3TUCA

Crystal structure of syk kinase domain with 1-benzyl-n-(5-(6,7-dimethoxyquinolin-4-yloxy)pyridin-2-yl)-2-oxo-1,2-dihydropyridine-3-carboxamide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
257
Chain Sequence
IRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Identification of Type-II Inhibitors Using Kinase Structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 257
sequence length 276
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tucA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tucA01
2UW7A 4L52A 4RIWA 3V3VA 4YJQA 4JAIA 2CJMA 4IX5A 4JIAA 2OJ9A 3GC7A 3PY3A 4R3PA 1H28A 4IWDA 3P86A 3I81A 3MJ2A 1PHKA 2VTLA 2WU7A 3AD4A 4APCA 4WD5A 5DWRA 3JR1A 5HCXA 2GS7A 2QOKA 3SXFA 3V8TA 4FI1A 4L00A 4EH3A 2GMXA 2GTNA 3MTFA 3Q04A 2C6DA 4MD7E 3EQBA 4O27B 1O6YA 3IW5A 3NW5A 3KCKA 2ITOA 4UWCA 4WOVA 4HYHA 3VWAA 1G5SA 5L8JA 3IPHA 4S2ZA 3SOCA 5DYJA 4X21A 2W1FA 2E9OA 2J0IA 3DBCA 4YO6A 5M53A 4CYIA 5LJJA 5FBNC 3F3VA 3F7WA 1Q8UA 2HY0A 2WELA 3RPRA 4YR8A 1WMKA 2XBJA 4TWCA 3QCYA 4QOXA 2YFXA 2JIUA 5CASA 5J9LA 1OL7A 1XH4A 4FKRA 5E8WA 3AGMA 5KMMA 2X7FA 5D9HA 2CNVA 5A46A 1LPUA 4Q9SA 3S4QA 3ZBFA 3BYSA 4CYJA 2QODA 3DJ5A 2IZSA 2FYSA 3C9WA 3GCVA 2QVSE 4NUSA 5KBQA 5HO7A 5E7RA 2C0IA 5FGKA 2GNGA 3FY0A 1XH8A 2O64A 2ONLC 1Y8GA 4U9AA 4X2GA 3TKUA 4BCIA 4C4EA 2BFXA 3C4XA 4XS2A 3TV4A 5FTGA 4NW6A 2JIIA 4XYFA 3PZHA 4APPA 4B8MA 4F65A 5K4JA 4NTTA 4DH1A 2XIXA 3OF0A 4WBOA 1CSNA 3F82A 4AT3A 1OIYA 3A4OX 3BGQA 4IAKA 5LARA 4TWOA 3QUDA 5K0KA 4DFZE 3MDYA 1XHAA 2C5NA 2WQBA 5HU9A 3FYJX 4U81A 4DE4A 4HVDA 4EI4A 4NM0A 4W8EA 5M51A 2ZDTA 2IO6A 2XEZA 2C3JA 1A06A 3BI6A 2XEYA 4LMNA 4A9RA 2O63A 3FMLA 3JS2A 3R22A 4FK3A 2QG7A 2HENA 2WIHA 4H1JA 2VWBA 3I0OA 4G6OA 4C59A 4FT3A 3Q6UA 4B8LA 4BCFA 2LGCA 3PVWA 2R3LA 4GJ2A 2HELA 4I5MA 4FGBA 5CSVA 4J96A 4EH5A 4XRLA 3HA6A 2EVAA 2NP8A 4FZ6A 4IVCA 3PJ3A 4UBAA 1KE9A 3UGCA 1PMEA 3QHRA 4OTQA 1LP4A 3N9XA 3VBVA 4C38A 5IH4A 2QD9A 3FQEA 3KULB 3NGAA 4QP8A 2XKFA 5KX8A 3S0OA 1PMVA 3DGKA 4ACMA 4KIOA 1PMNA 2NO3A 4EWQA 2C4GA 5HCZA 4AGWA 3E7OA 4ACDA 4BICA 3FMJA 3NIEA 5AA9A 4B6LA 3A61A 2P33A 3UC3A 3II5A 3REPA 2VWUA 5CT7A 4NW5A 4HCUA 4Q5EA 1FMOE 2QO7A 4ANNA 4LV8A 4JXFA 4FODA 4RIXB 4U79A 1OGUA 2I0VA 2PUUA 3VBQA 4F6SA 3AMYA 2ITPA 4IVBA 4PUZA 3HAVA 5JFWA 4ZIMA 3QX4A 2XKCA 3Q2MA 4L42A 2GHGA 3QQJA 4LOPA 3QTXA 3G0EA 4GIIA 5CNOA 3UOLA 4B99A 5F94A 4CT2A 4DFNA 3ZCLA 4O2ZA 3RNIA 4E4NA 5K9IA 3EL8A 2VN9A 4L44A 4U3ZA 4YPDA 4RBLA 1ZMUA 3BWFA 4RIYA 5HBJA 3LFQA 3OW3A 5HCYA 2RFEA 3I4BA 3HMPA 5A3XA 4U3YA 4OTDA 1Q5KA 3RALA 2W7XA 5DFPA 4UMPA 4JS8A 5EI2A 3SW7A 3VS5A 3DFAA 4F9WA 4O7TA 5AP6A 4EUTA 3U8WA 4AOIA 3BX5A 3PFQA 4TKSA 4C3RA 1LUFA 2FSMX 2CGVA 1Q24A 1ZOHA 1NA7A 2V22A 2VTIA 3AGLA 3QD2B 4M0ZA 4V0GB 3COMA 4IVDA 4UALA 3R7EA 4UZDA 2PUPA 4WNKA 2W4OA 3D9VA 4GFMA 3SXRA 3UIMA 3RI1A 2ITZA 3ZH8A 2A4LA 4PDOA 4PPBA 3A7JA 2R3OA 3QTRA 3D5WA 2EXMA 4H3BA 4BDKA 3EFWA 4BCHA 1YW2A 4UXQA 3ZLSA 5EDRA 4O7ZA 3CIKA 2A19B 5J5SA 2WZJA 2I7QA 5DPVA 3LQ3A 3HZTA 4X2JA 3ZSHA 1NW1A 3F5XA 3QZGA 5FXSA 1OUKA 3SQQA 1OL1A 4FKPA 5CU2A 5I9ZA 4K0YA 1XH6A 3G15A 2H96A 2C0OA 3LFBA 2R4BA 2AC3A 5IQIA 5CF6A 1ZRZA 3QCXA 3ZRMA 4ZZNA 4XBUA 2W0JA 4WHZA 3GP0A 3VBYA 4AGDA 1GIIA 1V0OA 3DXNA 5I0BA 3DK6A 3D14A 4I5HA 4RWLA 3NNWA 1UWJA 3LOKA 4X3FC 4ZJIA 3VBWA 4MXAA 3FL4A 5CU3A 5FUTA 4TNBA 3L9NA 4IFCA 3U9NA 5J87A 1RDQE 3WILA 1NVQA 5IZFA 2HW7A 4FBXA 3BE2A 2C1AA 3CCNA 4FVRA 3UZRA 2R3QA 4GT5A 2VZ6A 1OIUA 5K4IA 4LRKA 4MWIA 3UE4A 2OJJA 4AU8A 4EBVA 3EN7A 3DTCA 3IW7A 4ASXA 2OW3A 4FSQA 5AR7A 2XNEA 3O0GA 4O0XA 1OPJA 2CGWA 3DNEA 2J4ZA 3UQFA 2YEXA 3BYOA 3SAYA 1KSWA 4UZHA 3MN3A 5CU0A 5HQ0A 3ZM9A 4X0MA 5AP7A 3WF8A 5HTBA 4IWOA 4S30A 3LJ0A 2OIDA 3QUEA 4FTAA 4U80A 5TO8A 3VQUA 1YI3A 2VTMA 2CSNA 2IZRA 2W06A 3RBWA 5CF5A 4M12A 5EW9A 1OVEA 3GCQA 2ITVA 5H3QA 3V8WA 2VO7A 3WIKA 3C0IA 3CQUA 1H0WA 5BMMA 5CEQA 3HMMA 4GK3A 4C4IA 3U6JA 1VJYA 3FKNA 1OB3A 4XOZA 5ANDA 4NYEA 4YTCA 5ICPA 2WMUA 3AOXA 5FG8A 3LFCA 4G3CA 4PQNA 3I79A 4AZVA 1U54B 4R5SA 3HKOA 2YWVA 2B9JA 2R7IA 2YACA 2WPAA 3F88A 5EHOA 2R5TA 4JQ8A 2HXLA 2C5YA 3GNIB 5T3QA 3FPQA 3KRRA 4L8MA 4BDGA 4H3QA 1MQ4A 4HPTE 4AZSA 3A7GA 3K3IA 3Q9ZA 3UQCA 3LLTA 3F3ZA 3NZ0A 3VS3A 4WIHA 2IN6A 4GK4A 3I5NA 3QFVA 2J5FA 2PVHA 1TQPA 3OFMA 5B7VA 1Q62A 3FLZA 1MUOA 1XR1A 4ZOGA 4C61A 1IAHA 2BROA 3PPJA 4C33A 4PL3A 1Q3WA 3QX2A 4RPVA 4YGAA 5EW8A 4RWIA 4D2VA 1WBNA 5EYMA 3IOPA 4QMLA 4FV2A 4XG8A 2OFUA 5LVLA 5HG7A 1GZ8A 3OWJA 4A9TA 4WUNA 4X3JA 4M0YA 1U4DA 4O1PA 4AT4A 3ZRKA 2C3KA 2X1NA 2JKKA 3O96A 5HBHA 3F61A 2F57A 3D7TA 3AC2A 5EM6A 3MVJA 4ACHA 2ZJWA 3LFEA 4FX3A 5F20A 3FPMA 5TKDA 3LM0A 5M4UA 3DT1A 3DY7A 3AC3A 5M07A 3U87A 5IMEA 5GIPE 4NSTA 4RX7A 2V7AA 3HMNA 4RJ4A 1K2PA 4EZ7A 3FXZA 5AM6A 4BDFA 4DTAA 2J51A 4EOIA 3GENA 5FXRA 4ID7A 1OECA 2I40A 5BYYA 2GNIA 4PRJA 5D1JA 5CAQA 5E4HA 4FYNA 5AM7A 2O2UA 2OJGA 2R7BA 5KE0A 3BEAA 4I4FA 4BTMA 3PVGA 4FTOA 3HRFA 3PG1A 5AP1A 1PXJA 3UVPA 3DQXA 3EZRA 4V05A 3E8NA 5LXMA 2CDZA 4JDIA 1KWPA 1XBAA 2ACXA 2XK7A 4DH7A 5C8MA 4EC8A 1PRYA 4OUCA 3ZLXA 5JRSA 2UW6A 4CXAA 3DXQA 4FKSA 3UNKA 3NIZA 4H39A 3TNWA 3NMUF 1W8CA 