4OGRA

Crystal structure of p-tefb complex with aff4 and tat
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
314
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AFF4 binding to Tat-P-TEFb indirectly stimulates TAR recognition of super elongation complexes at the HIV promoter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/viral protein
molecule keywords Cyclin-dependent kinase 9
total genus 84
structure length 314
sequence length 323
chains with identical sequence E, I
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ogrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ogrA01
2YEXA 4F99A 4HYIA 3TUCA 3CD8A 3ELJA 3KN6A 4ASXA 3TIZA 2YITA 5HO7A 1YW2A 3DXQA 4O91A 4O7SA 3D94A 5DPVA 2IZTA 3JY9A 3W1FA 4F09A 2WZJA 2QOBA 5ANJA 3RKBA 3R7VA 4AT5A 2OZAA 4U3ZA 3TNIA 3VQHA 1G8SA 2I0HA 2V5QA 3EOCA 3QQFA 4GIHA 3EQDA 2W5HA 3QXPA 4G3FA 3ROCA 3VS1A 3COKA 3Q32A 4KKHA 2R3NA 4MXAA 5DBXA 5HORA 5J5SA 5JFXA 3TL8A 2Z7LA 4D58A 5HCYA 2UZVA 4DTBA 4RZWA 4XG9A 3DGKA 3O71A 4X6RA 3S00A 4LMNA 2XH5A 3ORKA 3LCSA 4QD6A 4YBJA 3UO6A 3W32A 4CFWA 4KS8A 4C37A 3UZRA 5IISA 4JQ7A 5AX3A 4EOPA 2YABA 5HKMA 1XH4A 4D5KA 3RVGA 4ACCA 4I6HA 4AN9A 4XBUA 4MWIA 5DN3A 2NO3A 3GCSA 4BN1A 4F0GA 2WMSA 4YUQA 3R00A 5CALA 1UNHA 4ZSGA 4DGGA 2X2KA 3FLNC 4IJPA 4ACDA 5BVKA 4B8LA 3SVVA 4KA3A 2X2LA 5CNOA 2I0YA 3NUYA 3QGWA 4RVKA 4AGWA 4L3PA 4LV5A 3VC4A 3TKIA 1FVTA 4F1OA 3BYVA 2CCIA 4NUSA 1XHAA 4FSYA 3DJ5A 1RDQE 2PVJA 4QQJA 5K5XA 5LWNA 3FZRA 1JQHA 3QX2A 3W2QA 4XBRA 2ZOQA 4D2WA 3WF9A 4XH6A 1Q61A 3LFNA 3QU0A 4D55A 4YC6A 1JSUA 1NY3A 3HV7A 3C0HA 4J52A 2VTIA 3E88A 3NNUA 1B6CB 1JKKA 3AT2A 4FUYA 2XB7A 4F6WA 4GS6A 2ZV7A 4OTHA 2OW3A 2JLDA 2PE1A 3RI1A 4FK3A 4JBQA 