3BWJA

Complex of pka with the bisubstrate protein kinase inhibitor lead compound arc-1034
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
341
structure length
338
Chain Sequence
SEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of ARC-type inhibitor (ARC-1034) binding to protein kinase A catalytic subunit and rational design of bisubstrate analogue inhibitors of basophilic protein kinases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 104
structure length 338
sequence length 341
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bwjA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bwjA02
4OBQA 4O2PA 5FTOA 4E5AX 4EBVA 3LXPA 2XK8A 3PA4A 4JT3A 2WQMA 4LL0A 5JK3A 3V6RA 2GU8A 5HESA 4KBCA 4RLLA 1Q3DA 2XCKA 3LFFA 4YGAA 4AZSA 4DG2E 4IHPA 5L2IA 3E7OA 3KXXA 4GH2A 4E7WA 2R3OA 1OPJA 4AF3A 1NW1A 4Z55A 2HK5A 5FUTA 2AC5A 5E1SA 5H8BA 4ANQA 3G15A 3ZHPC 3VO3A 3T3VA 4LGGA 3Q9XA 1BKXA 4GFOA 4NT4A 2Y9QA 5E8SA 4Y73A 4BDIA 2ONLC 1VYZA 1OI9A 2PVJA 3FZ1A 4XV1A 5CEIA 3AC3A 2Y8OA 2JEDA 4FKSA 2GTMA 4GIIA 5HEZA 3RP9A 1TQIA 2WO6A 5HD7A 3VJNA 1VR2A 5IH4A 4D2VA 4X0MA 3QQLA 2OXXA 1H1SA 3EWHA 3KXNA 4FT7A 4CFVA 4BCGA 3EQIA 1Z5MA 2RL5A 3PVWA 4BKJA 3HA6A 4P4CA 4F7LA 1Q41A 2P33A 4QOXA 3R9DA 3HKOA 3FL5A 3NYNA 3ORTA 4PTEA 4XCUA 2QOFA 2OK1A 3QCYA 4XBRA 3RAKA 1OKVA 3G6HA 3UQGA 5EI2A 4YU2A 3U54A 2IVUA 5EYCA 4IWDA 1OB3A 3F2AA 3MH2A 5JFWA 1G5SA 2GHMA 4X2KA 3SD0A 2J0LA 1W8CA 4TW9A 3EQBA 4I3ZA 4GW8A 4R5YA 5AR5A 5FLFA 2BCJA 3UVRA 3NS9A 1MQBA 5DLSA 4M84A 2BZIB 5H3QA 1E1XA 3L9LA 4TKSA 2WNTA 5EM6A 1H4LA 4ZLZA 3N4TA 4D9UA 4Y72A 2R7IA 2B52A 5F1ZA 4FF8A 5HX8A 2ERKA 3QF9A 2IZSA 5GIPE 3AC8A 4ASZA 2ZV7A 3SXSA 4NIFA 1Q8YA 4FEUA 1YHVA 2VGPA 4AE9A 5DI1A 2BAKA 3N4VA 3O2MA 3V5TA 5JGBA 2I0YA 4DC2A 5D7VA 4BCPA 3LHJA 1ZZ2A 5KMKA 2XVDA 3FI3A 3O8PA 3PY1A 2JDSA 4AUAA 3PVBA 1Q5KA 4B0GA 2VWXA 1TKIA 3OT3A 2FB8A 4LOOA 4E4XA 2VO7A 5I9YA 4GT5A 1B39A 5M07A 5M56A 1P4FA 1U59A 2IW8A 4C62A 4F65A 4BCMA 5ANJA 4BDGA 2PMIA 5E8UA 3KMUA 3D2IA 4ERWA 4QTEA 4Q9SA 2Z02A 2PK9A 1M2RA 5BVOA 3DXQA 3QTZA 3DNEA 4NL0A 5HTBA 2XNMA 4C7TA 2VTRA 2NRUA 5LWNA 3FQSA 5LJJA 3CPBA 4TWCA 5EM5A 1GZKA 4WNOA 2W1HA 3E88A 3U6IA 1R78A 3HV4A 2YDJA 3ZM4A 4WOVA 4IFGA 4L8MA 2WMRA 1R0EA 3HEGA 3LJ0A 3OUKA 4I92A 3RK5A 3TNWA 5AJQA 1PHKA 3Q4CA 3R7UA 3SGCA 2VTHA 4G5PA 1KE6A 5D41A 3RJCA 1YDTE 3S4QA 4UYAA 4FEVA 2QOQA 1SM2A 3C4ZA 4G3DA 4FT3A 4PRJA 1UNGA 4GVAA 4QMWA 1H0WA 2A27A 3GOPA 4BR3A 3ZLXA 4A9TA 2C5OA 3WZUA 5IQAA 5BVEA 1CDKA 3TZ7A 5K0XA 3BV2A 3F7WA 3COIA 2R3MA 4JBPA 4XYFA 5T3QA 5CSWA 2P3GX 4KIKA 5B7VA 5LVOA 3FSKA 3E8CA 3DB8A 5AV1A 3QTRA 3QZFA 5ANKA 4YO6A 2WOTA 2Y7JA 3BI6A 2YAAA 3T9TA 3V04A 2JLDA 1WBNA 2C6KA 3F3WA 5G1XA 2F7ZE 3UO4A 4QP8A 2OO8X 4HPTE 5I3OA 3SG9A 3S00A 3MVMA 4CTBA 3RNYA 3D4QA 4RJ7A 4K9YA 2R5TA 3CBLA 1PMUA 2GS6A 3O50A 3FMNA 5HICA 3ZXTA 1GOLA 2YLEA 3CC6A 5EOBA 1JOWB 4D1XA 4DN5A 2QOKA 3VWAA 3VUHA 3ROYA 2PYWA 2YDIA 3R1QA 4O86A 4UXQA 3VHKA 1YDSE 3NUPA 4CRLA 3GC0A 5C1QB 3KRXA 3FXXA 1PXIA 3PXFA 4IM0A 5CNNA 4AFEA 3MPTA 5LCJA 2BFYA 2GS7A 2ZV8A 1OL1A 4CFUA 3ZO1A 2XKCA 4FTRA 4NEUA 3FMEA 4PTGA 3BEGA 3QLGA 1Z9XA 1L3RE 5TR6A 3VN9A 3ZFXA 5JN2A 4CMOA 4JVGA 2I40A 5CX9A 3DK6A 2F7EE 5JT2A 5AP6A 3QBNA 3W8QA 1J7UA 4LYNA 2A0CX 1J91A 3ZLWA 2PVRA 3BYSA 2WGJA 3Q4TA 1V0BA 4I5PA 3IDCA 5EH0A 3UODA 4B8LA 5KMJA 3NIEA 3P23A 5IA3A 4XBUA 2BMCA 1ZXEA 4BZOA 4ZY5A 2ZM4A 5LCKA 5JFSA 3VJOA 4WNKA 2VTPA 3DFAA 2UW5A 4U44A 4I6BA 3LM5A 2IZUA 4MBLA 5EW8A 1T46A 3NNVA 3C51A 4JG8A 1KE9A 3U6JA 3IW5A 4C02A 3MJ1A 4L01A 4L00A 2HELA 3K3JA 1YWNA 1KSWA 2UZEA 1GAGA 1H25A 3MFRA 4OTHA 1Q3WA 5CU3A 2P4IA 1R1WA 3MTFA 3P9JA 3AC2A 4RZWA 4YHFA 5E8TA 4KIQA 3TJDA 4YBJA 4Q5EA 5HG7A 2DS1A 3VS0A 4X2NA 4N6ZA 5GNKA 4E8AA 4YMJA 5AP0A 3FZOA 4FV3A 5KHWA 3NYOA 1XHAA 3KN6A 2FH9A 4X2JA 3HRCA 2XS0A 3LJ1A 2QU6A 3C1XA 5C03A 3L8XA 3MTLA 2HZNA 4NTSA 3EYGA 4WRGA 5DR9A 3QHRA 2ZDUA 1PXMA 5KX8A 3TM0A 3JS2A 3UQCA 4USFA 3ZMMA 2YN8A 3NUAA 3EN4A 3KC3A 4LM5A 2WMTA 5DN3A 3EQRA 4UMTA 2W1CA 3MY1A 5KKRB 5I3RA 1JBPE 3I0OA 3RZFA 4QP9A 1T45A 5DYJA 2G2IA 3VBTA 5A4TA 2OLCA 4LUEA 5BYZA 4AACA 1WAKA 2JKMA 2OJIA 4U79A 4JDJA 4AZWA 3ACKA 4EKKA 1O6YA 5HO6A 5E90A 4BDHA 4NYEA 4ZTLA 3W2PA 4U3ZA 4BHZA 4MBIA 2E9OA 4CCUA 4IC7A 2SRCA 4KA3A 4F0IA 4WHZA 2NNWB 3UC4A 3F3ZA 5KHXA 4YNOA 3OZ6A 3PPJA 1XBBA 2J4ZA 3DU8A 4OTRA 5K4JA 3AGMA 4HVGA 4C2WA 2ITTA 3ZDIA 3D15A 1AD5A 3LMGA 3W2QA 2JD5A 2JKOA 3KFAA 2Y6OA 4CQEA 1ZLTA 1LEZA 3OCTA 4YC6A 3HRFA 4AGDA 3OTVA 4RWLA 4O6EA 4AOIA 4Z3VA 2VNWA 2WMAA 3KU2A 4CV9A 3OTUA 4QYFA 4M66A 3ORMA 2C1BA 4U40A 2ETMA 4ZLOA 2C1AA 4BGGA 1Q61A 3QXPA 3G51A 3WI6A 4O7RA 3NMUF 3AG9A 4F6SA 4UMPA 4JDKA 3F3VA 3FMDA 4MVFA 4EWHA 4DTKA 3BE2A 1OKWA 4EOIA 2GFSA 5LVPA 1GIJA 3A4OX 4O6LA 2ETRA 1FVVA 2WD1A 5DVRA 4E93A 5LXMA 2EXCX 3E3BX 3Q4ZA 4HCVA 4UB7A 3ATTA 1LEWA 1WZYA 4IB5A 4RVLA 4F08A 3MV5A 2QONA 3Q5IA 4ZOGA 2YJRA 3R01A 2XK9A 5LQFA 2WTKC 3HMIA 3GU6A 3NIZA 4YC3A 4BYIA 3ZSIA 3F61A 3DY7A 3UBDA 3FY0A 4UMRA 2W5BA 3SHEA 3W1FA 5HNIX 3RM6A 3L9NA 3EL7A 5FEQA 4XOYA 1Q97A 4QMPA 1DM2A 3OXZA 1PW2A 4BTKA 4CLJA 5HZNA 5CYIA 5M4CA 2B9FA 4E3CA 