3TZ7A 4YHTA 3B2TA 4D1ZA 4ZMFA 4DBNA 3K5UA 5L3AA 1PXIA 2BFYA 2XF0A 4LGDA 2UV2A 2HOGA 3V6RA 3V5TA 2V5QA 3D94A 3QRKA 4WBBB 3QZHA 5LWNA 4EHVA 3DKGA 4UMUA 2C30A 1H1QA 3MFUA 4IAIA 3ZUUA 2XCKA 3GCPA 1BI7A 3OUKA 5T68A 4XLIA 2X8DA 2YIYA 5AUXA 3VUDA 3ZO2A 4D4YA 5ITAA 4O0YA 4H1MA 4QPSA 5DE2A 4KKGA 4TYIA 1H1RA 3UP2A 5K5NA 5DN3A 5L6WL 4TYHB 4IM3A 3QYZA 3DZQA 1BYGA 2GPHA 5KHWA 1HOWA 2UW9A 2VWWA 2FA2A 3DDQA 4G6LA 4RRVA 4YLKA 1UVRA 2R3PA 4BDDA 1HCLA 4IADA 2PUIA 4M14A 3ZU7A 2Z02A 3VUGA 3M2WA 3BGPA 4FNXA 4U7ZA 5C1QB 2PE1A 3FL5A 1J3HA 1MRVA 3GT8A 4IB1A 3R28A 4F7SA 2VX1A 3PJ2A 3LFFA 3QTUA 4HYIA 3ETAA 3ZUVA 2WU6A 1H1WA 3I1AA 5B2LA 3LCDA 4N70A 4HVGA 1KOAA 4QMMA 4FV4A 4NM7A 4N57A 4IWPA 4R77A 4YUQA 1YXSA 3AC5A 4U41A 1L3RE 1CKIA 5C8NA 3R8VA 4CT1A 3LXKA 2J6MA 3PRFA 5ANEA 1OITA 3ET7A 4GFGA 1BI8A 3KN5A 3EN4A 1VYZA 4JL9A 3QWKA 4I5CA 4QP9A 3QD0A 4R3CA 3QA8A 4QMOA 3CKWA 2XIKA 3TUDA 2WAJA 4U6RA 4AS0A 5LVPA 3E63A 3QKMA 4FV5A 4EQUA 3ZZWA 4FSRA 4EYJA 4JBPA 5J79A 2OGVA 3R7GA 2HW6A 1REKA 5E91A 4XG4A 5IA1A 3UPZA 2VTQA 3O51A 4G3FA 1FQ1B 3MGYA 1AD5A 3KULA 4LUDA 2HZNA 4CG8A 3SG8A 2Y4IB 4LUEA 4AA0A 4JRNA 4OTIA 4GU9A 2WTVA 3P5KA 5FBOA 2XH5A 5AUZA 3R9DA 5CAOA 3NVKI 3UIUA 3FV8A 5L6PA 1OIRA 3MB6A 4FOBA 2BUJA 3NUUA 4NU1A 4FSNA 4RIXA 4ZSAA 5HNBA 3NDMA 5HICA 4S33A 4OR5A 3LCKA 1SNXA 2QG5A 4RSSA 3ZXZA 3K3JA 1WBPA 3KU2A 1QPCA 5DHJA 4ANQA 2BHEA 3C4WA 4OBQA 4TYJA 5HX6A 3DLZA 4FTNA 5CU6A 4E73A 3LM5A 4MBIA 2YCQA 3TNIA 3KREA 2XK6A 1M7NA 3OY1A 3CY2A 1SVEA 4J97A 4U0IA 5E1EA 1NY3A 4W8DA 3FHIA 4YTHA 3A99A 3DS6A 1Q61A 4FSWA 4A4XA 4ZY4A 2C69A 4QPMA 4B4LA 3RCDA 4AAAA 4O0SA 2W1IA 2OXDA 4L3JA 2WMAA 5TE0A 4D5KA 2QCSA 4BL1A 4F09A 2PTKA 3RHXA 3EHAA 5LMKA 2WTKC 2CPKE 5A4LA 2XZSA 4D0XA 4EYMA 3QC4A 2YDIA 5FWKK 3E8EA 5AEPA 3KXGA 2R3MA 1VR2A 5ANOA 3TUBA 4FL2A 1GY3A 4QP1A 4FOCA 2HWPA 2ITQA 4C02A 4V0GA 5DA3A 4BIEA 3KXHA 4UMQA 1A48A 3AD5A 4FTJA 4LL0A 4IB0A 3QKLA 5BVEA 5L2WA 4G31A 3NR9A 4KBCA 4O7YA 2VTAA 2UUEA 4ZTRA 1CMKE 1YHVA 4A07A 2X4ZA 5BUJA 3RWQA 4ZSGA 5A54A 5J1WA 1YHWA 4G5PA 2C6TA 4YZCA 3W2CA 3ZEWA 2Z7SA 3K5VA 3QQKA 3TNHA 5I9XA 5HKMA 3IDBA 5IQFA 4MQ1A 4U40A 4IAFA 3N4TA 3SG9A 4FT9A 1YXXA 2KULA 3TACA 5L2SA 3TNPC 4HOKA 5C03A 1H8FA 4R1YA 3QTSA 3FMEA 3M11A 1ZY5A 3JY9A 3TG1A 4OTWA 4H58A 2W17A 3MESA 5H9BA 5AWMA 5B2KA 3O17A 1CM8A 1R3CA 3IW4A 2WMTA 4L9IA 4I6BA 3D2IA 3QRTA 3VS0A 3ZEPA 3ZUTA 4AE6A 4NM5A 4AW0A 4WUAA 1H01A 2VTHA 3KKVA 3WYXA 2VO3A 5CSWA 2XNNA 4FIHA 4HNIA 4E1ZA 2W5AA 3LXPA 2WOTA 1WCCA 1WVXA 4TPTA 4QMYA 3ZSIA 3GXLA 5LCKA 4C34A 2C3IB 4QTDA 5AAGA 3NCGA 2X7OA 3BCEA 5HO8A 4A9UA 4IFGA 4A7CA 4B9DA 4RX8A 4IJPA 2X9FA 4FV0A 3C4CA 3QTZA 3R7OA 4QNAA 2W1HA 4UEUA 2WIPA 5AP2A 3ZHPC 3RPVA 4C37A 4C35A 2J9MA 4JLCA 5EI6A 2RIOA 5FP6A 2VTSA 5EM5A 5CLPA 5IUIA 3ZBXA 4E7WA 5AV4A 3OCSA 4PP7A 1YDRE 2R3JA 5LQFA 5HIDA 3GU7A 3NYNA 4L67A 5M4FA 1H08A 1KE8A 3KFAA 3OHTA 5HNGA 4FNWA 3T9IA 4XG6A 2RSVA 4E8AA 5IQDA 1JKLA 4FG8A 2O5KA 4EL9A 2BCJA 3Q3BA 4NJDA 1PY5A 3FLWA 3L9PA 4QYEA 2YCFA 4YJUA 1W84A 3RPSA 2WQEA 3OD6X 4CFNA 3LVPA 1U54A 4LMUA 5EDQA 3C0HA 3BKBA 3EZVA 3RK7A 1ZYSA 3ZTXA 2EUFB 2VD5A 3IS5A 3QTIA 3WE4A 2WQOA 3FBVA 4WNMA 1ZYDA 2VTPA 3DBFA 1CTPE 3ENMA 1DAWA 3VUMA 4NJ3A 2HZ0A 5AR4A 3E8CA 2PPQA 3A7FA 3E5AA 3MTLA 4EZ5A 4O7VA 4MNEA 4JG6A 2DWBA 4O86A 3MS9A 4I6FA 2X9EA 2H8HA 4YNEA 1VEBA 3KA0A 2YIWA 1OM1A 1Q8ZA 4F63A 2XIRA 3HUCA 3LFDA 3Q4UA 3Q9XA 3MI9A 3ZONA 4EKLA 4QTAA 5DT0A 2EXCX 1U59A 2YJRA 3JVRA 3SDJA 2FSLX 4UYNA 4IM0A 3I6UA 2YDJA 5A14A 3DZOA 1XH9A 2OG8A 3BV2A 5AP3A 3VHEA 2Y9QA 1J1CA 3PXKA 4TN6A 5FEDA 5HIBA 4FEUA 2ZMCA 3JYAA 3VS4A 3KXMA 3IGGA 3FC1X 1YHSA 3HV6A 4E6CA 4PWNA 2BRBA 3ZFXA 4CRSA 4YO4A 4MX9A 5JT2A 3Q6WA 4M84A 3C50A 2WMBA 3K2LA 1XBBA 4OTHA 4U5JA 5DR9A 3ORTA 4YJRA 3LPBA 5AR5A 2VWZA 5M4CA 1JLUE 2F2CB 1H24A 2UZTA 3ORNA 3Q96A 4EONA 3CBLA 4ZLZA 1WBWA 2ZM1A 5HU3A 2WMWA 3L1SA 4M13A 1OKYA 2CKQA 3VUTA 4PDPA 2VTTA 4PPCA 4QPAA 4WNOA 5IUHA 5EW3A 3N4VA 3KRJA 1YI6A 4GSBA 2F7ZE 3R1SA 3E92A 4AOTA 4EK5A 1QMZA 2ZDUA 3P23A 1SVGA 4D4VA 1P2AA 5CT0A 4FKQA 1HCKA 2G2FA 5FTOA 4GUEA 1STCE 4EH4A 3UMWA 4AF3A 3QQGA 5CZHA 4DTBA 4ZS0A 3F66A 1Q41A 3ULZA 3OWPA 5DEYA 3UG2A 1QPDA 4P90A 4FTTA 5IA5A 4RJ8A 1YWRA 1ZXEA 2CN5A 3HDMA 5CI6A 5HD7A 4AZTA 3O8UA 3DLSA 2CHLA 1GIJA 2P55A 3FMNA 5AFVA 2I0HA 4L3LA 5DT4A 4M8TA 4BYJA 1H07A 4LG4A 4QTBA 2XNBA 5GJGA 4DGNA 1M17A 2EXEA 5JN2A 4XBRA 4IX3A 4X7QA 4L7FA 3ZOSA 4ANLA 3JY0A 5EHYA 4ZTMA 5AV3A 3U4WA 4BDIA 4C62A 5HORA 4QMTA 4ITIA 1IRKA 2BILB 4FSMA 4TYHA 5JQ8A 1OL2A 4FSZA 4JDKA 4X3FB 2BMCA 4FL1A 2YZAA 3G6GA 4ENXA 3LMGA 4JQ7A 5AR2A 4AGUA 2PUNA 4L6QA 1PKDA 4OTPA 5FRIA 5IPJA 4PP9A 5I4NA 3GU6A 5BPYA 4DGMA 3NRMA 2A0CX 3Q5IA 3WZUA 4I0SA 3HRBA 3BYUA 1ZYCA 3SRVB 4DH3A 3MY5A 4MXCA 2QR8A 4F0FA 1KOBA 3PUPA 5A4QA 4I20A 3D15A 2CLXA 3DCVA 4K11A 4AWIA 4OBPA 3UDBA 4ALVA 4UXLA 5EK7A 2YISA 4MBLA 3Q53A 5I5ZA 2Q83A 4QMSA 5D7VA 3F5PA 4ASZA 4D28A 4YP8A 3D83A 5M56A 1PYEA 4C4FA 1ZARA 4E26A 4NM3A 4YJTA 4YU2A 5CS6A 5EQEA 1V0PA 1M2PA 2VAGA 1DAYA 4JQEA 1Y57A 3P4KA 5GNKA 2WMRA 1YWNA 1I09A 4JIKA 4TRLA 3GU8A 4QQ5A 4RWJA 2QOLA 1WBTA 5I9UA 4BGQA 4RJ3A 3U6HA 3R0TA 