3BWJA

Complex of pka with the bisubstrate protein kinase inhibitor lead compound arc-1034
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
341
structure length
338
Chain Sequence
SEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of ARC-type inhibitor (ARC-1034) binding to protein kinase A catalytic subunit and rational design of bisubstrate analogue inhibitors of basophilic protein kinases.
pubmed doi rcsb
source organism Bos taurus
total genus 104
structure length 338
sequence length 341
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bwjA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bwjA02
2Z7QA 4ZSEA 3BX5A 2XK4A 5EOBA 3ZM9A 1GAGA 4UBAA 3E92A 3GENA 1XH7A 5DPVA 5HNGA 5C8NA 3PSBA 5E92A 1H1PA 2WMWA 5KMIA 5CWZA 4PP7A 3TKUA 4ZSAA 2WB8A 3CQUA 1DM2A 4XBRA 1PXLA 2JITA 1W82A 3LW0A 5FEDA 5L8JA 3ZC5A 3KMUA 4A9TA 5LOHA 3U51A 2WIPA 4R3RA 4AA0A 1PRYA 4E4XA 2C6MA 1UNGA 4FV0A 2UVXA 3F66A 4YLLA 2PVNA 4QTEA 5B7VA 2V62A 2R3JA 4A4OA 2VTNA 5FBOA 2ZV8A 3D7ZA 5EH0A 4E6QA 3A99A 3ATSA 1UWHA 4KA3A 4ORKA 4FOBA 4JIKA 3TWJA 4ANNA 2ITVA 2WTWA 4R7HA 3KFAA 3NSZA 2XRWA 2C5XA 5AV0A 1REKA 3KXHA 5D7VA 2W9ZB 2C0TA 5HO6A 2WMBA 3BYVA 4IM0A 4FG7A 3R7EA 5IA1A 1WBSA 1WVWA 5BQ0A 4EHGA 4CG8A 4K0YA 1WBOA 4GK2A 2A4LA 4U9AA 2JIVA 3DJ7A 4EOLA 4WRGA 1R78A 1PXKA 4FSWA 5DH3A 4DG0E 3ZLYA 3VS0A 2Y6MA 3HECA 1H4LA 1KE5A 3PYYA 3QBNA 2VWZA 4DFZE 3EN9A 4O27B 4C57A 4FKTA 4KIPA 5L8LA 5FQDC 3UZRA 4PDSA 4WO5A 1Z57A 2ITWA 3PPZA 3BGZA 3IOPA 4XH6A 5GZ9A 4KRCA 4PV0A 3E8EA 4JLCA 3VO3A 3S2PA 4U45A 4OTPA 4OUCA 2J5FA 5E8XA 4DEDA 3EFJA 3QALE 4F0GA 2EWAA 3PXZA 1QL6A 2O5KA 4ANOA 4BL1A 3MWUA 3E87A 4BZNA 4BCNA 2ONLC 2W96B 3IW6A 4YO6A 3CXWA 3CY3A 4ZP5A 4PTGA 3A7FA 2UZTA 3CJFA 5K4IA 3RVGA 3UNKA 5HGIA 1LPUA 1ZOHA 2HZ0A 4LYNA 4QPSA 4CV9A 4K33A 3I1AA 4R3CA 2ETMA 1W83A 4RLLA 2WMRA 3DFAA 4F7NA 5EM5A 4QQCA 5AAGA 4AQCA 2YN8A 2VTTA 3RNIA 1IG1A 5BVKA 3WF9A 4FVQA 4XOZA 4QMXA 3RHKA 3G9NA 5L2WA 1PW2A 4M0YA 5LVMA 3FQEA 3PY3A 3QGWA 2X81A 5GJFA 4JDKA 2CPKE 4YHJA 2C6TA 3GT8A 4HGEA 4PY1A 4I6HA 2PVLA 2GSFA 4YJNA 2OFVA 4V0GA 5HD4A 1SVEA 4FC0A 2IJMA 4QTBA 4FTRA 3EB0A 4JBVA 3FE3A 4BYJA 3FMLA 5D11A 5HI2A 2J7TA 4E5BA 3DPKA 3HRFA 2EB2A 3E63A 4LGDA 3PZEA 2PUIA 4QO9A 4ERKA 2OJIA 3ZEWA 2R5TA 2GNIA 4FI1A 5JFWA 4F70A 3FMNA 3QCXA 3VBWA 3E62A 4HVDA 3LJ2A 3LFDA 3OEFX 5CXZA 3NMUF 3IPHA 3V6SA 2C1AA 1Q62A 2OO8X 5AP6A 4FSQA 4EHZA 4IB3A 3R01A 2QR7A 4FE2A 2C0IA 1Y8YA 2X9EA 4ANBA 3EQDA 1GZ8A 4KD1A 5DOSA 2PVKA 1YKRA 3AD6A 4R1YA 3RTPA 2JKMA 4MQ1A 1Q5KA 3GP0A 4IC7A 4M8TA 4BZOA 5KZIA 5JT2A 3Q9WA 5AAEA 1PY5A 5F94A 5B0XA 1BKXA 2BHEA 2BCJA 3QQFA 3BWFA 2WO6A 5AV3A 3ZU7A 1FQ1B 2WZJA 4JQ8A 3WOWA 3EFKA 2OGVA 4IDVA 2QHNA 2R3GA 3WBLA 4TZRA 1V0OA 4O96A 5FRIA 3RKBA 4ENYA 2DWBA 2XJ0A 1TQPA 3EN5A 1LEZA 4DEIA 5CEKA 5EW9A 3O50A 2CMWA 4Q2AA 5FTQA 3QKMA 4YHTA 3RCDA 4XNEA 4BDKA 4RVLA 3EQGA 4RT7A 5DGZA 4AG8A 3W2OA 4XP3A 3TT0A 2PZIA 4F99A 1O6YA 4O0RA 3GU8A 2HXQA 3CPBA 3UPZA 4ACHA 2WMXA 4QP1A 1IAHA 2VTIA 3EQPA 3OW3A 5DI1A 3AT3A 3OUKA 1XR1A 3DNDA 4KBKA 1ND4A 5T3QA 3I0OA 1ERKA 3COKA 3QTZA 3NW7A 4S31A 4CGAA 4X2NA 5EOLA 5FXRA 3Q96A 2C5OA 3NYNA 1YXTA 2RG6A 5TE0A 3DY7A 5HX8A 3ZSHA 2E9VA 2CNQA 3U6IA 2VTQA 3ACJA 2BKZA 4DGNA 3SOAA 4CKIA 3UYSA 3Q9XA 5EM7A 4GIIA 1Y6AA 4IQ6A 4F7SA 1PXMA 2VTOA 4DGLC 4L42A 4BGQA 4A9RA 2FUMA 2Y6OA 3MH3A 4JX3A 3KMMA 4OTHA 4GH2A 5JRSA 4FZDB 4PTEA 4XP0A 3WZKA 4EOIA 5A4CA 1L3RE 5E8SA 2E9UA 4LFIA 2WTVA 5BMSA 1J7LA 2OU7A 2QO2A 3CSVA 2V5QA 4B9DA 2FSMX 4JDHA 1Q4LA 2E9NA 4FYOA 4A9YA 5M44A 4IAAA 3S0OA 1YVJA 4G6LA 3DKFA 1OMWA 3ORMA 2OH4A 4F1OA 2R3MA 4DTBA 2J0KA 3TKIA 2RFNA 3A4OX 1QPEA 3GXLA 4YNEA 4YJVA 5HORA 2XNMA 5C8MA 4YR8A 3DQWA 3LXLA 4JT3A 4LRJA 5FLFA 2P3GX 4NW5A 2BZHB 4CQEA 4PMTA 5KMJA 2PU8A 2G9XA 4D55A 1FMKA 2C6EA 1YXUA 2I0EA 3NUYA 1J7UA 5H8EA 4MXAA 5IF1A 3GEQA 5EYKA 3TDVA 2G2HA 1OGUA 3UJGA 2QO7A 4BC6A 2X2MA 1OKYA 3DBCA 4RJ3A 2CGWA 4OT5A 1CM8A 1URCA 3E93A 4LUDA 5CF5A 3DXQA 4NM3A 3P4KA 4ZY6A 1Q8UA 3UMWA 3TZMA 4XG7A 3E8NA 4DT9A 3OZ6A 2CSNA 3HKOA 5FBNC 3EQIA 5AV4A 2XM8A 3MH0A 3FPMA 4KIQA 5H2UA 3AC4A 4YJQA 2QI8A 4C4IA 4GKHA 2AC3A 2QVSE 3BKBA 1Q97A 4IX4A 3VUMA 5HBJA 3OG7A 1YDSE 4DEGA 2B9FA 5J79A 2ZM3A 2I6LA 1GNGA 2HZ4A 2X39A 3LFCA 3A8XA 3B2TA 3HUCA 2BRGA 5E8ZA 2XJ1A 2YEXA 2B9JA 4FV6A 3MBLA 4IAKA 3E7VA 4QP2A 1RJBA 4BR3A 4RWLA 4R8QA 2HWOA 3E3PA 4YO4A 2VWWA 2BIYA 3GCSA 4FG9A 4LQMA 1VEBA 4E6AA 3DBEA 3HP5A 2VO3A 5A6OA 3AQVA 2QONA 4LM5A 1KE6A 5EYMA 4K11A 4QYGA 3I5NA 5IUGA 4O83A 1J1CA 3QZFA 3ELJA 4ZEGA 3RK5A 2UVYA 2JAMA 5M08A 5DG5A 4ASDA 1P4OA 1XBAA 4RX8A 1IEPA 4BKJA 2QLQA 2C3IB 1AGWA 3QAME 3R7OA 5AIKA 4FEWA 3O0GA 4O86A 2JD5A 3VULA 4TXCA 3TM0A 4HCVA 4I3ZA 3IECA 5AP2A 2CLXA 4KKEA 5A3XA 2XIRA 5C8KA 3GC9A 3DNEA 4O7YA 4FL2A 4X3FC 2W5BA 1BYGA 1PXPA 3UBDA 3EQCA 1ZMUA 3AC1A 1K2PA 3NNWA 3VS5A 3ZH8A 4BDAA 4QQTA 2ZDTA 4LI5A 4HVIA 2IG7A 3VRZA 4F6WA 2GNLA 3EN4A 2FVDA 4M67A 1YOLA 5HE2A 2BDWA 3TV7A 4QT1A 5JEBA 3DGKA 4LMUA 5EM8A 3MVLA 2HY81 5CVFA 1DAWA 2Z7SA 3MIAA 4EK4A 1KWPA 2BHHA 1OBGA 3ANRA 1V0PA 4IB5A 3FI4A 3OROA 2EXCX 4OLIA 2F2UA 3GVUA 2F57A 4F9BA 1OECA 