7LA 5CY3A 2NRUA 5G1XA 1ZAOA 4CFXA 1SNUA 2F49A 2WEVA 4YTCA 5AUWA 3VJOA 4EEVA 3UOHA 3QLFA 4ASXA 2WMXA 2FSTX 2R3NA 3EH9A 3R1NA 3RPVA 5JZJA 2B9IA 3DDPA 4JBVA 4N0SA 1OUYA 1U59A 3C4WA 2ETKA 4FIFA 4QYFA 3FDNA 4RJ7A 1M17A 5CU6A 3OXTA 3GQIA 1H08A 3QUDA 4G3GA 4CXAA 1J7LA 3HNGA 5DRBA 5HNGA 5A9UA 3PXQA 3Q60A 3CIKA 3ZYAA 4BI2A 4G3EA 3KMWA 3PDTA 4D2RA 1NW1A 4AZWA 2IVSA 4XG2A 1G8SA 2UZVA 1H0VA 3PJ8A 2ZM4A 1YHWA 2QLUA 2B54A 1PXOA 3BX5A 3GOPA 4O0RA 5EI8A 1TQIA 3TKUA 1DAYA 3RCJA 4FV1A 5L2WA 5AM7A 3GP0A 4V0GB 1YDRE 4CLIA 1Q3WA 4ZS0A 5HGIA 5EM8A 1BMKA 2XK6A 4FSMA 4FOBA 4C34A 3KXZA 5IEVA 1ZY5A 3R1SA 4MF1A 1G8AA 3UG2A 2X6EA 3BYSA 2QLQA 4K9YA 5IISA 3OWPA 4FKSA 5K0XA 4BDEA 3NUUA 3K3JA 3BLHA 1YDTE 2QNJA 5KKRC 5LVNA 4L00A 4OTPA 4FC0A 3Q4TA 4J53A 5I9YA 5GIOE 5F20A 3R73A 3NIZA 1APME 2ITZA 2YIXA 4MXXA 5HX8A 3DZQA 4FSUA 5CX9A 5KMMA 4BZDA 2IW9A 4QPAA 4CZTA 3NW6A 3CJGA 2W1ZA 2WTIA 4PDSA 3RAIA 4LFIA 2XCHA 1K3AA 2XKDA 1A9UA 2RIOA 4FV2A 4RPVA 3FC2A 4OTHA 4RWIA 3DAKA 4WG3A 2GFCA 3PVWA 4D0WA 4XYFA 4IZ7A 4DLIA 2P3GX 3FXZA 4F64A 4IX4A 3DBQA 3GT8A 1Q8ZA 2X39A 3DQXA 5L4QA 2CGUA 4GK3A 3VBVA 4YGAA 2VX0A 2REIA 3R7YA 3SKCA 5AUZA 4CMUA 4LYNA 4O21A 4DHFA 5HLWA 4GFMA 4DGLC 3HUCA 1JSTA 3RNIA 3NR9A 4QTEA 3P7CA 1UV5A 3BHUA 3GU8A 2FSOX 2QU5A 4Q2AA 3U51A 4HPUE 3UPZA 3SC1A 4E73A 4WNPA 2VWVA 5E8VA 3UTOA 5H9BA 3VHKA 4ERKA 4ZSEA 2R7BA 1U5RA 2CGWA 2CGVA 2NP8A 4FKGA 4I24A 4QTAA 4X3FC 2LAVA 3VN9A 5B0XA 2OO8X 1VYZA 2XNOA 1KOBA 2Y0AA 1CDKA 5JSMA 3U4WA 5FBNC 5I9VA 4I21A 3T3VA 2HZ4A 1Q5KA 4BDFA 5CAQA 1PRYA 2WPAA 4RWLA 4YP8A 2WQBA 1MRYA 4FUYA 2OJFE 4GU9A 1WVWA 5JGAA 2XEZA 5BPYA 4MXYA 2I0EA 5IA4A 2R3FA 2HWOA 4HOKA 2VWZA 4AA4A 2VTQA 2R3IA 4FKPA 3AC8A 3DJ7A 3EIDA 3DXPA 3OY1A 3NNVA 1OKZA 2Q0NA 3TNPC 1P5EA 4ZY5A 4ASDA 5M57A 3LVPA 4ANSA 3C51A 3QTSA 4FTIA 3QQUA 5AUTA 2EXMA 4UB7A 3OW3A 4FBXA 3QZGA 3QQFA 2IVVA 3C9WA 5TF9A 2HYYA 3UE4A 4AW1A 3OOGA 4PY1A 1WBWA 5L2QA 4R5SA 3E8NA 4RFMA 1L3RE 4ALWA 1CSNA 5HOAA 4F6SA 4G1WA 5LWNA 3L8PA 5G6VA 4WKQA 2CHLA 3BZ3A 1U5QA 2VGPA 1GIJA 4KABA 2OKRA 2ZV7A 3T9IA 3UO6A 4EOJA 5L2TA 4EBVA 5BYZA 4XOZA 3UQGA 3TNQB 2PUNA 3LLTA 3R7EA 3DTWA 4EK8A 3ZRLA 4WNOA 3OEFX 4EOQA 2IW6A 5H8BA 3KXNA 4AZEA 2V5QA 4QPMA 2E2BA 2XRWA 4B99A 3ZDIA 1YOJA 2JFMA 4M0ZA 2RG6A 1PW2A 3MTLA 5CF8A 3GUBA 4AW5A 2VU3A 3ETAA 5D9HA 2XIRA 5I9UA 3UC3A 2FSMX 3QRIA 4YZ9A 1FVVA 1PJKA 5J87A 3SXRA 2B52A 4F9YA 2BZJA 4IAZA 2YCFA 4OTQA 2V55A 5C8KA 5JFSA 4EUTA 4MHAA 5IDPA 3NUAA 4MD8E 1XBBA 3LFAA 2ZV2A 2YWVA 3N9XA 2VWYA 3R7OA 4PWNA 3O2MA 1UNHA 2BRMA 4E4LA 2J0IA 3QCYA 4MEDA 4U8ZA 3VBYA 3KK8A 4FGBA 4MWHA 3PE2A 4CEGA 5T6KA 4GL9A 5DT3A 4O1PA 4UMQA 4FT5A 3FMHA 3EQCA 1Q4LA 3KL8A 4WT6A 2WTKC 3E7OA 4FV4A 5KZIA 3ZM9A 1NVSA 4IANA 2IPXA 3KXXA 2X0GA 3CQUA 5KMOA 1SMHA 3WYYA 4IDVA 5FXSA 2O2UA 4FX3A 4OTRA 4KB8A 1PKGA 3VWAA 4BCPA 3BHYA 4FV7A 4NH1A 4KBCA 4P90A 4MXCA 4QNAA 3PXKA 5FEDA 2BZKB 5IPJA 5TR6A 4DGGA 5IH5A 1YW2A 4PL3A 4YO4A 3TWJA 3RHKA 5A3XA 4CMOA 3GNIB 4UZHA 4JAJA 5IQEA 3DZOA 2C5YA 1YXSA 2VX1A 4QTBA 2YITA 5ACKA 3UPXA 4EOMA 4OT6A 