4UMTA 3QGYA 3RCJA 4Y83A 4RA4A 3FZPA 3OG7A 3ZFMA 4FT0A 4O82A 4CLIA 2YM8A 4XV3A 3LLAA 4K1BA 3W2SA 3MV5A 4BI0A 3NW7A 5LMAA 2H9VA 3OW4A 4QQJA 3OXZA 2RL5A 5I9VA 2B9IA 4WRGA 5KHXA 4ZS4A 2B9FA 3OROA 4BDBA 2WEVA 3PG3A 1B6CB 4OAUC 3CC6A 2I1MA 2O3PA 2QR7A 3BQRA 2Z7LA 2QONA 3RKBA 2XYUA 4F7LA 3AT2A 4QMNA 4D58A 2FH9A 3Q2JA 5M08A 5DMZA 3FZSA 5KUPA 3GCUA 4IACA 2PYWA 2O0UA 4F6UA 4RFYA 4EK4A 2OZOA 3ZDUA 4ZLOA 4IXPA 4NKSA 4FUXA 1GNGA 4IDVA 3KGAA 3R00A 5KBRA 2R3FA 2BTRA 3VRZA 4USEA 5I3RA 4AN9A 4D4RA 2F2UA 4DT9A 4XH6A 4YC6A 3KRLA 1FPUA 4BDJA 3BBTB 3PPKA 2Y7JA 1FBNA 3A60A 3LQ8A 3U51A 4QMWA 4R7BA 4CKJA 4QT1A 5JZJA 3F69A 1I44A 3FYKX 4ARKA 5HD4A 4H36A 4Y85A 3OP5A 4MXZA 4DAWA 2AC5A 3NYXA 3UYTA 4EKKA 3POOA 2GNLA 5A6OA 2PMNX 2VO6A 2XIZA 2IWIA 2JAMA 4CFFA 4JR3A 3MVLA 3PE2A 4ZTHA 4D2TA 4Z3VA 1TKIA 3CTHA 3A7HA 3EL7A 3SA0A 2ZYBA 4FSUA 3N4UA 2C5VA 3KRXA 3RM7A 3QLFA 4X2FA 3C5UA 2Z60A 2ZB1A 4I41A 1FINA 5EYKA 4FNYA 1OL5A 2WMQA 5CSPA 3R1YA 3RP9A 4L3PA 3WF9A 1W82A 5DR6A 5AUWA 3QTQA 5BUEA 3RZBA 3KC3A 3MJ1A 4FKIA 5HI2A 3L9LA 4YJPA 2ITXA 4B7TA 5IU2A 2CCHA 3DK3A 3PIYA 4EWHA 4L45A 1ZYLA 5A4EA 5CEMA 1OKVA 4J8MA 1FVVA 3C4FA 3FC2A 4ALWA 5JEBA 3LCTA 3ENHA 2G01A 4PMSA 2AUHA 3OXTA 4G6NA 3CD3A 2JKQA 4BIDA 3FZOA 3MA3A 3QLGA 4IZ5A 2W5HA 4FTUA 3V5QA 5EH0A 4ZJVA 4MXYA 3OZ6A 2J0LA 3MB7A 4HYSA 4RG0A 5FDPA 4GEOA 4NFMA 4EHZA 4O7LA 2F4JA 3H0ZA 2OF4A 4MF0A 4MKCA 4NH1A 2ONLA 3G6HA 4Z7GA 2HAKA 3HV3A 3PY1A 3TL8A 2GFSA 2XK8A 4HPUE 4O84A 4TY1A 2ZV8A 2P4IA 2G2IA 2YLEA 4XG3A 3UIBA 4F08A 4YTIA 1OMWA 3WOWA 5M57A 3DPKA 2X6DA 3I0QA 2W05A 3QUPA 4PTGA 4F64A 1PYXA 4HW7A 4N6YA 2BIKB 3Q4CA 4ZTNA 3VHKA 3FLNC 1CKJA 3BYVA 1YDSE 3OWLA 4FIGA 4A9YA 3ODZX 4CCBA 5IISA 2YITA 3C51A 5K3YA 5L4QA 4XJ0A 1YDTE 4AA5A 2UW3A 2GQRA 2YAKA 3QYWA 1VYWA 3I7CA 4FMQA 3SD0A 2Z7QA 3W33A 4G17A 3NS9A 2BZKB 1F0QA 2BAQA 3QAME 4AP7A 4M67A 3EN9A 4GKIA 3HP2A 3MH2A 3AT3A 4GT3A 4M66A 5HG5A 3TJDA 4I21A 1YXVA 5HTIA 3Q9WA 2B7AA 3HVCA 3TTIA 2PZ5A 4U44A 2IG7A 4EEVA 2PVMA 5DRDA 2OIBA 2NRYA 4FEVA 3TZ8A 1LEZA 4DFYA 3GQLA 2B54A 4QYYA 3SOAA 2QNJA 1FVTA 3TN8A 3ZDIA 4FICA 4F1MA 3KEXA 4HJOA 2QC6A 5CEPA 2OWBA 3TT0A 4JOAA 3DFCB 4L53A 1JAMA 2UW0A 5DLSA 5F95A 2ZM4A 2XK3A 3EQFA 2JFMA 2YZLA 2SRCA 4CZTA 4D0WA 2PVJA 2OSCA 4M68A 4M7IA 4Z55A 3ZZEA 5E9EA 2YLFA 4EUUA 5AV0A 3I60A 2BTSA 3U4UA 4K18A 4KBAA 4QTCA 1PF8A 4CV8A 4FIFA 2VWIA 4GMYA 4O22A 2PVLA 2R3GA 3QQFA 4X6RA 4Y46A 4UN0C 3OMVA 1CDKA 3T8OA 1EH4A 2E9VA 4ZTLA 5HLNA 1JNKA 4BRXA 4D9UA 1M7QA 5AUVA 3EB0A 4GH2A 4BCJA 2XNPA 5CZIA 1A9UA 4FIEA 3OWKA 4WNPA 3QQHA 3GOKA 4CQEA 2WTKB 2WEIA 3DQWA 3IDCA 2OO8X 4TT7A 4XP3A 3QD4A 4W9WA 3RAHA 4AUAA 4RZVA 4O6EA 3ORZA 1PXPA 3DKCA 4KIPA 5AJQA 4M69B 1UKIA 2P0CA 4RMZA 1JKKA 2PVKA 3DB6A 3O2MA 3MPMA 4LQMA 5C8KA 3UC4A 3GVUA 3RMFA 3MA6A 5DEWA 4GT4A 2JBOA 4DG2E 4U8ZA 4ZSLA 1XJDA 1PKGA 1YWVA 1YOLA 3OC1A 1YXUA 2W4KA 3OS3A 4HGSA 4IB5A 2HZ4A 4TWNA 4BHZA 2JGZA 3OEFX 4FE2A 3DV3A 2F49A 4DN5A 4CV9A 3UVRA 2WQMA 4QP6A 1H1PA 3WZEA 4YNOA 1Q8YA 4BGHA 2WO6A 4EZ3A 4I1ZA 1Q3DA 3KY2A 2C6IA 3PXQA 3FSFA 3AT4A 5F9EA 4BHNA 4CFXA 2HY81 4HCVA 4XG9A 2X7GA 4DH5A 3FXXA 4YZ9A 5KNJA 2R2PA 4X3FA 3BPRA 2VGPA 5HTCA 5AAFA 3W55A 2RGPA 2P2IA 2WTCA 5FXQA 3OCTA 3WYYA 3ZLYA 4C4GA 4A06A 5EHLA 5CQWA 4FV8A 3D5UA 5BVKA 4UYAA 3BEGA 1G8AA 2FGIA 2OBJA 4RVTA 3UYSA 3SRVA 4XX9A 5CU4A 4G5JA 4TTHB 3UNJA 2PMIA 3DDPA 3R8PA 4K6ZA 2PMOX 1T46A 2YM3A 3MBLA 4FC0A 4XLVA 5AR8A 2ZOQA 1QPEA 3UODA 4ANOA 2ZB0A 5ANKA 3C0GA 3P0MA 2V7OA 4F4PA 2YWPA 1O6KA 5ACBC 5GINE 5J8IA 2VNWA 4C58A 1Z5MA 4M15A 1BLXA 4RA5A 3LXNA 1UWHA 4BDAA 1J7LA 3RPYA 4ZMEA 5I9WA 5J9YA 4BY9E 4ASDA 4FTRA 4I94A 3EWHA 4XG2A 3P08A 5EKOA 2DYLA 4BCNA 4EH9A 3NAYA 1H26A 5JK3A 5CI7A 5GHVA 1WBOA 1UU8A 2G2HA 2R3KA 1QCFA 1O6LA 2ZM3A 4DEBA 4FTLA 3I7BA 4PY1A 4UX9A 4FL3A 1B39A 4S31A 3R71A 1LR4A 2EU9A 3EFLA 1ZY4A 5M4IA 5CEIA 1PW2A 4DEDA 3H9RA 4MEDA 3PP0A 4GL9A 4PMMA 4J1RA 4BGGA 4CFUA 4AFEA 2GHMA 4PDYA 3BHHA 2ZMDA 1S9IA 3DKOA 5HOAA 5AUUA 4ZTSA 5T6KA 5JQ5A 3HX4A 4L68A 4W4XA 5EYDA 4DEEA 2HYYA 3E8DA 2YERA 3EKNA 4FZFB 4H3PA 4DFXE 3AC4A 4O83A 5KMOA 3HV7A 4U42A 2XYNA 4NZWB 3DTWA 3F3UA 3SX9A 3VBXA 5FDXA 4NCTA 3EKKA 3OVVA 3S1HA 2IW9A 4KUJA 2ZV2A 3AMAA 3QWJA 3QZIA 4LM5A 4MVFA 4WG4A 4XV1A 1QPJA 3EYGA 3C1XA 3K54A 5KKRB 4EOOA 5KZ0A 2IVVA 2VWVA 2EWAA 3OTUA 5CXZA 5CY3A 4FEQA 5IQEA 1CKPA 4PMPA 3CXWA 3TI1A 3VW6A 2R64A 4DFBA 4C7TA 3AMBA 4EOQA 3H30A 4OAVB 3DAEA 4QMVA 3FLQA 3QGWA 3S95A 4ACGA 4BKZA 3DBQA 1JSUA 3ERKA 2OKRA 3PP1A 5AV1A 5J95A 3VF8A 3FUPA 3VS1A 4GJ3A 3PY0A 2R3RA 2G9XA 3CTJA 3GUBA 4O0RA 3MH0A 2XKDA 4UB7A 4WSQA 1ZAOA 3R8LA 4PF4A 3LQ5A 4E6AA 2VTRA 3OCGA 2XRUA 4I93A 3LE6A 4DT8A 5L2QA 2PZIA 1IASA 1MRYA 5JFVA 5CXHA 5J7BA 4KBKA 4YHFA 3PRIA 3QHWA 4RC4A 2E2BA 3H0YA 4NK9A 3GQIA 4X2KA 3F2NA 3LCSA 1YXTA 4BVUA 2WKMA 3HP5A 4RLKA 3UP7A 1W83A 2P2HA 3BZ3A 3JXWA 3LXLA 4JBVA 1V0BA 2UZEA 4CMTA 5BX0A 5LWMA 3NUSA 2VGOA 2Z2WA 3QD3A 2IW6A 3MH3A 4W9XA 4JT3A 3CD8A 3UNZA 1ERKA 3OOGA 5C4KA 2YM4A 4AQCA 3OXIA 4WKQA 5FM3A 3GB2A 4QYFA 3RZFA 4UV0A 4FKJA 3NSZA 4UMRA 5AA8A 4LI5A 4O1OA 4NFNA 1WVYA 2VTNA 5AP0A 3DB8A 2YIRA 2Z7RA 3F6XA 2AYPA 2C5XA 