5IEVA 5M51A 2W0JA 1O6LA 4KD1A 4FNYA 4MH7A 2J2IB 1LUFA 4OTIA 3L9MA 4H3BA 4JJRA 2C6TA 4Z9LA 2IN6A 2J0IA 1G8AA 1P4OA 3D94A 4FKIA 1MQ4A 2XBAA 2JAMA 3B8QA 4C3PA 3ZZWA 3R04A 3GXLA 5M06A 4IXPA 2PVFA 2AC3A 5DA3A 5DT3A 4RWIA 4UWBA 4FSUA 4AW1A 3Q32A 4GVJA 4IJPA 1Y6BA 2A2AA 3QC9A 4OW8A 4QQ5A 5C9CA 3RAWA 2WMSA 3RKBA 4CFMA 2JIVA 5C8KA 4NH1A 3OW3A 2O8YA 3H0ZA 4HYHA 4CMTA 2YDKA 2W1FA 5FWKK 5HD4A 2I0EA 2VO3A 3QD2B 2VX0A 4IAIA 3MSSA 5DT4A 2H96A 1FGKA 3Q9ZA 2XKFA 4IMYA 1JKKA 2W96B 3LFDA 4PQNA 4MWIA 3C5UA 5IQBA 3TCPA 2VN9A 3HV7A 3R9NA 2NO3A 3A7GA 3LFQA 3PPZA 4J1RA 4PUZA 5E8XA 1DAWA 2Q83A 5LVLA 3F82A 3ZH8A 2VTTA 4R5SA 1LP4A 5C4KA 4NFMA 4FG7A 4HGTA 4A9UA 5L2SA 3PJ3A 4BRXA 2PVLA 3ZRLA 1G8SA 5EG3A 4ENYA 4GK4A 2O0UA 4QNYA 4FGRA 4Y5QA 4QP4A 2BRHA 2OKRA 2BFXA 2C6MA 3ZUUA 2CGVA 3ZZEA 3Q4UA 5HCZA 2YIYA 3OP5A 1WBVA 2PSQA 3ROCA 4UX9A 1PRYA 5KNJA 3FKNA 3RCJA 1DI9A 3BWFA 4EHZA 3A99A 3VAPA 4CV8A 5HG5A 4S32A 4NW6A 4AT3A 4H1JA 5CQWA 2UW6A 4EQCA 3ZXZA 3H0YA 3QKLA 4RPVA 3BQCA 4J98A 2WB8A 4E26A 4DEBA 4L53A 3RNIA 3DQXA 3F6XA 4D0XA 2HWOA 3ZEPA 5A6NA 5I9WA 3PWYA 4MXCA 2HZ0A 2OWBA 2ZAZA 4KKHA 4JBVA 3S2PA 1A06A 2HCKA 4G2FA 2GFCA 4O27B 3VBXA 5A54A 4APPA 5ANOA 1YWRA 3HDMA 3ZLYA 1BYGA 2QODA 4QMMA 4ARKA 2WMVA 4FICA 4HZSA 2XUUA 3TV4A 5CSVA 4FKUA 1WBTA 2EUFB 2F4JA 2X2LA 4R78A 4QT1A 4KUJA 3NYXA 2IVTA 3KXMA 4IM3A 4FSQA 4ITHA 2PL0A 4CSVA 4ANBA 2IVVA 3OOMA 3QD4A 2PZYA 4NZWB 1P5EA 1LPUA 5AP5A 2F57A 2OW3A 2CNQA 3FMMA 5CAVA 1ZYSA 4XG3A 4FK3A 1EH4A 4RGJA 1TQMA 1J1BA 5GZ9A 4JS8A 3MVJA 4TNBA 3VNTA 4K33A 1JKSA 3F69A 4IW0A 5FG8A 4IZAA 3F5UA 3MW1A 4ANOA 5ANIA 1OMWA 4BL1A 4ANMA 4IIRA 3EQPA 4LMUA 4EWQA 1Q24A 1Y8YA 4QYGA 3NWWA 2WU7A 3TV7A 3UDBA 4UN0C 2VTQA 4G17A 2CPKE 4RWJA 4V01A 2QLQA 1PYEA 3LOKA 3PXRA 2B53A 3PJCA 1SYKA 3FZRA 4HPUE 1YI4A 1YOMA 3VS6A 2UW9A 3MFTA 2X7GA 4C0TA 5KMIA 3SW4A 4IACA 3RCDA 3OROA 2KULA 3JVSA 3OOGA 3P7BA 4DFNA 4ZK5A 3CQWA 5LWMA 4FOCA 2PY3A 2CLQA 5IQCA 3NAYA 4N6YA 2HXLA 3RK7A 2WTWA 3LLAA 2XCHA 3CY3A 3ZOSA 3GCVA 1OIQA 1IG1A 1VYWA 2PVNA 4G3CA 4QP1A 3E87A 4YHJA 3P4KA 1QL6A 1XH4A 3A7JA 3W8LA 4FYOA 4QQCA 4O81A 3PY0A 4F0GA 3NUYA 2HY81 3QKMA 4KNBA 4W4XA 2O63A 4U42A 3PYYA 3DKGA 5FDPA 4TYHA 2YA9A 3T8OA 4L7FA 4ZAUA 3Q6WA 4QRCA 3R6XA 4TN6A 5IEXA 3AD5A 4A06A 2Z7QA 4YTIA 3SX9A 3E3PA 3KCFA 3JY9A 1QPCA 2C3IB 5L8LA 4YZ9A 4C3FA 4QMXA 3FPMA 2PVHA 5FRIA 5ANDA 5J1VA 4ZEGA 1BMKA 3QTWA 3M42A 4ONAA 3FMHA 3PA3A 5L8JA 4ACGA 1YHWA 2XEZA 3OD6X 5DG5A 4J8MA 4AW2A 2R3NA 1OM1A 2PZRA 2BZHB 2GSFA 4D5HA 5D7AA 4NJ3A 4K1BA 5B0XA 3UMXA 4A9SA 2BIKB 3LMIA 2WMQA 1U5RA 5TKDA 3O23A 1W82A 4YLLA 3FL4A 4AE6A 2WHBA 3UNKA 4FKTA 3OCGA 4J7BA 3F5XA 4E4MA 4XUFA 1KV2A 1UWHA 4KIPA 4XG9A 3NLBA 3AGLA 5FXQA 5D10A 3R8MA 2BRBA 5DFPA 4XNEA 2QVSE 3UOHA 1UNHA 3CSVA 3FLQA 5GIOE 1JWHA 1AQ1A 3I0QA 4FX3A 4HYSA 3FI4A 3ALOA 4FVPA 4O0SA 3C0IA 4RC2A 3R02A 4UALA 3TNPC 3ZS5A 4ZLYA 4FZ6A 5CI7A 4QP3A 3MVHA 5AUUA 4X3FA 3RHXA 2DWBA 4Z7HA 2EB2A 1H1PA 1OGUA 4R6VA 3PVGA 4ALUA 3LQ8A 4FUXA 4R8QA 2IO6A 4HGEA 4MXAA 4B8MA 4PMTA 1WVWA 2A19B 2ITWA 2GDOA 2W5AA 3G33A 3RPSA 3ZSHA 2VWVA 3WF6A 2HWPA 4GUBA 2YIWA 4FIIA 4I5MA 4KS8A 4M3QA 4XLIA 4AZTA 3DXNA 5BUJA 3Q53A 1UU9A 3Q96A 2ITQA 5DEYA 4IB0A 5DR6A 3VS7A 2I1MA 3FAAA 5EM8A 3I7CA 3FQEA 5FP5A 4YZBA 3ZO4A 2PMLX 4FKRA 3UG2A 1OITA 2Y4IC 4FV2A 5IH6A 3VW6A 4DBXA 2PZIA 3DLZA 4WA9A 4YJSA 1OIYA 2XK6A 4NM5A 4XP0A 4EOPA 2W1ZA 4J53A 2X6DA 3BHHA 3BU5A 4S33A 4WT6A 3O71A 5E92A 3FSFA 5LVNA 5J95A 2X8IA 2B7AA 4EH2A 3HZTA 5AUZA 5DGZA 4PPBA 4IZ7A 3CE3A 3PUPA 2C0IA 2XH5A 4I0SA 4I1ZA 1OPLA 4EOMA 4UEUA 4BDDA 2B9IA 4BCKA 3GCQA 2FSOX 3QA8A 4FSZA 2UVXA 2CCHA 3CXWA 4OTWA 4QMYA 2R3JA 1KOBA 4U3YA 5DHJA 2E9PA 2C4GA 5I9VA 3WARA 3CD3A 3PE2A 4NU1A 4UV0A 2PHKA 3QXOA 4IADA 4RFYA 1MP8A 4BTFA 5J5SA 2J0KA 4YTHA 4EOSA 3WZKA 5EHOA 1PMNA 4OBPA 3ZYAA 3QD3A 3QCXA 3QTXA 4EK8A 3LE6A 3UMWA 4WSQA 4IE9A 3MFUA 3R8LA 1CKIA 3VIDA 5AA9A 3PSCA 1JSUA 3R8UA 1RW8A 2BAJA 4KSQA 1SVGA 1ERKA 3RMFA 2VWIA 4QMVA 2UW8A 3UP2A 3F5GA 3CLYA 2CMWA 3BIZA 3G0FA 5IUGA 2GQSA 1GIIA 3NSZA 4LRMA 3R2BA 4GSBA 1I09A 4ACMA 4CQGA 5JRSA 1XO2B 4D5KA 4IVCA 5I9XA 3FKOA 3WZEA 4FZFB 3TNQB 4JQ7A 5HKMA 4EONA 2IG7A 3CIKA 4FOBA 4AS0A 4E6QA 4ID7A 4HW7A 3ZUVA 4EZ5A 4IB3A 5IDNA 3DAEA 3VHEA 3LCTA 1SNUA 5EHLA 4ZJVA 1RJBA 3HUCA 4JIAA 3TV6A 2F2CB 4I41A 4AGCA 3ZM9A 3BLRA 5AIKA 2V62A 3G2FA 4X3FC 4GKHA 3BU3A 5CEOA 4CLIA 4IDVA 1PXKA 1XH7A 2GNIA 1PXJA 2KTYA 3DZOA 5D9HA 1NY3A 5I9UA 2W4OA 3KN5A 3UO6A 4TYIA 3R7EA 3LQ5A 4ALVA 3QYZA 5FD2A 5CANA 3A7IA 5BVKA 3HV3A 3UOLA 3W33A 3KXGA 4JRNA 1FPUA 2QO2A 3ORZA 5KZ0A 3CR0A 4II5A 3DFCB 5HVJA 4AT5A 4HOKA 4YPDA 3CJGA 4FSNA 5EKOA 4YO4A 4CKIA 3PJ8A 4QMZA 3F88A 3R9RA 3UVPA 4XG2A 3I60A 1ZYDA 4BDEA 2YM4A 3HX4A 3D5XA 4DGOA 1YOJA 2RFEA 3U87A 4CRSA 5FTGA 4O83A 4ZS4A 4C8BA 3FQHA 4FV8A 4PPCA 4D2WA 3QWJA 4FV6A 3C0HA 3VUGA 4IVDA 3O8UA 3BZ3A 4IAAA 2OXDA 1OPKA 2VTAA 4PP9A 2DUVA 5EOLA 5HQ0A 4RIOA 3HV6A 3QRUA 1NT2A 3EQHA 4J99A 4D2RA 3QQFA 2B54A 5BYYA 2RFNA 5M4UA 4LMNA 3NYVA 4FIJA 3H30A 4V0GA 4QPAA 4R77A 5CF8A 4IX3A 4YLJA 3E63A 2ZVAA 1YWVA 2V5QA 2C6DA 1BI8A 3EQCA 2YIXA 1K2PA 3HA8A 4C36A 4EK6A 4L42A 