2B9IA 3VW8A 3P9JA 4JS8A 3W2CA 3JS2A 3MH2A 3PJ8A 2WTKC 1P2AA 3F88A 4L9IA 2QOKA 2WEVA 2OF4A 3VUGA 3WZEA 4EC9A 4BCHA 4ZTQA 5CVGA 3F9NA 3ZOSA 4MYGA 3MFTA 5DEWA 5GJDA 3EQFA 4KBAA 3LJ0A 3IDCA 3AGLA 4D5HA 5JFSA 4XOYA 5CQWA 1XQZA 1H8FA 4J96A 4NK9A 3U4WA 3A7GA 5KZ0A 4IVDA 5HIBA 4BIDA 5JKGA 2GQSA 3QQJA 4FTMA 1VR2A 5IA4A 4NM7A 2PPQA 4BGHA 2FSOX 1H26A 2ONLA 4OBOA 4RZWA 4YC8A 5AR7A 3TG1A 5JN2A 4O81A 3UOJA 2UV2A 2C68A 5A4LA 3V6RA 3TJDA 5LJJA 5A6NA 2PVYA 5L6PA 2ITXA 4I94A 4RX9A 5ANOA 4D2PA 5KKRB 4G3GA 3RPVA 4UWBA 3CPCA 4A07A 5D9HA 4I5CA 4CMOA 3WIGA 3D2KA 4F1TA 3VS2A 3PP1A 5JMSA 5EW8A 4EUTA 4QMPA 5F1ZA 3NAXA 2C0OA 4BCMA 4F9YA 1RE8A 1ZYCA 3UNZA 3VHEA 2IZRA 2IZTA 4O0VA 3VBTA 2I0YA 4ZMFA 1LR4A 5IUHA 3L9PA 5CYIA 3H10A 5CLPA 3ZC6A 2O8YA 5J9ZA 4ANMA 3MGYA 4CQGA 5ETAA 2HAKA 3D4QA 4OTFA 3RPYA 3CCNA 4KUJA 3OMVA 3PP0A 1NY3A 4BDFA 4FIJA 4H3BA 1FMOE 4J52A 4R3PA 1Q61A 4LOQA 4D4RA 1JKLA 4MTAA 3RINA 3FMDA 5DEYA 3RM6A 4BCOA 4DBXA 3LLTA 1MRVA 4P5QA 1Z5MA 4MX9A 2BR1A 3FKNA 3EFLA 3NUPA 1PXOA 5EI8A 5K0XA 3O8UA 3UO6A 2GS7A 3NPCA 3S95A 5B2MA 3HGKA 3KN6A 2A27A 4DGOA 2GNGA 3TZ9A 2GU8A 3KMWA 2RSVA 1JSUA 4X21A 2YZLA 2W1DA 2GHGA 4XG8A 3BQCA 4HOKA 2IW8A 5BVFA 4TYHB 3RAIA 3BE2A 5E8VA 2WPAA 5H8GA 3UPXA 4BRXA 2R3PA 3BBTB 4FX3A 4Q5HA 3SRVB 3PWYA 5EHYA 4GFGA 3R6XA 5ANKA 2QQ7A 2Z2WA 4DG3E 4ZLZA 1Q24A 2OG8A 5IQAA 3MYGA 3RZBA 2G15A 3BYUA 2WU6A 2CGXA 5KBRA 2I1MA 2UW6A 5G1XA 4L01A 1CKIA 3MSSA 5HTCA 2J90A 5J7BA 4RZVA 4NZWB 4O7WA 3C0IA 3Q60A 3O96A 4L53A 4LL5A 2XJ2A 1MRYA 2EUFB 3ZONA 2F7ZE 1HOWA 2P33A 3OWJA 4FIHA 4IAIA 4U3ZA 3CGFA 3LCDA 3PUPA 4IB0A 4DHFA 3WZUA 5KX8A 2QCSA 1PKDA 3E88A 5EYCA 3ZZEA 1OIYA 3S1HA 1KOAA 3UC4A 2CGVA 2X7OA 3V5JA 3EJ1A 4DF3A 3Q3BA 4XP2A 4HPUE 3MJ2A 3K3JA 4E26A 1IRKA 2XCHA 4N4SA 4UWYA 4LL0A 2JDTA 4B99A 3BWJA 3R22A 4NKAA 5CAUA 2W1HA 3NR9A 1DI9A 3OWLA 3FMMA 4ZZNA 5A46A 1SVHA 4L6QA 2VWXA 1B6CB 4KABA 5DNRA 3TIZA 4D9UA 4QQJA 2ZJWA 3DAEA 3KXGA 4FV5A 5FP6A 3LCKA 5HLPA 4U5JA 1IA8A 4TL0A 4ZTSA 2O3PA 4WNMA 4IBMA 1XWSA 1R0PA 4FIFA 3C50A 3ERKA 2C6IA 2H6DA 2CCIA 3G0EA 5FP5A 5IEVA 4HGLA 2YWVA 3ORXA 5EKOA 4ITIA 2PVMA 3RK7A 1PXNA 1UKIA 4FEVA 4IAZA 3W16A 4W4WA 5HE0A 3PPJA 2OI4X 1Y8GA 2PHKA 3FC2A 2A19B 3G2FA 3N4VA 4H58A 4PMMA 4IFGA 2VWVA 2VWUA 2Y4IC 3R7VA 2BMCA 3IW7A 4U0IA 1BMKA 3OBJA 3ALNA 4Q5EA 1OIUA 1JLUE 3OS3A 4U44A 1U54B 5EM6A 1MP8A 4G1WA 3CP9A 3DXPA 4CG9A 3MY5A 2YLFA 3DZOA 4IHPA 3QQHA 3HAMA 4GJ3A 3VUTA 3QLGA 2VN9A 3QA8A 4AT5A 2O63A 1TVOA 5KE0A 5CNOA 3IKAA 2XIXA 2HK5A 5AM7A 5K4JA 2R3FA 3KEXA 4LRMA 4DH5A 4O21A 2V7OA 2C47A 5B2KA 4MF0A 3UO5A 2R3QA 5C27A 3PRFA 4C38A 2WTDA 3V8TA 4IIRA 3P79A 3COHA 4UY9A 3CD8A 2UUEA 3KCFA 4F9AA 3F82A 1JOWB 2JDRA 3AD5A 2J6MA 4U81A 5DR6A 3RWQA 4IJ9A 4ZJVA 4LMNA 4ZLOA 3E64A 4FVRA 4YZCA 5CQUA 4MAOA 4L3JA 3Q6UA 5KHXA 1UWJA 2JDVA 5BVWA 3C4ZA 2OZOA 3DQXA 3C0GA 2ITNA 4RJ4A 3DK6A 3TUCA 1YI3A 3BGQA 4WNPA 3R28A 2XCKA 4EQUA 1ZYLA 3U87A 1ZY4A 3HVCA 1OPJA 2HELA 4FZ7A 2WOTA 4UMTA 4ZY5A 5C1QB 3MY0A 4EH9A 5HESA 4OTGA 4E8AA 3PJ2A 3RPSA 5KUPA 4MQ2A 2OFUA 4HGSA 3LMHA 4GRBA 4G6OA 1YOMA 4NW6A 3U8WA 4BCJA 4U6RA 4XCUA 3KREA 5EQYA 3VUKA 4JL9A 4HZSA 3FSKA 4YTCA 3I7BA 4GSBA 3NUXA 5DN3A 3IONA 2WMQA 3DKCA 4ZTNA 5AR5A 4X3FA 4WSYA 4DH1A 5ANDA 4XHKB 5TKDA 3FBVA 1BL7A 2VTJA 4H1MA 3V5LA 3G90X 5CTPA 4GK4A 3D5VA 3E8DA 3GI3A 5ETFA 3RWPA 3TNPC 1STCE 4AF3A 3PVWA 4RWIA 3UO4A 5HVJA 4E20A 2Z02A 3U54A 1BUHA 4FOCA 1JAMA 3NCGA 5I9XA 1UU7A 3OD6X 4QMVA 4V05A 5D1JA 4D0XA 3DTWA 4QMYA 1YI6A 5CU3A 3GC8A 2C5YA 5HG5A 3O2MA 1RDQE 4IVBA 4RIYA 5D12A 4NFNA 4PDOA 2UVZA 4CYJA 4I0SA 3FZPA 3BHYA 5HE3A 1H28A 5CI7A 2XRUA 5T6KA 4TKSA 4YZBA 4BTKA 2BRBA 3KXMA 4KRDA 3ZDIA 2WAJA 3LCSA 1ZARA 3MA3A 2CCHA 2IZUA 1NT2A 1JKSA 4O7SA 3OCSA 3ANQA 4U43A 5AR2A 5M55A 3FYJX 4KIKB 2X2KA 3F5GA 3GB2A 3HV6A 4FT9A 3H0ZA 1ZAOA 5DR9A 4EK8A 4EH2A 5HCZA 4QPAA 1H27A 4QOXA 2OSCA 2YCRA 1ZOEA 4I24A 5LARA 1WMKA 4RG0A 4DTKA 4FKRA 3COIA 4EOJA 2W1CA 3FMJA 4TYHA 1URWA 1QPJA 4JI9A 5I3OA 2BZJA 1ZWSA 3RP9A 3V5PA 1KOBA 3KN5A 3MVJA 2IW9A 2RG5A 3HV3A 1APME 3D2IA 4BDCA 4O7NA 4TY1A 2R0IA 3NGAA 3FZRA 5FUTA 4USFA 4IX6A 4P5ZA 5HG8A 2Z60A 3QXPA 4MK0A 4USDA 2QO9A 4UWCA 4AS0A 2ZM1A 4R77A 5GZ8A 2YWPA 2C30A 3D7TB 3FLWA 3QZGA 4FV7A 4Y95A 5HCYA 3UOLA 2BAJA 1H0VA 2QG5A 2XNEA 4FV9A 4JBPA 3WF8A 4U7ZA 3LM5A 4YLJA 2UZWE 3FHIA 2ETKA 3F3UA 3QYWA 4FYNA 4CKJA 2QKRA 1M7NA 5H3QA 4I5PA 4AN9A 5EDPA 4HCTA 5CAPA 4JG6A 4IX5A 3PZHA 3FZOA 4UZDA 3PE2A 3R2BA 4P2KA 3SLSA 3ZUTA 2ITOA 1NA7A 3K3IA 4EEVA 3DB6A 4FKSA 3MFUA 2R3IA 4D1ZA 4NT4A 5IEYA 4CFVA 5AM6A 2JDOA 5BMMA 2QLUA 4FTUA 4OTWA 2RGPA 4GU6A 2UZUE 5EI2A 4ZJJA 4FEXA 3R1SA 4L3LA 4U80A 5TF9A 2F7XE 4JG8A 2W1GA 4D9TA 2C6DA 4ZSLA 1H0WA 4R7IA 4QTAA 3I6UA 5A4QA 3HRCA 3D0EA 3KQ7A 3UNJA 4BWXA 4DBNA 3D5WA 4X6QC 4Y8DA 4I22A 2PMIA 4O82A 2XK8A 3I4BA 5GHVA 3D83A 3OWKA 2PSQA 4FTOA 4MKCA 3TUDA 2OJ9A 4EYJA 3QYZA 4IM3A 3BV2A 4I0TA 4ANSA 4E5AX 3ZS5A 2R3KA 4M3QA 4RGJA 2X8EA 3FLQA 4BDIA 4GFMA 1YXXA 2ZV7A 5LQFA 5ANGA 3BEAA 1PMEA 1FGKA 4FT7A 4L46A 4FIIA 4NIFA 2P0CA 3D5UA 2J2IB 4GT4A 5CU6A 2NNWB 5J5SA 3VBQA 3II5A 3ODZX 4OGRA 4PUZA 2VWBA 2HCKA 5EK7A 1OL6A 3EFWA 