1H4LA 1ZMWA 3KXZA 3NYOA 4P5QA 3RHKA 4BZDA 5L8KA 4IDTA 4IVAA 3FMDA 5FEQA 1U5RA 2XM8A 5EI8A 4H05A 3UQGA 4IB3A 1R0PA 2RFDA 3M42A 2W96B 3PSBA 1DI9A 4QMPA 3ANRA 5HG8A 4F0IA 4WA9A 1OKZA 5C4LA 3PLSA 4OTFA 4F9AA 4Y5HA 3EQIA 3F5UA 4JG7A 3NX8A 4I0RA 3TIZA 5DI1A 1Z57A 3IONA 4QQCA 2C6EA 2J50A 3VS2A 5I9YA 2NPQA 3PJ8A 2OF2A 1H25A 5L8LA 4Y73A 4GIHA 4K33A 5GJFA 2JFLA 4AW2A 5IMXA 4O2PA 3UMXA 2XBAA 3KF7A 3QKKA 1Y91A 4B0GA 3SHEA 2BZJA 4JX7A 1ZZLA 2UVXA 2WMSA 2REIA 5DNRA 4O7WA 3R30A 1MRUA 3S3IA 3TEIA 2WD1A 2WMVA 2PY3A 2XKEA 4V01A 5D10A 3ZC6A 1YQJA 2QI8A 4NT4A 5H8GA 2QOQA 3P7BA 4L01A 4YC8A 2OK1A 1DI8A 5CNNA 2C5OA 4R7IA 2HIWA 4IAAA 2F9GA 3NWWA 2WTDA 3LMHA 3H4JA 5ETIA 2BDWA 3PA3A 3QU0A 1Q99A 2UW4A 3QF9A 3W2QA 3A62A 5IDNA 1YVJA 1XH7A 4CMOA 4DYMA 2J2IB 3R01A 4YJOA 2VUWA 3W18A 3IK3A 4C57A 5HVJA 5KMLA 3EFKA 4JX3A 4YBJA 4ZP5A 4BZOA 4MHAA 5IA0A 4TNDA 3QRIA 5E92A 3UO5A 4JDHA 1TQIA 4F7NA 4D1XA 5EQYA 4D2WA 2WFYA 4O21A 3G2FA 3V6SA 5HIEA 3SC1A 4RC2A 3S00A 4FIJA 4FV1A 3V04A 3VULA 3ALOA 4P4CA 4BWKA 2UZNA 3WBLA 4EK8A 4QMQA 4GFOA 4F9CA 1W0XC 1YKRA 4KKEA 4C2WA 1RJBA 4E93A 2BKKA 3Q52A 3E87A 3OUNB 3OCBA 2OIQA 4FKGA 3SGCA 5J5TA 5AP4A 4BB4A 2PWLA 5IEXA 4IQ6A 4HGLA 4FUYA 3CKXA 1Y8YA 5IA4A 4P7EA 4TWPA 4I22A 5FM2A 1FGIA 4I24A 3R7IA 3O7LD 2BZIB 2CN8A 3PE1A 5G6VA 5DOSA 2XK9A 4FSYA 4G3GA 4TL0A 4Q9ZA 2ZVAA 2PVYA 3CE3A 4ZZMA 4FVPA 2XNOA 4M69A 3ACKA 3DXPA 2IJMA 2QLQA 2X2LA 3BU6A 3KXXA 4JR7A 4Z9LA 2VTJA 3VJOA 3FKOA 4OLIA 2PMLX 3EN5A 4HGTA 4EH2A 2JDOA 2R0UA 4G3DA 2OU7A 3TWJA 1IA8A 4G34A 3QRUA 4EK3A 2A2AA 4HZSA 3CP9A 2W1GA 1U5QA 4GCJA 4CNHA 5F4NA 4AG8A 3QC9A 2HWOA 2YA9A 5C01A 1YRPA 3UO4A 5CAUA 5JH6A 4BCOA 4FEWA 1XQZA 3R9NA 5JGBA 3ALNA 4E6QA 1SM2A 1YOMA 2GS2A 2R3NA 4QMUA 3M1SA 4RJ7A 3UOHA 3V5LA 1OPKA 5BVWA 4O7RA 3FMHA 4ORKA 3HEGA 2BRGA 2WMXA 5IEVA 3Q32A 4LV5A 3RVGA 4O81A 3VUIA 2W1DA 2QOBA 2BRNA 1T45A 3G9NA 4G2FA 5CX9A 2OH4A 2UVZA 4KSQA 1KE7A 2YDKA 1BL7A 3AC8A 4XRJA 4QMXA 1PXLA 4YZNA 4YHJA 3FI3A 3UBDA 4ERKA 5B2MA 3CPBA 2W1CA 3RNYA 4OTRA 3BLRA 5FTQA 2HCKA 3W2PA 3E3PA 2W9FB 3G0FA 3ANQA 5DT3A 3CR0A 1OKWA 2W99B 4BCGA 2ZV7A 5C26A 2J5EA 3RPOA 1IAJA 4FV7A 3DK7A 2XIYA 4RFMA 3AQVA 3O50A 3KMUA 4QRCA 3GBZA 4FGRA 4EJ7A 4ALUA 1JWHA 4AGCA 2VO0A 3QQUA 3EOCA 5GZ9A 5A9UA 4QYHA 3V51A 4M97A 3ZS5A 2RKUA 3SXSA 5ANIA 3BHTA 2BAKA 5EOLA 4XEYA 2X2MA 2HK5A 3CQEA 4TYEA 4V04A 1UNLA 5BMSA 4FKWA 4C3PA 1IG1A 1GZNA 5BUIA 2E9UA 5BVNA 3IDPA 2W5BA 2X2KA 3VS6A 3R7VA 5ETAA 2E9NA 3P9JA 4J7BA 5BYZA 2UZLA 2PVRA 3R83A 3FAAA 5HLPA 4CKRA 4KB8A 1IR3A 3THBA 1YOJA 2FUMA 1BUHA 4ZTQA 4KNBA 3EQCA 4DEGA 2VX3A 4AACA 1UU3A 5CQUA 1WBSA 3G51A 5L2IA 4BTFA 5JGDA 3Q4ZA 4JVGA 3DBDA 3IOKA 4I6HA 4FKVA 1ZZ2A 5C27A 5M55A 5CEOA 4Y8DA 3ATTA 4U43A 3DAKA 4HYUA 4HVHA 5E8UA 5IH6A 3RK9A 4IW0A 3W2RA 2Z8CA 4XV2A 5E8SA 3HDNA 4J71A 4L43A 4NL0A 2VWYA 3IQ7A 2X81A 1SVHA 4CVAA 3ORKA 4F1OA 3BQCA 2JEDA 5HE3A 2QKRA 3FKLA 4EHEA 5BVDA 4RVMA 3LHJA 1FMKA 2GFCA 2WGJA 5FQDC 4EOKA 3EQRA 3VAPA 5LVMA 4ZJJA 2V62A 4X6QC 2B0QA 5M06A 4IAZA 3V5WA 2Q0NA 3RM6A 3F5GA 1ND4A 4ANBA 2R0IA 5IQBA 3COKA 1OL6A 4GG7A 5IDPA 3L8PA 4AZFA 1UV5A 4BCPA 4WO5A 3E64A 3B2WA 1W98A 4LRMA 3ZMMA 4GG5A 1Z9XA 1ZMVA 4CEGA 3R2YA 5JMSA 2B53A 4J52A 5ANJA 1ATPE 1BL6A 5H8BA 5BQ0A 4ZEGA 4BKYA 3UOKA 4RVKA 4MWHA 4YZDA 2B9HA 2BRMA 3ID6C 2UW8A 3FI2A 2R9SA 4GRBA 4K2RA 2C6LA 5IEYA 4Q2AA 4HZRA 2IW8A 3WE8A 4D2PA 1M2RA 1R78A 2YM5A 3QL8A 2C47A 3TUCA 4JDJA 2IZTA 3E7VA 4MXOA 4K9YA 1OI9A 1OPLA 2XCHA 5IQAA 2YAAA 2H34A 4YBKA 4PDSA 3SV0A 3LZBA 4GW8A 4JNWA 3DJ7A 4BBEA 1KV1A 4BBFA 4HVIA 3RINA 3QCSA 5A4CA 2JC6A 3OY3A 2YABA 2PULA 5ETFA 4BDCA 2W4JA 3LJ1A 2FSTX 4PV0A 2OH0E 4WSYA 4JAJA 2C68A 3ATSA 3PA4A 4AX8A 3NUNA 5EDPA 3FI8A 3ORXA 3QXPA 3L8SA 2I6LA 5GJDA 1YI4A 3BRBA 4FV6A 3R1QA 4MCVA 4N6ZA 3SKCA 5ACKA 2QHMA 3HV5A 4HNFA 4KD1A 5D11A 4F99A 4ZSJA 2C6OA 3MH1A 4QYGA 4MNFA 5KMNA 1F3MC 4AT5A 1F5QA 1JSVA 3OT8A 3V5PA 5AIKA 4TW9A 4XNEA 4FIIA 1FOTA 3G90X 4DTKA 4CD0A 4D1SA 2Y0AA 4PL4A 5ETCA 5BNJA 5DGZA 4FKUA 3UPXA 2W1EA 3HNGA 5HE1A 3E62A 2X39A 5HO6A 2JBPA 4F0GA 3JPVA 5GIOE 2OZAB 4ERWA 4DHFA 2BDJA 3TKIA 3OBJA 2ERZE 2JD5A 3F7ZA 4S34A 5DH3A 1GOLA 4PNIA 1VZOA 2YHVA 3OT3A 3VNTA 4CSVA 4S32A 5HLWA 3ZO4A 1P5EA 4CZYB 4DGGA 2VNYA 5LVNA 3MY1A 3KXNA 4IM2A 4BC6A 4WG3A 1SYKA 4XCUA 3R1NA 4RIOA 2BR1A 3IGOA 5TOZA 5FEEA 3HA8A 5C9CA 2GSFA 1Y6BA 4KS7A 4E4XA 3D5VA 4P2KA 4O38A 4ZAUA 5CVFA 3VN9A 4GYGA 3A7IA 4FT5A 4F70A 5K0XA 3FDNA 4DA5A 3R2BA 4NKAA 5HEZA 2CCIA 3MIAA 4GK2A 2GCDA 1J7UA 3G5DA 2JLDA 4PX6A 2VRXA 4FKLA 4IJ9A 2QHNA 3CGOA 4CFMA 3QA0A 5AUTA 2GDOA 4WG5A 3T3UA 1OBGA 3FXWA 3IG7A 5AV2A 3W16A 5CYIA 2OLCA 4M3QA 4DEAA 3U55A 4DLJA 4J53A 4XV9A 1JBPE 2BDFA 2CLQA 4PNKA 3FZTA 1DM2A 2C3LA 2BIYA 2C1BA 2PZPA 2XJ2A 3PXRA 4G9RA 4IANA 4R3RA 3LMIA 4USFA 4MD8E 2W9ZB 4Y5QA 2JITA 3BELA 5E8VA 4ANMA 1APME 2GHLA 3O7LB 1SNUA 4WT6A 3Q60A 1FVRA 3BLHA 3O8TA 3TV7A 4DLIA 5BYLA 2ITNA 5HGIA 4R6VA 3B8RA 3KVWA 3PVUA 4EHGA 2WOUA 2QOOA 4BI1A 3TM0A 4OT6A 3W1FA 4NEUA 4C0TA 4YJNA 3UIXA 3N51A 4PMTA 2Y6MA 3RTPA 2IVUA 5EQPA 1BX6A 4TZRA 3EH9A 2QQ7A 4RJ5A 2CMWA 4BBMA 4IIRA 4MD9E 4EH8A 3VO3A 2G1TA 2UZBA 2XNMA 