3DFCB 2WTWA 2C6EA 3F7ZA 4ZLYA 4H1MA 5GJDA 4F0IA 5CEPA 4YZBA 4I4EA 5AP0A 2BKKA 3RM7A 2I0YA 4A9TA 2Y7JA 4KA3A 4NCTA 1Q8WA 3L9MA 4UMUA 1F0QA 4NKSA 1WBPA 3Q9XA 3WI6A 3FZPA 4IDTA 1FVTA 4OTFA 2DS1A 3QRTA 4H05A 1YXUA 3GBZA 5T68A 3V5PA 2EB2A 1BX6A 2F2UA 2WB8A 3LE6A 5J9YA 4G3DA 4Y5HA 3KXMA 4OGRA 3QCXA 2P2IA 4D9TA 2ZVAA 3ACJA 3IOKA 5HVYA 4CT1A 2Y8OA 3DBDA 4BL1A 3K5VA 4Y73A 1OL6A 3DQWA 4XRJA 2AC5A 4FKUA 4WOVA 2PMNX 1XBAA 4ZZMA 4TYGA 4BBMA 4BHZA 5JFXA 4CV8A 4HGSA 3ZS5A 4EOOA 5CQWA 5AWMA 3ET7A 1H1PA 1XH6A 5HU9A 2XIXA 2X7FA 3R28A 4PPAA 4C4FA 4EZ3A 1IAJA 5IQFA 1W83A 1OB3A 5EYMA 4K8AA 3UVRA 5EK7A 4ZTSA 2QOBA 4JI9A 5B2KA 3M42A 3C1XA 1RW8A 2XYNA 2UW0A 5L8LA 2PWLA 4JIKA 2CJMA 2VTOA 4HVGA 3L8VA 5EW3A 2PVJA 3HMIA 4Q9ZA 3PSDA 4QO9A 3UIXA 3ERKA 4TW9A 4IWOA 4LGDA 3AT2A 3VHEA 5A46A 3EN7A 4FV3A 4YJPA 3AT3A 1XO2B 4IQ6A 4PMPA 1WCCA 3FQHA 4RGJA 4I6QA 3JR1A 4HVIA 5ETFA 5IQAA 2C30A 2JGZA 2VWXA 3AC2A 5IG1A 2BDFA 3QKMA 5EYDA 3ZHPC 5I9XA 1ZYLA 2F7EE 2QR7A 3QA0A 3TNHA 3PVBA 4FTLA 3UQCA 4YTIA 4DF3A 4Q5EA 2C4GA 2E9OA 3NRMA 3FI4A 4CV9A 4L43A 4TYHA 3NAXA 2BROA 3EJ1A 3GCVA 2QURA 4GUBA 5AV0A 1H1WA 2XNMA 3OCGA 4AGWA 4TWOA 4G5JA 5EOLA 5FDXA 3FZSA 4M8TA 5H8EA 5J1VA 4ALUA 5KMKA 1MP8A 4YPSA 3BBWA 3PTGA 4YZMA 5DE2A 4YTHA 5AEPA 2J2IB 3PJ3A 5FRIA 4LL0A 5LVMA 4O0WA 4LG4A 4DEDA 2EUFB 4E3CA 3VO3A 3OY3A 4BTFA 1QCFA 4R78A 3Q04A 3I0QA 4GEOA 5D10A 2QG5A 5IEYA 3RZBA 2VWUA 2BAKA 2ITVA 3HMPA 2R3RA 3F9NA 2IZSA 3R6XA 4MD7E 4NJ3A 1FOTA 1M52A 3S00A 2PE0A 3HMMA 5AP4A 4ARKA 3C0IA 4FGRA 4CMTA 1JLUE 2XYUA 4FZ7A 5M06A 2QOQA 2XNEA 3LXPA 2RF9A 2G15A 2UZDA 2WMTA 1REKA 3D0EA 4O2PA 3UOKA 4YTFA 5LMBA 5AJQA 4BCKA 3ZU7A 4ZTMA 3GC0A 5J7BA 4Y83A 4RIYA 3I6WA 5AUVA 3VS6A 1PYXA 5KCVA 5A4TA 4BCGA 1WZYA 4KSPA 3A7GA 3BWJA 5A4QA 2BUJA 4UZDA 5L3AA 4FEUA 3QU0A 1ZRZA 4E20A 2VO6A 2BFYA 2VTAA 3L8SA 3VUKA 4OBOA 1J7IA 3AMAA 4UEUA 5CEQA 3RI1A 3UIMA 3HV5A 2WTJA 4G17A 4Z16A 3T9TA 5J79A 3A2CA 4JQ8A 5EQYA 1Z57A 3BBTB 3H9FA 4QMPA 5FWKK 3GVUA 4NU1A 5HE1A 4JR3A 4AUAA 3DNEA 2EXEA 2W1IA 3V5JA 4C4EA 1IEPA 5E8TA 3LPBA 4NFMA 4BIDA 2GS2A 1U4DA 1JVPP 2X7OA 2Q83A 3QGWA 1VJYA 4F0FA 4LUDA 3SG8A 4DBXA 3VW6A 3BYMA 1FVRA 1R3CA 4LM5A 2UV2A 4GK2A 3MYGA 2VUWA 3W8LA 2WKMA 3C4CA 5CT0A 5AR8A 3S95A 4E6QA 4YLKA 4Z55A 2PVMA 3T8OA 2JD5A 4O81A 3FI3A 3O71A 4FKOA 5AAGA 4IFGA 3KREA 3SW4A 1LUFA 1ZXEA 3R9HA 4YUQA 5ETCA 1YI3A 3ACKA 4L53A 1YOMA 3PE1A 2R3QA 4E5WA 3LFBA 2XA4A 1HOWA 3GU4A 4I92A 2YCSA 3E93A 3IGGA 3D94A 1H26A 5CNNA 4EK3A 2WHBA 3R0TA 4O1OA 3PZEA 4GFGA 1KSWA 3ZH8A 4GYIA 4AE9A 4TL0A 3KFAA 1IASA 3ZDUA 4JRNA 4MD9E 2ITUA 4FV6A 5IU2A 1OL7A 1IRKA 4BWKA 3QYZA 4EC8A 3BYUA 3EQRA 5FLFA 3BQCA 2OG8A 3LZBA 5LARA 3G0EA 4APPA 3VNTA 3C5UA 5AA9A 3KXHA 3PRFA 5CASA 1WBNA 2XF0A 1OECA 1TVOA 5BMSA 4EC9A 5M4FA 4FSQA 3OFMA 2DQ7X 5T3QA 3DY7A 5CF6A 1Q24A 4BWXA 5DA3A 2BDWA 3OT3A 4RX7A 3BI6A 3KVWA 4AW0A 3R21A 2XJ2A 4DFNA 1OKVA 1R78A 2J5EA 2Z60A 3GC9A 4IH8A 3BHHA 3DPKA 5BNJA 4BDKA 2DUVA 3DB8A 1JKLA 1R1WA 3LCKA 5A14A 5E8XA 4TWCA 2R3KA 2W5BA 1Q41A 3QD0A 4QQCA 4ZSLA 3ZXZA 5HNIX 3ODZX 