1YOJA 2JDRA 4FTUA 5EYMA 3RAHA 5M44A 3PWYA 3MPAA 5IPJA 4WIHA 2C6KA 4BIEA 3MSSA 1DS5A 3VUGA 4M8TA 4BWKA 1R0EA 1OBDA 4M67A 5HGIA 5LJJA 4XOYA 4ALWA 2VTMA 2WTWA 3TUBA 1J3HA 5HNGA 2W96B 2VO3A 3ZC6A 4UXLA 4BCJA 4IM0A 4QQTA 4XRJA 3OP5A 1P14A 2WQEA 3N51A 3OFMA 4YNEA 3SD0A 2WU6A 5J9LA 3DAKA 5HBHA 4YNOA 4DLIA 5F4NA 2O5KA 5H8EA 2B9IA 4GVJA 5DR9A 3CXWA 4UWYA 2Y8OA 3TV4A 2OJ9A 2Z2WA 3HP5A 1HOWA 3GVUA 4XG4A 3IOPA 4AW0A 2WQNA 1GIHA 4UX9A 1JKSA 2JIVA 3R63A 3NCGA 3FQHA 3ZUUA 2RL5A 5E8XA 5A3XA 4BIDA 2VWIA 3RPVA 4ZS0A 3ENMA 4DEIA 3F2RA 3R7EA 2R3JA 2VTOA 3MPTA 3QAME 3RINA 5BUIA 3KN5A 3UVPA 3RMFA 2YCQA 2JFMA 4TY1A 2OKRA 4CRLA 4QP9A 2H96A 3EN5A 3EQGA 3GQLA 2GHGA 2YIYA 4XCUA 4YLLA 5AP4A 3O17A 3HL7A 4F7NA 5C8NA 2QOFA 1SM2A 2ITTA 3TJCA 4DH8A 4YZ9A 5I9VA 3ORPA 2W9FB 3KRWA 4Y72A 2XYUA 2Z02A 3LLAA 2VWUA 4N57A 3RHXA 1UWHA 5EHOA 4HVDA 4O82A 5IQFA 3FYKX 4N0SA 4DFBA 3GXLA 4W8EA 5AUZA 4M7IA 4FTKA 4FTIA 5E8WA 4Z3VA 1M17A 4OTQA 3GI3A 4NCTC 3U51A 2BRBA 2R3MA 3VS0A 1IG1A 4HPUE 4HGTA 4M0ZA 4ANOA 3VW6A 1H00A 1IA9A 3DOGA 2G15A 3HV6A 3TNQB 3KULA 2BPMA 2W5AA 4K9YA 1REKA 4IWDA 5I3RA 2QQ7A 3AG9A 2YFXA 3FI4A 4D1XA 1H24A 3WIGA 1Q8WA 4BI2A 3VBTA 1SMHA 4IC8A 4FEXA 3FMHA 3KL8A 4I41A 4Q2AA 4RC2A 2HELA 3CGOA 3GUBA 4L7FA 4CFVA 4CZYB 1PKDA 1U54B 4AOTA 5E92A 3UYSA 3FPQA 4ENYA 5CEOA 5J9YA 3SHEA 1OGUA 4FSWA 4D4YA 1M2QA 5AP1A 1OZ1A 3ZOSA 4RGJA 3UQGA 5LMKA 3OT3A 4IJ9A 5JFWA 2W1IA 3DB6A 3D0EA 3UOHA 1Q8ZA 2VTHA 4C4GA 4TYEA 3C51A 4CKJA 5AAGA 4C3RA 3ZYAA 4A9TA 2P3GX 4FVPA 4S34A 3W8QA 4O1PA 4BB4A 1DM2A 4NZWB 4DHFA 5A46A 5IUHA 1YOLA 4QP7A 5GJFA 2OXYA 4QMQA 3DQWA 5HESA 3GFEA 4EWHA 1UU9A 4DGOA 3O2MA 4HYHA 1LEWA 2B4SB 2J0JA 3VF9A 4RJ8A 5HIDA 4QMSA 4Y46A 3W2CA 3ZLWA 4BDCA 