4NH1A 4G34A 3PG3A 3HDNA 4IX3A 1YHVA 3HV7A 4J95A 4WBBB 5BYYA 2BDFA 4XV9A 3L1SA 4A4LA 4IACA 4CXAA 2BTSA 2GHLA 3TXOA 3ZO3A 2VRXA 4ZLYA 1FVTA 4KAOA 2OIQA 3UG1A 5K5NA 3TN8A 2XEZA 4BKZA 2HOGA 5CSXA 4J98A 3F7ZA 1M2QA 3HV5A 4YJSA 3EIDA 4RA4A 4G3CA 5CAQA 3VJOA 3IG7A 4XLVA 5HO7A 3UQGA 3NEWA 3N4UA 2OZAB 3FLYA 2YDJA 4CZTA 3HX4A 3DAJA 2ERZE 5IMEA 1JPAA 4M68A 2GPHA 4S34A 4AZTA 5IQEA 3HA6A 3PSDA 3QD2B 3QL8A 3DS6A 1H08A 2XM9A 3LFNA 4UV0A 4BZDA 3SXFA 3VF8A 4W4YA 3EQRA 4BIEA 2REIA 1WFCA 2VD5A 4EQMA 4JDIA 2PYWA 1FVRA 1OI9A 4YC3A 1OITA 4HW7A 1OIRA 3E7OA 3R04A 4IZ7A 4FUXA 4JX7A 5ETIA 5CEIA 3SW4A 4AUAA 4O91A 4PPBA 4I92A 3BZ3A 3KRXA 4GJ2A 4PX6A 3CQWA 2WNTA 4WBOA 2WTCA 3HP2A 3VS3A 2YM3A 3L9LA 3AC2A 2HW6A 4YGAA 4BFMA 3G15A 3BQRA 4D58A 2R3RA 3A4PA 5HZNA 3F3TA 2W99B 2FH9A 4DITA 2GNJA 4JR7A 2XP2A 4KBCA 2PUNA 5D41A 3R1YA 2BUJA 4LOOA 1UKHA 3KULB 3QCQA 4IZAA 5J9YA 4X7QA 1AQ1A 3VRYA 4KS7A 3R8LA 3WF7A 3C7QA 3RALA 4AGWA 4YJTA 3ZXTA 4RIXB 4CZYB 5HIDA 1UV5A 5CSHA 4J1RA 2H34A 4N0SA 4BICA 1LEWA 4YHFA 2WGJA 3GCPA 4C02A 2XA4A 4X2KA 3PSCA 4AFJA 4R1VA 4AW2A 3OBGA 4HVGA 5F9EA 5CASA 3UQFA 4X2FA 5AX3A 3CQEA 4ZTLA 4IADA 2PWLA 5I9VA 3PIXA 4BWKA 3WE8A 4NL0A 3FL5A 4D4VA 4TWCA 5B2LA 5JH6A 3E5AA 5IQFA 3EOCA 4IC8A 4UYNA 4I23A 3SV0A 2QU5A 3C4WA 3RZFA 2YISA 3D9VA 3EH9A 5E9EA 4WT6A 3MIYA 5A4TA 4DH7A 4A9SA 4F7JA 2LAVA 1Q8YA 3VNTA 3SG9A 3KF4A 5HNIX 4EBVA 2JKKA 4NJ3A 2Y4PA 3GFWA 3LXKA 3Q4ZA 4M84A 4N70A 1H25A 5M56A 2PY3A 5AEPA 4ALVA 3FC1X 4RIWB 3C4FA 3CE3A 3R73A 5JQ5A 2UW9A 5TO8A 4XJ0A 4AXAA 3HRBA 3JY9A 3UC3A 2IZSA 3IW8A 5AUVA 2PE2A 2PMOX 5BVNA 4UX9A 2YDKA 3EZVA 3ZRMA 1YDRE 3BHUA 4XG6A 1G3NA 3Q5IA 1OKZA 4WIHA 5CEMA 4NJDA 2J0JA 3F3WA 2CHLA 3MFRA 5FTOA 3KVXA 1REJA 2GQRA 2RKUA 4U42A 3F6XA 1M2RA 3O71A 1S9IA 4D2SA 4RMZA 3BGPA 1JBPE 4O6LA 4BIBA 2V22A 4MXXA 4MXOA 2GS2A 3DV3A 3GQIA 4D0WA 4YPSA 2E9PA 3R00A 1J1BA 4RFYA 4FSTA 3QD3A 4GCJA 5L2QA 2BROA 1VJYA 4FTTA 3T9IA 3GGFA 4NEUA 4PNIA 4F6SA 2DUVA 4JQ7A 2C5NA 5CALA 4HCUA 2H8HA 3Q6WA 5DT3A 4GT5A 1Q8TA 3D7TA 4G17A 3JXWA 3QD0A 4XUFA 3R7YA 3R30A 4EOPA 4QP7A 4DFLA 4AACA 5FTGA 2JIIA 5DYJA 2E9OA 3QTQA 4AAAA 5CNNA 2VGPA 5L6WL 2B55A 2HZIA 3NIEA 5E8TA 5J7HA 2X0GA 4V01A 1SYKA 1YXSA 2C6KA 3WE4A 3BYOA 4EZ3A 3H0YA 1XO2B 5IA3A 2HZNA 3MW1A 2YERA 3TKHA 3EMGA 4WNOA 4F08A 5FG8A 2PTKA 3TJCA 5EKNA 1TQIA 1MQ4A 4Q9ZA 2Y0AA 4TT7A 3ITZA 5EFQA 1GOLA 4ITHA 1X8BA 2BZKB 3PWDA 3HV4A 2UZEA 4H05A 4EOSA 1YW2A 2I0HA 2VO0A 2BPMA 1R0EA 4BTMA 4FA2A 4R7BA 3BLQA 3KVWA 5AP4A 2JEDA 3C5UA 4FVPA 5DRBA 5AV1A 3G51A 5AP1A 4I41A 2B9HA 4FKLA 2PE1A 4GG7A 4RJ8A 1PMVA 4CTCA 1XKKA 3FXZA 3PXKA 1KE8A 5J95A 4XMOA 2ZMDA 1ZRZA 3K54A 4L44A 5DT4A 4S2ZA 3UTOA 3Q4CA 1YWRA 3ET7A 2VTSA 4BCQA 5HVKA 5E4HA 3GCVA 3O8PA 1JVPP 3LAUA 3A7IA 2R3NA 2YCSA 2ITYA 2JC6A 4NM5A 2PULA 3P7CA 4KS8A 3V3VA 4I4FA 3SGCA 4IANA 3AXWA 1JNKA 2XIZA 4UN0C 3LE6A 4XYFA 5K5XA 4AA4A 1WZYA 4BF2A 2VX3A 3DK7A 5J1VA 3COMA 2DQ7X 2C1BA 3ORZA 4FKUA 3QQUA 2ESMA 5LWNA 5FEEA 3WILA 4O7RA 5H8BA 5DMZA 4BY9E 5IU2A 2RFSA 3QRIA 3EL8A 2EXMA 3LFQA 3GC0A 3WF5A 2G1TA 4FTLA 1WBNA 3BBWA 3Q4TA 4XRLA 3ZLXA 4PL5A 5DHJA 2YAKA 3KK9A 5KKRC 2WELA 3W18A 3W33A 2I7QA 5KNJA 2DYLA 3GUBA 4UALA 4ZMEA 2ZVAA 2P4IA 3VIDA 4YZDA 5IH4A 3RPRA 1YOJA 3H9FA 4XEYA 3RMFA 4XG4A 3WZDA 4JJRA 4EC8A 2R0UA 4C59A 1JKTA 1FGIA 3Q4UA 4HYIA 4XX9A 4A9UA 3RNYA 5HLWA 2WQBA 1OPLA 3FHRA 4CMUA 5EW3A 4AZEA 1B38A 4I4EA 3O7LB 3LXPA 4IWQA 3VS6A 5CANA 3ZRLA 3O23A 4TPTA 2XEYA 3UODA 3DA6A 4QMUA 1PYEA 4FF8A 5FEQA 2CDZA 5IA0A 3MB6A 4PWNA 2YJRA 4TWPA 4O0SA 5IUIA 5I0BA 1DAYA 4KNBA 5F95A 3IW4A 3R1QA 4C3PA 3DBFA 2X4FA 4G16A 3R02A 4NWMA 3GU7A 3SX9A 4JOAA 4DA5A 3F61A 3QCYA 2OWBA 2I40A 3Q04A 4WG4A 3TL8A 3OOGA 5HD7A 3IDPA 3HDMA 4EUUA 4ZS4A 4HYUA 3FI3A 2OF2A 4FZFB 4QRCA 1H1SA 4HPTE 4O7VA 3KULA 3AD4A 1UU3A 3L8XA 3U55A 3C4CA 3PLSA 3MVMA 3QTXA 2XKFA 3T3VA 3L8VA 4U79A 4R5SA 4XG3A 4EKKA 3BEGA 5FDPA 4WNKA 4J97A 3QX2A 4X2GA 4F64A 3HEGA 3OY1A 5BX0A 2E2BA 1PKGA 1WBTA 2FYSA 4ZXTA 2YIQA 1PMNA 2XNPA 5FWKK 5FXQA 2QOQA 2JIUA 3HMIA 3DBQA 3C0HA 4FSYA 3H30A 4BHZA 2XS0A 3DU8A 4Z16A 1U46A 4TYGA 3FYKX 3RPOA 1BI8A 5AUYA 4GG5A 4JBQA 3OXIA 4TYJA 2B52A 2VV9A 4FGBA 4M69B 2YIXA 5FDXA 4C34A 4L7FA 4BDHA 3U6HA 3KKVA 3L8PA 4KWPA 5FXSA 4ZK5A 4FODA 5ETCA 5AR8A 2PVJA 3QCSA 4EHVA 2X9FA 3FLZA 3A7JA 3UE4A 2NP8A 5HX6A 3GOPA 5CF4A 1YQJA 3Q32A 1XH9A 5IA5A 4M97A 5IQDA 4UXLA 1YRPA 1UNLA 3KRLA 3MI9A 3NX8A 2OW3A 5CENA 5HQ0A 3DOGA 3I81A 3LFSA 3TUBA 4FICA 3V01A 2IW6A 4IE9A 4RIWA 4IB1A 1OUKA 3M1SA 4FTNA 3FMKA 5TOZA 2XBJA 1M52A 5JFXA 3TACA 2ETRA 1GIHA 1Y57A 2W0JA 1BL6A 4ACCA 4FBXA 2JBPA 2CNUA 2CJMA 1QMZA 4PNKA 4UYAA 5M57A 3CKWA 1V0BA 1A9UA 2I0VA 3ORKA 4F6UA 1SMHA 5T68A 2FGIA 4ACMA 5CX9A 3TCPA 4AFEA 4ZSJA 5HNBA 3MESA 3FL4A 2F4JA 4YU2A 4YC6A 2UW3A 4XV2A 2XK3A 5C01A 5HTIA 3FQHA 4CV8A 4RJ6A 4Q9SA 4PP9A 3S4QA 4ACDA 4L00A 4CT2A 3HA8A 3FJQE 4W8EA 3TI1A 2QC6A 4AX8A 2QURA 1CKJA 1F0QA 4QQ5A 2UZDA 3LLAA 2CNVA 3VQUA 3R21A 4ALUA 4E93A 4IVAA 5LVNA 3RM7A 4FKQA 1P5EA 3IGOA 5EQPA 2OXDA 2A0CX 1J3HA 3HMNA 5HO8A 1ZYDA 4BVUA 2GMXA 1H00A 3GCQA 5A4EA 2VTPA 3VBYA 4KINA 4JBOA 4U97A 3CBLA 3UVPA 4XBUA 