4FR4A 4EHEA 4I93A 5ANJA 3POZA 4OBPA 3ZRKA 3EQIA 5IUGA 3ZLYA 4I0RA 5DIAA 3SXFA 1YOLA 5TO8A 2ZOQA 5HG9A 3ZEPA 4C36A 3HAMA 3DK6A 3GQLA 5CF4A 3A4OX 1REJA 2W1DA 4K1BA 1PXPA 4U44A 4X6RA 4YLLA 5B7VA 2X9FA 3EYHA 5BYYA 2BALA 2R3OA 2GNIA 5KHWA 4RWKA 3VBXA 4IX5A 2OK1A 3AG9A 3HKOA 2XM8A 2ZDUA 5EDPA 4RX5A 5K5XA 4BI0A 3JVRA 2SRCA 2CLQA 2WTVA 4CRSA 2EVAA 4MAOA 4W4XA 5EM6A 3CY2A 5CSHA 4R3PA 3EZRA 4EONA 1IR3A 3GEQA 5K0KA 3R8VA 3AOXA 5EOBA 3IK3A 3O7LB 4CSVA 1JKTA 2ESMA 2HW6A 3C0HA 4G31A 4KRDA 4FV0A 1QMZA 3T3UA 3ATSA 2W17A 5C1QB 3CTQA 3H9RA 4A4LA 4X2KA 4O6EA 4DEAA 2OFVA 4IAIA 3GFEA 5GHVA 4EKKA 3P5KA 2AYPA 4EOSA 3THBA 4IB1A 3R7GA 1DAWA 2PZ5A 4QP2A 4WRSA 3GGFA 3SW7A 5HG7A 3VF9A 3MV5A 1PXKA 5DWRA 3SDJA 5KBRA 2HY81 4C62A 5EQPA 1J1CA 3HGKA 4YR8A 3R9RA 2C6KA 4U40A 5GJGA 3HRBA 2B55A 3UC4A 3WZEA 2CN5A 4FTUA 3RPRA 2W1HA 3FWQA 5DFPA 3JUHA 4ZJJA 2JAMA 4OAUC 3RK9A 5HIEA 3GCPA 4G9RA 2GNJA 2JITA 3UMXA 4ZP5A 2IN6A 4R5YA 3OCBA 5CU3A 4HGLA 4AZVA 5HO7A 3EQDA 2H96A 2BRBA 4NYEA 3C7QA 3UZPA 4EQUA 3TXOA 3ANQA 4I22A 2OI4X 5HO6A 4A4OA 4CT2A 1B39A 4XV2A 3UZTA 4NEUA 3CKXA 1V0PA 4ANOA 1I09A 2J0JA 4PDOA 3G51A 1UU7A 4FSZA 5BVKA 3ZLSA 4E4XA 4ZZOA 3U6HA 3VS4A 5FUTA 5HORA 3R02A 2CKOA 1OVEA 1LPUA 4J97A 4WA9A 4U80A 3K5UA 3IW4A 4QPSA 4WBOA 3U55A 3PG3A 4RFZA 4OUCA 2RKUA 2W1EA 3MBLA 3Q52A 5A4CA 3EN5A 4MXOA 2IZRA 3SOCA 2AUHA 1V0OA 5DYJA 4G34A 1U54A 4OT5A 4V01A 3OEZA 4PV0A 2PMOX 4BDHA 3TDVA 4J71A 5C4KA 5AIKA 5HE3A 4M67A 1YKRA 4MBJA 4HCVA 5GZ9A 4XS2A 3L1SA 4OBQA 5DHJA 5HICA 2R3HA 3Q2MA 5EI2A 4N70A 4YSJA 3IECA 3Q6UA 3FAAA 4RJ8A 2HXLA 5CNOA 2ITWA 3SD0A 4IACA 2UVYA 4ZTLA 2JKQA 4QP8A 5IF1A 3G6GA 4HGTA 3NUYA 2FO0A 3IDBA 4DFZE 3LKMA 4IWPA 4BC6A 3DK3A 4EOKA 4OR5A 4DBNA 4LQMA 2WOTA 4I20A 1H00A 3LOKA 4YHTA 3R30A 2YERA 4H1JA 4UBAA 4EQCA 5J7HA 1DI8A 4C37A 5CT7A 2GNFA 3GOKA 4G3CA 4L68A 4RC2A 5IUHA 2EB3A 5LVLA 2EU9A 4XP2A 4GSBA 4DFYA 3ROYA 4NM5A 1Q8TA 3QBNA 3FHIA 5K4JA 3D9VA 4JBPA 4NT4A 3OHTA 3VW8A 4RQVA 1UWJA 1H4LA 2XNNA 3ELJA 5GJFA 4CFFA 3BGZA 3IG7A 4II5A 4O7WA 3UIUA 5HVKA 5HX6A 3BU3A 5F94A 4TYIA 3OD6X 2W06A 2XEYA 5FXRA 3UNJA 2ITQA 4XV1A 4I1ZA 4HNIA 3ZLXA 1EH4A 1GZNA 2F57A 3QZIA 3E64A 5AP7A 4ANQA 3MA3A 4HVDA 5GZ8A 5E8UA 4C7TA 1SVGA 5ITAA 4BGQA 3F3UA 4R7HA 5L6OA 2C69A 2ZV9A 4BCIA 2BAQA 2OXXA 5TE0A 5I0BA 4IVBA 4AOTA 2BKZA 4AT5A 4FTAA 2JDRA 4GT5A 1J3HA 1XBCA 3VS7A 5DN3A 3EKKA 4GG5A 3WARA 2P4IA 2OGVA 3FL5A 5CSWA 4FL2A 5DEWA 5CZIA 4P7EA 2QOLA 2BPMA 3D2IA 3C4EA 3Q5IA 2WTDA 4BDDA 4FK6A 3OS3A 3KRWA 5D1JA 3D7TA 4O7LA 4NW6A 1Y57A 2WIPA 3R00A 4XJ0A 4IHPA 4C3FA 4YZCA 2WMQA 4U3YA 3VS2A 4DH8A 1ZZ2A 3OVVA 4O0VA 5JK3A 2UW7A 4YU2A 3DBFA 5EHYA 2GCDA 3V04A 2E9PA 3KF7A 5JN2A 4DTBA 5ANGA 4LOQA 4ERWA 2WQOA 2XJ0A 3R9DA 4RIXA 3ORNA 3W33A 4U3ZA 4XG7A 4F99A 3I60A 3FY2A 3KA0A 4HYSA 3R1YA 4E4NA 3Q9ZA 2OH4A 4EH7A 2C3IB 2OICA 4CYJA 2F7XE 4CKJA 2FSLX 2CMWA 4FSYA 3O7LD 4JG8A 3W1FA 5KO1A 4FEXA 4KAOA 3NVMB 3LXLA 3H0ZA 1Q3DA 4KIPA 4B4LA 4BDGA 3L9NA 1WBOA 2R3MA 4J1RA 4RT7A 4CCBA 5E8SA 2W05A 2A2AA 1LEZA 3JVSA 1VR2A 3ALNA 3KMMA 2C47A 