5L8KA 2OIBA 2W17A 1WVXA 2BRMA 1A48A 3HZTA 5LOHA 2UW9A 1H07A 1V0OA 4GU6A 1VJYA 3QXOA 4F9WA 2VAGA 4X2NA 5LVOA 2YJRA 5IKWA 4FL1A 4CT1A 4N70A 5AIRA 3MI9A 3SDJA 4EHGA 4ORKA 3IGGA 3RAKA 2YA9A 5HLPA 3QTZA 4DLJA 3MY5A 4WHZA 4CZTA 4ZTNA 5ANEA 3ZHPC 1AGWA 3CKXA 3HAMA 3U6JA 4QTEA 4HCVA 5D9HA 4C2VA 1H27A 3NNXA 1IR3A 2Z7RA 1O6YA 4LOOA 4FIJA 2FSOX 2JKOA 3U4UA 2IZRA 5DFPA 3L8SA 4IFCA 1FVVA 3A8XA 3GT8A 2W0JA 2PZRA 3KCFA 4UWBA 5L8LA 2HENA 5AIKA 3NYXA 3CPCA 3QWJA 4WRGA 1O9UA 3RZBA 3BYSA 3FBVA 4N6ZA 2YDJA 3HKOA 3R8UA 4IB0A 5L2TA 3FZPA 3IK3A 3R6XA 1VYWA 3H10A 3RBWA 3C50A 3BZ3A 5JQ5A 2BMCA 2PUPA 3PSBA 2B7AA 4XP0A 1YHVA 3THBA 1CMKE 3QZIA 2HWPA 3PXQA 2Z7SA 2C3KA 4TNDA 3ATSA 2EB2A 5DEWA 3ODZX 4QQCA 3MYGA 1BYGA 4EH5A 3NUAA 2IJMA 1A06A 2VWZA 4IDTA 4R7IA 4AS0A 4F9BA 4NJDA 4Q9ZA 3ZBXA 3D15A 1JWHA 3AC8A 3ZSGA 4I5CA 4EH7A 4ZP5A 3NNVA 3QUEA 1QPCA 3O7LD 3DXNA 5I9YA 4C58A 3A99A 4E1ZA 1YHWA 3LFCA 2XKEA 4X3FA 3RAWA 3NUPA 4KRDA 4HCTA 3EHAA 4I93A 2BAKA 1JLUE 2XKCA 3HNGA 4A9RA 2WKMA 5CVGA 5KO1A 4ZZNA 1W8CA 4EK6A 3MVLA 4LQMA 3B2TA 3JVSA 3EIDA 4Y8DA 5AUYA 4DYMA 1URWA 3MS9A 4D2VA 1OMWA 2CLQA 4E4LA 2ONLA 3GU7A 4YHJA 5HG7A 3UODA 3WYXA 5JFVA 4O81A 4FKLA 4D0XA 2LGCA 4L3JA 3HA6A 3HMIA 2B9JA 1FPUA 3G15A 3L1SA 3VBVA 3EJ1A 2CN8A 4YO6A 4UN0C 3KVWA 4QRCA 4BGHA 2UZWE 2R4BA 3IW8A 4IACA 3Q4TA 4FBXA 5CASA 5GIOE 3R22A 2XK4A 4X2JA 4QO9A 3F3ZA 4MYGA 3VUMA 2R0IA 5HHWA 1OIYA 4OTRA 5BYZA 2HWOA 2WEIA 3RAIA 4XMOA 3RWQA 2OJFE 4X21A 4ARKA 5DYJA 4OUCA 3HUCA 4ZSAA 2QG7A 1BI7A 4RJ7A 3IO7A 2Z7QA 3RM6A 4R7BA 3WF6A 4OAUC 1Q3DA 3KRXA 2BRHA 3NSZA 3FL5A 2G9XA 4EH3A 3LFBA 4PNIA 3E87A 1OIRA 3ULZA 3EYGA 4RVTA 2YM4A 4L00A 5JGDA 3F82A 1OKVA 3KVXA 3TV6A 5HBJA 4R77A 4I6BA 4AACA 3TM0A 