1OL5A 2BDJA 2GHMA 4IJPA 1PJKA 4NFMA 4FNWA 2XIYA 3VJNA 5L6OA 4EH7A 1FPUA 1CKPA 2WMSA 3F3VA 4WOVA 4APCA 3LVPA 4BBFA 5CAVA 1R1WA 4EORA 5I9UA 3AG9A 1WAKA 1PHKA 4BGGA 4QD6A 3VWAA 4KB8A 2HXLA 4B6LA 4DLIA 2ZB1A 2SRCA 4FG8A 3WYXA 4O1OA 5DIAA 5I9ZA 2VO7A 3NVMB 3NUSA 3DT1A 3G9LX 4GK3A 3N9XA 4HVHA 4Z7HA 2O65A 5HE1A 3LQ5A 3F69A 2PK9A 4FV4A 1GIIA 4G3FA 4QP3A 3R8UA 2PVRA 4DN5A 2J4ZA 3W2PA 4BDEA 1K3AA 4LGGA 2VNYA 3OXTA 4DCAA 5AA8A 3GFEA 5AX9A 4N6ZA 4QP9A 3PIYA 1Q3WA 3R7GA 5CT7A 4B8LA 3R8PA 5GZAA 5E8YA 4I0RA 2J9MA 3JYAA 3U9CA 4CFWA 3A60A 4FTKA 3IQ7A 3VS1A 4MBJA 4ARKA 5IQCA 1KV2A 2GTNA 4O7LA 3FXXA 4FTAA 5DE2A 4C62A 3WI6A 5BVOA 3BPRA 4HGTA 4YPDA 3NW5A 3TNWA 1VYZA 2Z8CA 3R63A 2VTMA 5CU0A 3PG1A 3QC9A 4ZJIA 4FKPA 4HYSA 1FINA 4CCUA 4DGMA 2XIKA 3NRMA 4FZ6A 3KCKA 2OJFE 1K9AA 4IW0A 3KXNA 3W2RA 4OW8A 4AOTA 2R4BA 1Q8WA 4MWIA 3ZFMA 4E4NA 3ENMA 3CY2A 4FSMA 5ACKA 2JKQA 5HICA 2XKCA 4JG7A 4WHZA 5KMOA 1MQBA 3LHJA 4I5HA 4GVAA 5HEZA 3ID6C 2FSLX 3DKGA 4AWIA 4BI0A 1ZYSA 4BDDA 4J71A 4O7ZA 4W9WA 4N57A 4IM2A 2VWYA 2J0MB 3F5UA 3QQLA 4DYMA 5CF6A 4FSNA 4RPVA 3P7BA 4BI2A 4O0XA 4G5JA 5KMNA 3EN7A 4YTIA 4ZZOA 4K18A 3KRJA 4ZAUA 4P7EA 1OVEA 3V5TA 4S30A 2YIWA 1YHSA 3TNQB 3F2RA 5CS6A 3SHEA 4FKOA 3NVKI 4M12A 5IZFA 3BLRA 5AUTA 3NYXA 4DC2A 1T45A 3ROCA 3C9WA 5CSWA 1Y6BA 3G5DA 3EKNA 3PVGA 5HHWA 4QMWA 3BE9A 2OXXA 2EVAA 5ANJA 4O22A 4YZMA 3AT2A 2WMUA 4TW9A 3MH1A 3C1XA 3OT3A 4KIOA 5CZHA 4RJ7A 4E4LA 2XVDA 4MVFA 2R9SA 4F4PA 4BWPA 4XS2A 5AV2A 3VQHA 4AOJA 5HU9A 4CVAA 5HBHA 3BHHA 2XF0A 4OBQA 4RBLA 5J1WA 5HG9A 4DEHA 1GIJA 4YURA 3AC8A 4FV1A 3VUIA 4BTFA 5EI6A 3RCJA 2HIWA 3RHXA 4RX5A 4H36A 1ZMVA 4BDJA 4DFUA 2PVFA 4IWDA 2ITPA 4V0GB 3QZHA 1W7HA 3OFMA 2O64A 2YM5A 4O6EA 4DAWA 1UVRA 3QFVA 4AGUA 3QUPA 3FSFA 4M69A 4EJNA 3SD0A 5C4LA 3DJ5A 2R3LA 4UXQA 4ZZMA 4C33A 4O2PA 3LM0A 3FZSA 3V8WA 5EYDA 3VBXA 2R3HA 2WXVA 5E91A 1I09A 2X8DA 4CKRA 3V51A 1ZMWA 4NM0A 2OXYA 3N4TA 2UW0A 5LMBA 4HNFA 2HENA 4UZHA 3C4EA 3NW6A 5C9CA 3F2NA 5TT7A 4ANLA 1PYXA 3H3CA 3KL8A 4PDYA 2C4GA 2IVSA 3QD4A 4FKVA 3KY2A 4QNAA 3LMIA 3QKKA 3Q9ZA 3IOKA 4IWOA 3LIJA 4NTSA 4GV1A 3UIBA 3ORTA 3QKLA 4U41A 1ZZLA 4ITJA 3RAKA 4QYYA 3WZJA 2H96A 3EKKA 5L3AA 2ZM4A 3QTSA 4F63A 4MNEB 2Q0BA 3FV8A 4I6BA 4QMLA 2XYUA 3UIXA 3AGMA 3LPBA 3UVQA 3W32A 3LFAA 4NCTC 5H9BA 1U5QA 4ALWA 2IPXA 5LWMA 4J8NA 2C69A 2WQOA 5IQBA 1OZ1A 3P08A 1H1QA 2AC5A 1VYWA 4DE4A 4I21A 1V1KA 5A54A 1ZZ2A 1YWVA 1JSVA 2BRNA 1FVVA 2YJSA 1OUYA 1H24A 5D7AA 3FKOA 3SOCA 3DAKA 4J7BA 1O6KA 4BN1A 4EZ7A 2WHBA 4C3RA 3M11A 4RFMA 3EYHA 1NVQA 2QOHA 3IDBA 5IDPA 4U40A 4Z9LA 4FEQA 4I93A 4KSQA 5CT0A 5IMXA 3R9NA 1CSNA 3K5UA 4PL3A 1OKWA 1ZYJA 4C4FA 4ACGA 2WQMA 4C36A 3HNGA 2C3KA 4J8MA 2WOUA 2A2AA 3BYMA 4FIGA 4IAYA 5BPYA 3SG8A 2XNNA 5K9IA 3DB8A 2WFYA 3BHVA 5BYLA 3Q9YA 3SRVA 3VS4A 2LGCA 2X7GA 4AT3A 4L68A 4DGGA 4RVMA 3GU5A 3V5WA 3K5VA 5M06A 4E7WA 3MN3A 1ATPE 3QQKA 3QTUA 3HZTA 4KKHA 2XMYA 2JFMA 4G2FA 4MWHA 4TRLA 4HVSA 5JK3A 5EHOA 2W4JA 3PXYA 4ZTHA 4U3YA 4A7CA 3POZA 2PZYA 4JNWA 4O2ZA 4BKYA 4CYIA 4E3CA 3U9NA 4D28A 2VTHA 4IMYA 2XK9A 4O38A 3PVBA 4AN2A 4FV3A 1RW8A 4ZS0A 4NUSA 1WBWA 3MDYA 4S32A 4AW5A 3UQCA 2GFSA 2XH5A 4EH5A 3QWJA 4QP4A 3LMGA 5CSVA 1LUFA 4CLIA 3B8QA 3C4XA 5BNJA 1XHAA 3R9HA 4C35A 2C5VA 5KBQA 3WIKA 3LXNA 2GFCA 4CFXA 4YSJA 3KU2A 3LQ8A 5L4QA 4K9YA 5HIEA 1JQHA 4JXFA 4RFZA 2KTYA 4WA9A 4GIHA 4P4CA 5CSPA 5E90A 2C6OA 1ZXEA 4QNYA 4S33A 5HBEA 1FBNA 3CJGA 4O84A 4FV8A 2DS1A 4UMQA 4RA5A 2B54A 2VAGA 4R78A 1UU8A 4W9XA 3A62A 3QWKA 4Y72A 3HMMA 3F2AA 3FMHA 3QHRA 5AUZA 4EZ5A 3PA5A 5IKWA 5HOAA 4FEUA 4TWOA 3R8VA 3DXNA 4GKIA 2HY0A 5M07A 2YABA 3QTWA 5A9UA 3RAWA 2W1EA 2JDSA 5AUWA 3NUUA 3HMOA 2HYYA 4G5PA 4ENXA 3S00A 3IO7A 3SVVA 3VN9A 5BUEA 1WCCA 2PZ5A 2BAQA 1G8SA 1XH4A 1W0XC 2XZSA 3OF0A 1HCLA 3UG2A 2QG7A 3R71A 4MD9E 3OY3A 2UZNA 3JVRA 3QUEA 4FT5A 2F49A 2XUUA 1U54A 4Z3VA 3EYGA 4UEUA 4ASZA 5E1SA 3SC1A 4FTIA 5KHWA 3AOXA 3FLNC 5CU2A 4GMYA 1U59A 4JAJA 4C2VA 1J7IA 4YJOA 3KK8A 4EYMA 4H3PA 3BLHA 3ZZWA 2OJGA 1BI7A 3ZO4A 1OL1A 5G6VA 1E1VA 3ALOA 4DINA 5KO1A 2F2CB 3FEGA 4M7IA 3I60A 4R6VA 1F5QA 4WSQA 4EHEA 4X2JA 2Z7LA 5L2SA 3MY1A 1GY3A 5AP7A 2RFEA 4YBKA 3VC4A 4WG5A 3W10A 4C2WA 1RQQA 4FSZA 5KCVA 3B8RA 3GCUA 5DLSA 4BDBA 3ZBFA 4K6ZA 3QGYA 3TNIA 5D10A 5CEPA 5I3RA 5J9LA 4DEEA 3PA3A 5E7RA 4RJ5A 2YITA 2QOOA 2PVHA 3CTJA 4FTJA 5BUIA 3UP7A 1CMKE 4B0GA 2ITTA 1OM1A 5HU3A 4Y83A 5IH6A 3FKLA 4IEBA 5JGBA 3NNXA 4GYGA 4OAUC 3RBWA 4NU1A 4M14A 2O2UA 4ZSGA 5GNKA 2NRYA 1JSTA 4LRKA 2ITUA 3ETAA 2WEIA 3TTIA 5HVYA 4FNXA 3P1AA 4II5A 3ZSIA 3U6JA 3R8ZA 5C4KA 4EK5A 3P23A 2YLEA 3AMBA 3ZO1A 3IS5A 2JAVA 4IXPA 3EWHA 5GIOE 2FSTX 3I79A 3MTFA 4ZOGA 4Z55A 1PMUA 2ITQA 2YM6A 1ZY5A 2OIDA 4XLIA 4KSPA 1ZOGA 2VTRA 3C51A 3OUNB 3P86A 2WMVA 1QPDA 4AP7A 4O7TA 3Q52A 5CI6A 3VS7A 3UGCA 5IEXA 3A7HA 3KF7A 2WIHA 4GVJA 2WQNA 4XG9A 1M17A 4FT3A 3R9OA 4C3FA 4PMPA 5IA2A 2BKKA 4O0WA 1M7QA 4YJUA 5DA3A 4BBEA 3SW7A 3TV4A 1P4FA 3EN6A 5JQ8A 5GINE 1A48A 5L2TA 3MA6A 4MNEA 5AP0A 2FB8A 3I0QA 3UOHA 3Q5ZA 3R7IA 3OW4A 4OT6A 3SQQA 3ZMMA 3BRBA 4C4JA 5IDNA 3PXQA 3VAPA 3OOMA 4PF4A 3W8QA 3THBA 4H1JA 4F1MA 3QRTA 3PE1A 1WBVA 3NNVA 3OCBA 