2Y4IB 3C4FA 3NX8A 3QCQA 3QD4A 4EOLA 3AGMA 4JT3A 2YHVA 2OZAA 4HZSA 3I5NA 4F1TA 4PL4A 4FTRA 4ID7A 2PVRA 2G9XA 3F61A 4UWBA 4M14A 1B6CB 4J8NA 1ATPE 4WBBB 5K3YA 1OMWA 5C4LA 2O64A 3CD8A 4EORA 4EYJA 3FMKA 2UW5A 2VTHA 4C4HA 3E7VA 3ZC6A 1OITA 4L3LA 2WQMA 4L67A 1SVHA 3P08A 4FG7A 2HELA 5M56A 4C57A 4D2TA 2FGIA 1S9JA 4U43A 2CLXA 2H9VA 3CGOA 3UVPA 4NZWB 3HYHA 4X3FA 3QZFA 3TZ9A 3V3VA 3ZBXA 2QVSE 4RJ3A 2IZTA 3Q4CA 3UG1A 4RSSA 3HP5A 3KXGA 4NTSA 3PA5A 4C4GA 3LXNA 4NJDA 3MFSA 3FMDA 1P14A 3LHJA 4G16A 1QPJA 3VQHA 2PU8A 4HGEA 1BKXA 2WFYA 2XJ1A 3QTIA 4O0YA 3WF5A 3NUSA 4QMVA 4TZRA 4QMTA 5AP6A 3LJ0A 4I5PA 2HAKA 3EWHA 4ENXA 2J6MA 3MN3A 4UWCA 1WFCA 3SQQA 2RFSA 2PVFA 4M97A 3H10A 3FXWA 1KE6A 2B53A 2W1GA 3FKNA 2BHHA 4LV5A 4ACHA 3E3BX 1ZMVA 4FG8A 2Z8CA 4M7IA 3EL7A 1M14A 3KQ7A 5EYKA 4BCHA 1FGKA 2R9SA 3OF0A 3TUCA 1UU9A 3ZLWA 5HU3A 1ZYJA 4RJ5A 2WIHA 3KB7A 4GIHA 4EH5A 1ZYCA 3RM6A 4ZMFA 2W9ZB 4I3ZA 4CVAA 3MTFA 3Q9YA 5CAUA 2Y6MA 3EQHA 4EHZA 4HVSA 4ZJVA 5FTGA 5J5TA 2QONA 3NLBA 2ZB0A 2C5XA 3EFJA 4Y72A 4E8AA 3QD3A 3TL8A 4L6QA 5CF5A 1Y6AA 3C4ZA 3GB2A 3SHEA 5JKGA 4FK3A 3PSCA 3N4VA 5AP5A 3LQ3A 4N4SA 1H0WA 5CS6A 1MUOA 2BR1A 3F3TA 3IW8A 4CKIA 5JGDA 3LIJA 4EH3A 1WMKA 4EL9A 2R3GA 2VTMA 4L8MA 2XKFA 3PY3A 1I44A 3QTQA 3IO7A 2JBOA 3LCSA 1IAHA 4IX3A 2JDVA 4FIJA 2XKEA 4JBOA 2JIUA 3UYTA 4O7NA 4ITJA 3VS3A 3R8ZA 3U8WA 2GQGA 3UOLA 3W2CA 4P4CA
chains in the Genus database with same CATH superfamily
1J7UA 3MFUA 5JMSA 5E8ZA 5JFWA 4DEEA 2CCHA 3Q9WA 3WIKA 2Q0BA 3CPBA 4ZSGA 3WYXA 4D4YA 3RWPA 3IDPA 5FBOA 4AG8A 2PUIA 4OTIA 5HHWA 2IVUA 3OXIA 1XMLA 3HDMA 5DI1A 4O7YA 2QOHA 3G33A 4IB3A 3PZHA 4C61A 4KIKA 5CXHA 1W8CA 2C5VA 2WAJA 3RPOA 3I79A 4NUSA 1FPUA 4X2FA 3DXQA 4IB0A 4QMMA 4QMLA 1VLRA 5HZNA 2FH9A 3IW6A 4TY1A 5AV4A 5CWZA 1IA9A 4QQJA 5FEQA 5E8WA 3B2WA 2C3LA 2BMCA 2B9FA 4S33A 3UP7A 4ANMA 4C4IA 3PFQA 4HNFA 1XWSA 3REPA 3SXSA 3RAKA 4BTKA 1OL2A 1B38A 3FQSA 3W8QA 4PRJA 4EQMA 2C5NA 1PKDA 4CTBA 3HEGA 4D5HA 3WZDA 3NYVA 3R7UA 1SM2A 3D5VA 4TNBA 4KBAA 4C02A 4LGHA 4YNOA 2EXCX 4A9SA 1GZKA 2WMAA 4XG9A 4YHJA 3S4QA 3NW5A 5B2LA 4N6YA 5HLNA 3S0OA 2R3JA 4IW0A 4BDJA 3Q32A 3ZO2A 4MNEA 4FIGA 5IA0A 1AQ1A 4D1XA 4O7RA 5BYLA 2OF2A 4IVCA 4A7CA 2X0QA 1V1KA 3CE3A 3TI1A 4BHNA 5IMXA 4ACDA 2NRYA 5HKMA 3DK7A 1O6YA 4CFUA 5CEMA 3N51A 5DNRA 2Z7RA 3W55A 1KE7A 3O8TA 4BI1A 3R2BA 2W0JA 4DTKA 3MVMA 2RFEA 4H3BA 2I7QA 2YFXA 2J5FA 1BI8A 4DDGA 2X7GA 4AGDA 4CKRA 3MESA 2ZMCA 4XP3A 4JG6A 4D4RA 5KMIA 4PDPA 4KKEA 3KU2A 2BILB 4FSTA 1ZY4A 5ANIA 1CTPE 2I6LA 4IWDA 3BL9A 2YLFA 3SG9A 5KMJA 3BV3A 3G6HA 2WEIA 3D4QA 4F6WA 3D5WA 3OBJA 4FRFA 4R3RA 3P78A 5E7RA 5J95A 3HRCA 2WMSA 2W7XA 3DLSA 3RHXA 4S34A 2F2CB 2VRXA 4X2NA 4E6DA 4XNEA 5ANKA 3PA4A 2RG5A 4XV3A 4WHZA 3BU6A 4O0XA 4BCQA 4HYHA 4KRCA 5IA3A 4FVRA 3QWKA 4RZVA 4U6RA 5BX0A 2A27A 5CSXA 3UMWA 5A6NA 4YC3A 5CAVA 3GCQA 3QZHA 4J52A 2WU7A 4QMNA 3HLLA 4D5KA 3GU5A 3A60A 2E9VA 4FTOA 3OWLA 3NVKI 3KN6A 2CKPA 3DA6A 1ZYSA 3CPCA 3TV4A 4NL0A 3O17A 5LWMA 3QTUA 2W99B 2QR8A 5TOZA 3FLNC 3IW5A 2C0TA 3QRUA 3LMHA 3WIGA 4X21A 1JWHA 