4BCJA 3BWJA 3ZCLA 3HUBA 4CMUA 4XX9A 4USEA 4AA4A 4EH8A 4BCQA 3LXLA 3OEFX 3FI2A 2WMXA 1P2AA 5J9LA 2X81A 4W9XA 4ACHA 3RTPA 3V5WA 4BCFA 4YSJA 5ETCA 4AW0A 3HDNA 3PSDA 4BIBA 4XV9A 2OJFE 3KF4A 4UXLA 1ZMVA 1SVHA 2HW6A 4NUSA 3RGFA 1QPEA 4MF0A 1H28A 3M11A 3FEGA 3VBQA 1FMOE 3GI3A 4GRBA 3LFBA 5IZFA 3GU7A 1PXPA 2WTJA 2R4BA 5CLPA 5E8WA 1RQQA 1WBSA 2HENA 3A60A 3TG1A 3R73A 4X7QA 3L1SA 2G2FA 3MGYA 3VRYA 4IH8A 1M7QA 2HXQA 2XIRA 4V0GB 4ENXA 1H01A 4BICA 3AD4A 3CY2A 5JGDA 3TUBA 3OEZA 2X0GA 4C4JA 5ITAA 3V8SA 2X7FA 2ZB0A 3NUNA 2X6EA 5HTIA 2E9NA 5CU2A 4CFFA 4KS7A 5ACKA 3UVQA 5BNJA 1OUKA 1Q8UA 3A62A 4DEGA 5JSMA 3MFSA 3HMPA 3EKNA 3RAIA 4PL5A 1GZOA 1IA8A 2GNLA 1KUTA 5D1JA 3RWPA 5AP1A 4YJRA 1FVRA 2UUEA 2F2UA 3SOCA 5IH5A 4D2SA 1IASA 2VU3A 4K77A 4TZRA 3Q2JA 4ZSLA 5JKGA 1Q62A 4M97A 5EDRA 3LFSA 4Y8DA 2YM7A 3PRIA 4BDJA 3E8DA 2GCDA 4E6DA 4W8DA 4QPMA 3RINA 1W0XC 3ORPA 3TKUA 4GV1A 4FV0A 4ZSGA 5B2LA 1UKIA 3BHTA 5CNOA 2HYYA 4PX6A 2WEVA 4RX8A 5E8ZA 4K11A 3V5LA 2G01A 4GYGA 4YPSA 1K3AA 3SVVA 3ZONA 3GU8A 5AR7A 4C57A 1H07A 3GBZA 4MWHA 2GHGA 4H36A 3UIUA 3AD6A 3BBTB 3VRZA 2IJMA 4DGNA 2BIYA 4BWPA 4DEIA 4LI5A 5FQDC 5ACBC 4DE4A 4AQCA 4BZDA 3P79A 4G3GA 3OT8A 2ZM3A 1IAHA 4RQVA 4DH1A 3U6HA 4JRVA 2WIPA 2X9EA 2GNHA 4RLKA 3DCVA 4HZRA 3LCKA 4JIKA 4QMSA 2H8HA 5DRDA 2E9UA 2XK7A 4B6LA 4F6UA 3HP5A 3RPRA 1FVTA 3U4WA 4H05A 2X4FA 5I4NA 2EB3A 2PULA 3FXWA 1IAJA 3F3UA 4HYUA 4YNEA 1JAMA 2NP8A 3TTIA 4BN1A 2BRMA 3BBWA 4V04A 2BR1A 3I4BA 4DFLA 4RMZA 2R3HA 4BTJA 3OWPA 1CKPA 4M67A 4CG8A 1HCKA 2JIUA 2BPMA 2WXVA 4JR3A 2CCIA 5FBNC 3GCSA 4XRLA 4FZDB 4FTCA 3UOJA 4PDPA 1JVPP 4ORKA 3ENMA 3KQ7A 3FPQA 3KK9A 5HHWA 2XK4A 2CN5A 4XS2A 3NUSA 2B0QA 2YZAA 3QZGA 2XNNA 3R8VA 4RVMA 2WPAA 1KV1A 5CALA 5ETFA 4OR5A 1SZMA 2YLFA 4IVBA 3PIZA 2J51A 3FC2A 3LFCA 4MHAA 3MA3A 1BLXA 4F1MA 2B4SB 4UWYA 3MA6A 1TVOA 2YWPA 4EC8A 5IUHA 5EHYA 5IISA 4C37A 3K5VA 4LQMA 3TNIA 5IQGA 2FYSA 1YKRA 1R39A 4FSMA 4RIWB 3TDVA 4MXYA 1ZY4A 1PXLA 3SLSA 4BGQA 4FEQA 2WKMA 2OFVA 1XH9A 3WIKA 2CGWA 2QO9A 1OL7A 2X1NA 4IWQA 1IR3A 4G6NA 3TZ8A 4EJ7A 3BEAA 4PDOA 3OWLA 3FLSA 4LUDA 4YLKA 4CZTA 4FNZA 4EH4A 4EZ3A 5EQYA 2XRWA 2XRUA 4C58A 5E4HA 1BI7A 2AYPA 3BRBA 4KBKA 2CKOA 3K3IA 1GNGA 4TWNA 1WBOA 3BQRA 1R0PA 2NRYA 3RPVA 4IEBA 3PY3A 4DCAA 2EVAA 4KWPA 5KUPA 5IQIA 1PYXA 5AR2A 5J79A 1O9UA 2C6IA 3OBJA 3MN3A 1K9AA 4DGGA 3VW8A 3ZFMA 1FMKA 3VBYA 3WILA 4GFMA 4P2KA 2GNFA 2W1DA 4FC0A 4QYEA 2C5YA 5L2TA 4FUYA 4EHEA 3G9NA 3LM0A 3NX8A 4MXXA 4G1WA 1ZZLA 2IW9A 3QKKA 4UWCA 3NZ0A 4IJ9A 4FE2A 3IW6A 2CKQA 3VS2A 4XG7A 5HVKA 2XB7A 4APCA 3JY0A 3H10A 1ZARA 4UMQA 4CNHA 3GVUA 4HVHA 3RALA 4F9CA 5EYDA 3DB6A 4D1SA 4NM0A 1S9IA 5AAGA 2VO0A 3W16A 4FGBA 5EYMA 4BWXA 2YCSA 3C9WA 5BVFA 3UIMA 3G0EA 4D4SA 4U6RA 2VRXA 5BQ0A 2AUHA 3VBVA 3DGKA 1X8BA 3PFQA 3A8XA 4RA5A 5CQUA 1PMEA 5ANEA 4ZZMA 2RFSA 2QO7A 3EFLA 3IK3A 4B99A 4ZTSA 4D55A 4GEOA 5ICPA 3EN7A 3ACJA 3TZMA 4YZNA 4E1ZA 1BX6A 2YITA 2J0JA 4YJTA 5KMMA 3COHA 5HVYA 2R0UA 4C33A 4FMQA 3KRJA 4EK3A 3PZHA 4FSRA 3UPZA 2BALA 4M69B 4BC6A 3CEKA 4IDTA 1GZ8A 3GFEA 5IA5A 1VJYA 5AP2A 1H08A 2GPHA 2UZDA 1QPJA 3CTHA 3DTCA 4I0TA 3B2WA 3WBLA 4UMUA 3FI8A 1Q99A 5HBEA 3HV5A 3MY5A 4WIHA 4E5WA 2O3PA 2PMOX 4LGHA 4EOLA 3V3VA 1E9HA 3BLHA 1B38A 4R7IA 4K6ZA 5HE1A 4AG8A 4EQMA 4F9BA 5KKRC 3PG3A 2YISA 3ZUTA 2R9SA 3BYVA 3MJ2A 2UV2A 1IRKA 3FYJX 4TY1A 4FKGA 4JG7A 2JFLA 3EL8A 3OUNB 5AV4A 4ZSEA 3AT3A 4C3RA 3PXQA 3IGGA 4O0YA 3LW0A 1XR1A 4S2ZA 3P86A 3HECA 4QYHA 3KXHA 2J9MA 5EDQA 5AEPA 1HCLA 2YCRA 4PV0A 4CG9A 4JAJA 5CEKA 5T6KA 3DJ5A 3FLWA 3IDPA 3A7FA 5CT0A 3RBWA 4F63A 3FMJA 3AC5A 5EYKA 3R8PA 1H27A 4ZS0A 2GS2A 2G9XA 3ORNA 3H9FA 3PTGA 5HGIA 4BZNA 4F7JA 3WF7A 1OVEA 2G15A 2VD5A 1ZMUA 1U5QA 3BGZA 4PL3A 4QD6A 3RAHA 4O7YA 2FSMX 5J9YA 2CGUA 3UNZA 3EHAA 5HE0A 1E1VA 4AWIA 3EN6A 2ZMCA 5EFQA 1ZOHA 3C4EA 5HO7A 1AGWA 4RC3A 5HBHA 3R30A 3POOA 4C4GA 4DFYA 1ZYLA 3Q3BA 2XIXA 3QQGA 4FTIA 2C0TA 1YXUA 2LAVA 1H26A 2W5HA 4NFNA 2UW4A 1J1CA 3O7LD 3SRVB 5HX6A 5IG1A 4PL4A 2Q0NA 3HAVA 5CF6A 1M52A 5HU9A 3SG8A 1URWA 1PJKA 4IX6A 3E7VA 2YEXA 5DIAA 2J7TA 3QALE 4G9CA 3TKHA 1FBNA 4I94A 2RKUA 2C6OA 3HNGA 5TO8A 4UY9A 1UV5A 5M44A 3KVWA 2JITA 2I7QA 3QUPA 1XKKA 1PXOA 4NSTA 4RX7A 3MPMA 4GK3A 5CF5A 5HNGA 3QD0A 4DA5A 4U97A 2OZAB 2XP2A 4CCBA 1H8FA 2QKRA 2R2PA 3PA5A 4FKLA 4P90A 4AX8A 3FZTA 3RWQA 4J52A 3FMKA 1ZOGA 3PXYA 3GU5A 4OTDA 1V1KA 3R0TA 4UZDA 2R3FA 5M55A 3R7IA 4BCNA 4N70A 5IQFA 3EJ1A 5AWMA 3BX5A 2VTSA 2GNJA 4WG5A 3ZEWA 2UW0A 4RQKA 2PUNA 4BCHA 4RIXB 3KREA 2PUPA 4J96A 4AU8A 4PTCA 3UIBA 3UTOA 3DV3A 5L6OA 2HZ4A 3IGOA 2QOCA 5FP6A 4EC9A 4MCVA 4ZZNA 4QTAA 2I0HA 3CKXA 2UZWE 1ZOEA 4YSMA 4I4EA 3P0MA 2VUWA 4C4FA 4PPAA 4OAVB 4ZTHA 1QPDA 3TEIA 5FM3A 2OIBA 2BHHA 4DG0E 4Q2AA 5J9ZA 2UZLA 3CD8A 1FGIA 1BUHA 4AP7A 1ZAOA 4RJ5A 5GJGA 3TJCA 4WD5A 4GJ3A 4EUTA 5GINE 2ZB1A 3L8VA 4DFUA 5M53A 3D7TA 4ERKA 4U0IA 4BDKA 4ZTRA 2UW3A 3EB0A 4MEDA 1STCE 2WAJA 3R7GA 4CFXA 1H00A 4CD0A 1UU8A 2GTNA 5M57A 2RG6A 3D0EA 5TT7A 1J7LA 3SOAA 2QR8A 2Z8CA 4G3EA 4L44A 2P2HA 2OIQA 4U7ZA 4BDCA 4GKIA 3QX4A 4FKWA 1KWPA 3R00A 5ETAA 3VF9A 2OJ9A 3ZBXA 4BIEA 4O22A 1V0OA 5H9BA 1YQJA 3I5NA 3SQQA 3KGAA 