4ACCA 4IMYA 5M44A 3R73A 3C5IA 3HUBA 3TIYA 5LVOA 4MBJA 3V5JA 3VS7A 3MFSA 4F9BA 1M52A 2BRHA 3R8MA 2GNHA 2O65A 2RFSA 1KE5A 5A6NA 3CJFA 2VU3A 4OW8A 3QZFA 1UKHA 3ODYX 3H9FA 1UU7A 2PVNA 4MK0A 3VW8A 3ZLWA 4ONAA 5IA3A 3BWJA 1JVPP 2QLUA 4C36A 2PE0A 1R39A 4R7HA 2X8EA 1SMHA 5E8YA 2QO9A 3D0EA 3R6XA 2WB8A 2O8YA 3NUAA 4QO9A 2JDTA 3NYVA 4W4VA 3TNQB 4KABA 2JDVA 3WZJA 4KWPA 2PL0A 4O0UA 3RWPA 2XM9A 5EYCA 3BV3A 3NNUA 4N0SA 3RK5A 4FTQA 3V8SA 2V55A 3HL7A 3DA6A 2RG5A 3L9MA 2DUVA 3MWUA 4IBMA 4KIQA 2J90A 3ZM4A 4ZLYA 5M09A 4LRJA 1JOWB 3NEWA 4LGGA 1JKTA 1RE8A 5H2UA 5HG9A 5EM7A 4KKHA 5K5XA 1ZWSA 4O96A 5DR2A 1ZOEA 4HGEA 2ETMA 3NLBA 4AW1A 1Q97A 3RAWA 4EOJA 4UWBA 3R8UA 3CEKA 4KIKB 4YJSA 2FSOX 5EFQA 2R3HA 2UVYA 3LW0A 5E1SA 3POZA 5ANGA 3NNXA 3VIDA 1GIHA 4NIFB 3DOGA 4AFJA 4CG9A 5IQCA 4DF3A 5TT7A 4PPAA 2J0JA 3PSCA 3GEQA 1P4FA 3FZ1A 3Q5ZA 4FT7A 3T3VA 3W32A 3WF6A 2QO2A 3PA5A 1OZ1A 2UZDA 4YTFA 2BALA 4KAOA 4LGHA 3MFTA 3BIZA 2R3IA 4F1TA 2WTWA 2BAJA 2NRUA 3SW4A 4O7NA 3MW1A 4FF8A 5HBEA 3GC0A 3NVMB 4W4YA 4U45A 3KQ7A 5CAVA 3COHA 5CENA 3R7YA 3PIZA 3H9OA 3MYGA 2J0MB 2QOFA 4DFUA 4J99A 1E1XA 3ROYA 5BVOA 3EYHA 4LYNA 3UZPA 2OFVA 4FZDB 4CZUA 1XWSA 3GC9A 4EOLA 3R9HA 3FI4A 3R04A 2B52A 4DITA 4BDEA 4X2NA 3MIYA 2FVDA 5HX8A 3LKMA 4FR4A 3WI6A 2Q0BA 1S9JA 3LFAA 2WTIA 3IECA 2QOHA 1G3NA 3MY0A 5J1VA 5IA2A 3NNVA 4Y72A 3P78A 1KV2A 3VRYA 3L8VA 2XS0A 1WFCA 3CS9A 5JKGA 3Q4TA 2GQSA 5J7HA 2BZHB 3HECA 4I3ZA 2A1AB 2IVSA 2OICA 3F2AA 3FY2A 3FZRA 4RC3A 3TZMA 2F7EE 1UU9A 3FJQE 2G15A 4OBOA 3BU3A 3ZO3A 5FP5A 4ZY6A 4Z16A 4KINA 4C4JA 5CSHA 4DFLA 3JUHA 2VWXA 4JBOA 4D5HA 2PHKA 2YM7A 4KRCA 4MNEB 3TXOA 3WF7A 4E3CA 1PXOA 3ITZA 3P1AA 3L8XA 3PWYA 2UW5A 3ORMA 2NNWB 4NCTC 1OBDA 3TDWA 2GS6A 5TR6A 4L7SA 4GV1A 4CFWA 5HVKA 5D7AA 3CQWA 4G16A 5IQHA 5DRBA 3RAIA 3FSKA 1KE6A 3GGFA 4GKHA 3NPCA 4MAOA 5DVRA 1ZYJA 2ITYA 3I5ZA 3WF5A 1XBCA 5CEKA 1GJOA 1PXKA 2WTJA 3DKFA 3FLSA 3IKAA 3H10A 4EORA 3UZTA 1BMKA 3R02A 2BHHA 1B38A 4EBWA 3HYHA 5AX9A 4AA4A 3GOPA 3IW6A 3C4ZA 4BN1A 2ITTA 2YCSA 5KMKA 3DNDA 4YLJA 1H00A 4DGLC 4EK6A 2ETRA 5IG1A 3NCZA 3COIA 1M2QA 2ITUA 3KRWA 3A8XA 3BHVA 3MPAA 5AMNA 4UWYA 1Q8WA 1JQHA 3R7UA 4GUBA 4J95A 2JIVA 4YZMA 4CLJA 3MVMA 3F3WA 4IX6A 4D2RA 2CGXA 4GS6A 4K77A 3LIJA 1Q8TA 3QRJA 3R63A 4RQKA 3A2CA 4E5BA 3HMOA 5CVHA 3FQHA 2XNGA 4EC9A 4R78A 2EB3A 5E8XA 2OXXA 3BBWA 1PJKA 4QP4A 3ROCA 1Q4LA 4RVLA 3VVHA 2ESMA 5DIAA 3P7CA 4LOOA 4QP3A 2QURA 4EOSA 3JVSA 2EB2A 4BR3A 4PTCA 4F9YA 1BKXA 1E1VA 4DH8A 4BZNA 4E4LA 3QBNA 1TQMA 5DBXA 5CALA 5IF1A 1O9UA 3EN6A 4MF1A 4DINA 3AD6A 3MPTA 1PXMA 2RF9A 4ZK5A 4C4HA 2F7XE 4ITJA 4XG7A 2JDRA 2VX0A 4IX4A 5LMKC 3UOJA 3FEGA 4I23A 4LOQA 1WAKA 4EQMA 5IH5A 3CSVA 2OZAA 3FMMA 2Y6OA 5BVFA 5GZAA 4USDA 4EOPA 2DS1A 3FHRA 4J8NA 4EOMA 3F2RA 4JG8A 2X8IA 4RIWB 4ZSEA 5IQGA 2UZWE 4GVAA 2QU5A 3ORLA 3W8QA 4AN2A 4DG0E 2QKWB 3QCQA 1REJA 3F9NA 4IHPA 4KA3A 3UJGA 2YN8A 3RAKA 2HXQA 4D4SA 5LCJA 1LEWA 1WZYA 4LFIA 4BKJA 4JRVA 4MQ2A 3TCPA 4QP2A 5GZ8A 3PPZA 4PL5A 4QP7A 4I92A 3KN6A 5EM8A 2DQ7X 2OI4X 5H8EA 2IPXA 2C0TA 3MVHA 3MFRA 5KO1A 3GCSA 4FTCA 4RX5A 5HZNA 5AAEA 3IW8A 5AX3A 3NUYA 4Y95A 4FNZA 4I6QA 4AW5A 4AN3A 3KMMA 3PLAE 3FWQA 2X4FA 3P7AA 3V01A 1GZKA 3RGFA 4BYIA 1WVWA 2CKOA 3DU8A 3E3BX 5EG3A 4DEHA 3R21A 5IKWA 4FG7A 3PWDA 3BLQA 2OJFE 5LOHA 1J1BA 1IEPA 4D55A 4IZYA 4CGAA 5KMJA 4AOJA 2E9PA 3EQHA 4FV9A 3C13A 2I0EA 4IC7A 3TJCA 2XUUA 2J7TA 2I0YA 2XMYA 3OEZA 2XK4A 4II5A 4Q5HA 2YIXA 4O0WA 5IUGA 1RQQA 4FV3A 3G9LX 3CPCA 3A8WA 1NXKA 4FK6A 5CTPA 3TKHA 3W8LA 2Y4PA 3O23A 3PSDA 4FZ7A 3HAMA 3HV4A 4AXAA 4Z7HA 3FE3A 4CTBA 3PTGA 2X6EA 3AXWA 4JBQA 4KSPA 4DG3E 3QXOA 2PSQA 3KCFA 4XMOA 5AP5A 2FO0A 4OGRA 4TYGA 3BU5A 4FSTA 5HESA 5B0XA 3ULIA 1JPAA 4G3EA 4XP2A 2XRWA 5FLFA 5CWZA 2KTYA 3CTQA 4RT7A 5JZNA 2CNQA 1ZOGA 4K8AA 3O71A 2UZOA 4BF2A 4QQTA 2ITWA 4I4EA 1X8BA 3PZEA 3FMKA 4JJRA 4MYGA 4JI9A 5KMIA 1URWA 2CKEA 4C3FA 3Q9YA 4BCMA 4CMUA 4FTMA 3EIDA 2CNUA 3C4EA 4UY9A 2YCRA 3SVVA 1NVRA 4ANSA 4O91A 4A9SA 5KCVA 1P14A 3U6IA 3C7QA 5E8TA 3PIXA 4IWQA 3TDVA 2GTMA 3VUHA 2WNTA 4BCKA 2HZIA 2PE2A 4IZ7A 3WZKA 3PYYA 4D9TA 5AIRA 3UG1A 4HVSA 4I0TA 3BYMA 4E20A 5CANA 4MXXA 2IZUA 3G33A 5CAPA 3MSSA 5HVYA 3NUPA 3TV6A 4FVQA 3ELJA 5CF8A 4MTAA 3R9RA 2GNJA 3PDTA 3KL8A 4ZXTA 1P4OA 2QOIA 1KUTA 1H27A 3A4PA 3HGKA 5CSXA 4FKOA 1JKSA 2YM6A 3KMWA 5CF4A 3HRCA 4D2SA 4FYOA 4XHKB 4G9CA 3KB7A 3R8ZA 2X0GA 2RG6A 2C6MA 5JFSA 5JGAA 1W7HA 4KS8A 2FB8A 4YSMA 1TVOA 4FG9A 4AZEA 4RQVA 1PMUA 4A4LA 1K3AA 1OUYA 4KIKA 4AE9A 3QQLA 3TZ9A 4YC3A 5KZIA 4BTJA 4CQGA 4NIFA 3GFEA 4IEBA 3U9CA 4BFMA 3DAJA 4ITHA 4O0TA 4RIYB 1RW8A 2ETKA 4ZZOA 1PXNA 3BHYA 2Y8OA 4R8QA 5AUYA 3D5XA 5E90A 3PXFA 4IE9A 4RLLA 3UO6A 4EJNA 3ZRLA 4EH7A 5JRQA 2J0KA 5D41A 1URCA 2OXYA 4ZY5A 1MQBA 4O6LA 4XP0A 3DBEA 1J7IA 3KK9A 4BTKA 4XOYA 2WHBA 4FTIA 4CKIA 4IC8A 3PVBA 4BDHA 2QOCA 4ASEA 1H1SA 3EJ1A 3EQPA 4KRDA 2PZYA 3E93A 4QMZA 3FQSA 4BCQA 1GZOA 4NWMA 5G1XA 3P79A 2YJSA 3D4QA 2VV9A 2P3GX 3D2KA 4GVJA 4RGJA 5F1ZA 3GFWA 3HLLA 4IH8A 3GU4A 3T9TA 4BIBA 3ZFYA 3DJ6A 3AC1A 3ORIA 2B4SB 2UZVA 1OIQA 3E88A 3IO7A 4IAYA 4YJVA 2B1PA 3S2PA 2B55A 3WIGA 5LMBA 4RWKA 4L46A 2XJ1A 