1M2QA 5LCKA 4XHKB 4DINA 1JKKA 2PZPA 3TZMA 2CDZA 2R4BA 3DT1A 3UYSA 5EKOA 3HZTA 2C1AA 4DLJA 4F9BA 2X1NA 4R6VA 5CU0A 5J9LA 2YN8A 2J0MB 3VUMA 3GCUA 1ST0A 2JDTA 2ETMA 3D5UA 3Q3BA 4USDA 4C38A 1UWHA 1O6KA 4YSMA 4I5CA 4D28A 4IADA 4W4VA 4FEWA 3FBVA 2UUEA 3UDSA 3OUKA 1G8KA 5GIPE 3BQRA 3EMGA 3BPRA 4XLIA 3KRJA 5JEBA 3DBCA 2J51A 4O22A 3TTJA 4BVUA 3DS6A 4D0XA 3V51A 4B9DA 4FICA 4M15A 3SRVB 4LOOA 4YMJA 1PXIA 5J8IA 4OLIA 3MGYA 4EH4A 3O5AA 3PXYA 3TM0A 2A1AB 4DH7A 4EJ7A 2PHKA 3ENHA 1QPEA 2HZIA 3BCEA 5JRQA 3VC4A 3Q4ZA 4X2GA 3N4UA 1O9UA 1YRPA 1KUTA 4BRXA 4ZY4A 4DH5A 3P5JC 2XNGA 1PYEA 4UMPA 3HUBA 2JDSA 1CKPA 2B1PA 4B0GA 2PMIA 3QXOA 4NM3A 4PL5A 4M84A 2V7AA 3JY0A 2J4ZA 3MPTA 4PMSA 2QOIA 4YHFA 2ZFYA 3RINA 1BL7A 3NUXA 1M7NA 4YBKA 4LRJA 3BGPA 4DAWA 3SA0A 4CCUA 4IX6A 4DHZA 3LCDA 1U54B 4DGOA 3LMIA 4JR7A 3FY0A 3SVVA 2A4LA 3KGAA 3FMEA 3FI2A 2YM4A 3LM0A 2FUMA 4I0TA 1OKWA 5KNJA 3NDMA 4TRLA 4GCJA 4IAAA 4NCTC 2VAGA 3WZKA 3QHRA 3BE2A 4DG2E 3MFRA 3R2YA 3EFWA 4JL9A 4AF3A 2XNBA 2ZMDA 1YHVA 3GXLA 3I5ZA 3FYJX 5FP6A 5M09A 2CKEA 3QTXA 2QO9A 4DA5A 4TN6A 3HV3A 4MXAA 4FTKA 4QTCA 4DFUA 4K18A 4A9RA 4AN9A 4GK4A 2UVZA 4UV0A 5CXZA 2FB8A 1FINA 4AAAA 4IB5A 2XM9A 2WELA 4NFNA 3LAUA 3ZRMA 2XK9A 3F82A 4BCMA 2HW7A 3ORXA 3QWJA 3MY1A 5DH3A 1CKJA 2VTTA 1GY3A 5KHXA 3FXXA 4WG5A 2YIWA 4YJUA 3K3IA 5KX8A 2X0OA 2IO6A 3FSKA 3IPHA 3SX9A 2P0CA 3VUHA 3TUBA 3CSVA 5B2MA 2ZYBA 2Y4IC 4IC7A 4TNDA 3V8SA 4F7NA 3I7CA 3MY0A 1QPDA 4E5AX 3RPYA 2W1FA 2WQEA 5HO8A 1OIYA 3HL7A 4JX7A 5M44A 3ALOA 2YDJA 4NIFB 5AMNA 2WMBA 1XH7A 2Z02A 3MVJA 4UYNA 3FHRA 5DT0A 2UVXA 4CRLA 1UNGA 1H25A 4YO6A 4D2PA 3QQKA 3QTWA 2YEXA 4ZJIA 4JQ7A 2X8EA 4O27B 3EB0A 4FNXA 2XB7A 3BGQA 3TEIA 4FTJA 3KK9A 4M69A 4TWNA 4XG4A 4R1VA 4A4XA 1SZMA 1R0EA 5HNBA 2WTCA 3A7HA 3L8XA 1JNKA 1PMEA 3RVGA 1Q61A 4F08A 5LCJA 1J91A 1Q8UA 3G5DA 4W8EA 4GJ3A 2VO3A 4QYYA 4CGAA 1XHAA 3R9NA 4F09A 1A06A 3N4TA 5DLSA 2KTYA 2V62A 3ORTA 3KY2A 2O8YA 4Y8DA 4HVHA 1T45A 2I1MA 2R64A 3HX4A 2VTSA 3ENMA 2YM8A 4BDCA 2UZWE 4C35A 5LMAA 3WE8A 4O38A 4BGGA 3ZBFA 2C5OA 3D14A 3VVHA 4BGHA 5H8GA 2CNVA 2BIKB 2QD9A 4RC3A 4Y85A 2WQNA 2LGCA 1XH9A 3KN5A 2WMRA 3FLWA 3RK7A 1HCLA 2GNLA 1H01A 1VYWA 3BEGA 3F66A 2YCRA 3K54A 5DG5A 5AR3A 3JY9A 4D2WA 5A4EA 1ZMUA 4LDTA 3COMA 4YJSA 4BIEA 3SOAA 5J1WA 1FQ1B 5EDRA 4BF2A 2QODA 1V0BA 2ERKA 1CKIA 4HYUA 5HIDA 3ORKA 4KKHA 4X3JA 3TJDA 2OIQA 3QCSA 1S9IA 2JFLA 3HRFA 4J8MA 5L8JA 3PSBA 4L3PA 4DG3E 4BYJA 1ZMWA 3VULA 3C0GA 4QMZA 4ZS4A 5CU4A 3TIZA 4IBMA 4UXQA 3FMLA 5HE2A 4AP7A 4BTMA 3AD4A 4RBLA 4RZWA 5AAFA 4A07A 2WMUA 4FNWA 4AZTA 2IF8A 2ITNA 4DITA 4PUZA 5K9IA 4GKIA 3D15A 3PUPA 4C2WA 1ZARA 5ANOA 3DAEA 3QLGA 4FTTA 2R7IA 3DKOA 3LCTA 5CYIA 3IS5A 3CCNA 3FKOA 5ANDA 4BKZA 5M53A 2BDJA 5BUEA 4FVQA 3CKWA 2WD1A 1G3NA 2BCJA 2Y9QA 2VN9A 4MX9A 2R0UA 2VV9A 4DFXE 4JX3A 3WF9A 5HVJA 1OZ1A 2PVNA 3NUPA 3CTJA 3MS9A 3FC1X 3PXZA 4QDEA 3E5AA 3F5XA 4IXPA 3O0GA 2PMLX 4FZFB 4HJOA 4KIQA 4Q9SA 5DBXA 3U9CA 2B7AA 1OIUA 4C4JA 3LFEA 4YC8A 1OM1A 2YM3A 1FGIA 5D41A 3V5QA 5AAEA 3D2KA 4K11A 4UN0C 3CS9A 1YXTA 2CGXA 