2PWLA 3DLSA 4UYNA 2HW7A 2VTMA 4FZAB 4MNFA 5FEEA 2HOGA 3W2CA 4DEDA 4JG6A 2C5NA 2JDRA 2VO6A 2PTKA 3M2WA 5CASA 3QCQA 3DKCA 2RSVA 4EH5A 2VWZA 3G90X 3KF7A 3QZIA 4HGSA 3BCEA 3JXWA 3HLLA 4R1YA 5CY3A 4EI4A 3E64A 3KRWA 3AC1A 4BI1A 2JDVA 3LJ2A 3R22A 4O0XA 3WYXA 3K54A 4DGLC 4F1OA 1MUOA 4GT3A 5CSXA 4I22A 3PE1A 5CWZA 5AIRA 5AUYA 3ITZA 2W7XA 2W1IA 5J8IA 2JGZA 5JQ5A 4R3RA 4FTKA 3D7TB 4K8AA 2VTIA 4QO9A 4ZP5A 5IPJA 4BYJA 2J0MB 3GCUA 2WZJA 4I5HA 4QNAA 4YP8A 5A4QA 3LPBA 2QQ7A 2BHEA 4ZJIA 3UJGA 4ZXTA 5LOHA 2BKKA 4RSSA 3C50A 3UOKA 3BYOA 2OG8A 5M09A 4C4IA 2XIZA 4OT6A 2Z7SA 4AN2A 3N51A 1UWJA 4G9RA 2V0DA 4MXOA 3R9OA 5JEBA 2OJJA 3FKLA 3QQJA 4CVAA 4M0ZA 5DRBA 3AT4A 2OIDA 3Q2MA 4M15A 5HG9A 2WMWA 5DH3A 5E1EA 4FR4A 3TUDA 3ERKA 3CTQA 2QHNA 2YM3A 3GB2A 4CYIA 4F4PA 3DA6A 2P2IA 2GQRA 2JKQA 4Y85A 3D7ZA 3NVKI 4XP3A 4I93A 4BGHA 3DBCA 4EYJA 5KBQA 3N9XA 2Q0BA 3QFVA 4C4EA 4H58A 5A4CA 2XYNA 2RG5A 5F20A 3KXZA 5K3YA 3QQKA 3R1YA 1ZMWA 2ITXA 3CJFA 3UG1A 3FZSA 2J50A 3MIYA 3ORLA 3TKIA 4JX3A 4C34A 4DFZE 3OW4A 4F99A 5DE2A 3NR9A 4W4VA 4JR7A 3UNJA 4DH5A 4Y95A 3TACA 5C8NA 4XRJA 1OBDA 4IWOA 1IEPA 2WFYA 5HU3A 2XIYA 4QTBA 5FGKA 4LG4A 4QMLA 2YCFA 4O7TA 4FVQA 2QC6A 3BHVA 3IS5A 1Y57A 4F6WA 5LVMA 1CMKE 2PUUA 2W4KA 5EM7A 4NTTA 3WF9A 4A9RA 2WELA 3DDPA 3QTIA 4HVSA 4GJ2A 2WTDA 5HOAA 1YHSA 3VUDA 4E73A 3QUDA 4TYGA 1V0PA 3QRIA 5CENA 3ZC5A 1HOWA 4AOTA 2HIWA 5AUWA 3DBQA 4K2RA 5JQ8A 5CS6A 3VVHA 2YFXA 3FXZA 3N4UA 3TXOA 3AMBA 1LR4A 1UVRA 3FZPA 3QTUA 4QPSA 3TNHA 4XV2A 3OY3A 3OF0A 4F0FA 4OBOA 3OWKA 3IECA 4YC8A 4IZYA 2CN8A 4HCUA 5HO8A 3M1SA 4XG6A 3ANRA 4E6AA 5KMNA 2CHLA 3CKWA 2HY0A 3KEXA 2GQGA 4IWPA 4CT2A 4EH9A 3G9LX 3KULA 3BGQA 5KBRA 4JBQA 3BYUA 4LRJA 2BKZA 3S0OA 5C4LA 2BDFA 1ZYJA 2BDWA 2UZUE 3AQVA 4O21A 4KRCA 5KCVA 2RGPA 1YI3A 3ALNA 3MESA 4PNKA 4LFIA 3UGCA 4AGWA 4FIFA 4N0SA 1MRUA 4CZUA 4CTCA 2X8DA 5TE0A 3SKCA 5AMNA 3VS4A 4AW5A 5DPVA 5HIBA 5IU2A 3F2RA 2OJGA 4IX4A 4RG0A 3NPCA 3OS3A 3ET7A 2V55A 4FTMA 2WU6A 4X2GA 5AR4A 5AM6A 5IMEA 4XOZA 2ZOQA 3D2KA 4GU9A 4HNFA 2ZV2A 3EZRA 2PVKA 3OVVA 2XNPA 2O65A 1FQ1B 3GOKA 4XV3A 4E4NA 3F9NA 3QLFA 3S95A 4QMQA 1DAYA 3LXNA 2ONLA 3S1HA 3GT8A 4GL9A 2VX3A 5CTPA 4E6CA 1OIUA 5L4QA 3ZO2A 2WOUA 2R7BA 4L46A 4TRLA 3CS9A 4RX5A 5JZJA 4C61A 4X21A 4O7SA 2W4JA 5AX9A 3I81A 2C3LA 4FKJA 5G6VA 4JOAA 3KULB 4HYIA 4D4RA 4YJQA 3ZO3A 4Y83A 3R7OA 3HMNA 3PJ1A 4MQ2A 4OT5A 2PPQA 3FUPA 4DYMA 2OZOA 3BE9A 4RFMA 5AP4A 4DHFA 4J8NA 2R0IA 3LMHA 2HZIA 1OL6A 3NGAA 4RRVA 3KMMA 4JI9A 3GC7A 5GHVA 3ANQA 3PP1A 2OH0E 3WZJA 3O0GA 4B4LA 4U45A 1H0VA 3OC1A 4FODA 4PDSA 3E62A 3QC4A 4F1TA 4AA0A 4OTGA 3FC1X 4AN9A 4YBKA 3HMOA 2BRGA 2UW7A 4TL0A 2IVSA 3NNWA 1F5QA 3AOXA 3L8SA 3B2TA 4O7LA 4D1ZA 3NCGA 5AR8A 4ZTNA 4A07A 5CSHA 2UZBA 3F5PA 4RT7A 4FTJA 3IONA 2X39A 3QWKA 5JGAA 5CVGA 2WEIA 4M0YA 4PP7A 3LXKA 1BL6A 5AA8A 3BV3A 2VTNA 2XEYA 4FTAA 2C3KA 3TL8A 4I6HA 3PSBA 5IQHA 3A7HA 1ZRZA 2FO0A 2JDOA 2VNYA 4JXFA 2CKPA 4HVIA 3NW6A 1ATPE 5EQPA 3CQEA 2A1AB 5HLWA 3EFJA 3O8TA 4ASEA 4EORA 5ETIA 3TTJA 2XM9A 4F9WA 4YTFA 4FKVA 3UP7A 4YTCA 3EYHA 1YXXA 1JLUE 2O5KA 3GC8A 2WMBA 3I1AA 4KSPA 5GJDA 5TOZA 5CEPA 4BBFA 3JPVA 4EK5A 4RC4A 5HBJA 3MH0A 1A48A 2BDJA 3C4WA 3EH9A 3CTJA 4PDYA 3BELA 3VQUA 4DBNA 1I44A 3EOCA 3QTSA 3WE8A 4EJNA 4U80A 2YABA 2W9FB 1U54A 3PG1A 3VUTA 5IA2A 2VWBA 4Z7GA 1TQPA 3G5DA 4L9IA 4NKSA 1JNKA 3C4FA 3MDYA 1NA7A 3P5KA 5HCXA 4BI2A 1ZWSA 5AX3A 4ACDA 1WBWA 2PZPA 3UPXA 4BDFA 3NUUA 4EOKA 4EOJA 1NVQA 2ERZE 3ENHA 2J6MA 5L2QA 4V05A 3R9HA 3CGOA 2W1GA 3U51A 4BVUA 3LZBA 2QCSA 3E5AA 4QMUA 3PXKA 5CI6A 4DH8A 3BYMA 5BUIA 4EHGA 4DFBA 3LFAA 3Q5ZA 4FT5A 4U5JA 5DNRA 4MNEA 4PY1A 2H6DA 1XBCA 3NEWA 3TI1A 1UU3A 2WTIA 3GFWA 5CU4A 4BDAA 3ETAA 3IW4A 4F9AA 1OECA 3Q9WA 1F0QA 1H1QA 5A4LA 3O7LB 4GG7A 4K0YA 3PIXA 4O7NA 2BILB 4RJ8A 4FV7A 4N4SA 1F3MC 5EI8A 1U54B 2QD9A 5H2UA 2IPXA 5CU0A 5M4FA 3ZBFA 1Q8TA 3DTWA 4AOJA 4JAIA 4YR8A 1ZYCA 3LVPA 4XH6A 4O0WA 5F94A 4YJVA 1WVXA 4ZMEA 4YJUA 3QX2A 2XKEA 3PLSA 5A9UA 3V6SA 1KE7A 1XBAA 3GUBA 3VUIA 3SV0A 3O51A 3V5JA 5AUXA 5JFXA 1J7IA 2QHMA 1PMVA 1YOLA 2BVAA 4GK2A 3W32A 3ORKA 3ZDUA 5EDPA 4GYIA 4MTAA 4IFCA 1NVRA 2VTLA 4KRDA 4IM2A 4R7BA 4MXZA 2QKWB 3IKAA 4L6QA 3ORXA 3PXZA 4O0RA 4H39A 2UZOA 4LV5A 3WF8A 3ZFYA 3F7ZA 3HP2A 4MNEB 4EQUA 1JSTA 4AZFA 5E8YA 5EI6A 4MD8E 3H9OA 2Y0AA 3NDMA 3IW7A 4J95A 4I4FA 2IWIA 2ITOA 2C47A 4USDA 3GP0A 5L2WA 3C7QA 4GMYA 3PPKA 4FZ7A 1WBPA 3RPYA 4QQJA 3GQIA 1JKLA 3FDNA 3MS9A 4IZ5A 1M2QA 2F7XE 2VTOA 2XNEA 3FBVA 3R1SA 5F4NA 4O82A 3FV8A 3JVRA 4FIGA 4G6LA 2ITNA 4FSYA 3DXPA 3SC1A 5KMLA 1W7HA 5EK7A 5IMXA 4NIFB 4RVTA 5HIDA 2UZVA 4ZSJA 3BKBA 1PKGA 4I20A 4FEWA 3PRFA 4UZHA 4Y5HA 5KO1A 2V7OA 4EL9A 5A4EA 5EQEA 5AADA 4OTQA 5E7RA 3QTQA 4O7ZA 4HNIA 5AUVA 2PUIA 4I21A 4IANA 4F7SA 4L3PA 4FTNA 4MQ1A 3OWJA 4S31A 2PE1A 1CM8A 2PE0A 4H3QA 5HE3A 3IPHA 4C35A 3MVLA 1L8TA 2YWVA 3U55A 4XG8A 4EH7A 2WQBA 3K5UA 3P78A 4TXCA 4RIWA 3S3IA 3V5PA 2YAKA 3VULA 2WQOA 3DOGA 2CJMA 3IOPA 4NJDA 2H34A 4DTAA 4RA4A 2XNGA 4JLCA 4WBBB 5AUTA 1R3CA 4MBJA 5D11A 3VQHA 3OFMA 4AN3A 3VF8A 4LGDA 4NCTA 1KOAA 4O1PA 2XK3A 2YERA 4CEGA 2C6EA 1UU7A 4AXAA 2QOBA 5BPYA 5GZ8A 4C38A 1YRPA 