3D7ZA 3KK8A 2ERKA 4GU6A 2WQNA 4ENYA 4DC2A 4BI2A 2XA4A 4RFZA 4A4OA 1E9HA 5L2TA 1XKKA 3BGZA 4J98A 3CGFA 3EFJA 5JSMA 4OT5A 4BWPA 1R1WA 4C8BA 4YZBA 2JKMA 4E6DA 4E5WA 5D12A 4CRLA 3W10A 1G8SA 1L8TA 3UTOA 4C2VA 5L6OA 3QALE 4O7SA 2XP2A 3LJ2A 1R0EA 3CJGA 5HE0A 1JSTA 3PXZA 4E5AX 2JDSA 2LAVA 4PTEA 4EQCA 5I3OA 4HCTA 2GQGA 4FZAB 1IA9A 2VTOA 4G1WA 4DGOA 4MH7A 2PZRA 4LL5A 3OBGA 4XUFA 4F6WA 4GYIA 2GNFA 5DG5A 3TTJA 3FLYA 1UNGA 4OTGA 5KKRC 3HMIA 4DEIA 3ACJA 3ZSGA 2W1ZA 3NW6A 3VUKA 3WZDA 3AG9A 5HNIX 1Y6AA 3LFSA 5HHWA 4AZWA 4YLLA 5AR3A 3VQHA 3LAUA 1J91A 3OTVA 1SZMA 5E8ZA 3GU5A 4N4SA 4P5ZA 3VBTA 4WRSA 3QTWA 1UA2A 3H3CA 1MP8A 3NAXA 3PJ1A 4RZWA 2PU8A 3ORPA 2UZUE 4DBXA 5HE2A 2QU6A 4U97A 4DCEA 1M14A 4FA2A 3UVQA 4O0VA 4CCUA 4YURA 5EOBA 5JFXA 4DCAA 3ZXTA 3EMGA 3LFNA 2ZV9A 1XH5A 2H6DA 2Y4IC 5A4TA 4R5YA 3W2OA 2V0DA 4QTEA 4QD6A 4CTCA 1WBVA 2XJ0A 3CY3A 3WARA 2XVDA 3BHUA 2CGUA 3PJCA 2OJIA 5AADA 4BWXA 2C6KA 1AQ1A 1V1KA 3LCOA 4QNYA 3VJNA 1XO2B 1UNHA 3ZC5A 3EQDA 1QL6A 5FD2A 3I6WA 5TF9A 2WXVA 1H0VA 2PVFA 5CVGA 4FEXA 4YPSA 2XB7A 4CFVA 1U46A 3R9OA 3BE9A 1NVSA 2YIQA 4IZAA 4EH6A 2IVTA 3GC8A 3PXYA 3RJCA 3ZYAA 4FKTA 4R1VA 2GU8A 3CLYA 2CKPA 4NTSA 5J9ZA 1AGWA 1FGKA 4YMJA 3GI3A 3SLSA 1ZLTA 1NT2A 2ZAZA 1DS5A 3D7TB 4FTKA 2RFNA 2A27A 4RX9A 3KF4A 3NUXA 4W4WA 3VF9A 2BVAA 5EKNA 3KVXA 3ZO1A 4E4MA 4TXCA 2JAVA 3O8PA 2BKZA 3EQGA 3U54A 3B8QA 4RJ6A 4F7JA 3VC4A 1GAGA 3OOMA 4I5PA 2BPMA 1K9AA 3F3TA 2JKOA 4YSJA 2PK9A
chains in the Genus database with same CATH superfamily
2UW7A 4L52A 4RIWA 3V3VA 4YJQA 4JAIA 2CJMA 4IX5A 4JIAA 2OJ9A 3GC7A 3PY3A 4R3PA 1H28A 4IWDA 3P86A 3I81A 3MJ2A 1PHKA 2VTLA 2WU7A 3AD4A 4APCA 4WD5A 5DWRA 3JR1A 5HCXA 2GS7A 2QOKA 3SXFA 3V8TA 4FI1A 4L00A 4EH3A 2GMXA 2GTNA 3MTFA 3Q04A 2C6DA 4MD7E 3EQBA 4O27B 1O6YA 3IW5A 3NW5A 3KCKA 2ITOA 4UWCA 4WOVA 4HYHA 3VWAA 1G5SA 5L8JA 3IPHA 4S2ZA 3SOCA 5DYJA 4X21A 2W1FA 2E9OA 2J0IA 3DBCA 4YO6A 4LDTA 3W0OA 5M53A 4CYIA 5LJJA 5FBNC 3F3VA 3F7WA 1Q8UA 2HY0A 2WELA 3RPRA 4YR8A 1WMKA 2XBJA 4TWCA 3QCYA 4QOXA 2YFXA 2JIUA 5CASA 5J9LA 1OL7A 1XH4A 4FKRA 5E8WA 3AGMA 5KMMA 2X7FA 5D9HA 3BL7A 2CNVA 5A46A 1LPUA 4Q9SA 3S4QA 3ZBFA 3BYSA 4CYJA 2QODA 3DJ5A 2IZSA 2FYSA 3C9WA 3GCVA 2QVSE 4NUSA 5KBQA 5HO7A 5E7RA 2C0IA 5FGKA 2GNGA 3FY0A 1XH8A 2O64A 2ONLC 1Y8GA 4U9AA 4X2GA 3TKUA 4BCIA 4C4EA 2BFXA 3C4XA 4XS2A 3TV4A 5FTGA 4NW6A 2JIIA 4XYFA 3PZHA 4APPA 4B8MA 4F65A 5K4JA 4NTTA 4DH1A 2XIXA 3OF0A 4WBOA 1CSNA 3F82A 4AT3A 1OIYA 3A4OX 3BGQA 4IAKA 5LARA 4TWOA 3QUDA 5K0KA 4DFZE 3MDYA 1XHAA 2C5NA 2WQBA 5HU9A 3FYJX 4U81A 4DE4A 4HVDA 4EI4A 4NM0A 4W8EA 5M51A 2ZDTA 2IO6A 2XEZA 2C3JA 1A06A 3BI6A 2XEYA 4LMNA 4A9RA 2O63A 3FMLA 3JS2A 3R22A 4FK3A 2QG7A 2HENA 2WIHA 4H1JA 2VWBA 3I0OA 4G6OA 4C59A 4FT3A 3Q6UA 4B8LA 4BCFA 3PFYA 2LGCA 3PVWA 2R3LA 4GJ2A 2HELA 4I5MA 4FGBA 5CSVA 4J96A 4EH5A 4XRLA 3HA6A 2EVAA 2NP8A 4FZ6A 4IVCA 3PJ3A 4UBAA 1KE9A 3UGCA 1PMEA 3QHRA 4OTQA 1LP4A 3N9XA 3VBVA 4C38A 5IH4A 2QD9A 3FQEA 3KULB 3NGAA 4QP8A 2XKFA 5KX8A 3S0OA 1PMVA 3DGKA 4ACMA 4KIOA 1PMNA 2NO3A 4EWQA 2C4GA 5HCZA 4AGWA 3E7OA 4ACDA 4BICA 3FMJA 3NIEA 5AA9A 4B6LA 3A61A 2P33A 3UC3A 3II5A 3AKJA 3REPA 2VWUA 5CT7A 4NW5A 4HCUA 4Q5EA 1FMOE 2QO7A 4ANNA 4LV8A 4FJVA 4JXFA 2ZFYA 4FODA 4RIXB 4U79A 1OGUA 2I0VA 2PUUA 3VBQA 4F6SA 3AMYA 2ITPA 4IVBA 4PUZA 3HAVA 5JFWA 4ZIMA 3QX4A 2XKCA 3Q2MA 4L42A 2GHGA 3QQJA 4LOPA 3QTXA 3G0EA 4GIIA 5CNOA 3UOLA 4B99A 5F94A 4CT2A 4DFNA 3ZCLA 4O2ZA 3RNIA 4E4NA 5K9IA 3EL8A 2VN9A 4L44A 4U3ZA 4YPDA 4RBLA 1ZMUA 3BWFA 4RIYA 5HBJA 3LFQA 3OW3A 5HCYA 2RFEA 3I4BA 3HMPA 5A3XA 4U3YA 4OTDA 1Q5KA 3RALA 2W7XA 5DFPA 4UMPA 4JS8A 5EI2A 3SW7A 3VS5A 3DFAA 4F9WA 4O7TA 5AP6A 4EUTA 3U8WA 4AOIA 3BX5A 3PFQA 4TKSA 4C3RA 1LUFA 2FSMX 2CGVA 1Q24A 1ZOHA 1NA7A 2V22A 2VTIA 3AGLA 3QD2B 4M0ZA 1XMLA 4V0GB 3COMA 4IVDA 4UALA 3R7EA 4UZDA 2PUPA 4WNKA 2W4OA 3D9VA 4GFMA 3SXRA 3UIMA 3RI1A 2ITZA 3ZH8A 2A4LA 4PDOA 4PPBA 3A7JA 2R3OA 3QTRA 3D5WA 2EXMA 4H3BA 4BDKA 3EFWA 4BCHA 1YW2A 4UXQA 3ZLSA 5EDRA 4O7ZA 3CIKA 2A19B 5J5SA 4O4EA 5BV3A 2WZJA 2I7QA 5DPVA 3LQ3A 3HZTA 4X2JA 3ZSHA 1NW1A 3F5XA 3QZGA 5FXSA 1OUKA 3SQQA 1OL1A 4FKPA 5CU2A 5I9ZA 4K0YA 1XH6A 3G15A 2H96A 2C0OA 3LFBA 2R4BA 2AC3A 5IQIA 5CF6A 1ZRZA 3QCXA 3ZRMA 4ZZNA 4XBUA 2W0JA 4WHZA 3GP0A 3VBYA 4AGDA 3PUFC 1GIIA 1V0OA 3DXNA 5I0BA 3DK6A 3D14A 4I5HA 4RWLA 3NNWA 1UWJA 3LOKA 4X3FC 4ZJIA 3VBWA 4MXAA 3FL4A 5CU3A 5FUTA 4TNBA 3L9NA 4IFCA 3U9NA 5J87A 1RDQE 3WILA 1NVQA 5IZFA 2HW7A 4FBXA 3BE2A 2C1AA 3CCNA 3UDSA 4FVRA 3UZRA 2R3QA 4GT5A 2VZ6A 1OIUA 5K4IA 2IF8A 4LRKA 4MWIA 2OJJA 3UE4A 4AU8A 4EBVA 3EN7A 3DTCA 3IW7A 4ASXA 2OW3A 4FSQA 5AR7A 2XNEA 3O0GA 4O0XA 1OPJA 2CGWA 3DNEA 2J4ZA 3UQFA 2YEXA 3BYOA 3SAYA 3UDTA 1KSWA 4UZHA 3MN3A 5CU0A 5HQ0A 3ZM9A 4X0MA 5AP7A 3WF8A 5HTBA 4IWOA 4S30A 3LJ0A 2OIDA 3QUEA 4FTAA 4U80A 5TO8A 3VQUA 1YI3A 2VTMA 2CSNA 2IZRA 2W06A 3RBWA 5CF5A 4M12A 5EW9A 1OVEA 3GCQA 2ITVA 5H3QA 3V8WA 2VO7A 3WIKA 3C0IA 3CQUA 1H0WA 5BMMA 5CEQA 3HMMA 4GK3A 4C4IA 3U6JA 1VJYA 3FKNA 1OB3A 4XOZA 5ANDA 4NYEA 4YTCA 5ICPA 2WMUA 3AOXA 5FG8A 3LFCA 4G3CA 4PQNA 3I79A 4AZVA 1U54B 4R5SA 3HKOA 2YWVA 2B9JA 2R7IA 2YACA 2WPAA 3F88A 