3BL7A 4JNWA 3PFYA 1OPLA 5IQHA 4FSNA 4L45A 3QXPA 4AS0A 5IQGA 2UW6A 2WZJA 2PE1A 3P23A 4DCAA 4TPTA 4FT3A 3G9NA 4AQCA 3DAJA 2F7ZE 3RNYA 2OFUA 2VNWA 3F7WA 3HMNA 5D7AA 1KE9A 2OZOA 2O0UA 4EZ7A 2YACA 4RC4A 5HLPA 3ZTXA 3U54A 4RJ6A 3IQ7A 3ZOSA 4AXDA 2YJSA 4AA5A 4CNHA 2IVTA 4NM0A 3R63A 2C3JA 2OXDA 3MWUA 3TNIA 5HG8A 5CLPA 3MPAA 4Y5QA 4FTQA 4ZIMA 4U45A 3PXFA 3QX4A 3ZO4A 4Z3VA 5E8YA 3ULIA 4EH6A 3ORPA 3O23A 4FZAB 3IOPA 4YBJA 5EM7A 4O4FA 4O7VA 2X8DA 4EHVA 4MXZA 3PPJA 4YZNA 3TUDA 3Q2JA 4RVTA 4BDBA 2AC3A 5AX9A 4FKQA 3W0SA 4GG7A 2IW8A 3Q96A 1IG1A 1U46A 3E8EA 4KBKA 3EQBA 4I5MA 4LMNA 4M3QA 3VS0A 4D2SA 2X6DA 4XV9A 4F1MA 4QMQA 2PUPA 4QTDA 4ALVA 4H58A 4CZYB 2XP2A 3I1AA 3OOMA 4AE6A 3PUFC 3FYKX 3WBLA 3AMYA 4GRBA 4PX6A 5IZFA 4IJPA 3VS1A 3EN9A 3P7BA 1DM2A 3KC3A 5EHOA 3V5LA 2W5HA 3QQHA 4XUFA 4MTAA 4XRLA 3P86A 5I4NA 4J98A 3R7IA 4DE4A 3COIA 4LRKA 1WVXA 5LOHA 3IKAA 4U79A 5JZNA 1ZWSA 2ITXA 3RWQA 3QA8A 2QO2A 4BCJA 4XLVA 5AV2A 3NS9A 4AFJA 2ETRA 2WXVA 3OCTA 3MFTA 4JAIA 5IQDA 3KCFA 4W9XA 5EQEA 5CSVA 3UDBA 2XKCA 2C6TA 4EK4A 3A4PA 3LQ8A 3A8WA 4BDIA 3MH2A 1Z9XA 1GOLA 3MW1A 3EZVA 4RVKA 3MA6A 3RTPA 4EH2A 2XARA 4FA2A 5CVFA 2NYAA 3KRLA 3CGFA 3WOWA 5BVDA 3OCSA 3TNWA 3R22A 4FL3A 4FV5A 5FM2A 3PJ2A 3W2RA 4H36A 2XIYA 5E1SA 5LMKA 4AGUA 1OGYA 1M7QA 3CQEA 3ID6C 1M2RA 1FBNA 5E9EA 4AU8A 1E9HA 3C50A 4Y46A 4WO5A 3NCZA 3HAVA 3MSSA 4L9IA 4RA5A 3QQLA 2GNHA 2XIKA 4GMYA 4BKJA 4FYNA 4ENYA 2GQSA 4AN3A 1NVQA 2ONLA 2XBJA 4MH7A 5DOSA 1KE5A 3BYVA 4I4FA 3FEGA 4IZ5A 1SYKA 4JBQA 2JEDA 4IAFA 1Q99A 4WUAA 4C59A 1Y8YA 3EN4A 3TG1A 4ITIA 4V04A 3P0MA 4IFCA 4TWPA 2YZLA 3II5A 2WGJA 2UZBA 5J9ZA 2PK9A 2UZEA 4X0MA 5EDQA 3CXWA 4O96A 2HIWA 3QGYA 1GZ8A 3LFCA 4XH6A 3W16A 3GI3A 4BICA 4LV7A 1KWPA 2YAAA 2ITOA 3COKA 4IZAA 2CCIA 2J50A 2RGPA 4U42A 4YURA 4PNKA 3FZ1A 2YWPA 4FT7A 4FSWA 1OBDA 3GCSA 5LVOA 4AQKA 3U4UA 4ANNA 4FIIA 4PPBA 2HK5A 3RJCA 1JKSA 4D2VA 3IW7A 3R8UA 4KUJA 4LUEA 4HPTE 4N6ZA 2YDKA 3W2SA 5D12A 5EYCA 3HDNA 3VRYA 1E1XA 1YQJA 3ZSHA 4PMMA 5LXMA 2IEWA 3PXRA 4FTMA 3UQFA 4X7QA 3FQEA 4JDJA 3CP9A 4HYIA 4XG3A 3DV3A 4FKLA 5ETIA 5CANA 3KF4A 4EOIA 3UZRA 1PF8A 1UA2A 3Q5ZA 2OJGA 3E3PA 4FKTA 5FXQA 5BVWA 5KMLA 3ZUTA 1SNXA 4TT7A 4WSYA 4ASZA 3P7AA 4RIOA 2GPHA 4C3RA 4UMRA 2Y4PA 3OTUA 3RAWA 4RLLA 3U9NA 5FTOA 3PA3A 4E93A 4ACGA 3I81A 1JQHA 5I3OA 3VQUA 3F2AA 3R8PA 1FMOE 4DC2A 2YA9A 5D7VA 4RQKA 3SV0A 5C03A 2GHLA 4Z7GA 4EUUA 4B7TA 2YM5A 3DJ5A 3TT0A 2JDOA 3UIBA 5EH0A 2QHMA 3ZC5A 1TQPA 3DFAA 2QU6A 1JPAA 3JXWA 4P5QA 4J7BA 4DEBA 3C4XA 3LMGA 3O8UA 3PPZA 3DGKA 2PPQA 3BEAA 4YJOA 3WE4A 2XBAA 3R01A 4DFBA 2XK7A 2BRNA 1HCKA 1SVEA 3HVCA 5C27A 4ZSAA 2G1TA 1GJOA 1KV1A 1RQQA 2R3PA 4PQNA 3V8TA 4FMQA 4LRMA 5CEKA 3UNZA 3FZOA 3VAPA 4QYGA 4BFMA 5AADA 2JIIA 2P2HA 2UW8A 3R8LA 3NNUA 5F4NA 5AR2A 4DH1A 4XG6A 1H1SA 4WG4A 3LFQA 4JXFA 3PG1A 2WMWA 2YDIA 2UW9A 1TZDA 3MDYA 3QRJA 4APCA 3DTCA 4MQ2A 1UNLA 5FG8A 4C58A 4E6CA 3LFSA 3NYXA 1RDQE 2UZUE 4C33A 3NUNA 2GTNA 5HE0A 4AAYA 5I9WA 2QKWB 3A7JA 5CAOA 5I3RA 4GJ2A 4QRCA 5LJJA 4FKRA 4RIWA 2ZDTA 3P4KA 4NM7A 3C5IA 2NO3A 