2G2HA 2PY3A 3V8SA 3AMBA 3EQCA 4JR7A 4F7JA 5BVDA 5EG3A 1OUKA 2XMYA 2W4KA 4WBBB 1V1KA 2OU7A 2ZMDA 4C57A 3GU5A 3LJ2A 5GZ8A 3IS5A 2J5EA 1O6LA 3ZRMA 3D2IA 3V04A 3ZFXA 3UIBA 1YWVA 3H9FA 3U8WA 5IA3A 1L8TA 5IQAA 4FTLA 1FMKA 4W9WA 2W99B 2YM3A 2YM7A 3MIAA 3PXYA 2QO2A 4JQEA 4UYAA 2QVSE 3NVKI 4AG8A 2GS7A 3GC9A 2X39A 3QCYA 3R2BA 3R7YA 5DRBA 1A9UA 2O65A 3BWJA 3WARA 2R3GA 4GT5A 4P2KA 4C33A 2X81A 5GJGA 4CYIA 4E5WA 4YSJA 3BU5A 4G5JA 4XRLA 4RX8A 2ZYBA 3ZU7A 3FZOA 2UW4A 2UZEA 2V55A 3UPXA 5M09A 3ZC5A 3GBZA 1PMEA 2BZKB 3OT8A 4O27B 4OW8A 4ZOGA 5EKNA 3MTLA 3UMXA 2OJGA 3I7CA 3W2SA 4DT8A 2Q83A 4CSVA 5CSWA 1FINA 3FV8A 4B7TA 2CPKE 4AWIA 1XKKA 1GZNA 4RT7A 3AC5A 2WGJA 4FTQA 5E8SA 4CQEA 2PVRA 3WBLA 1UA2A 4HYUA 4M0YA 4L67A 4YJPA 1DAWA 3EMGA 3NIEA 4FTNA 2QO7A 4NM0A 4M12A 5LVMA 3NCZA 5J5TA 1EH4A 5A4TA 2VNYA 4NTSA 4J98A 4XV1A 5I3OA 3A7FA 3Q96A 4YZCA 4I0TA 2BAQA 4AA0A 1L3RE 3GCPA 4TPTA 4KNBA 3BLQA 4EOKA 1DI9A 3MH0A 3RPOA 2ZM3A 4X3FC 4FKQA 3NEWA 3BI6A 2XNPA 2XCKA 3DKGA 4JXFA 2E2BA 3R1QA 2R3KA 4EI4A 4XHKB 2IPXA 1E1VA 1U59A 4TWNA 3CBLA 3QYWA 2JC6A 4L68A 4XG3A 4D9TA 5JSMA 4U81A 1OBGA 4MXYA 5IMXA 2B53A 2ERZE 4TNBA 3DTWA 3OY1A 4A9SA 4QYHA 2CKEA 1XH5A 4FV8A 1H01A 3LQ8A 3P78A 3FLSA 3P7AA 4QP4A 3TACA 2PVLA 3ZRKA 5EI6A 4AZSA 4RZVA 4TWPA 3MESA 4YTIA 3HA8A 1K3AA 1B39A 2WELA 3QA8A 5AP6A 4GFMA 5KMMA 4FSTA 2W1EA 2YISA 4TTHB 2VN9A 3MDYA 2J6MA 3R1NA 4TL0A 4G34A 1BL6A 2XJ0A 4IAYA 2WAJA 4MNFA 3DBQA 4WG4A 5BVEA 4ANLA 3MH2A 2ETRA 4WRSA 4IZYA 4IZAA 2JGZA 3RTPA 4BC6A 3PY3A 4MD8E 2REIA 4C2WA 1ZMWA 4XUFA 3KGAA 5HOAA 4APCA 5K5NA 4R8QA 2UW6A 3PJ2A 2XP2A 3ZLXA 3PP1A 4BZDA 4FKGA 5BMSA 2X9FA 3C13A 4XYFA 4AA4A 4XG6A 3AMYA 4FV5A 5ANGA 2BDWA 3Q52A 2PE2A 4BBMA 3R73A 4MBIA 