2XBAA 5LVLA 1O6LA 4MXZA 2IVVA 3OEZA 4YJPA 5AP5A 3ULIA 4K77A 3N51A 4D4SA 5LVOA 2NRUA 4YNOA 3RK9A 5M4FA 4BHNA 1YHWA 5M4UA 4F9WA 4DTAA 3OC1A 3UZPA 3LCTA 2VTLA 3LCOA 4I20A 2X1NA 4CEGA 3QRKA 2P55A 4IH8A 3FI8A 4GEOA 5L8KA 3R7UA 5DT0A 2FO0A 3LFFA 4KIKA 4L3PA 4RWJA 3H9OA 4A06A 4CMTA 2UW8A 5IQHA 4FL1A 2B1PA 3ZHPC 4E73A 5GIPE 4FSRA 5FD2A 2AYPA 3NNUA 1YDTE 4Y46A 1H1RA 3ATTA 3W2QA 5CVHA 3UIUA 2GCDA 2VX0A 1Q41A 4C8BA 4JRNA 2ZV2A 1T46A 4GYIA 3OVVA 2C3LA 2F7EE 4MEDA 5HG7A 3IK3A 3OT8A 2XKDA 3FDNA 2IO6A 4GW8A 1R39A 5F4NA 2GTMA 4MXCA 2GNFA 4F7LA 2CKEA 3TV6A 5BVEA 3R83A 2R3OA 3W8LA 2QOIA 4UMRA 2WMAA 4CD0A 3QUDA 2BFYA 3KA0A 4OBPA 4QMOA 5HCXA 4JIAA 3V5QA 4D1XA 4HNIA 3R2YA 4V04A 4EK6A 4ZY4A 4AU8A 4C37A 4EOKA 2BTRA 4FKIA 4BYIA 4FK3A 1NW1A 4MBIA 2OBJA 3AC3A 2W1IA 4J53A 4YJRA 1WBPA 2ZB0A 3PY1A 5I4NA 4D2VA 3PY0A 4CFUA 5KMMA 4F09A 2VNWA 2OLCA 4Y5QA 3ZYAA 4EOOA 2V7AA 2V55A 4BCPA 5JRQA 4DT8A 4L7SA 3FLSA 4NCTA 2RIOA 4NKSA 4Y73A 4C4EA 5BUJA 2YAAA 2R7BA 1Q99A 3P0MA 2R7IA 3BELA 1I44A 4GFOA 3OCGA 2J51A 3OCTA 3PA4A 1L8TA 2ACXA 2W17A 4GU9A 4RQKA 2YM4A 2W05A 3PXRA 3POOA 2HWPA 2UW4A 2ITZA 3D15A 5F20A 1WVYA 1ZLTA 3DDPA 1XJDA 3LOKA 4AT4A 2BFXA 4LGHA 5AUUA 3NAYA 4FMQA 2OIBA 4DFNA 4X3JA 4PPAA 4CRSA 4JRVA 5J87A 2YCQA 4CT1A 3QTIA 4YLKA 5AAFA 4D2TA 1R3CA 1NXKA 4AZWA 4I6FA 3DLSA 3V04A 3QX4A 2VWIA 3NLBA 2EB3A 5J8IA 1KE7A 2Z7RA 2HW7A 4I5MA 3GU6A 4B4LA 3QTRA 4BCGA 2YIRA 3GQLA 4RVTA 2YM7A 1O9UA 3PTGA 4AGDA 3NS9A 3F7WA 2G2IA 2IVUA 2ZAZA 2UW7A 3LKMA 3SXSA 2FA2A 4ID7A 3JVSA 3O8TA 4YBJA 2VO6A 3L8SA 3L9NA 4W4VA 3JY0A 2RL5A 3SXRA 5IQGA 2X2LA 3BI6A 3ZLWA 3OXZA 4CTBA 1XBCA 3FZ1A 4EH8A 4C61A 4C4GA 2VGOA 1MUOA 2OZAA 3D94A 1JWHA 2CKOA 4F0IA 2PL0A 4D4YA 4BTJA 5HKMA 3HUBA 3QC4A 2PUUA 4DLJA 4D2RA 3VHKA 4G3EA 4AE9A 2PMNX 3UZTA 2XNGA 4PL4A 2W5HA 5AP3A 4DFXE 4FR4A 4BCFA 2C3JA 5IG1A 2P2HA 4QMTA 3WF6A 1KUTA 3MTLA 2NPQA 2Q0NA 3DZQA 3DDQA 4FNYA 2G01A 4ASXA 1YI4A 4DH3A 4LV5A 4OAVB 3CTQA 2UZOA 2V0DA 3JPVA 1GJOA 4O0TA 5GJGA 5KMKA 5KMLA 3TZ7A 1SNUA 5AJQA 4E6DA 1OBDA 4EWQA 4YTFA 5DR2A 3Q2MA 4JVGA 1SZMA 1W84A 2WTJA 2XNBA 4C58A 2QU6A 2YM8A 3FWQA 1OKVA 5LMKC 3RJCA 1U4DA 3G33A 4QTDA 3H9RA 4G9RA 4TYIA 3CKXA 5K0KA 2VX1A 4FTCA 5DWRA 2Q83A 1Z9XA 4DFBA 4TTHB 2ERKA 2BVAA 5CY3A 4PTCA 2XNOA 4ASEA 5HTBA 4FK6A 4FGRA 4RIXA 4CRLA 4IWPA 5CZIA 5DRDA 3NWWA 3ODYX 5ANEA 2WD1A 3VUDA 3QRJA 1YWNA 3MFSA 3UOKA 4L45A 4X6RA 4EWHA 1OL7A 2AUHA 2GQGA 4BB4A 1H01A 1XH5A 3BU6A 1DI8A 3ZDUA 3HAVA 2J5EA 3UIMA 3VF9A 4UMPA 3SAYA 4MF1A 4NTTA 1YXVA 3QA0A 4L43A 4MD8E 5AIRA 4F0FA 4LG4A 2F9GA 4XV1A 4X0MA 4FV2A 3FQSA 3NZ0A 1MRUA 4EOQA 3Q53A 5HLNA 2X4ZA 4EK3A 4HZRA 3R9RA 4QTCA 1HCKA 2YCFA 3CTHA 2XK7A 2CLQA 4QPMA 3R1NA 2YHVA 3DTCA 1BX6A 1U5RA 2QODA 4BDGA 2R2PA 1KE9A 3NCZA 2IVTA 3OTVA 4I6QA 4PMSA 3V8SA 4H3QA 2QOLA 4ZTMA 3C13A 4WUNA 2PUPA 2CN5A 2JFLA 1BLXA 5JFVA 3CD3A 3PXFA 3JUHA 2WKMA 4BCKA 4EL9A 4TNDA 4NSTA 5JZNA 5ICPA 3WYYA 2XK6A 4CZUA 3EL7A 2J50A 4DEBA 3BIZA 4PPCA 5AMNA 3VW6A 3HMPA 3UDBA 3BV3A 1IR3A 3ZO2A 4YMJA 3KRWA 4C4HA 3HL7A 3ORPA 3UP2A 3M42A 1SNXA 3MPAA 3PIZA 3UMXA 4BBMA 3CS9A 3EZRA 1SVGA 1UNHA 3QLFA 4X3FB 2O0UA 4E4MA 5AA9A 2QR8A 3QF9A 4RVKA 2GS6A 4H39A 3CLYA 3T8OA 4U8ZA 2GDOA 2PZRA 1E9HA 2B4SB 2QD9A 2W7XA 1WVXA 3P5KA 2YACA 5C03A 3G6GA 4AA5A 3VVHA 4AOIA 4FZAB 5I9WA 4YZNA 4EONA 2X6EA 1H1WA 4O1PA 5CU4A 2OK1A 4N6YA 4PDPA 4RLKA 3W1FA 2IN6A 2WMTA 3ZLSA 1A06A 4RIYB 4ZIMA 1G8AA 2QOCA 4QMQA 2X6DA 2X7FA 5CEQA 5CF8A 1W8CA 4FKJA 4QYEA 1IAJA 2OKRA 3LJ1A 2VZ6A 3GU4A 4G6NA 2CKPA 3VUHA 2PZPA 4ONAA 4TYEA 2UZBA 2VUWA 1E1XA 4AZVA 3ROYA 3SKCA 1KV1A 3QRUA 4AZSA 5IH5A 4W8DA 1Q3DA 4YTHA 3ZBXA 3LQ3A 3KGAA 1P14A 4MBLA 2BRMA 4DFYA 2Y7JA 3ZSGA 5JZJA 3OWPA 3IW5A 3JR1A 2XB7A 2WTKB 4FUYA 4O0YA 2R64A 4RWKA 3T3UA 3R9DA 2GNHA 4F9CA 3ZCLA 2XKEA 4C0TA 2UZLA 3AMAA 3CEKA 3TZ8A 4CLJA 2W06A 4WG3A 4QYHA 3GOKA 4APPA 4F65A 2UZVA 3KC3A 4Z7GA 2XYNA 3E8CA 3FMEA 3MS9A 3NYVA 4CCBA 5L2IA 1IASA 3OTUA 5LMKA 2W9FB 3LFEA 3PVUA 2BALA 2P2IA 4MHAA 3MPMA 2JGZA 3CIKA 4K8AA 5DFPA 4B8MA 1F3MC 4KKGA 2W4OA 4D2WA 2CKQA 2PE0A 3BYSA 3ZTXA 3ZEPA 5K3YA 4WD5A 3FAAA 2W4KA 2BILB 5EDRA 1OPKA 3DBDA 4EH3A 3NUNA 3ZXZA 4AW0A 3E3BX 3PLAE 5EG3A 5DBXA 4TN6A 5FM2A 2JKOA 1SM2A 3ORNA 4UMUA 5JSMA 2JLDA 5IPJA 3CGOA 3O51A 5M51A 4AGCA 3HYHA 2Y9QA 4UB7A 4RSSA 3OP5A 3IGGA 4D5KA 3G0FA 2WTIA 3BU3A 2W1ZA 3GBZA 3TIYA 5LVPA 2CGUA 4WRSA 3DKOA 3UYTA 3D5XA 3BU5A 5EHLA 1GZKA 3F5PA 3LZBA 4CFNA 2RF9A 1UA2A 4QMNA 3ULZA 3EQHA 3EQBA 3FY0A 3NYOA 3DFCB 3L9MA 4E1ZA 2G2FA 2Y8OA 3QU0A 5E8WA 3KB7A 1B39A 4WUAA 1NVRA 3G6HA 5LXMA 4AW1A 2IWIA 2UW5A 2BRHA 3AT4A 5LCJA 3DJ6A 3ZM4A 4RRVA 3F3ZA 4PRJA 5IQIA 4MXYA 4QP8A 3FI2A 1NVSA 3Q2JA 1XH8A 3FXWA 3FUPA 1W98A 1CDKA 3AC5A 1Y91A 4YP8A 4LV8A 5ACBC 5AUXA 2QOFA 4EKLA 4TNBA 3CC6A 4WKQA 4NIFB 1JKKA 3B2WA 3KXXA 3VBVA 4JQEA 4PQNA 3A2CA 1OB3A 3PJCA 4GS6A 4RC3A 4AE6A 4BCIA 4CFMA 1PXJA 1GZOA 4IFCA 4RC2A 4DCEA 4LOPA 4R5YA 5CAOA 5J5TA 4FIEA 1PXIA 3I6WA 5E1EA 5BVDA 1OL2A 4RQVA 1J91A 4OTQA 3CR0A 2QKWB 4L8MA 1M2PA 3NIZA 4MCVA 3RAHA 3R0TA 1UU9A 4K2RA 1Q8ZA 4XV3A 2VTAA 3WARA 3PPKA 4E6CA 5I9YA 4EI4A 3FZTA 2B0QA 4FT0A 3PDTA 2B7AA 