2ZJWA 1VEBA 3KY2A 4DLIA 4DT8A 3BHUA 3DZQA 2FSLX 1YXVA 4JNWA 2ZYBA 4OGRA 4JQEA 2FVDA 4F64A 5DWRA 3GCPA 3LQ3A 2JKKA 4FK6A 3QCSA 2JBPA 2EXMA 5FEDA 3P7CA 4FIEA 3BPRA 4RJ6A 3OY1A 3U4UA 3EQFA 3KB7A 3KVXA 4RWKA 4PNIA 5A6OA 2PVMA 4IAFA 3C0GA 3DJ6A 5IA1A 3D14A 4KIKB 4GCJA 4IBMA 3OMVA 5AAFA 5B2MA 5CSPA 4D58A 3RHKA 1OIRA 1MRVA 4JBOA 3FHRA 4C59A 3IW8A 2OBJA 1M7NA 4U81A 3SAYA 5M08A 3KK8A 4IQ6A 3R8ZA 4YHTA 3FY2A 3NNUA 4CXAA 3F2NA 4MAOA 1JQHA 5KMOA 3HAMA 4RIYA 5CZIA 2ACXA 3W18A 5EKNA 3DDQA 1XJDA 5J7BA 3DT1A 1WMKA 2JAVA 4HGLA 3NRMA 3QHWA 3R28A 3TT0A 4D2PA 3P08A 2VWUA 4FL2A 4DF3A 1YI6A 5A46A 3E92A 5L6WL 2UZTA 3RPOA 5D12A 3THBA 5TF9A 1B6CB 2PMNX 4DFXE 3NNXA 2I0VA 3ORIA 4O84A 4FTUA 3AMYA 3I79A 3DBFA 1XWSA 5DBXA 5C8MA 3MH1A 2B1PA 4M69A 1NVSA 3SW7A 2P0CA 3AT2A 4BBEA 2C30A 4RX9A 4CFNA 5DT0A 3DAJA 1XH5A 4QTCA 4DAWA 3UE4A 4EBWA 2BUJA 4JDIA 4C4HA 4PMSA 2GHLA 4GFGA 3HRBA 4G34A 4NW5A 4WRSA 2F9GA 3D9VA 3PJ2A 3UIXA 2XJ0A 4DEEA 3R7YA 4E4LA 4XJ0A 3PZEA 2Y4PA 2VAGA 4LRKA 4EK4A 2ZMDA 3A4PA 4O96A 3ATSA 4EZ7A 5HTCA 2Y6MA 3W2OA 5H8EA 3R21A 3COMA 4NCTC 4EH3A 3VUKA 2R3KA 2XJ1A 3LCSA 4MKCA 2QOLA 5M4IA 2CDZA 4KABA 4RIYB 3CGFA 3Q9YA 4DH7A 4EHVA 3R83A 1S9JA 2QNJA 4M14A 4U8ZA 5IQEA 2EXEA 3A8WA 4YUQA 2QURA 2X2KA 1WCCA 4DGMA 1RE8A 4I23A 2QG7A 3EKKA 4W4YA 5I5ZA 2YZLA 3OXIA 4ZTQA 3QZHA 3GGFA 4DH3A 2XYUA 5LMKA 1OBGA 2YM8A 1H1RA 4FA2A 4D9TA 3C5IA 2JDTA 3QRJA 4BY9E 3C13A 4X6QC 3LLTA 2WTKB 3LFNA 4X6RA 4AA5A 2ZDTA 3NCZA 4TTHB 3KKVA 3ZTXA 4D4YA 5A3XA 3O17A 4FSWA 4XEYA 1QMZA 1OKZA 4MX9A 4P5ZA 5CAUA 4FEXA 3UZRA 2ITZA 2X2MA 3QUEA 4FIHA 3U8WA 3EIDA 3OCSA 4ITIA 4PWNA 4KB8A 2NPQA 2BROA 2VZ6A 3GU4A 4A4OA 2QOOA 4G16A 4I6FA 3SRVA 4CGAA 2E9VA 2WQEA 4RJ3A 2OICA 4JX7A 3Q52A 4GIHA 4GU6A 3W10A 4AT4A 2CGXA 5KE0A 5FDXA 3DPKA 2UVZA 4ASDA 5L8KA 4YJOA 1YVJA 1KE8A 3EN5A 4TYEA 2XNBA 4AAAA 1MRYA 4FV4A 4F9YA 2C3JA 5K5XA 2B9JA 4FKQA 1J3HA 2OZAA 1JSVA 3D5WA 3HL7A 4R3PA 3VUMA 3PWDA 4H3PA 1OZ1A 4L3LA 4BKYA 2IW6A 3W55A 3DAKA 5CF4A 3FWQA 4R1VA 3MB6A 4C2VA 1GY3A 3U9CA 3A2CA 2C68A 3ZU7A 4I24A 3Q60A 2QU5A 4FYNA 2YJSA 4RIXA 4XLVA 1M17A 2UVYA 4RJ4A 4FT0A 4O7VA 4ZMFA 4O91A 3OHTA 3QQHA 4FTQA 4XG4A 4DLJA 3II5A 2EU9A 3P1AA 3ZSGA 1M2PA 1SNXA 3DK3A 5L3AA 2BRNA 5I9ZA 2QLUA 2UZNA 4M68A 4PF4A 2PVYA 2QOIA 2J5EA 4TWPA 3MWUA 2W1EA 2OGVA 2RF9A 3BGPA 3COKA 4FBXA 2OXYA 3SA0A 5J7HA 5HORA 2X7OA 4IVAA 3L9PA 4FNXA 3V8WA 2W99B 2BAQA 2FA2A 2OF4A 3FMLA 5C01A 3QQUA 4D4VA 4X3JA 2ITVA 2C69A 2XJ2A 3QL8A 3DQWA 3NUXA 3VS5A 3ZRKA 5C26A 3DK7A 4M12A 1OL2A 2Z7LA 1U46A 5HE2A 3V01A 5LMKC 2HAKA 5IEYA 1WVYA 4FT9A 4J97A 1CSNA 1GIHA 1UNLA 2QR7A 3WOWA 4EKLA 3PP0A 3RVGA 4BCOA 4ZIMA 4OLIA 4CZYB 3HYHA 3VBWA 5H8GA 2JBOA 5DR2A 4O2ZA 3JYAA 2XA4A 2R3PA 5CVHA 2C6LA 4HJOA 2OU7A 5F9EA 3REPA 3JUHA 4BHNA 1XH6A 1P14A 4ALWA 4CT1A 4RZVA 4GUEA 5HCYA 5J5TA 4CFWA 4XP2A 4XMOA 2YHVA 5BVWA 4KBAA 2OI4X 4DITA 3QRTA 3WE4A 4ANSA 3DBEA 4MD7E 2W9ZB 2YCQA 4L68A 4TWOA 5LMAA 5AV0A 3ID6C 4LV8A 4BDBA 2VWYA 3HVCA 4YURA 2FGIA 4IAKA 4N57A 4LL5A 3I6WA 4IX5A 2PZ5A 3FLZA 4RFZA 2F49A 1Z57A 4LOPA 4TT7A 2E2BA 4HCTA 4F7NA 5BVDA 3EN9A 3L8PA 3LCDA 2EWAA 5T68A 4D0WA 2C0OA 2QOHA 1Q4LA 4KKEA 4M13A 3Q6UA 4W9WA 5L6PA 3WZDA 3FYKX 4FL3A 4O0TA 3W2SA 2PE2A 3ELJA 4QTDA 3KRRA 3KRLA 4OUCA 1URCA 5HI2A 3KMWA 3TN8A 2ZM1A 5LARA 3PIYA 4DTBA 3EQGA 3GC9A 5AP7A 2WQNA 4DINA 2IZTA 5BUEA 2YACA 3QAME 5CAQA 4X2FA 5JRQA 3R63A 4QP7A 3G6GA 3HGKA 2CLXA 3EFKA 3Q04A 1H1WA 2C5VA 4MYGA 3T9IA 2WMUA 3SXRA 3TDWA 3LAUA 4FL1A 4IC8A 4QQTA 4OAUC 2OH4A 4D28A 4S34A 4B9DA 4O1OA 1PXNA 2XZSA 3VS3A 3OXTA 3E93A 2Z2WA 2CKEA 4AZVA 3TUCA 2ITUA 3TIZA 2W05A 3MIAA 2V7AA 3JR1A 4JL9A 3H9RA 1OKYA 4TPTA 3KCKA 4ZZOA 2ITYA 2WIHA 5E9EA 1NXKA 4XHKB 5BX0A 5IF1A 3E8NA 3A61A 2W06A 5CU6A 2VX1A 1SVEA 1SMHA 3CPCA 5CXHA 5IKWA 3R71A 4GG5A 4Y46A 5CXZA 4P5QA 3IDBA 4ANLA 4FTOA 4KINA 4NWMA 4P7EA 1YDRE 4HVDA 4L43A 2A4LA 3F3TA 3H3CA 4KKGA 4YJNA 5HLPA 3OG7A 3V8TA 4ACCA 4H1MA 5JZNA 4G5JA 4KIOA 2VV9A 4FV1A 3H4JA 4K18A 4GT4A 3UQFA 3VC4A 4WNPA 1W98A 5FXSA 3DKOA 3RK9A 3QGYA 4L45A 4B7TA 5HNBA 4FNWA 2H9VA 3AXWA 4WUNA 3RM7A 4MF1A 4S30A 4BFMA 4CYJA 2BZKB 4E5BA 3BHYA 2XKDA 1G3NA 5JH6A 4WUAA 4ZY6A 2RFDA 4ITJA 2R3QA 4EOOA 2DYLA 5KZIA 4BWKA 4M8TA 1Y91A 3D5VA 1A9UA 1Q8WA 5B2KA 2LGCA 2REIA 2CNVA 4F70A 3P7AA 5AP3A 5CEMA 3DJ7A 3IOKA 4FI1A 3FLNC 1H24A 5HIEA 2YIRA 4O7WA 3WYYA 5J1WA 3C4CA 4LOQA 1FOTA 2X9FA 2QG5A 2Z60A 2CNUA 2R3RA 3KA0A 3IG7A 3UZPA 1YXSA 3UZTA 2IZRA 4FV9A 3LFEA 5E91A 4D2TA 2XMYA 4G6OA 5BMMA 2R3LA 4NKAA 3MBLA 5CAOA 2XM8A 3NAXA 2JFMA 3MYGA 1UA2A 3MPAA 4L7SA 4BF2A 5J87A 3QYWA 2R64A 4L67A 4GS6A 4IAZA 4DEHA 5IA0A 2YIQA 4DCEA 1Y6AA 5A14A 4W4WA 1DS5A 2DQ7X 1REJA 2WTCA 3BU6A 3FHIA 4OTPA 4A9YA 4KAOA 3ODYX 3MY0A 3TWJA 3VS1A 3ZRMA 4MK0A 2BZJA 3HMMA 4FTTA 1APME 4FKOA 3UC3A 4CKJA 1IA9A 3V51A 2GNGA 2XF0A 1JKTA 3CP9A 3GENA 4EH6A 3PDTA 1RDQE 2Y4IB 1GZNA 1GJOA 1REKA 5CT7A 2BTSA 4ZSAA 4TYJA 4E20A 1XQZA 4AGUA 2RIOA 3LKMA 2YM5A 3LIJA 4MD9E 4TNDA 4UBAA 5IA4A 2B9HA 1FINA 4A4XA 2PU8A 4QMOA 3F66A 5IUIA 5K9IA 2FSTX 3I7BA 4I5CA 5AM7A 5CVFA 3SDJA 5GZAA 5JMSA 4TYHB 4R7HA 2O2UA 3EQDA 5F95A 2V22A 2Z7RA 4U41A 