4IVCA 4FODA 3O8PA 5DIAA 5B0XA 5HX8A 4U40A 3HV4A 4EH4A 4IEBA 3BGZA 5DEYA 2G2FA 2BALA 3QCQA 3FHIA 3MY0A 4U79A 2VNWA 2FSLX 3MVHA 4AGUA 4NIFA 3FXZA 3D9VA 2OFUA 1LPUA 1Q4LA 2RFEA 1OM1A 4QMVA 4ALVA 3LXNA 3R21A 3QD2B 4NSTA 1Y57A 4MH7A 4BDGA 3QRUA 3CCNA 4UWCA 5CU3A 3SXFA 2B1PA 3LAUA 3LMHA 2W1GA 2O63A 4S33A 4YZBA 5C4LA 4FIFA 1KUTA 3UYTA 3AOXA 4AAAA 3QQLA 4I6QA 4QYGA 3UDBA 4AT4A 3VQUA 2XS0A 4EJ7A 3PG3A 4QMNA 2GNHA 2YWPA 4B6LA 3QZHA 3IDPA 2C0OA 3TNHA 4DAWA 4XX9A 4GSBA 4N6YA 5TO8A 4G3CA 4YMJA 4DBXA 2H9VA 1KWPA 3QQGA 5KE0A 2GQRA 1IEPA 5M06A 3NWWA 3P7CA 4E6CA 5T3QA 4D1SA 2G1TA 3O8TA 3ZM4A 5DNRA 5CY3A 3ZXTA 3ET7A 3NGAA 4X3FB 3ZRLA 4BI1A 3SRVB 3TUDA 3DZQA 1JKTA 3VBWA 1PHKA 3BQRA 2GNLA 3TTIA 3LXKA 4GYGA 3WF5A 2C5XA 1Q62A 2XIZA 3K54A 4E8AA 3PXFA 5ANKA 4AGDA 5HVJA 4UY9A 4O0WA 3WZEA 1OKYA 5HLWA 2QR7A 4IX4A 5HG5A 4XNEA 4C4JA 5L3AA 5IUGA 5HO8A 1YDSE 2WMBA 1XBCA 2WMRA 4UMTA 3ZFMA 5BMMA 5CAOA 4FSNA 3MGYA 3AXWA 4H3BA 3FC1X 3U9NA 4U41A 5H8BA 1GJOA 2ZDTA 3CJGA 3BELA 3DKCA 4QMMA 3E93A 5EDQA 3BV2A 2F2UA 4G16A 3BBTB 4FSQA 4KSPA 1ZZ2A 5JRSA 2W1CA 2QOHA 1JSVA 4LG4A 1OL5A 1PXKA 5AUXA 5C27A 2I7QA 3KF7A 3H0ZA 2FH9A 5CVFA 4O2ZA 4QTAA 4RSSA 1GNGA 4IX6A 4YLKA 4AF3A 3BHYA 5KHWA 3RALA 2C5OA 3H30A 5AWMA 5FXQA 3ZSHA 3G2FA 1Y91A 3JYAA 3PUPA 4BR3A 3TEIA 2ETKA 4NEUA 3VN9A 4TZRA 4BCNA 3A62A 3MVJA 3AC3A 3AC2A 5CAUA 3F88A 3FPMA 4EK8A 5E7RA 2I0EA 4IB5A 3QFVA 4PF4A 4CLJA 5IQBA 3DLSA 4C0TA 3VW8A 4ZXTA 1Q99A 5IQEA 2XCHA 2JD5A 3I0OA 2Y4IB 4MD7E 5AP5A 4CFMA 3LOKA 3FLWA 3Q4ZA 3UGCA 2XVDA 1H08A 1PXMA 4RFZA 4FMQA 3DKFA 2CKQA 2J51A 4JRNA 4WNKA 1ZRZA 5ETIA 1OKWA 3PA5A 3LHJA 4QMLA 5KMLA 4EOIA 4IWPA 5E90A 3NMUF 3QRTA 3BPRA 4LGHA 1KOAA 4EHVA 3OHTA 3QD0A 5FBNC 3AT3A 