1S9JA 1QCFA 2J0IA 3SA0A 3DCVA 2WU7A 4FTQA 4MNFA 4DH8A 3FY2A 4K1BA 4ZTRA 1CTPE 3O17A 4AN3A 2CN8A 2WQEA 1FOTA 5ANIA 2B53A 1LP4A 3UVRA 4CFFA 4EBWA 4IZ5A 4EJ7A 3TNHA 1AD5A 4IAFA 4MD7E 3REPA 5E8UA 3I7CA 1PF8A 5M09A 4OR5A 5BYZA 3ZUVA 4GUBA 5TR6A 4E5WA 3ENHA 4QP6A 3MB7A 4OTDA 3SDJA 4DG2E 1DS5A 2BAKA 5LCKA 3NUAA 4L67A 5JGDA 1G5SA 2A1AB 2W1FA 2YDIA 4CNHA 5LMAA 4G31A 4G9CA 2OJJA 1KSWA 4D1SA 3C5IA 4RX7A 3U4UA 4QMSA 3ORIA 4M13A 5AFVA 1XBBA 3QZIA 3A8WA 2PMLX 3LFBA 3GC7A 2YFXA 4QMMA 3ACKA 3QXOA 3AMYA 4Y5HA 3P78A 4MH7A 3F5XA 3DLZA 3R8MA 2ZYBA 4XRJA 4EH6A 4GUEA 4ERWA 4QMZA 3TTJA 2EXEA 4HJOA 3FPQA 1GZNA 1QPCA 3QHWA 5FM3A 4YUQA 2BIKB 3BHTA 1VZOA 5AWMA 2ZDUA 4I1ZA 3EHAA 4FNZA 2QNJA 3MJ1A 4QYFA 4YZ9A 5DVRA 5AR3A 3RGFA 4EQCA 3K2LA 2KULA 4P90A 5AR4A 4JR3A 3BCEA 1M14A 3MVHA 4XG2A 4DEAA 5M53A 5C26A 3OHTA 3TEIA 3QQGA 3PJ1A 2X8IA 3ZFXA 2QOBA 4ANQA 4CSVA 3ZRKA 5CEOA 4JAIA 1TKIA 4TWNA 5I5ZA 4RC4A 2Y4IB 2YIYA 3H4JA 3W2SA 2RFDA 1H07A 5M4IA 4RIOA 4NYEA 3MV5A 5A14A 5M4CA 4IZYA 3KXZA 4GL9A 2NO3A 2H9VA 4FKGA 4FKWA 5FGKA 4LUEA 4IDTA 4M0ZA 1TQMA 4Y85A 4AZFA 4GT3A 3I5ZA 3ZFYA 2EU9A 4C7TA 5CXHA 2C6LA 2ZOQA 3MPTA 4IVCA 3ZUUA 4EH4A 1XH6A 2QHMA 1OIQA 2ZV9A 4B7TA 3DK3A 2W5AA 2OH0E 4J99A 5AADA 3TDWA 3ORLA 3RI1A 4A4XA 1IA9A 3M2WA 5EQEA 3PFQA 3NDMA 4M66A 2BZIB 4O0UA 4BI1A 4W4XA 4G3DA 5EDQA 3W55A 2YA9A 4L52A 4OTIA 4FL3A 4USEA 3S3IA 2JBOA 3D14A 2VU3A 2ZMCA 3PJ3A 5IISA 3P7AA 3GNIB 2J0LA 4HYHA 2OICA 4YSMA 3HLLA 3T9TA 1EH4A 3PRIA 3O7LD 4FSUA 3A61A 4JDJA 4OTRA 4M15A 5ITAA 5JGAA 2YZAA 4EOMA 3KRRA
chains in the Genus database with same CATH superfamily
2Z7QA 4ZSEA 3BX5A 2XK4A 5EOBA 3ZM9A 1GAGA 4UBAA 3E92A 3GENA 1XH7A 5DPVA 5HNGA 5C8NA 3PSBA 5E92A 1H1PA 2WMWA 5KMIA 5CWZA 4PP7A 3TKUA 4ZSAA 2WB8A 3CQUA 1DM2A 4XBRA 1PXLA 2JITA 1W82A 3LW0A 5FEDA 5L8JA 3ZC5A 3KMUA 4A9TA 5LOHA 3U51A 2WIPA 4R3RA 4AA0A 1PRYA 4E4XA 2C6MA 1UNGA 4FV0A 2UVXA 3F66A 4YLLA 2PVNA 4O4DA 4QTEA 2V62A 5B7VA 2R3JA 4A4OA 2VTNA 5FBOA 2ZV8A 3D7ZA 5EH0A 4E6QA 3A99A 3ATSA 1UWHA 4KA3A 4ORKA 4FOBA 4JIKA 3TWJA 4ANNA 2ITVA 2WTWA 4R7HA 3KFAA 3NSZA 2XRWA 2C5XA 5AV0A 1REKA 3KXHA 5D7VA 2W9ZB 2C0TA 5HO6A 2WMBA 3BYVA 4IM0A 4FG7A 3R7EA 5IA1A 1WBSA 1WVWA 5BQ0A 4EHGA 4CG8A 4K0YA 1WBOA 4GK2A 2A4LA 4U9AA 2JIVA 3DJ7A 4EOLA 4WRGA 1R78A 1PXKA 4FSWA 5DH3A 4DG0E 3ZLYA 3VS0A 2Y6MA 3HECA 1H4LA 1KE5A 3PYYA 3QBNA 2VWZA 4DFZE 3EN9A 4O27B 4C57A 4FKTA 4KIPA 5L8LA 5FQDC 3UZRA 4PDSA 4WO5A 1Z57A 2ITWA 3PPZA 3BGZA 3IOPA 4XH6A 5GZ9A 4KRCA 4PV0A 3E8EA 4JLCA 3VO3A 3S2PA 4U45A 4OTPA 4OUCA 2J5FA 5E8XA 4DEDA 3EFJA 3QALE 4F0GA 2EWAA 3PXZA 1QL6A 2O5KA 4ANOA 4BL1A 3MWUA 4BJJA 3E87A 4BZNA 4BCNA 2ONLC 2W96B 3IW6A 4YO6A 3CXWA 3CY3A 4ZP5A 4PTGA 4O4EA 3A7FA 2UZTA 3CJFA 5K4IA 3RVGA 3UNKA 5HGIA 1LPUA 1ZOHA 2HZ0A 4LYNA 4QPSA 4CV9A 4K33A 3I1AA 4R3CA 2ETMA 1W83A 4RLLA 2WMRA 3DFAA 4F7NA 5EM5A 4QQCA 5AAGA 4AQCA 2YN8A 2VTTA 3RNIA 1IG1A 5BVKA 3WF9A 4FVQA 4XOZA 4QMXA 3RHKA 3G9NA 5L2WA 1PW2A 4M0YA 5LVMA 3FQEA 3PY3A 3QGWA 2X81A 5GJFA 4JDKA 2CPKE 4YHJA 2C6TA 3GT8A 4HGEA 4PY1A 4I6HA 2PVLA 2GSFA 4YJNA 2OFVA 4V0GA 5HD4A 1SVEA 4FC0A 2IJMA 4QTBA 4FTRA 3EB0A 4JBVA 3FE3A 4BYJA 3FMLA 5D11A 5HI2A 2J7TA 4E5BA 3DPKA 3HRFA 2EB2A 3E63A 4LGDA 3PZEA 2PUIA 4QO9A 4ERKA 2OJIA 3ZEWA 2R5TA 2GNIA 4FI1A 5JFWA 4F70A 3FMNA 3QCXA 1G8JA 3VBWA 3E62A 4HVDA 3LJ2A 3LFDA 3OEFX 5CXZA 3NMUF 3IPHA 3V6SA 2C1AA 1Q62A 2OO8X 5AP6A 4FSQA 4EHZA 4IB3A 3R01A 2QR7A 4FE2A 2C0IA 1Y8YA 2X9EA 4ANBA 3EQDA 1GZ8A 4KD1A 5DOSA 2PVKA 1YKRA 3AD6A 4R1YA 3RTPA 2JKMA 4MQ1A 1Q5KA 3GP0A 4IC7A 4M8TA 4BZOA 5KZIA 5JT2A 3Q9WA 5AAEA 1PY5A 5F94A 5B0XA 1BKXA 2BHEA 2BCJA 3QQFA 3BWFA 2WO6A 5AV3A 3ZU7A 1FQ1B 2WZJA 4JQ8A 3WOWA 3EFKA 2OGVA 4IDVA 2QHNA 2R3GA 3WBLA 4TZRA 1V0OA 4O96A 5FRIA 3RKBA 4ENYA 2DWBA 2XJ0A 1TQPA 3EN5A 1LEZA 4DEIA 5CEKA 5EW9A 3O50A 2CMWA 4Q2AA 3AKJA 5FTQA 3QKMA 4YHTA 3RCDA 4XNEA 4BDKA 4RVLA 3EQGA 4RT7A 5DGZA 4AG8A 3W2OA 4XP3A 3TT0A 2PZIA 4F99A 1O6YA 4O0RA 3GU8A 2HXQA 3CPBA 3UPZA 4ACHA 2WMXA 3VONA 4QP1A 1IAHA 2VTIA 3EQPA 3OW3A 5DI1A 3BL7A 3AT3A 3OUKA 1XR1A 3DNDA 4KBKA 1ND4A 5T3QA 3I0OA 1ERKA 3COKA 3QTZA 3NW7A 4S31A 4CGAA 4X2NA 5EOLA 5FXRA 3Q96A 2C5OA 3NYNA 1YXTA 2RG6A 5TE0A 3DY7A 5HX8A 1W2CA 2E9VA 3ZSHA 3U6IA 2VTQA 2CNQA 3ACJA 2BKZA 4DGNA 3SOAA 4CKIA 3UYSA 3Q9XA 5EM7A 4GIIA 1Y6AA 4IQ6A 4F7SA 1PXMA 2VTOA 4DGLC 4L42A 4BGQA 4A9RA 2FUMA 2Y6OA 3MH3A 4JX3A 3KMMA 4OTHA 4GH2A 5JRSA 4FZDB 4PTEA 4XP0A 3WZKA 4EOIA 5A4CA 1L3RE 5E8SA 4MUQA 2E9UA 4LFIA 2WTVA 5BMSA 1J7LA 2OU7A 2QO2A 3CSVA 2V5QA 4B9DA 2FSMX 4JDHA 1Q4LA 2E9NA 4FYOA 4A9YA 5M44A 4IAAA 3S0OA 1YVJA 4G6LA 3DKFA 1OMWA 3ORMA 2OH4A 4F1OA 2R3MA 4DTBA 2J0KA 3TKIA 2XALA 2RFNA 3A4OX 1QPEA 3GXLA 4YNEA 4YJVA 5HORA 2XNMA 5C8MA 4YR8A 3DQWA 3LXLA 4JT3A 4LRJA 5FLFA 2P3GX 4NW5A 2BZHB 4CQEA 4PMTA 5KMJA 2PU8A 2G9XA 4D55A 1FMKA 2C6EA 1YXUA 2I0EA 3NUYA 1J7UA 5H8EA 4MXAA 5IF1A 3GEQA 5EYKA 3TDVA 2G2HA 1OGUA 3UJGA 2QO7A 4BC6A 2X2MA 1OKYA 3DBCA 4RJ3A 2CGWA 4OT5A 1CM8A 1URCA 3E93A 4LUDA 5CF5A 3DXQA 4NM3A 3P4KA 4ZY6A 1Q8UA 3UMWA 3TZMA 4XG7A 3E8NA 4DT9A 3OZ6A 2CSNA 3HKOA 5FBNC 3EQIA 5AV4A 2XM8A 3MH0A 3FPMA 4KIQA 5H2UA 