3ZLSA 4DEAA 4Q9ZA 4IB1A 3UYSA 1QCFA 3K2LA 1PKDA 5FTQA 4JDHA 4L3JA 3R7VA 2GMXA 5CAPA 3E8EA 3D83A 2J90A 4NM3A 3W2RA 1KE5A 3ODZX 5IQDA 3UO5A 5I0BA 5AAEA 4WKQA 3ZC6A 4I6QA 3FE3A 4A7CA 3KL8A 4WSYA 3LCOA 5ANGA 4F09A 4RVKA 1Y8GA 3TIYA 4QMTA 4YZDA 4FV5A 4O0VA 3OBGA 3ULIA 4YZMA 2VWWA 4BBMA 4EEVA 3PLAE 1Q8ZA 3MB7A 4ANNA 5FXRA 2JC6A 1OL5A 5AV2A 4NK9A 2VGOA 3RI1A 5AFVA 4G31A 2CSNA 2C5XA 1CKJA 2XNOA 4FVRA 1ZY5A 4PMMA 2J5FA 4WNMA 3C4XA 4QP2A 4U9AA 4BKZA 3BLQA 4IAYA 4I0RA 2ITPA 2R3GA 2W17A 1CTPE 3EMGA 3PVUA 5FM2A 4EOQA 3SXFA 5BMSA 3EZVA 1M14A 3WIGA 4FSTA 3POZA 3NVMB 3FLYA 4O0UA 4RBLA 1YW2A 2G2HA 5HLNA 2R3IA 3QGWA 5EW3A 4BCIA 4BI0A 3T3UA 2OF2A 3FJQE 5IDPA 2ZV9A 3DKFA 4Q5HA 2P55A 1W83A 3D5UA 5AV3A 4L52A 4O38A 4YJPA 4EYMA 3OCBA 4BIDA 3R1NA 3IO7A 3NW7A 3I6UA 2XBJA 3CCNA 1VZOA 1WFCA 5FBOA 3UYTA 4DG3E 4X3FB 3DBDA 3TZ9A 4BTMA 4NM7A 4G3FA 5HG8A 5CEQA 5LMBA 1DI8A 2I6LA 1OUYA 2OSCA 3AMAA 4FKPA 3EFWA 2OFUA 5EW9A 3GQLA 4PMPA 4DT9A 2ESMA 2B55A 3QRKA 3V5QA 1PF8A 4ZTMA 4ZY4A 3DNDA 5K0KA 3O96A 2YM6A 4FTLA 2O64A 3CQUA 4W8EA 3RZBA 2G1TA 3I5ZA 1O6KA 5CZHA 1U4DA 4U43A 4Z16A 3R2YA 1W84A 4A4LA 5K4IA 4J71A 2QI8A 3DS6A 4WG4A 3ULZA 5AR3A 4ASXA 5BYLA 1PY5A 2ETKA 5GJFA 5K5NA 3IQ7A 2FUMA 2X8EA 2XIKA 3AC4A 4JQ8A 4WBOA 1XH8A 2X4ZA 4WO5A 2VTJA 3QU0A 1JPAA 4QYYA 4YZCA 4WG3A 4AFJA 4EUUA 5C27A 4BB4A 5E8VA 4CKRA 3QA0A 5DMZA 4M7IA 1BL7A 4R3CA 5DEWA 4ZJJA 3GNIB 5BVNA 4FG8A 5DOSA 2JIIA 3NW5A 3WF5A 3B8RA 1ND4A 5JFVA 2BTRA 3U9NA 3MI9A 4OTFA 4QP6A 1UKHA 1YXTA 4QMNA 4AZEA 2WTVA 4FG9A 3MH3A 3GEQA
chains in the Genus database with same CATH superfamily
4OBQA 4O2PA 5FTOA 4E5AX 4EBVA 3LXPA 2XK8A 3PA4A 4JT3A 2WQMA 4LL0A 5JK3A 3V6RA 2GU8A 5HESA 4AXEA 4KBCA 4RLLA 1Q3DA 2XCKA 3LFFA 4YGAA 4AZSA 4DG2E 4IHPA 5L2IA 3E7OA 3KXXA 4GH2A 4E7WA 2R3OA 1OPJA 4AF3A 1NW1A 4Z55A 2HK5A 5FUTA 2AC5A 5E1SA 5H8BA 4ANQA 3G15A 3ZHPC 3VO3A 3T3VA 4LGGA 3Q9XA 1BKXA 4GFOA 4NT4A 2Y9QA 5E8SA 4Y73A 4BDIA 2ONLC 1VYZA 1OI9A 2PVJA 3FZ1A 4XV1A 5CEIA 3AC3A 2Y8OA 2JEDA 2IF8A 2GTMA 4FKSA 4GIIA 5HEZA 3RP9A 1TQIA 2WO6A 5HD7A 3VJNA 1VR2A 5IH4A 4D2VA 4X0MA 3QQLA 2OXXA 1H1SA 3EWHA 3KXNA 4FT7A 4QDVA 4CFVA 4BCGA 3EQIA 1Z5MA 2RL5A 3PVWA 4BKJA 3HA6A 4P4CA 4F7LA 1Q41A 2P33A 4QOXA 3R9DA 3HKOA 3FL5A 3NYNA 3ORTA 4PTEA 4XCUA 2QOFA 2OK1A 3QCYA 4XBRA 3RAKA 1OKVA 3G6HA 3UQGA 5EI2A 4YU2A 3U54A 2IVUA 5EYCA 4IWDA 1OB3A 3F2AA 3MH2A 5JFWA 1G5SA 2GHMA 4X2KA 3SD0A 2J0LA 1W8CA 4TW9A 3EQBA 4I3ZA 4GW8A 4R5YA 5AR5A 5FLFA 2BCJA 3UVRA 3NS9A 1MQBA 5DLSA 4M84A 2BZIB 5H3QA 1E1XA 3L9LA 4TKSA 2WNTA 5EM6A 1H4LA 4ZLZA 3N4TA 4D9UA 4Y72A 2R7IA 2B52A 5F1ZA 4FF8A 5HX8A 2ERKA 3QF9A 2IZSA 5GIPE 3AC8A 4ASZA 2ZV7A 3SXSA 4NIFA 1Q8YA 4FEUA 1YHVA 2VGPA 4AE9A 5DI1A 2BAKA 3KIOC 3N4VA 3O2MA 3V5TA 5JGBA 2I0YA 4DC2A 5D7VA 4BCPA 3LHJA 1ZZ2A 5KMKA 2XVDA 3FI3A 3O8PA 3PY1A 2JDSA 4AUAA 3PVBA 1Q5KA 4B0GA 2VWXA 1TKIA 3OT3A 2FB8A 4LOOA 4E4XA 2VO7A 5I9YA 4GT5A 1B39A 5M07A 5M56A 1P4FA 1U59A 2IW8A 4C62A 4F65A 4BCMA 5ANJA 4BDGA 2PMIA 5E8UA 3KMUA 3D2IA 4ERWA 4QTEA 4Q9SA 2Z02A 2PK9A 1M2RA 5BVOA 3DXQA 3QTZA 3DNEA 4NL0A 5HTBA 2XNMA 4C7TA 2VTRA 2NRUA 5LWNA 3FQSA 5LJJA 3CPBA 4TWCA 5EM5A 1GZKA 4WNOA 2W1HA 3E88A 3U6IA 1R78A 3HV4A 2YDJA 3ZM4A 4WOVA 4IFGA 4L8MA 2WMRA 1R0EA 3HEGA 3LJ0A 3OUKA 4I92A 3RK5A 3TNWA 5AJQA 1PHKA 3Q4CA 3R7UA 3SGCA 2VTHA 4G5PA 1KE6A 5D41A 3RJCA 1YDTE 3S4QA 4UYAA 4FEVA 2QOQA 1SM2A 3C4ZA 4G3DA 4FT3A 4PRJA 1UNGA 4GVAA 4QMWA 1H0WA 2A27A 3GOPA 4BR3A 3ZLXA 4A9TA 2C5OA 3WZUA 5IQAA 5BVEA 1CDKA 3TZ7A 5K0XA 3BV2A 3F7WA 3COIA 2R3MA 4JBPA 4XYFA 5T3QA 5CSWA 2P3GX 4KIKA 5B7VA 5LVOA 3FSKA 3E8CA 3DB8A 5AV1A 3QTRA 3QZFA 5ANKA 4YO6A 2WOTA 2Y7JA 3W0PA 3BI6A 2YAAA 3T9TA 3V04A 2JLDA 1WBNA 2C6KA 3F3WA 5G1XA 2F7ZE 3UO4A 4QP8A 2OO8X 4HPTE 5I3OA 3SG9A 3S00A 3MVMA 4CTBA 3RNYA 3D4QA 4RJ7A 4K9YA 2R5TA 3CBLA 1PMUA 2GS6A 3O50A 3FMNA 5HICA 3ZXTA 1GOLA 2YLEA 3CC6A 5EOBA 1JOWB 4D1XA 4DN5A 2QOKA 3VWAA 3VUHA 3ROYA 2PYWA 2YDIA 3R1QA 4O86A 4UXQA 3VHKA 1YDSE 3NUPA 4CRLA 4DDGA 3GC0A 5C1QB 3KRXA 3FXXA 1PXIA 3PXFA 4IM0A 5CNNA 4AFEA 3MPTA 5LCJA 2BFYA 2GS7A 2ZV8A 1OL1A 4CFUA 3ZO1A 2XKCA 4FTRA 4NEUA 3FMEA 4PTGA 3BEGA 3QLGA 1Z9XA 1L3RE 5TR6A 3VN9A 3ZFXA 5JN2A 4CMOA 4JVGA 2I40A 5CX9A 3DK6A 2F7EE 5JT2A 5AP6A 3QBNA 3W8QA 1J7UA 4LYNA 2A0CX 1J91A 3ZLWA 2PVRA 3BYSA 2WGJA 3Q4TA 1V0BA 4I5PA 3IDCA 5EH0A 3UODA 4B8LA 5KMJA 3NIEA 3P23A 5IA3A 4XBUA 2BMCA 1ZXEA 4BZOA 4ZY5A 2ZM4A 5LCKA 5JFSA 2XAMA 3VJOA 4WNKA 2VTPA 3DFAA 2UW5A 4U44A 4I6BA 3LM5A 2IZUA 4MBLA 5EW8A 1T46A 3NNVA 3C51A 4JG8A 1KE9A 3U6JA 3IW5A 4C02A 3MJ1A 4L01A 4L00A 2HELA 3K3JA 1YWNA 1KSWA 2UZEA 1GAGA 1H25A 3MFRA 4OTHA 1Q3WA 5CU3A 2P4IA 1R1WA 3MTFA 3P9JA 3AC2A 4RZWA 4YHFA 5E8TA 4KIQA 3TJDA 4YBJA 4Q5EA 5HG7A 2DS1A 3VS0A 4X2NA 4N6ZA 5GNKA 4E8AA 4YMJA 5AP0A 3FZOA 4FV3A 5KHWA 3NYOA 1XHAA 3KN6A 2FH9A 4X2JA 3HRCA 2XS0A 3LJ1A 2QU6A 3C1XA 5C03A 3L8XA 3MTLA 2HZNA 4NTSA 3EYGA 4WRGA 5DR9A 3QHRA 2ZDUA 1PXMA 5KX8A 3TM0A 3JS2A 3UQCA 4USFA 3ZMMA 2YN8A 3NUAA 3EN4A 3KC3A 4LM5A 2WMTA 5DN3A 3EQRA 4UMTA 2W1CA 3MY1A 5KKRB 5I3RA 1JBPE 3I0OA 3RZFA 4QP9A 1T45A 5DYJA 2G2IA 3VBTA 5A4TA 2OLCA 4LUEA 5BYZA 4AACA 