1V0BA 3F3UA 1F5QA 4IH8A 4OTGA 5DHJA 2XNBA 5FXSA 2VTAA 2VTPA 1URCA 1UU3A 3BBWA 3H0YA 4Y5QA 4YJQA 4KUJA 5CZIA 1NVQA 3NYVA 4DFUA 5KBQA 4V0GA 2JITA 2C3IB 1U46A 2GNFA 5IA0A 3FSFA 4X3JA 5FLFA 3GQIA 3UOLA 3FMLA 4ID7A 3V5JA 5JK3A 3A4PA 3GNIB 1YDRE 2QD9A 5AV3A 1OVEA 4LGDA 1Q8TA 4WBOA 3UMWA 2C6DA 4DH3A 4RX7A 4IE9A 3F5GA 4S31A 4JR3A 3UVQA 4RIOA 3UQCA 2BIKB 4HVGA 3HYHA 4LUDA 2QHNA 3QTUA 1UNGA 4I6FA 3LE6A 5AR3A 5IDNA 3PVWA 3SW4A 1REJA 3PA4A 3NS9A 3SC1A 2IWIA 3MWUA 3Q5IA 3QQJA 3EQHA 4YSMA 3PIZA 4PTEA 2EUFB 4NJ3A 5HNIX 3TZ7A 2AC5A 5IH6A 3C4FA 4Q5HA 4V0GB 2C5VA 5HQ0A 4GT3A 5AJQA 1K9AA 2ZV2A 4MNEB 2ITZA 2Y7JA 4OTDA 4WO5A 5B2MA 4AGCA 3CR0A 2WTCA 1Q97A 1J1CA 4AXAA 2I1MA 3MPMA 4KD1A 1TQMA 5ETFA 4CT2A 2R3HA 4O1OA 2HZ4A 2CGUA 3Q53A 4EH6A 5KMNA 2WTIA 5IA4A 2FVDA 4QP3A 2BCJA 4LRMA 3B2WA 1UNLA 3TKUA 3QTSA 1H1RA 3OROA 1QPEA 2PHKA 4GUBA 5F95A 3SA0A 2QI8A 2OGVA 3OTUA 3VJNA 3FMDA 4BWXA 4CD0A 4C7TA 4UBAA 4AZTA 3V5QA 2CLXA 3Q4CA 4QMUA 3R71A 1ZMUA 2P55A 3FI2A 5LCJA 2WTKC 2XZSA 1LR4A 3GGFA 2UZNA 5D41A 4TRLA 3N4TA 1XJDA 4X2FA 3OWPA 5CI6A 1W7HA 2JDOA 4YPDA 3GC7A 5CQWA 4BCGA 3CC6A 5CX9A 2R3QA 3KULB 3NUUA 1KE6A 5FUTA 3PXRA 4F1TA 2X7OA 4M69B 4O0YA 1OITA 1OPKA 4UMRA 2H34A 3PP0A 5FWKK 4E93A 2R3RA 4AN3A 1QPJA 5JQ8A 4JJRA 3ID6C 4PY1A 5EFQA 4RX5A 4RWLA 2G2IA 4KBAA 4D2TA 1DI8A 5B7VA 2I0VA 2VUWA 2XNMA 3EL8A 3ZO1A 3UVRA 4BDFA 3UIXA 2WHBA 1LP4A 4O0TA 5CF6A 3RCJA 1QL6A 2XIYA 3PSDA 4GVAA 4BTFA 4DGMA 4M97A 3SKCA 3W16A 1E9HA 5JGBA 5HEZA 4QMYA 3LQ3A 3OY3A 1PY5A 3HDNA 1WBTA 5KZ0A 3OWJA 4MXZA 4R5SA 4J96A 1XH8A 4YHFA 3ZH8A 3LMGA 4IHPA 2C6OA 3LPBA 3BHVA 5IU2A 4GK3A 4RC4A 4XG2A 3QC4A 2DWBA 2X8EA 1BI8A 2A19B 2B9FA 4FT7A 2PVHA 5CU2A 3I7BA 4FF8A 3DU8A 2J0KA 5E4HA 