5EHOA 2R5TA 4JQ8A 2HXLA 2C5YA 3GNIB 5T3QA 3FPQA 3KRRA 4L8MA 4BDGA 4H3QA 1MQ4A 4HPTE 4AZSA 3A7GA 3K3IA 3Q9ZA 3UQCA 3LLTA 3F3ZA 3NZ0A 3VS3A 4WIHA 2IN6A 4GK4A 3I5NA 3QFVA 2J5FA 2PVHA 1TQPA 3OFMA 5B7VA 1Q62A 3FLZA 1MUOA 1XR1A 4ZOGA 4C61A 1IAHA 2BROA 3PPJA 4C33A 4PL3A 1Q3WA 3QX2A 4RPVA 4YGAA 5EW8A 4RWIA 4D2VA 1WBNA 5EYMA 3IOPA 4QMLA 4FV2A 4XG8A 2OFUA 5LVLA 5HG7A 1GZ8A 3OWJA 4A9TA 4WUNA 4X3JA 4M0YA 1U4DA 4O1PA 4AT4A 3ZRKA 2C3KA 2X1NA 2JKKA 3O96A 5HBHA 3F61A 2F57A 3D7TA 3AC2A 5EM6A 3MVJA 4ACHA 2ZJWA 3LFEA 4FX3A 5F20A 3FPMA 5TKDA 3LM0A 3NFFB 5M4UA 3DT1A 3DY7A 3AC3A 5M07A 3U87A 5IMEA 5GIPE 4NSTA 4RX7A 3W0NA 2V7AA 3HMNA 4RJ4A 1K2PA 4EZ7A 3FXZA 5AM6A 4BDFA 4DTAA 2J51A 4EOIA 3GENA 5FXRA 4ID7A 1OECA 2I40A 5BYYA 2GNIA 4PRJA 5D1JA 5CAQA 5E4HA 4FYNA 5AM7A 2O2UA 2OJGA 2R7BA 5KE0A 3BEAA 4I4FA 4BTMA 3PVGA 4FTOA 3HRFA 3PG1A 5AP1A 1PXJA 3UVPA 3DQXA 3EZRA 4V05A 3E8NA 5LXMA 2CDZA 4JDIA 1KWPA 1XBAA 2ACXA 2XK7A 4DH7A 5C8MA 4EC8A 1PRYA 4OUCA 3ZLXA 5JRSA 2UW6A 4CXAA 3DXQA 4FKSA 3UNKA 3TYKA 3NIZA 4H39A 3TNWA 3NMUF 1W8CA 3TZ7A 4YHTA 3B2TA 4D1ZA 4ZMFA 4DBNA 3K5UA 5L3AA 1PXIA 2BFYA 2XF0A 4LGDA 2UV2A 2HOGA 3V6RA 3V5TA 2XALA 2V5QA 3D94A 3QRKA 4WBBB 3QZHA 5LWNA 4EHVA 3DKGA 4UMUA 2C30A 1H1QA 3MFUA 4IAIA 3ZUUA 2XCKA 3GCPA 1BI7A 3OUKA 5T68A 4XLIA 2X8DA 2YIYA 5AUXA 3VUDA 3ZO2A 4D4YA 5ITAA 4O0YA 4H1MA 4QPSA 5DE2A 4KKGA 4TYIA 1H1RA 3UP2A 5K5NA 5DN3A 5L6WL 4TYHB 4IM3A 3QYZA 3DZQA 1BYGA 2GPHA 5KHWA 1HOWA 2UW9A 2VWWA 2FA2A 3DDQA 4G6LA 4RRVA 4YLKA 1UVRA 2R3PA 4BDDA 1HCLA 4IADA 2PUIA 4M14A 3ZU7A 2Z02A 3VUGA 3M2WA 3BGPA 4FNXA 4U7ZA 5C1QB 2PE1A 3FL5A 1J3HA 1MRVA 3GT8A 4IB1A 3R28A 4F7SA 2VX1A 3PJ2A 3LFFA 3QTUA 4HYIA 3ETAA 3ZUVA 2WU6A 1H1WA 3I1AA 5B2LA 3LCDA 4N70A 4HVGA 1KOAA 4QMMA 4FV4A 4NM7A 4N57A 4IWPA 4R77A 4YUQA 1YXSA 3AC5A 4U41A 1L3RE 1CKIA 5C8NA 3R8VA 4CT1A 3LXKA 2J6MA 3PRFA 5ANEA 1OITA 3ET7A 4GFGA 1BI8A 3KN5A 3EN4A 1VYZA 4JL9A 3QWKA 4I5CA 4QP9A 3QD0A 4DHJA 4R3CA 3QA8A 4QMOA 3CKWA 2XIKA 3TUDA 2WAJA 4U6RA 4AS0A 5LVPA 3E63A 3QKMA 4FV5A 4EQUA 3ZZWA 4FSRA 4EYJA 4JBPA 5J79A 2OGVA 3R7GA 2HW6A 1REKA 5E91A 4XG4A 5IA1A 3UPZA 2VTQA 3O51A 4G3FA 1FQ1B 3MGYA 1AD5A 3KULA 4LUDA 2HZNA 4CG8A 3SG8A 2Y4IB 4LUEA 4AA0A 4JRNA 4OTIA 4GU9A 2WTVA 3P5KA 5FBOA 2XH5A 4DDGA 5AUZA 3R9DA 5CAOA 3NVKI 3UIUA 3FV8A 5L6PA 1OIRA 3MB6A 4FOBA 2BUJA 3NUUA 4NU1A 4BJJB 4FSNA 4RIXA 4ZSAA 5HNBA 3NDMA 5HICA 4S33A 4OR5A 3LCKA 1SNXA 2QG5A 4RSSA 3ZXZA 3K3JA 1WBPA 3KU2A 1QPCA 5DHJA 4ANQA 2BHEA 3C4WA 4OBQA 4TYJA 5HX6A 3DLZA 4FTNA 5CU6A 4E73A 3LM5A 4MBIA 2YCQA 3TNIA 3KREA 4DDIA 2XK6A 1M7NA 3OY1A 3CY2A 1SVEA 4J97A 4U0IA 5E1EA 1NY3A 4W8DA 3FHIA 4YTHA 3A99A 3DS6A 1Q61A 4FSWA 4A4XA 4ZY4A 2C69A 4QPMA 4B4LA 3RCDA 4AAAA 4O0SA 2W1IA 2OXDA 4L3JA 2WMAA 5TE0A 4D5KA 2QCSA 4BL1A 4F09A 2PTKA 3RHXA 3EHAA 5LMKA 2WTKC 2CPKE 5A4LA 2XZSA 4D0XA 4EYMA 3QC4A 2YDIA 5FWKK 3E8EA 5AEPA 3KXGA 2R3MA 1VR2A 5ANOA 3TUBA 4FL2A 1GY3A 4QP1A 4FOCA 2HWPA 2ITQA 4C02A 4V0GA 5DA3A 4BIEA 3KXHA 4UMQA 1A48A 3AD5A 4FTJA 4LL0A 4IB0A 3QKLA 5BVEA 5L2WA 4G31A 3NR9A 4KBCA 4O7YA 2VTAA 2UUEA 4ZTRA 1CMKE 1YHVA 4A07A 2X4ZA 5BUJA 3RWQA 4ZSGA 5A54A 5J1WA 1YHWA 4G5PA 2C6TA 4YZCA 3W2CA 3ZEWA 2Z7SA 3K5VA 3QQKA 3TNHA 5I9XA 5HKMA 3IDBA 5IQFA 4MQ1A 4U40A 4IAFA 3N4TA 3SG9A 4FT9A 1YXXA 2KULA 3TACA 5L2SA 3TNPC 4HOKA 5C03A 1H8FA 4R1YA 3QTSA 3FMEA 3M11A 1ZY5A 3JY9A 3TG1A 2XANA 4OTWA 4H58A 2W17A 3MESA 5H9BA 5AWMA 5B2KA 3O17A 1CM8A 1R3CA 3IW4A 2WMTA 4L9IA 4I6BA 3D2IA 3QRTA 3VS0A 3ZEPA 3ZUTA 4AE6A 4NM5A 4AW0A 4WUAA 4F78A 1H01A 2VTHA 3KKVA 3WYXA 2VO3A 5CSWA 2XNNA 4DHZA 4FIHA 4HNIA 4E1ZA 2W5AA 3LXPA 2WOTA 1WCCA 1WVXA 4TPTA 3W0MA 4QMYA 3ZSIA 3GXLA 5LCKA 4C34A 2C3IB 4QTDA 5AAGA 3NCGA 2X7OA 3BCEA 5HO8A 4A9UA 4IFGA 4A7CA 4B9DA 4RX8A 4IJPA 2X9FA 4FV0A 3C4CA 3QTZA 3R7OA 4QNAA 2W1HA 4UEUA 2WIPA 5AP2A 3ZHPC 3RPVA 4C37A 4C35A 2J9MA 4JLCA 5EI6A 2RIOA 5FP6A 2VTSA 5EM5A 5CLPA 5IUIA 3ZBXA 4E7WA 5AV4A 3OCSA 4PP7A 1YDRE 2R3JA 5LQFA 5HIDA 3GU7A 3NYNA 4L67A 5M4FA 1H08A 1KE8A 3KFAA 3OHTA 5HNGA 4FNWA 3T9IA 4XG6A 2RSVA 4E8AA 5IQDA 1JKLA 4FG8A 2O5KA 4EL9A 2BCJA 3Q3BA 4NJDA 1PY5A 3FLWA 3L9PA 4QYEA 2YCFA 4YJUA 1W84A 3RPSA 2WQEA 3OD6X 4CFNA 3LVPA 1U54A 4LMUA 5EDQA 3C0HA 3BKBA 3EZVA 3RK7A 1ZYSA 3ZTXA 2EUFB 2VD5A 3IS5A 3QTIA 3WE4A 2WQOA 3FBVA 4WNMA 1ZYDA 2VTPA 3DBFA 1CTPE 3ENMA 1DAWA 3VUMA 4NJ3A 2HZ0A 5AR4A 3E8CA 2PPQA 3A7FA 3E5AA 3MTLA 4EZ5A 4O7VA 4MNEA 4JG6A 2DWBA 4O86A 3MS9A 4I6FA 2X9EA 2H8HA 4YNEA 1VEBA 3KA0A 2YIWA 1OM1A 1Q8ZA 4F63A 2XIRA 3HUCA 3LFDA 3Q4UA 3Q9XA 3MI9A 3ZONA 4EKLA 4QTAA 5DT0A 2EXCX 1U59A 2YJRA 3JVRA 3SDJA 2FSLX 4UYNA 4IM0A 3I6UA 2YDJA 5A14A 3DZOA 1XH9A 2OG8A 3BV2A 5AP3A 3VHEA 2Y9QA 1J1CA 3PXKA 4TN6A 5FEDA 5HIBA 4FEUA 2ZMCA 3JYAA 3VS4A 3KXMA 3IGGA 3FC1X 1YHSA 3HV6A 4E6CA 4PWNA 2BRBA 3ZFXA 4CRSA 4YO4A 4MX9A 5JT2A 3Q6WA 4M84A 3C50A 2WMBA 3K2LA 1XBBA 4OTHA 4U5JA 5DR9A 3ORTA 4YJRA 3LPBA 5AR5A 2VWZA 5M4CA 1JLUE 2F2CB 1H24A 2UZTA 3ORNA 3Q96A 4EONA 3CBLA 4ZLZA 1WBWA 2ZM1A 5HU3A 2WMWA 3L1SA 4M13A 1OKYA 2CKQA 3VUTA 4PDPA 2VTTA 4PPCA 4QPAA 4WNOA 5IUHA 5EW3A 3N4VA 3KRJA 1YI6A 4GSBA 2F7ZE 3R1SA 2XAMA 3E92A 4AOTA 