1ZZLA 2QI8A 3PWDA 3FZTA 4W4YA 5C9CA 2IJMA 3NZ0A 5M55A 4FV9A 4O7SA 2X4FA 5IQBA 3ZM4A 2GQRA 2R2PA 3MB6A 4PMTA 4AXAA 4D4SA 5AUXA 2G2FA 5FP5A 3FL4A 2Y6OA 2ZJWA 4MF0A 4BWPA 5EKNA 4TYHB 2H6DA 3BKBA 4IM0A 4XX9A 2QKRA 5L6PA 4FIEA 3MIAA 3ZO3A 4YLJA 5AV3A 2QO7A 4FKWA 3IDCA 3DCVA 4FIHA 4YJNA 1OIRA 4UWYA 2CNUA 5JFVA 3HV4A 4IAKA 3PYYA 3ZO1A 2XS0A 2O5KA 5AM6A 4MYGA 1H1QA 5JQ5A 3E8DA 3BRBA 1LP4A 4NKAA 3PP0A 3QL8A 4MBIA 4RMZA 3H4JA 5DR9A 4FTCA 4A9UA 1IA8A 4D1ZA 4EI4A 3AC4A 4O7ZA 3TMOA 4QOXA 4D9UA 4F70A 3ZXTA 1UVRA 3H9OA 3FMJA 4U7ZA 2J9MA 3HECA 3RCDA 5CAPA 1ZOEA 3RKBA 2OH0E 2OW3A 3D7ZA 3ZZEA 4BDAA 1R39A 3GC7A 1W7HA 3QD2B 4L3JA 3TZ8A 2JLDA 4L7FA 4RIYB 5IKWA 5IEXA 5HCZA 4GUEA 1YWVA 3H0YA 3LM5A 4YJQA 4AACA 4D4VA 3M11A 5EG3A 4BJJB 4S32A 2PE2A 1KE8A 5AP1A 2RFNA 4FEQA 4LMUA 3ODYX 4RX8A 3I0OA 2DYLA 2OJIA 4U5JA 2C68A 3I7BA 2I0VA 2C6IA 2UZTA 4KKGA 5IQCA 4ANLA 5EW8A 3L9PA 4R7IA 5HIBA 3AD5A 5DRDA 3DNDA 2YCQA 2VTLA 5EW9A 3ITZA 4F6UA 1A48A 1RJBA 2A98A 3AC1A 3BHTA 5JT2A 5I5ZA 1P4OA 4DFLA 2R3LA 3V6SA 4GT3A 5AA8A 2YLEA 3PRIA 2QQ7A 4QP6A 5C8NA 3OP5A 4WUNA 5EFQA 5JQ8A 4QDVA 3NCGA 2UZNA 3NNXA 3BIZA 4M69B 4DGMA 4AOJA 3VBQA 4JIAA 4KWPA 5KZ0A 3AKKA 4F7SA 2HZ0A 4QP9A 4I41A 2ITPA 2R0IA 2VWIA 2J0LA 4EOPA 4IC8A 1ZOHA 2NNWB 3FI8A 4ZLOA 3FMNA 4NTTA 3UBDA 3Q53A 2X81A 2GS7A 1LR4A 2VO7A 3FLZA 4ZTNA 4F1OA 4FZ6A 3HP2A 4ONAA 3W18A 4UX9A 3PJCA 2XH5A 5BUIA 4Z7HA 4IVAA 3BLRA 2O63A 5IA5A 1OL5A 2JKMA 5FQDC 3CTHA 4JOAA 2O65A 3EHAA 3CLYA 3RALA 4A06A 4C8BA 2O3PA 4M68A 2CKQA 2JBPA 3PWYA 4CFWA 3PP1A 4ZTRA 2ZM3A 2CPKE 3D5XA 4K0YA 4B6LA 2HWPA 4YC6A 3VJNA 4ACMA 4BCOA 1STCE 3ZONA 4GVAA 4MNFA 2YISA 4FT0A 3RGFA 4HCUA 4F9AA 1YDSE 1W0XC 2HZNA 2QHNA 4GH2A 4BKYA 2OJ9A 1DI9A 3F2NA 5E1EA 4AX8A 3NFFB 2HY0A 5JGBA 4G9CA 2B0QA 3F3WA 2YIYA 3EQPA 1NY3A 2RFDA 3HV7A 5CALA 4BZOA 2YAKA 4CD0A 1H07A 1XH4A 2OIDA 5JRSA 4QD6A 4E26A 3MI9A 1GNGA 1ND4A 4DEHA 2H8HA 1BL6A 2FA2A 4TTHB 4IE9A 4R7BA 2PTKA 2P55A 3KMUA 4I23A 5HBEA 5KUPA 4M0YA 1XJDA 3FSFA 4S2ZA 4GVJA 3WF6A 5HCYA 2ACXA 3OZ6A 4HCTA 1YVJA 4F65A 2QOCA 2XK3A 4J95A 3TV7A 2XAOA 3BU5A 3PIYA 4YJTA 3ZSIA 3ORZA 4C3PA 5M51A 2FVDA 2XCKA 4GV1A 3QFVA 4FZDB 4O7TA 5EM5A 3NPCA 3I4BA 4NW5A 3W2PA 3UJGA 1JSVA 4AZSA 5ANEA 4ZZNA 3G90X 4ZMEA 4I0SA 2C0IA 3FZRA 3K2LA 3R7VA 3V5TA 3RK5A 3RAHA 4UALA 1NA7A 1ZOGA 3NFGB 4TYEA 2ITYA 2OXYA 5HI2A 3RMFA 4CQGA 3MJ1A 4WSQA 5BQ0A 3B2TA 1XH8A 3UP2A 3BLAA 3DXNA 4PDYA 3M1SA 3CR0A 4RG0A 4WRGA 4WNKA 4MCVA 4IWQA 5AR4A 3BLQA 2OLCA 3KULA 4L46A 2IZUA 3FJQE 3LJ1A 3NWWA 1OBGA 5FDPA 1GIHA 1OPJA 1YI4A 2PL0A 4M12A 3MPMA 2PUUA 1PXNA 2VTJA 4Q5HA 1AD5A 1KV2A 3A61A 1WAKA 3QKKA 4AW2A 5CQUA 3HV6A 4JQEA 4CG9A 1W82A 5LVPA 3H3CA 4AT4A 1NXKA 4DCEA 2QOOA 1Z5MA 5A4LA 4ASEA 4Y95A 3MB7A 3S1HA 1VEBA 3TACA 5JH6A 4YNEA 3NYOA 4QMUA 3NEWA 3V6RA 5FGKA 3O50A 3CY3A 3TJCA 5AIRA 4O86A 3D83A 4XMOA 1OI9A 2C3KA 4DT8A 2GDOA 4LI5A 3PVGA 4G3FA 2VWWA 3HA6A 2PULA 4ZSJA 3BV2A 3FPMA 4QP7A 2UZOA 3PIZA 3QTRA 2I0HA 2V7OA 3C13A 1KOAA 3G2FA 4RFYA 2JKOA 5FD2A 3FPQA 3R1QA 1XR1A 3LFDA 3WZJA 4AA0A 1K2PA 