4Z9LA 5KZIA 4YTHA 3UO5A 4WG3A 3O23A 3R01A 2PL0A 4YZNA 4D4VA 3QRJA 5HBEA 5CF4A 4BHNA 3RK7A 3QTRA 3SV0A 2VO6A 3UNZA 4O0VA 5IQIA 1V0PA 2GTNA 3NPCA 4O0SA 3RGFA 5K9IA 5FTGA 4G6LA 5HTCA 3G90X 4Y5HA 5AP7A 5ACKA 4QMXA 3R9OA 3OCSA 3RPRA 3V5LA 3QL8A 4GJ3A 4EONA 3W10A 2YM5A 3CGFA 5FEEA 3R8MA 1IAHA 4XLVA 5CSVA 4J97A 4GJ2A 5M07A 3HRCA 1MRVA 3SRVA 2ITWA 3EQFA 4C59A 4AT3A 2WB8A 5DT0A 4AA5A 5HI2A 4E3CA 1YOMA 3R7UA 4JL9A 2BIYA 4D2RA 2VTRA 2C47A 2Y0AA 4FV7A 1OUYA 3U6HA 2OJIA 2W1ZA 1YKRA 3G51A 2BHHA 3PRFA 4RC3A 1R0PA 3OBGA 3PJ8A 1YXSA 4WT6A 3BEAA 1GZ8A 4ZJIA 3CJFA 3UIMA 3C4ZA 4K8AA 3IG7A 3I1AA 1I44A 4BCOA 4EWQA 3LXPA 2X8DA 4E20A 1APME 4XS2A 2R9SA 1ZY4A 5EKOA 3DAEA 2PZIA 2UZOA 3FLZA 2A0CX 4IC7A 1PYEA 4PL3A 1O6KA 1UKHA 4FV3A 5TT7A 4ERKA 4QPMA 4C36A 2BVAA 3POOA 3MB6A 2YM8A 2XK8A 4WSQA 4PMPA 4F70A 1PXIA 3Q04A 4DN5A 1M52A 5CEQA 3UTOA 5EI2A 4Y83A 4MXOA 2NPQA 1GAGA 5I9WA 4FKIA 4WOVA 4BDAA 4PDOA 5F94A 4CTCA 4UEUA 4JDHA 3WIKA 4JDIA 3VHKA 4CTBA 5IA2A 4MKCA 2GU8A 1R3CA 1SZMA 1VR2A 2X6EA 4L42A 3C0GA 4NFNA 4A7CA 4F1MA 2XBJA 3PY0A 3RPSA 2VWVA 4DC2A 4E6AA 1UVRA 1YXUA 3PVGA 4PTCA 3OD6X 3AD6A 3V01A 2FO0A 2VGOA 3OXZA 4MBJA 3R8PA 2IG7A 3MH3A 1VZOA 2X4ZA 4CCUA 3LFFA 4D4RA 4DITA 4UYNA 2OFVA 3QTXA 4MQ1A 4DFXE 4TYGA 2JDVA 2YDIA 4FEWA 3LFAA 2BZJA 2YCFA 3A60A 2PYWA 1M2RA 2XKDA 3DJ7A 5F20A 4UV0A 2GDOA 3QZGA 3DXPA 2F7EE 3CEKA 3PTGA 4C38A 5AR4A 2SRCA 1ZOEA 2XKFA 2ITXA 1G3NA 3R2YA 3DBDA 4BGQA 4DF3A 4F7LA 2R7IA 2BZIB 2VTTA 3G6HA 2OSCA 3U6IA 2VGPA 4O84A 3UP7A 4FVRA 1IA8A 3IECA 3OWKA 4DH1A 4R1YA 5HG8A 3NDMA 3VUDA 3AC1A 4CG9A 3HGKA 2VWBA 5AV1A 4OT6A 2X0GA 3TZ9A 4E6DA 3FMNA 3LQ5A 4CMTA 4EHZA 4YLJA 4MWHA 1PXLA 2UVZA 2VX1A 4IMYA 5JEBA 2YM6A 4I92A 3NYNA 4NW6A 