3PFYA 3AC4A 4YJQA 2QI8A 4C4IA 4GKHA 2AC3A 2QVSE 3BKBA 1Q97A 4IX4A 3VUMA 5HBJA 3OG7A 1YDSE 4DEGA 2B9FA 5J79A 2ZM3A 2I6LA 1GNGA 2HZ4A 2X39A 3LFCA 3A8XA 3B2TA 3HUCA 2BRGA 5E8ZA 2XJ1A 2YEXA 2B9JA 4FV6A 3MBLA 4IAKA 3E7VA 4QP2A 1RJBA 4BR3A 4RWLA 4R8QA 2HWOA 3E3PA 4YO4A 2VWWA 3AKLA 2BIYA 3GCSA 4FG9A 4LQMA 1VEBA 4E6AA 3DBEA 4FJVA 3HP5A 2VO3A 5A6OA 3AQVA 2QONA 4LM5A 1KE6A 5EYMA 4K11A 4QYGA 3I5NA 5IUGA 4O83A 1J1CA 3QZFA 3ELJA 4ZEGA 3RK5A 2UVYA 2JAMA 5M08A 5DG5A 4ASDA 1P4OA 1XBAA 4RX8A 1IEPA 4BKJA 2QLQA 2C3IB 1AGWA 3QAME 3R7OA 5AIKA 4FEWA 3O0GA 4O86A 2JD5A 3VULA 4TXCA 3TM0A 4HCVA 4I3ZA 3IECA 5AP2A 2CLXA 4KKEA 5A3XA 2XIRA 5C8KA 3GC9A 3DNEA 4O7YA 4FL2A 4X3FC 2W5BA 1BYGA 1PXPA 3UBDA 3EQCA 1ZMUA 3AC1A 1K2PA 3NNWA 3VS5A 3ZH8A 4BDAA 4QQTA 2ZDTA 4LI5A 4HVIA 2IG7A 3VRZA 4F6WA 2GNLA 3EN4A 2FVDA 4M67A 1YOLA 5HE2A 4DDGA 2BDWA 3TV7A 4QT1A 5JEBA 3UDTA 3DGKA 4LMUA 5EM8A 3MVLA 2HY81 5CVFA 1DAWA 2Z7SA 3MIAA 4EK4A 1KWPA 3O5AA 2BHHA 1OBGA 3ANRA 3PUFC 1V0PA 4IB5A 3FI4A 3OROA 2EXCX 4OLIA 2F2UA 3GVUA 2F57A 4F9BA 1OECA 2B9IA 3VW8A 3P9JA 4JS8A 3W2CA 3JS2A 3MH2A 3PJ8A 2WTKC 1P2AA 3F88A 4L9IA 2QOKA 2WEVA 2OF4A 3VUGA 3WZEA 4EC9A 2ZFYA 4BCHA 4ZTQA 5CVGA 3F9NA 3ZOSA 4MYGA 3MFTA 5DEWA 5GJDA 3EQFA 4KBAA 3LJ0A 3IDCA 3AGLA 4D5HA 5JFSA 4XOYA 5CQWA 1XQZA 1H8FA 4J96A 4NK9A 3U4WA 3A7GA 5KZ0A 4IVDA 5HIBA 4BIDA 5JKGA 2GQSA 3QQJA 4FTMA 1VR2A 5IA4A 4NM7A 2PPQA 4BGHA 2FSOX 1H26A 2ONLA 4OBOA 4RZWA 4YC8A 5AR7A 3TG1A 5JN2A 4O81A 3UOJA 2UV2A 2C68A 5A4LA 3V6RA 3TJDA 5LJJA 5A6NA 2PVYA 5L6PA 2ITXA 4I94A 4RX9A 5ANOA 4D2PA 5KKRB 4G3GA 3RPVA 4UWBA 3CPCA 4A07A 5D9HA 4I5CA 4CMOA 3WIGA 3D2KA 4F1TA 3VS2A 3PP1A 5JMSA 5EW8A 4EUTA 4QMPA 5F1ZA 3NAXA 2C0OA 4BCMA 4F9YA 1RE8A 1ZYCA 3UNZA 3VHEA 2IZRA 2IZTA 4O0VA 3VBTA 2I0YA 4ZMFA 1LR4A 5IUHA 3L9PA 5CYIA 3H10A 5CLPA 3ZC6A 2O8YA 5J9ZA 4O4BB 4ANMA 3MGYA 4CQGA 5ETAA 2HAKA 3D4QA 4OTFA 3RPYA 3CCNA 4KUJA 3OMVA 3PP0A 1NY3A 2X0PA 4BDFA 4FIJA 4H3BA 1FMOE 4J52A 4R3PA 1Q61A 4LOQA 4D4RA 1JKLA 4MTAA 3RINA 3FMDA 5DEYA 3RM6A 4BCOA 4DBXA 3LLTA 1MRVA 4P5QA 1Z5MA 4MX9A 2BR1A 3FKNA 3EFLA 3NUPA 1PXOA 5EI8A 5K0XA 3W0NA 3O8UA 3UO6A 2GS7A 3NPCA 3S95A 5B2MA 3HGKA 3KN6A 2A27A 4DGOA 2GNGA 3TZ9A 2GU8A 3KMWA 2RSVA 1JSUA 4X21A 2YZLA 2W1DA 2GHGA 4XG8A 3BQCA 4HOKA 2IW8A 5BVFA 4TYHB 3RAIA 3BE2A 5E8VA 2WPAA 5H8GA 3UPXA 4BRXA 2R3PA 3BBTB 4FX3A 4Q5HA 3SRVB 3PWYA 5EHYA 4GFGA 3R6XA 5ANKA 2QQ7A 2Z2WA 4DG3E 4ZLZA 1Q24A 2OG8A 5IQAA 3MYGA 3RZBA 2G15A 3BYUA 2WU6A 2CGXA 5KBRA 2I1MA 2UW6A 5G1XA 4L01A 1CKIA 3MSSA 5HTCA 2J90A 5J7BA 4RZVA 4NZWB 4O7WA 3C0IA 3Q60A 3O96A 4L53A 4LL5A 2XJ2A 1MRYA 2EUFB 3ZONA 2F7ZE 1HOWA 2P33A 3OWJA 4FIHA 4IAIA 4U3ZA 3CGFA 3LCDA 3PUPA 4IB0A 4DHFA 3WZUA 5KX8A 2QCSA 1PKDA 3E88A 5EYCA 3ZZEA 1OIYA 3S1HA 1KOAA 3UC4A 4JMQA 2CGVA 2X7OA 3V5JA 3EJ1A 4DF3A 3Q3BA 4XP2A 4HPUE 3MJ2A 3K3JA 4E26A 1IRKA 2XCHA 4N4SA 4UWYA 4LL0A 2JDTA 4B99A 3BWJA 3R22A 4NKAA 5CAUA 2W1HA 3NR9A 1DI9A 3OWLA 3FMMA 4ZZNA 5A46A 1SVHA 4L6QA 2VWXA 1B6CB 4KABA 5DNRA 3TIZA 4D9UA 4QQJA 2ZJWA 3DAEA 3KXGA 4FV5A 5FP6A 1ST4A 3LCKA 5HLPA 4U5JA 1IA8A 4TL0A 4ZTSA 2O3PA 4WNMA 4IBMA 1XWSA 1R0PA 4FIFA 3C50A 3ERKA 2C6IA 2H6DA 2CCIA 3G0EA 5FP5A 5IEVA 4HGLA 2YWVA 3ORXA 5EKOA 4ITIA 2PVMA 3RK7A 1PXNA 1UKIA 4FEVA 4IAZA 3W16A 4W4WA 5HE0A 3PPJA 2OI4X 1Y8GA 2PHKA 3FC2A 2A19B 3G2FA 3N4VA 4H58A 4PMMA 4IFGA 2VWVA 2VWUA 2Y4IC 3R7VA 2BMCA 3IW7A 4U0IA 1BMKA 3OBJA 3ALNA 4Q5EA 1OIUA 1JLUE 3OS3A 4U44A 1U54B 5EM6A 1MP8A 4G1WA 3CP9A 3DXPA 4CG9A 3MY5A 2YLFA 3DZOA 4IHPA 3QQHA 3HAMA 4GJ3A 3VUTA 3QLGA 2VN9A 3QA8A 4AT5A 2O63A 1TVOA 5KE0A 5CNOA 3IKAA 4AXCA 2XIXA 2HK5A 5AM7A 5K4JA 2R3FA 3KEXA 4LRMA 4DH5A 4O21A 2V7OA 2C47A 5B2KA 4MF0A 3UO5A 2R3QA 5C27A 3PRFA 4C38A 2WTDA 3V8TA 4IIRA 3P79A 3COHA 4UY9A 3CD8A 2UUEA 3KCFA 4F9AA 3F82A 1JOWB 2JDRA 3AD5A 2J6MA 4U81A 5DR6A 3RWQA 4IJ9A 4ZJVA 4LMNA 4ZLOA 3E64A 4FVRA 4YZCA 5CQUA 4MAOA 4L3JA 3Q6UA 5KHXA 1UWJA 2JDVA 5BVWA 3C4ZA 2OZOA 3DQXA 3C0GA 2ITNA 4RJ4A 3DK6A 3TUCA 1YI3A 3BGQA 4WNPA 3R28A 2XCKA 4EQUA 1ZYLA 3U87A 1ZY4A 3HVCA 1OPJA 2HELA 4FZ7A 2WOTA 4UMTA 4ZY5A 5C1QB 3MY0A 4EH9A 5HESA 4OTGA 4E8AA 3PJ2A 3RPSA 5KUPA 4MQ2A 2OFUA 4HGSA 3LMHA 4GRBA 4G6OA 1YOMA 4NW6A 3U8WA 4BCJA 4U6RA 4XCUA 3KREA 5EQYA 3VUKA 4JL9A 4HZSA 3FSKA 4YTCA 3I7BA 4GSBA 3NUXA 5DN3A 3IONA 2WMQA 3DKCA 4ZTNA 5AR5A 4X3FA 4WSYA 4DH1A 5ANDA 4XHKB 5TKDA 3FBVA 1BL7A 2VTJA 4H1MA 2NYAA 3V5LA 3G90X 5CTPA 4GK4A 3D5VA 3E8DA 3GI3A 5ETFA 3RWPA 3TNPC 1STCE 4AF3A 3PVWA 4RWIA 3UO4A 5HVJA 4E20A 2Z02A 3TMOA 1BUHA 4FOCA 3U54A 1JAMA 3NCGA 5I9XA 1UU7A 3OD6X 4QMVA 4V05A 5D1JA 4D0XA 3DTWA 4QMYA 1YI6A 5CU3A 3GC8A 2C5YA 5HG5A 3O2MA 1RDQE 4IVBA 4RIYA 5D12A 4NFNA 4PDOA 2UVZA 4CYJA 4I0SA 3FZPA 3BHYA 5HE3A 1H28A 5CI7A 2XRUA 5T6KA 4TKSA 4YZBA 4BTKA 2BRBA 3KXMA 4KRDA 3ZDIA 2WAJA 3LCSA 1ZARA 3MA3A 2CCHA 2IZUA 1NT2A 1JKSA 4O7SA 3OCSA 3ANQA 4U43A 5AR2A 5M55A 3FYJX 4KIKB 2X2KA 3F5GA 3GB2A 3HV6A 4FT9A 3H0ZA 1ZAOA 5DR9A 4EK8A 4EH2A 5HCZA 4QPAA 1H27A 4QOXA 2OSCA 2YCRA 1ZOEA 4I24A 5LARA 1WMKA 4RG0A 4DTKA 4FKRA 3COIA 4EOJA 2W1CA 3FMJA 4TYHA 1URWA 1QPJA 4JI9A 5I3OA 2BZJA 1ZWSA 3RP9A 3V5PA 1KOBA 