1WAKA 2JKMA 2OJIA 4U79A 4JDJA 4AZWA 3ACKA 4EKKA 1O6YA 5HO6A 5E90A 4BDHA 4NYEA 4ZTLA 3W2PA 4U3ZA 4BHZA 4MBIA 2E9OA 4CCUA 4IC7A 2NYAA 2SRCA 4KA3A 4F0IA 4WHZA 2NNWB 3UC4A 3F3ZA 5KHXA 4YNOA 3OZ6A 3PPJA 1XBBA 2J4ZA 3DU8A 4OTRA 5K4JA 3AGMA 4HVGA 4C2WA 4O4EA 2ITTA 3ZDIA 3D15A 1AD5A 3LMGA 3W2QA 2JD5A 2JKOA 3KFAA 2Y6OA 4CQEA 1ZLTA 1LEZA 3OCTA 4YC6A 3HRFA 4AGDA 3OTVA 4RWLA 4O6EA 4AOIA 4Z3VA 2VNWA 2WMAA 3KU2A 4CV9A 3OTUA 4QYFA 4M66A 3ORMA 2C1BA 4U40A 2ETMA 4ZLOA 2C1AA 4BGGA 1Q61A 3QXPA 3G51A 3WI6A 4O7RA 4DHIB 4QEBA 3AG9A 3NMUF 4F6SA 4UMPA 4JDKA 3F3VA 3FMDA 4MVFA 4EWHA 4DTKA 3BE2A 1OKWA 4EOIA 2GFSA 5LVPA 1GIJA 4AQKA 3A4OX 4O6LA 2ETRA 1FVVA 2WD1A 5DVRA 4E93A 5LXMA 2EXCX 3E3BX 3Q4ZA 4HCVA 4UB7A 3ATTA 1LEWA 1WZYA 4IB5A 4RVLA 4F08A 3MV5A 2QONA 3Q5IA 4ZOGA 2YJRA 3R01A 2XK9A 5LQFA 2WTKC 3HMIA 3GU6A 3NIZA 4YC3A 4BYIA 3ZSIA 3F61A 3DY7A 3UBDA 3FY0A 4UMRA 2W5BA 3SHEA 3W1FA 5HNIX 3RM6A 3L9NA 3EL7A 5FEQA 4XOYA 1Q97A 4QMPA 1DM2A 1ST4A 3OXZA 1PW2A 4BTKA 4CLJA 5HZNA 5CYIA 5M4CA 2B9FA 4E3CA 5IEVA 5M51A 2W0JA 1O6LA 4KD1A 4FNYA 4MH7A 2J2IB 1LUFA 4O4CA 4OTIA 3L9MA 4H3BA 4JJRA 2C6TA 4Z9LA 2IN6A 2J0IA 1G8AA 1P4OA 3D94A 4FKIA 1MQ4A 2XBAA 2JAMA 3B8QA 4C3PA 3ZZWA 3R04A 3GXLA 5M06A 4IXPA 2PVFA 2AC3A 5DA3A 5DT3A 4RWIA 4UWBA 4FSUA 4AW1A 3Q32A 4GVJA 4IJPA 1Y6BA 2A2AA 3QC9A 4OW8A 4QQ5A 1TZDA 5C9CA 2WMSA 3RAWA 3RKBA 2JIVA 4CFMA 4NH1A 5C8KA 3OW3A 2O8YA 3H0ZA 4HYHA 4CMTA 2YDKA 2W1FA 5FWKK 5HD4A 2I0EA 2VO3A 3QD2B 2VX0A 4IAIA 3MSSA 5DT4A 2H96A 1FGKA 3Q9ZA 2XKFA 4IMYA 1JKKA 2W96B 3LFDA 4PQNA 4MWIA 3C5UA 5IQBA 3TCPA 2VN9A 3HV7A 3R9NA 2NO3A 3A7GA 3LFQA 3PPZA 4J1RA 4PUZA 5E8XA 1DAWA 2Q83A 5LVLA 3F82A 3ZH8A 3W0RA 2VTTA 4R5SA 1LP4A 5C4KA 4NFMA 4FG7A 4HGTA 4A9UA 5L2SA 3PJ3A 4BRXA 2PVLA 3ZRLA 1G8SA 5EG3A 4ENYA 4GK4A 2O0UA 4QNYA 4FGRA 4Y5QA 4QP4A 2BRHA 2OKRA 2BFXA 2C6MA 3ZUUA 2X0QA 2CGVA 3Q4UA 5HCZA 3ZZEA 2YIYA 3OP5A 1WBVA 2PSQA 3ROCA 4UX9A 1PRYA 5KNJA 3FKNA 3RCJA 1DI9A 3BWFA 4EHZA 3A99A 3VAPA 4CV8A 5HG5A 4S32A 4NW6A 4AT3A 4H1JA 5CQWA 2UW6A 4EQCA 3ZXZA 3H0YA 3QKLA 4RPVA 3BQCA 4J98A 2WB8A 4E26A 4DEBA 4L53A 3RNIA 3DQXA 3F6XA 4D0XA 2HWOA 3ZEPA 5A6NA 5I9WA 3PWYA 4MXCA 2HZ0A 2OWBA 2ZAZA 4KKHA 4JBVA 3S2PA 1A06A 2HCKA 4G2FA 2GFCA 4O27B 3VBXA 5A54A 4APPA 5ANOA 1YWRA 3HDMA 3ZLYA 1BYGA 2QODA 4QMMA 4ARKA 2WMVA 4FICA 4HZSA 2XUUA 3TV4A 5CSVA 4FKUA 1WBTA 2EUFB 2F4JA 2X2LA 4I6LA 4R78A 4QT1A 4KUJA 3NYXA 2IVTA 3KXMA 4IM3A 4FSQA 4ITHA 2PL0A 4CSVA 4ANBA 2IVVA 3OOMA 3QD4A 2PZYA 4NZWB 1P5EA 1LPUA 4LDTA 5AP5A 2F57A 2OW3A 2CNQA 3FMMA 5CAVA 1ZYSA 4XG3A 3TMOA 4FK3A 1EH4A 4RGJA 1TQMA 1J1BA 5GZ9A 4JS8A 3MVJA 4TNBA 3VNTA 4K33A 1JKSA 3F69A 4IW0A 5FG8A 4IZAA 3F5UA 3MW1A 4ANOA 5ANIA 1OMWA 4BL1A 4ANMA 4IIRA 3EQPA 4LMUA 4EWQA 1Q24A 1Y8YA 4QYGA 3NWWA 2WU7A 3TV7A 3UDBA 4UN0C 2VTQA 4G17A 2CPKE 4RWJA 4V01A 2QLQA 1PYEA 3LOKA 3PXRA 2B53A 3PJCA 1SYKA 3FZRA 4HPUE 1YI4A 1YOMA 3VS6A 2UW9A 3MFTA 2X7GA 4C0TA 5KMIA 3SW4A 4IACA 3RCDA 3OROA 2KULA 3JVSA 3OOGA 3P7BA 4DFNA 4ZK5A 3CQWA 5LWMA 4FOCA 2PY3A 2CLQA 5IQCA 3NAYA 4N6YA 2HXLA 3RK7A 2WTWA 3LLAA 2XCHA 3CY3A 3ZOSA 3GCVA 1OIQA 1IG1A 1VYWA 2PVNA 4G3CA 4QP1A 3E87A 4YHJA 3P4KA 1QL6A 1XH4A 3A7JA 3W8LA 4FYOA 4QQCA 4O81A 3PY0A 4F0GA 3NUYA 2HY81 3QKMA 4KNBA 4W4XA 2O63A 4U42A 3PYYA 3DKGA 5FDPA 4TYHA 2YA9A 3T8OA 4L7FA 4ZAUA 3Q6WA 4QRCA 3R6XA 4TN6A 5IEXA 3AD5A 4A06A 2Z7QA 4YTIA 3SX9A 3E3PA 3KCFA 3JY9A 1QPCA 2C3IB 5L8LA 4YZ9A 4C3FA 4QMXA 3FPMA 2PVHA 5FRIA 5ANDA 5J1VA 4ZEGA 1BMKA 3QTWA 3M42A 4ONAA 3FMHA 3PA3A 5L8JA 4ACGA 1YHWA 2XEZA 3OD6X 5DG5A 4J8MA 4AW2A 2R3NA 1OM1A 2PZRA 2BZHB 2GSFA 4D5HA 5D7AA 4NJ3A 4K1BA 5B0XA 3UMXA 4A9SA 2BIKB 3LMIA 2WMQA 1U5RA 5TKDA 3O23A 1W82A 4YLLA 3FL4A 4AE6A 2WHBA 3UNKA 4FKTA 3OCGA 4J7BA 3F5XA 4E4MA 4XUFA 1KV2A 1UWHA 4KIPA 4XG9A 3W0NA 3NLBA 3AGLA 5FXQA 5D10A 3R8MA 2BRBA 5DFPA 4XNEA 2QVSE 3UOHA 1UNHA 3CSVA 3FLQA 5GIOE 1JWHA 1AQ1A 3I0QA 4FX3A 4HYSA 3FI4A 3ALOA 4FVPA 4O0SA 3C0IA 4RC2A 3R02A 4UALA 3TNPC 3ZS5A 4ZLYA 4FZ6A 5CI7A 4QP3A 4FJVA 3MVHA 5AUUA 4X3FA 3RHXA 2DWBA 4Z7HA 2EB2A 1H1PA 1OGUA 4R6VA 3PVGA 4ALUA 3LQ8A 4FUXA 4R8QA 2IO6A 4HGEA 4MXAA 4B8MA 4PMTA 1WVWA 2A19B 2ITWA 2GDOA 2W5AA 3G33A 3RPSA 3ZSHA 2VWVA 3WF6A 2HWPA 4GUBA 2YIWA 4FIIA 4I5MA 4KS8A 4M3QA 4XLIA 4AZTA 3DXNA 5BUJA 3Q53A 1UU9A 3Q96A 2ITQA 5DEYA 4IB0A 5DR6A 3VS7A 2I1MA 3FAAA 5EM8A 3W0OA 3I7CA 3FQEA 1TFFA 5FP5A 4YZBA 3ZO4A 2PMLX 4FKRA 3UG2A 1OITA 2Y4IC 4FV2A 5IH6A 3VW6A 4DBXA 2PZIA 3DLZA 4WA9A 4YJSA 1OIYA 2XK6A 4NM5A 4XP0A 4EOPA 2W1ZA 4J53A 2X6DA 3BHHA 3BU5A 4S33A 4WT6A 3O71A 5E92A 3FSFA 5LVNA 5J95A 2X8IA 2B7AA 4EH2A 3HZTA 5AUZA 4DHZA 5DGZA 4PPBA 4IZ7A 3CE3A 3PUPA 2C0IA 2XH5A 4I0SA 4I1ZA 1OPLA 4EOMA 4UEUA 4BDDA 2B9IA 4BCKA 3GCQA 2FSOX 3QA8A 4FSZA 2UVXA 2CCHA 3CXWA 4OTWA 4QMYA 2R3JA 1KOBA 4U3YA 5DHJA 2E9PA 2C4GA 5I9VA 3WARA 3CD3A 3PE2A 4NU1A 4UV0A 3O5AA 2PHKA 3QXOA 4IADA 4RFYA 1MP8A 4BTFA 5J5SA 2J0KA 4YTHA 4EOSA 3WZKA 5EHOA 1PMNA 4OBPA 3ZYAA 3QD3A 3QCXA 3QTXA 4EK8A 3LE6A 3UMWA 4WSQA 4IE9A 3MFUA 3R8LA 1CKIA 3VIDA 5AA9A 3PSCA 1JSUA 3R8UA 1RW8A 2BAJA 4KSQA 1XMMA 1SVGA 1ERKA 3RMFA 2VWIA 4QMVA 2UW8A 3UP2A 3F5GA 1W2FA 