4EK5A 1QMZA 2ZDUA 3P23A 1SVGA 4D4VA 1P2AA 5CT0A 4FKQA 1HCKA 2G2FA 5FTOA 4GUEA 1STCE 4EH4A 3UMWA 4AF3A 3QQGA 5CZHA 4DTBA 4ZS0A 3F66A 1Q41A 3ULZA 3OWPA 5DEYA 3UG2A 1QPDA 4P90A 4FTTA 5IA5A 4RJ8A 1YWRA 1ZXEA 2CN5A 3HDMA 5CI6A 5HD7A 4AZTA 3O8UA 3DLSA 2CHLA 4LV7A 1GIJA 2P55A 3FMNA 5AFVA 2I0HA 4L3LA 5DT4A 4M8TA 4BYJA 4I6LA 1H07A 4LG4A 4QTBA 2XNBA 5GJGA 4DGNA 1M17A 2EXEA 5JN2A 4XBRA 4IX3A 4X7QA 4L7FA 3ZOSA 4ANLA 3JY0A 5EHYA 4ZTMA 5AV3A 3U4WA 4BDIA 4C62A 5HORA 4QMTA 4ITIA 1IRKA 1W2FA 2BILB 4FSMA 4TYHA 5JQ8A 1OL2A 4FSZA 4JDKA 4X3FB 2BMCA 4FL1A 2YZAA 3G6GA 4ENXA 3LMGA 4JQ7A 5AR2A 4AGUA 2PUNA 4L6QA 1PKDA 4OTPA 5FRIA 5IPJA 4PP9A 5I4NA 3GU6A 5BPYA 4DGMA 3NRMA 2A0CX 3Q5IA 3WZUA 4I0SA 3HRBA 3BYUA 1ZYCA 3SRVB 4DH3A 3MY5A 4MXCA 2QR8A 4F0FA 1KOBA 3PUPA 5A4QA 1VLRA 4I20A 3D15A 2CLXA 3DCVA 4K11A 4AWIA 4OBPA 3UDBA 4ALVA 4UXLA 5EK7A 2YISA 4MBLA 3Q53A 5I5ZA 2Q83A 4QMSA 5D7VA 3F5PA 4ASZA 4D28A 4YP8A 3D83A 5M56A 1PYEA 4C4FA 1ZARA 4E26A 4NM3A 4YJTA 4YU2A 5CS6A 5EQEA 1V0PA 1M2PA 2VAGA 1DAYA 4JQEA 1Y57A 3P4KA 5GNKA 2WMRA 1YWNA 1I09A 4JIKA 4TRLA 3GU8A 1G8KA 4QQ5A 4RWJA 2QOLA 1WBTA 5I9UA 4BGQA 4RJ3A 3U6HA 3R0TA 4UMTA 3QGYA 3RCJA 4Y83A 4RA4A 3FZPA 3OG7A 3ZFMA 4FT0A 4O82A 4CLIA 2YM8A 4XV3A 3LLAA 2X0PA 4K1BA 3W2SA 3MV5A 4BI0A 3NW7A 5LMAA 2H9VA 3OW4A 4QQJA 3OXZA 2RL5A 5I9VA 2B9IA 4WRGA 5KHXA 4ZS4A 2B9FA 3OROA 4BDBA 2WEVA 3PG3A 1B6CB 4OAUC 3CC6A 2I1MA 2O3PA 2QR7A 3BQRA 2Z7LA 2QONA 3RKBA 2XYUA 4F7LA 3AT2A 4QMNA 4D58A 2FH9A 3Q2JA 4BJJA 5DMZA 3FZSA 5KUPA 3GCUA 4IACA 2PYWA 2O0UA 4F6UA 4RFYA 4EK4A 2OZOA 3ZDUA 4ZLOA 4IXPA 4NKSA 4FUXA 1GNGA 4IDVA 3KGAA 3BL9A 3R00A 5KBRA 2R3FA 3VONA 2BTRA 3VRZA 4USEA 5I3RA 4QEBA 4AN9A 4D4RA 2F2UA 4DT9A 4XH6A 4YC6A 3KRLA 1FPUA 4BDJA 3BBTB 3PPKA 2Y7JA 1FBNA 3A60A 3LQ8A 3U51A 4QMWA 4R7BA 4CKJA 4QT1A 5JZJA 3F69A 1I44A 3FYKX 4ARKA 5HD4A 4H36A 4Y85A 3OP5A 4MXZA 4DAWA 2AC5A 3NYXA 3UYTA 4EKKA 3POOA 2GNLA 5A6OA 2PMNX 2VO6A 2XIZA 2IWIA 2JAMA 4CFFA 4JR3A 3MVLA 3PE2A 4ZTHA 4D2TA 4Z3VA 1TKIA 3CTHA 3A7HA 3EL7A 3SA0A 2ZYBA 4FSUA 3N4UA 2C5VA 3KRXA 3RM7A 3QLFA 4X2FA 3C5UA 2Z60A 2ZB1A 4I41A 1FINA 5EYKA 4FNYA 1TZDA 1OL5A 2WMQA 5CSPA 3R1YA 3AKLA 3RP9A 4L3PA 3WF9A 1W82A 1G8JA 5DR6A 5AUWA 3QTQA 3UDZA 5BUEA 3RZBA 3KC3A 3MJ1A 4FKIA 4AXFA 5HI2A 3L9LA 4YJPA 2ITXA 4B7TA 5IU2A 2CCHA 3DK3A 3PIYA 4EWHA 4L45A 1ZYLA 5A4EA 5CEMA 1OKVA 4J8MA 1FVVA 3C4FA 3FC2A 4O4CA 4ALWA 3LCTA 5JEBA 3ENHA 2G01A 4PMSA 2AUHA 3OXTA 4G6NA 3CD3A 2JKQA 4BIDA 2X0QA 3FZOA 3MA3A 3QLGA 4IZ5A 2W5HA 4FTUA 3V5QA 5EH0A 4ZJVA 4MXYA 3OZ6A 2J0LA 3MB7A 4HYSA 4RG0A 5FDPA 4GEOA 4NFMA 4EHZA 4O7LA 2F4JA 3H0ZA 2OF4A 4MF0A 4MKCA 4NH1A 2ONLA 3G6HA 4Z7GA 2HAKA 3HV3A 3PY1A 3TL8A 3O5AA 4QDEA 2GFSA 2XK8A 4HPUE 4O84A 4TY1A 2ZV8A 2P4IA 2G2IA 2YLEA 4XG3A 3UIBA 4F08A 4YTIA 1OMWA 3WOWA 5M57A 3DPKA 2X6DA 3I0QA 2W05A 3QUPA 4PTGA 4F64A 3W0SA 1PYXA 4HW7A 4N6YA 2BIKB 3Q4CA 4ZTNA 3VHKA 3FLNC 3KIOC 1CKJA 3BYVA 1YDSE 3OWLA 4FIGA 4A9YA 3ODZX 4CCBA 5IISA 2YITA 3C51A 5K3YA 5L4QA 4XJ0A 1YDTE 4AA5A 2UW3A 2GQRA 2YAKA 3QYWA 1VYWA 3I7CA 4FMQA 3SD0A 2Z7QA 3W33A 4G17A 3NS9A 2BZKB 1F0QA 2BAQA 3QAME 4AP7A 4M67A 3EN9A 4GKIA 3HP2A 3MH2A 3AT3A 4GT3A 4M66A 5HG5A 3TJDA 4I21A 1YXVA 5HTIA 3Q9WA 2B7AA 1OGYA 3HVCA 3TTIA 2PZ5A 4U44A 2IG7A 4EEVA 2PVMA 5DRDA 2OIBA 2NRYA 4FEVA 3TZ8A 1LEZA 4DFYA 3GQLA 2B54A 4QYYA 3SOAA 2QNJA 1FVTA 3TN8A 3ZDIA 4FICA 4F1MA 3KEXA 4HJOA 2QC6A 5CEPA 2OWBA 3TT0A 4JOAA 3DFCB 4FRFA 4L53A 1JAMA 2UW0A 5DLSA 5F95A 2ZM4A 2XK3A 3EQFA 2JFMA 2YZLA 2SRCA 4CZTA 4D0WA 2PVJA 2OSCA 4M68A 4M7IA 4Z55A 3ZZEA 5E9EA 2YLFA 4EUUA 5AV0A 3I60A 2BTSA 3U4UA 4K18A 4KBAA 4QTCA 1PF8A 4CV8A 4FIFA 2VWIA 4GMYA 4O22A 2PVLA 2R3GA 3QQFA 4X6RA 4Y46A 4UN0C 3OMVA 1CDKA 3T8OA 1EH4A 2E9VA 4ZTLA 5HLNA 1JNKA 4BRXA 4D9UA 1M7QA 5AUVA 3EB0A 4GH2A 4BCJA 2XNPA 5CZIA 1A9UA 2AEGA 4FIEA 3OWKA 4WNPA 3QQHA 3GOKA 4CQEA 2WTKB 4MUQA 2WEIA 3DQWA 3IDCA 2OO8X 4TT7A 4XP3A 3QD4A 4W9WA 3RAHA 4AUAA 4RZVA 4O6EA 3ORZA 1PXPA 3DKCA 4KIPA 5AJQA 4M69B 1UKIA 2P0CA 4RMZA 1JKKA 2PVKA 3DB6A 3O2MA 3MPMA 4LQMA 5C8KA 3UC4A 3GVUA 3RMFA 3MA6A 5DEWA 4GT4A 2JBOA 4DG2E 4U8ZA 4ZSLA 1XJDA 1PKGA 1YWVA 1YOLA 3OC1A 1YXUA 2W4KA 3OS3A 4HGSA 4IB5A 2HZ4A 4TWNA 4BHZA 2JGZA 3OEFX 4FE2A 3DV3A 2F49A 4DN5A 4CV9A 3UVRA 2WQMA 4QP6A 1H1PA 3WZEA 4YNOA 1Q8YA 4BGHA 2WO6A 4EZ3A 4I1ZA 1Q3DA 3KY2A 2C6IA 3PXQA 3FSFA 3AT4A 5F9EA 4BHNA 4CFXA 2HY81 4HCVA 4XG9A 2X7GA 4DH5A 3FXXA 4YZ9A 5KNJA 2R2PA 4X3FA 3BPRA 2VGPA 5HTCA 5AAFA 3W55A 2RGPA 2P2IA 2WTCA 5FXQA 3OCTA 3WYYA 3ZLYA 4C4GA 4A06A 5EHLA 5CQWA 4FV8A 3D5UA 5BVKA 4UYAA 3BEGA 1G8AA 2FGIA 2OBJA 4RVTA 3UYSA 3SRVA 4XX9A 5CU4A 4G5JA 4TTHB 3UNJA 2PMIA 3DDPA 3R8PA 4K6ZA 2PMOX 1T46A 2YM3A 3MBLA 4FC0A 4XLVA 5AR8A 2ZOQA 1QPEA 3UODA 4ANOA 2ZB0A 5ANKA 3C0GA 3P0MA 2V7OA 4F4PA 2YWPA 1O6KA 5ACBC 5GINE 5J8IA 2VNWA 4C58A 1Z5MA 4M15A 1BLXA 4RA5A 3LXNA 1UWHA 4BDAA 1J7LA 3RPYA 4ZMEA 5I9WA 5J9YA 4BY9E 4ASDA 4FTRA 4I94A 3EWHA 4XG2A 3P08A 5EKOA 2DYLA 4BCNA 4EH9A 3NAYA 1H26A 5JK3A 5CI7A 5GHVA 1WBOA 1UU8A 2G2HA 2R3KA 1QCFA 1O6LA 2ZM3A 4DEBA 4FTLA 3I7BA 4PY1A 4UX9A 4AXDA 4FL3A 1B39A 4S31A 3R71A 1LR4A 2A98A 2EU9A