3KN5A 3MVJA 2IW9A 2RG5A 3HV3A 1APME 3D2IA 4BDCA 4O7NA 4TY1A 2R0IA 3NGAA 3FZRA 5FUTA 4FRFA 4USFA 4IX6A 4P5ZA 5HG8A 2Z60A 3QXPA 4MK0A 4USDA 2QO9A 4UWCA 4AS0A 2ZM1A 4R77A 5GZ8A 2YWPA 2C30A 3D7TB 3FLWA 3QZGA 4FV7A 4Y95A 5HCYA 3UOLA 2BAJA 1H0VA 2QG5A 2XNEA 4FV9A 4JBPA 3WF8A 4U7ZA 3LM5A 4YLJA 2UZWE 3FHIA 2ETKA 3F3UA 3QYWA 4FYNA 4CKJA 2QKRA 1M7NA 5H3QA 4I5PA 4AN9A 5EDPA 4HCTA 5CAPA 4JG6A 4IX5A 3PZHA 3FZOA 4UZDA 3PE2A 3R2BA 4P2KA 3SLSA 3ZUTA 2ITOA 1NA7A 3K3IA 4EEVA 3DB6A 4FKSA 3MFUA 2R3IA 4D1ZA 4NT4A 5IEYA 4CFVA 5AM6A 2JDOA 5BMMA 2QLUA 4FTUA 4OTWA 2RGPA 4GU6A 2UZUE 5EI2A 4ZJJA 4FEXA 3R1SA 4L3LA 4U80A 5TF9A 2F7XE 4JG8A 2W1GA 4D9TA 2C6DA 4ZSLA 1H0WA 4R7IA 4QTAA 3I6UA 5A4QA 3HRCA 3D0EA 3KQ7A 3UNJA 4BWXA 4DBNA 3D5WA 4X6QC 4Y8DA 4I22A 2PMIA 4O82A 2XK8A 3I4BA 5GHVA 3D83A 3OWKA 2PSQA 4FTOA 4MKCA 3TUDA 2OJ9A 4EYJA 3QYZA 4IM3A 3BV2A 4I0TA 4ANSA 4E5AX 3ZS5A 2R3KA 4M3QA 4RGJA 2X8EA 3FLQA 4BDIA 4GFMA 1YXXA 2ZV7A 5LQFA 5ANGA 3BEAA 1PMEA 1FGKA 4FT7A 4L46A 4FIIA 4NIFA 2P0CA 3D5UA 2J2IB 4GT4A 5CU6A 2NNWB 4F78A 5J5SA 3VBQA 3II5A 3ODZX 4OGRA 4PUZA 2VWBA 2HCKA 5EK7A 1OL6A 3EFWA 4NH1A 4G34A 3PG3A 3HDNA 4IX3A 1YHVA 3HV7A 4J95A 4WBBB 5BYYA 2BDFA 4XV9A 3L1SA 4A4LA 4IACA 4CXAA 2BTSA 2GHLA 3TXOA 3ZO3A 2VRXA 4ZLYA 1FVTA 4KAOA 2OIQA 3UG1A 5K5NA 3TN8A 2XEZA 4BKZA 2HOGA 5CSXA 4J98A 3F7ZA 1M2QA 3HV5A 4YJSA 3EIDA 4RA4A 4G3CA 5CAQA 3VJOA 3IG7A 4XLVA 5HO7A 3UQGA 3NEWA 3N4UA 2OZAB 3FLYA 2YDJA 4CZTA 3HX4A 3DAJA 2ERZE 5IMEA 1JPAA 4M68A 2GPHA 4S34A 4AZTA 5IQEA 3HA6A 3PSDA 3QD2B 3QL8A 3DS6A 1H08A 2XM9A 3LFNA 4UV0A 2XAOA 4BZDA 3SXFA 3VF8A 4W4YA 3EQRA 4BIEA 2REIA 1WFCA 2VD5A 4EQMA 4JDIA 2PYWA 1FVRA 1OI9A 4YC3A 1OITA 4HW7A 1OIRA 3E7OA 3R04A 4IZ7A 4FUXA 4JX7A 5ETIA 5CEIA 3SW4A 4AUAA 4O91A 4PPBA 4I92A 3BZ3A 3KRXA 4GJ2A 4PX6A 3CQWA 2WNTA 4WBOA 2WTCA 3HP2A 3VS3A 2YM3A 3L9LA 3AC2A 2HW6A 4YGAA 4BFMA 3G15A 3BQRA 4D58A 2R3RA 3A4PA 5HZNA 3F3TA 2W99B 2FH9A 4DITA 2GNJA 4JR7A 2XP2A 4KBCA 2PUNA 5D41A 3R1YA 2BUJA 4LOOA 1UKHA 3KULB 3QCQA 4IZAA 5J9YA 4X7QA 1AQ1A 3VRYA 4KS7A 3R8LA 3WF7A 3C7QA 3RALA 4AGWA 4YJTA 3ZXTA 4RIXB 3KIOC 4CZYB 5HIDA 1UV5A 5CSHA 4J1RA 2H34A 4N0SA 4BICA 1LEWA 4YHFA 2WGJA 3GCPA 4C02A 2XA4A 4X2KA 3PSCA 4AFJA 4R1VA 4AW2A 3OBGA 4HVGA 5F9EA 5CASA 3UQFA 4X2FA 5AX3A 3CQEA 4ZTLA 4IADA 2PWLA 5I9VA 3PIXA 4BWKA 3WE8A 4NL0A 3FL5A 4D4VA 4TWCA 5B2LA 5JH6A 3E5AA 5IQFA 3EOCA 4IC8A 4UYNA 4I23A 3SV0A 2QU5A 3C4WA 3RZFA 2YISA 3D9VA 3EH9A 5E9EA 4WT6A 3MIYA 5A4TA 4DH7A 4A9SA 4F7JA 2LAVA 1Q8YA 3VNTA 3SG9A 3KF4A 5HNIX 4EBVA 2JKKA 4NJ3A 2Y4PA 3GFWA 3LXKA 3Q4ZA 4M84A 4N70A 1H25A 5M56A 2PY3A 5AEPA 4ALVA 3FC1X 4RIWB 3C4FA 3CE3A 3R73A 5JQ5A 2UW9A 5TO8A 1ST0A 4XJ0A 4AXAA 3HRBA 3JY9A 3UC3A 2IZSA 3IW8A 5AUVA 2PE2A 2PMOX 5BVNA 4UX9A 2YDKA 3EZVA 3ZRMA 1YDRE 3BHUA 4XG6A 1G3NA 3Q5IA 1OKZA 4WIHA 5CEMA 4NJDA 2J0JA 3F3WA 1VLRA 2CHLA 3MFRA 5FTOA 3KVXA 1REJA 2GQRA 2RKUA 4U42A 3F6XA 1M2RA 3O71A 1S9IA 4D2SA 4RMZA 3BGPA 1JBPE 4O6LA 4BIBA 2V22A 4MXXA 4MXOA 2GS2A 3DV3A 3GQIA 4D0WA 4YPSA 2E9PA 3R00A 1J1BA 4RFYA 4FSTA 3QD3A 4GCJA 5L2QA 2BROA 1VJYA 4FTTA 3T9IA 3GGFA 4NEUA 4PNIA 4F6SA 2DUVA 4JQ7A 2C5NA 5CALA 4HCUA 2H8HA 3Q6WA 5DT3A 4GT5A 1Q8TA 3D7TA 4G17A 3JXWA 3QD0A 4XUFA 3R7YA 3R30A 4EOPA 4QP7A 4DFLA 4AACA 5FTGA 2JIIA 5DYJA 2E9OA 3QTQA 4AAAA 5CNNA 2VGPA 5L6WL 2B55A 2HZIA 3NIEA 5E8TA 5J7HA 2X0GA 4V01A 1SYKA 1YXSA 2C6KA 3WE4A 3BYOA 4EZ3A 3H0YA 1XO2B 5IA3A 2HZNA 3MW1A 2YERA 3TKHA 3EMGA 4WNOA 4F08A 5FG8A 2PTKA 3TJCA 5EKNA 1TQIA 1MQ4A 4Q9ZA 2Y0AA 4TT7A 3ITZA 5EFQA 1GOLA 4ITHA 1X8BA 2BZKB 3PWDA 3HV4A 2UZEA 4H05A 4EOSA 1YW2A 2I0HA 2VO0A 2BPMA 1R0EA 4BTMA 4FA2A 4R7BA 3BLQA 3KVWA 5AP4A 2JEDA 3C5UA 4FVPA 5DRBA 5AV1A 3G51A 5AP1A 4I41A 2B9HA 4FKLA 2PE1A 4GG7A 4RJ8A 1PMVA 4CTCA 1XKKA 3FXZA 3PXKA 1KE8A 5J95A 4XMOA 2ZMDA 1ZRZA 3K54A 4L44A 5DT4A 4S2ZA 3UTOA 3Q4CA 1YWRA 3ET7A 2VTSA 4BCQA 5HVKA 5E4HA 3GCVA 3O8PA 1JVPP 3LAUA 3A7IA 1G8KA 2R3NA 2YCSA 2ITYA 2JC6A 4NM5A 2PULA 3P7CA 4KS8A 3V3VA 4I4FA 3SGCA 4IANA 3AXWA 1JNKA 2XIZA 4UN0C 3LE6A 4XYFA 5K5XA 4AA4A 1WZYA 4BF2A 2VX3A 3DK7A 5J1VA 3COMA 2DQ7X 2C1BA 3ORZA 4FKUA 3QQUA 2ESMA 5LWNA 5FEEA 3WILA 4O7RA 5H8BA 5DMZA 4BY9E 5IU2A 2RFSA 3QRIA 3EL8A 2EXMA 3LFQA 3GC0A 3WF5A 2G1TA 4FTLA 1WBNA 3BBWA 3Q4TA 4XRLA 3ZLXA 4PL5A 5DHJA 2YAKA 3KK9A 3UDZA 5KKRC 2WELA 3W18A 3W33A 2I7QA 5KNJA 2DYLA 3GUBA 4UALA 4ZMEA 2ZVAA 2P4IA 3VIDA 4YZDA 5IH4A 3RPRA 1YOJA 3H9FA 4XEYA 3RMFA 4XG4A 3WZDA 4JJRA 4EC8A 2R0UA 4C59A 1JKTA 4AQKA 1FGIA 3Q4UA 4HYIA 4XX9A 4A9UA 3RNYA 5HLWA 2WQBA 1OPLA 3FHRA 4CMUA 5EW3A 4AZEA 1B38A 4I4EA 3O7LB 3LXPA 4IWQA 3VS6A 5CANA 3ZRLA 3O23A 4TPTA 2XEYA 3UODA 3DA6A 4QMUA 1PYEA 4FF8A 5FEQA 2CDZA 5IA0A 3MB6A 4PWNA 2YJRA 4TWPA 4O0SA 5IUIA 5I0BA 1DAYA 4KNBA 5F95A 3IW4A 3R1QA 4C3PA 3DBFA 2X4FA 4G16A 3R02A 4NWMA 3GU7A 3SX9A 4JOAA 4DA5A 3F61A 3QCYA 2OWBA 2I40A 3Q04A 4WG4A 3TL8A 3OOGA 5HD7A 3IDPA 3HDMA 4EUUA 4ZS4A 4HYUA 3FI3A 2OF2A 4FZFB 4QRCA 1H1SA 4HPTE 4O7VA 3KULA 3AD4A 1UU3A 3L8XA 3U55A 3C4CA 3PLSA 3MVMA 3QTXA 2XKFA 3T3VA 3L8VA 4DDIA 4U79A 4R5SA 4XG3A 4EKKA 3BEGA 5FDPA 4WNKA 4J97A 3QX2A 4X2GA 4F64A 3HEGA 3OY1A