2CMWA 3CLYA 3BIZA 3G0FA 5IUGA 2GQSA 1XMLA 1GIIA 3NSZA 4LRMA 3R2BA 4GSBA 1I09A 4ACMA 4CQGA 5JRSA 1XO2B 4D5KA 4IVCA 5I9XA 3FKOA 3WZEA 4FZFB 3TNQB 4JQ7A 5HKMA 4EONA 2IG7A 3CIKA 4FOBA 4AS0A 4E6QA 4ID7A 4HW7A 3ZUVA 4EZ5A 4IB3A 5IDNA 3DAEA 3VHEA 3LCTA 3UDZA 1SNUA 5EHLA 4ZJVA 1RJBA 3HUCA 4JIAA 3TV6A 2F2CB 4I41A 4AGCA 3ZM9A 3UDSA 3BLRA 5AIKA 2V62A 3G2FA 4X3FC 4GKHA 3BU3A 5CEOA 4CLIA 4IDVA 1PXKA 1XH7A 2GNIA 1PXJA 2KTYA 3DZOA 5D9HA 1NY3A 5I9UA 2W4OA 3KN5A 3UO6A 4TYIA 3R7EA 3LQ5A 4ALVA 3QYZA 5FD2A 2XARA 5CANA 3A7IA 5BVKA 3HV3A 3UOLA 3W33A 3KXGA 4JRNA 1FPUA 2QO2A 3ORZA 5KZ0A 3CR0A 4II5A 3DFCB 5HVJA 4AT5A 4HOKA 4YPDA 3CJGA 4FSNA 5EKOA 4YO4A 4CKIA 3PJ8A 4QMZA 3F88A 3R9RA 3UVPA 4XG2A 3I60A 1ZYDA 4BDEA 2YM4A 3HX4A 3D5XA 4DGOA 1YOJA 2RFEA 3U87A 4CRSA 5FTGA 4O83A 4ZS4A 4C8BA 3FQHA 4FV8A 4PPCA 4D2WA 3QWJA 4FV6A 3C0HA 3VUGA 4IVDA 1VLRA 3O8UA 3BZ3A 4IAAA 2OXDA 1OPKA 2VTAA 4PP9A 2DUVA 5EOLA 5HQ0A 4RIOA 3HV6A 3QRUA 1NT2A 3EQHA 4J99A 4D2RA 3QQFA 2B54A 5BYYA 2RFNA 5M4UA 4LMNA 3NYVA 4FIJA 3H30A 4V0GA 4QPAA 4R77A 5CF8A 4IX3A 4YLJA 3E63A 2ZVAA 1YWVA 2V5QA 2C6DA 1BI8A 3EQCA 2YIXA 1K2PA 3HA8A 4C36A 4EK6A 4L42A 4BCJA 3BWJA 3ZCLA 3HUBA 4CMUA 4XX9A 4USEA 4AA4A 4EH8A 4BCQA 3LXLA 3OEFX 3FI2A 2WMXA 1P2AA 5J9LA 2X81A 4W9XA 4ACHA 3RTPA 3V5WA 4BCFA 4YSJA 5ETCA 4AW0A 3HDNA 3PSDA 4BIBA 4XV9A 2OJFE 3KF4A 4UXLA 1ZMVA 1SVHA 2HW6A 4NUSA 3RGFA 2AEGA 1QPEA 4MF0A 1H28A 3M11A 3FEGA 3VBQA 1FMOE 3GI3A 4GRBA 3LFBA 5IZFA 3GU7A 1PXPA 2WTJA 2R4BA 5CLPA 5E8WA 1RQQA 1WBSA 2HENA 3A60A 3TG1A 3R73A 4X7QA 3L1SA 2G2FA 3MGYA 3VRYA 4IH8A 1M7QA 2HXQA 2XIRA 4V0GB 4ENXA 1H01A 4BICA 3AD4A 3CY2A 5JGDA 3TUBA 3OEZA 2X0GA 4C4JA 5ITAA 3V8SA 2X7FA 2ZB0A 3NUNA 2X6EA 5HTIA 2E9NA 5CU2A 4CFFA 4KS7A 5ACKA 3UVQA 5BNJA 1OUKA 1Q8UA 3A62A 4DEGA 5JSMA 3MFSA 3HMPA 1OGYA 3EKNA 3RAIA 4PL5A 1GZOA 1IA8A 2GNLA 1KUTA 5D1JA 3RWPA 5AP1A 4YJRA 1FVRA 2UUEA 2F2UA 3SOCA 5IH5A 4D2SA 4O4DA 1IASA 2VU3A 4K77A 4TZRA 3Q2JA 4ZSLA 5JKGA 1Q62A 4M97A 5EDRA 3LFSA 4Y8DA 2YM7A 3PRIA 4BDJA 3E8DA 2GCDA 4E6DA 4W8DA 4QPMA 3RINA 1W0XC 3ORPA 3TKUA 4GV1A 4FV0A 4ZSGA 5B2LA 1UKIA 3BHTA 5CNOA 2HYYA 4PX6A 2WEVA 4RX8A 5E8ZA 4K11A 3V5LA 2G01A 4GYGA 4YPSA 1K3AA 3SVVA 3ZONA 3GU8A 1W2DA 5AR7A 4C57A 1H07A 3GBZA 4MWHA 2GHGA 4H36A 3UIUA 3AD6A 3BBTB 3VRZA 2IJMA 4DGNA 2BIYA 4BWPA 4DEIA 4LI5A 5FQDC 5ACBC 4DE4A 4AQCA 4BZDA 3P79A 4G3GA 3OT8A 2ZM3A 1IAHA 4RQVA 4DH1A 3U6HA 4JRVA 2WIPA 2X9EA 2GNHA 4RLKA 3DCVA 4HZRA 3LCKA 4JIKA 4QMSA 3PUFC 2H8HA 5DRDA 2E9UA 2XK7A 4B6LA 4F6UA 3HP5A 3RPRA 1FVTA 3U4WA 4H05A 2X4FA 5I4NA 2EB3A 2PULA 3FXWA 1IAJA 3F3UA 4HYUA 4YNEA 1JAMA 2NP8A 3TTIA 4BN1A 2BRMA 3BBWA 4V04A 2BR1A 3I4BA 4DFLA 4RMZA 2R3HA 4BTJA 3OWPA 1CKPA 4M67A 4CG8A 1HCKA 2JIUA 2BPMA 2WXVA 4JR3A 2CCIA 5FBNC 3GCSA 4XRLA 4FZDB 4FTCA 3UOJA 4PDPA 1JVPP 4ORKA 3ENMA 3KQ7A 3FPQA 3KK9A 5HHWA 3W0QA 2XK4A 2CN5A 4XS2A 3NUSA 2B0QA 2YZAA 3QZGA 2XNNA 3R8VA 4RVMA 2WPAA 1KV1A 5CALA 5ETFA 4OR5A 1SZMA 2YLFA 4IVBA 3PIZA 2J51A 3FC2A 3LFCA 4MHAA 3MA3A 1BLXA 4F1MA 2B4SB 4UWYA 3MA6A 1TVOA 2YWPA 4EC8A 5IUHA 5EHYA 5IISA 4C37A 3K5VA 4LQMA 3TNIA 5IQGA 2FYSA 1YKRA 1R39A 4FSMA 4RIWB 3TDVA 4MXYA 1ZY4A 1PXLA 3SLSA 4BGQA 4FEQA 2WKMA 2OFVA 1XH9A 3WIKA 2CGWA 2QO9A 1OL7A 2X1NA 4IWQA 1IR3A 4G6NA 3TZ8A 4EJ7A 3BEAA 4PDOA 3OWLA 3FLSA 4LUDA 4YLKA 4CZTA 4FNZA 4EH4A 4EZ3A 5EQYA 2XRWA 2XRUA 4C58A 5E4HA 1BI7A 2AYPA 3BRBA 4KBKA 2CKOA 3K3IA 1GNGA 4TWNA 1WBOA 3BQRA 1R0PA 2NRYA 3RPVA 4IEBA 3PY3A 4DCAA 2EVAA 4KWPA 5KUPA 5IQIA 1PYXA 5AR2A 5J79A 1O9UA 2C6IA 3OBJA 3MN3A 1K9AA 4DGGA 3VW8A 3ZFMA 1FMKA 3VBYA 3WILA 4GFMA 4P2KA 2GNFA 2W1DA 4FC0A 4QYEA 2C5YA 5L2TA 4FUYA 4EHEA 3G9NA 3LM0A 3NX8A 4MXXA 4G1WA 1ZZLA 2IW9A 3QKKA 4UWCA 3NZ0A 4IJ9A 4FE2A 3IW6A 2CKQA 3VS2A 4XG7A 5HVKA 2XB7A 4APCA 3JY0A 3H10A 1ZARA 4UMQA 4CNHA 3GVUA 4HVHA 3RALA 4F9CA 5EYDA 3DB6A 4D1SA 4NM0A 1S9IA 5AAGA 2VO0A 3W16A 4FGBA 5EYMA 4BWXA 2YCSA 3C9WA 5BVFA 3UIMA 3G0EA 4D4SA 4U6RA 2VRXA 5BQ0A 2AUHA 3VBVA 4AXCA 3DGKA 1X8BA 3PFQA 3A8XA 4RA5A 5CQUA 1PMEA 5ANEA 4ZZMA 2RFSA 2QO7A 3EFLA 3IK3A 4B99A 4ZTSA 4D55A 4GEOA 5ICPA 3EN7A 3ACJA 3TZMA 4YZNA 4E1ZA 1BX6A 2YITA 2J0JA 4YJTA 5KMMA 3COHA 5HVYA 2R0UA 4BJJB 4C33A 4FMQA 3KRJA 4EK3A 3PZHA 4FSRA 3UPZA 2BALA 4M69B 4BC6A 3CEKA 4IDTA 1GZ8A 3GFEA 5IA5A 1VJYA 5AP2A 1H08A 2GPHA 2UZDA 1QPJA 3CTHA 3DTCA 4I0TA 3B2WA 3WBLA 4UMUA 2XANA 3FI8A 1Q99A 5HBEA 3HV5A 3MY5A 4WIHA 4E5WA 2O3PA 2PMOX 4LGHA 4EOLA 3V3VA 1E9HA 3BLHA 1B38A 4R7IA 4K6ZA 5HE1A 4AG8A 4EQMA 4F9BA 5KKRC 3PG3A 2YISA 3ZUTA 2R9SA 3BYVA 3MJ2A 2UV2A 1IRKA 3FYJX 4TY1A 4FKGA 4JG7A 2JFLA 3EL8A 3OUNB 5AV4A 4ZSEA 3AT3A 4C3RA 3PXQA 3IGGA 4O0YA 3LW0A 1XR1A 4S2ZA 3P86A 3HECA 4QYHA 3KXHA 2J9MA 5EDQA 5AEPA 1HCLA 2YCRA 4PV0A 4CG9A 4JAJA 5CEKA 5T6KA 3DJ5A 3FLWA 3IDPA 3A7FA 5CT0A 3RBWA 4F63A 3FMJA 3AC5A 5EYKA 3R8PA 1H27A 4ZS0A 2GS2A 2G9XA 3ORNA 3H9FA 3PTGA 5HGIA 4BZNA 4F7JA 3WF7A 1OVEA 2G15A 2VD5A 1ZMUA 1U5QA 3BGZA 4PL3A 4QD6A 3RAHA 4O7YA 2FSMX 5J9YA 2CGUA 3UNZA 3EHAA 5HE0A 1E1VA 4AWIA 3EN6A 2ZMCA 5EFQA 1ZOHA 3C4EA 5HO7A 1AGWA 4RC3A 5HBHA 3R30A 3POOA 4C4GA 4DFYA 1ZYLA 3Q3BA 2XIXA 3QQGA 4FTIA 2C0T