2J0KA 4JVGA 1K9AA 4TYJA 1T46A 2HOGA 4F9WA 3EFKA 5C26A 4O83A 4U9AA 5D11A 1H24A 2VNYA 5BVNA 5M4CA 2QOFA 4EH8A 3RPSA 4FVPA 5M4IA 3OXZA 5HCXA 2JKKA 5AUUA 4O82A 4R77A 2HCKA 4LOPA 4CQEA 5DVRA 3ULZA 5AR7A 2P33A 2ZAZA 4PPCA 1OUKA 3EN6A 5HG5A 3F5UA 4AT3A 4CZUA 2XK4A 5ACBC 3QTZA 3AGLA 3RZFA 3B8RA 3LFNA 3MVHA 3CBLA 2RL5A 1Q8YA 4JLCA 4BZNA 3KKVA 1OL1A 4MUQA 1CM8A 5CEOA 3OUNB 4PNIA 2FYSA 4RX9A 4E6AA 3A7IA 2X9EA 3NYNA 3PIXA 4RLKA 3VUTA 3W2QA 4I6HA 1PHKA 3FKLA 4TKSA 2WMVA 4XOYA 5KBQA 4DTAA 4QMXA 3F2RA 5CSPA 5CZHA 4I94A 3QQJA 4V0GA 4UY9A 3QC9A 4BTJA 3UVQA 4ZTHA 4EZ5A 4JDHA 3GU7A 4R8QA 2ERZE 5CU2A 4MVFA 5AR5A 1Y91A 2G01A 4O91A 3RP9A 3SAYA 5ETAA 2PVLA 3ZFXA 4HW7A 2BIYA 4DG0E 4RA4A 4GKHA 3TZ7A 4FEVA 1AGWA 4KS8A 5CVGA 4P2KA 4YJRA 4K6ZA 2HENA 3P79A 4EK5A 4FYOA 1Q97A 4ZLZA 3MH3A 4FNYA 3Q6WA 3CQWA 2G2HA 4IVDA 4NK9A 2KULA 3DLZA 3PY1A 4XG8A 4AGCA 1CMKE 1H8FA 4ZXTA 4YJVA 3AD6A 1MRVA 1W98A 4WD5A 5IMEA 2VD5A 4ZEGA 3FLSA 4FODA 4G6LA 4G6NA 4BBFA 4QQTA 2PZRA 1R0PA 4E7WA 3OWJA 4PTGA 2XMYA 1DS5A 3JPVA 1UKIA 4OTWA 5F95A 5I9ZA 3A7FA 5DR2A 3DJ6A 2VWBA 3ORIA 5CI6A 3EOCA 2C0OA 2OJJA 3EQFA 2VZ6A 3TDWA 3V01A 3AXWA 4FL1A 3BYOA 3BHVA 2BRHA 2VO0A 4RVMA 1H27A 2X4ZA 4CYIA 2A19B 1XH5A 2CN8A 3TKHA 4C2VA 2BHEA 2Z7SA 4BB4A 5HTBA 4PP7A 3FV8A 4B8MA 2VX3A 4PTEA 3G15A 4H3QA 4WIHA 4KSQA 5K4IA 2PSQA 5HQ0A 3GENA 4PP9A 3EQGA 1PXLA 2VGOA 3DB6A 2BZHB 4UMTA 2PYWA 3LJ2A 1YXVA 4EH9A 2NPQA 4PTCA 5J5SA 3EFLA 3U87A 4FT9A 3B8QA 4DEGA 4GS6A 2C6OA 2YM7A 5CENA 3NNWA 2GNGA 4OTGA 4GU6A 1OGUA 3FE3A 3PY0A 4MQ1A 4BN1A 4QQ5A 1UKHA 4QP4A 3FLQA 2DWBA 3ZEWA 3W0MA 5E90A 1PMNA 2X8IA 3OW4A 1URCA 2C6LA 2X2MA 3W0NA 2PVHA 4BIBA 3TV6A 2B4SB 4FKVA 4GT4A 3D7TB 4ZK5A 4ZAUA 5HBJA 3NSZA 1H1RA 5EI6A 5H2UA 3V5WA 1YWRA 1YWNA 4NSTA 4DYMA 3UNKA 3QQGA 2JIVA 2OIBA 5CEIA 3ZZWA 1LEWA 2BZIB 4QMYA 1WVYA 3QYWA 3ML1A 3OROA 4DN5A 5KKRB 5DEYA 4H39A 4AZFA 3QKLA 4O6LA 3MH1A 4EJNA 5EHLA 3H30A 2QG7A 3A99A 4F9CA 4QEBA 2RSVA 4QNYA 1Q62A 2OF4A 4QYHA 3LFFA 4KINA 4LGGA 4RIXB 4O84A 2G2IA 3VONA 3EKNA 2Z2WA 2C1BA 3VRZA 3ZUVA 4GIIA 3AC3A 1FMKA 1F3MC 2WOUA 4FE2A 3AT4A 1RE8A 1ZYDA 3ZFMA 4O0UA 1W84A 3VF8A 4GFOA 5E92A 4MBLA 5DT4A 1MQBA 1OIQA 2PY3A 2QOKA 5AP3A 3G9LX 5TKDA 4BR3A 3KIOC 3IONA 4X2JA 1GAGA 3DU8A 5DGZA 4U0IA 3VIDA 1JBPE 1YI6A 2PVKA 3PLSA 3WF7A 5E91A 2OZAB 3AC5A 3PLAE 4MK0A 5IDNA 3KCKA 4BCNA 3VUDA 3R9OA 3IGOA 2OSCA 4YPDA 3ZMMA 3O51A 4GW8A 3DKFA 2YJRA 4IM2A 2WU6A 2BTRA 4KIOA 3TKIA 3L9LA 5IA2A 2B9JA 2PZIA 3V8WA 3O96A 2QC6A 2YABA 3R71A 1JSUA 4QMWA 2BAJA 5IA1A 5A6OA 5A54A 2E9UA 5BVOA 2VTRA 2Z7LA 4QYEA 4RIWB 4X3FB 2XVDA 2I40A 3CD3A 4FG9A 2QCSA 4FSRA 5HBHA 4E5BA 4K77A 3NIEA 3HA8A 4FV8A 5L2SA 3S3IA 3VUIA 3TIYA 5F9EA 2VTIA 4ACCA 3E88A 4U41A 2GMXA 4BBEA 2F4JA 4ZY6A 4FNZA 2GU8A 3BE9A 4EWQA 5BVEA 4W8DA 2XUUA 4FKJA 4BY9E 5LQFA 5CVHA 5GINE 1QPCA 3PJ1A 5DPVA 4CLJA 5IH6A 5IUIA 4LL5A 5CTPA 3FUPA 5E4HA 1W2CA 2IG7A 3UO4A 3ATTA 3NAYA 3GU6A 3ORLA 4UYAA 3UGCA 1Y6BA 2GTMA 4D1SA 4FJVA 2OU7A 3S2PA 2W9FB 1BLXA 4JS8A 4QMOA 2XIZA 2EWAA 2XNPA 2UZLA 1O6LA 3QHWA 3QALE <