4ZS4A 4C4FA 5M56A 2OXXA 3U54A 2VTQA 3K5UA 2UVYA 5GHVA 3D7TB 3D83A 4DEEA 5CWZA 4NIFB 4BKYA 2QU6A 5DRDA 2XIXA 2WD1A 3KXMA 3DCVA 3RK9A 2VD5A 5G6VA 5FTOA 1BKXA 4YJTA 4O38A 4FT5A 1IRKA 2C3LA 4PDSA 5I9XA 4DEGA 4EOJA 1FBNA 5DLSA 4DBNA 4YHTA 1XR1A 4KSQA 3NIZA 3KKVA 4YGAA 2GS2A 4L3LA 4QMWA 3GC8A 3F7WA 4IVAA 4WG5A 4DCAA 2HK5A 4FIIA 4U42A 5J87A 2ERKA 5HTBA 4A9UA 3PVBA 2XIRA 3MFUA 3TNPC 3BGPA 3ORXA 2IN6A 4MD9E 3PYYA 1B38A 3NUXA 4L43A 5M55A 3REPA 2PUIA 2DUVA 3AC4A 3DNDA 4BZNA 2HOGA 1PJKA 3BX5A 2J0LA 3O0GA 4K11A 4APPA 4USEA 4DG2E 3ZLSA 5H3QA 2NRUA 4AZWA 4FNZA 3I5ZA 4RJ5A 2UZBA 1MRUA 3R0TA 4DFLA 4OGRA 5EDPA 3BE2A 4YO4A 1H1WA 3BHTA 4FC0A 2WTKB 4M13A 1J7LA 2QG5A 3UC3A 3EN7A 4GW8A 3U87A 4GEOA 3OUKA 4FZ7A 4H3PA 3R9NA 4DINA 2BZHB 4E73A 2V22A 3CTHA 3LW0A 1X8BA 3BYMA 3R8ZA 3VF8A 4AFEA 4ZEGA 5C1QB 3E64A 2A2AA 4CQGA 2XK3A 3B8RA 1SVHA 5M51A 3P08A 4FTMA 3C9WA 4RX9A 3RCDA 4PP7A 1IASA 4KABA 4JBPA 1YHSA 4JX3A 3VS3A 4G9CA 1PRYA 3R02A 2PE0A 5CT0A 3QGYA 4BY9E 3JPVA 5EYCA 1H25A 3GC0A 1WCCA 5EW9A 2WIPA 5JRQA 5E9EA 3HVCA 4BI0A 1BUHA 3M1SA 5L2WA 3PZHA 5BPYA 4G3EA 4ZZOA 3MIYA 3KMUA 3TXOA 4C4HA 4PPBA 3FC2A 4BCHA 4BDKA 4OAVB 2WXVA 3EN9A 4RFMA 4F6SA 5A4EA 3LCOA 4HJOA 1Y6BA 4EUTA 2GSFA 3IPHA 2QLQA 3FXXA 5L2SA 2C0TA 3PIXA 3VIDA 4JIKA 3V5TA 2C68A 3RP9A 5CF8A 3UPZA 4BYIA 4FEUA 5AP0A 3LCDA 3PE2A 4HNFA 3KXNA 1UU8A 2JAVA 4BF2A 4FT9A 2YHVA 3EWHA 4KBKA 1OI9A 3TTJA 1NVRA 5AUTA 5EQYA 2Y6OA 3G9NA 3KU2A 4GMYA 3HMOA 4XV2A 2P2IA 3HMMA 1RQQA 2OWBA 4PRJA 4YP8A 1YVJA 2RG6A 4ONAA 4TYJA 1SNUA 4AW2A 2YIQA 4TWOA 1CTPE 3M42A 4ZTHA 5JZNA 2VO7A 2JBOA 5DH3A 4AZFA 2ZV9A 5CU0A 2B52A 3GCQA 4KBCA 1HCLA 2R3IA 4D9UA 2Q0BA 4IVBA 4EL9A 2EVAA 4NK9A 4P4CA 2QOQA 5CS6A 4AZVA 5H2UA 4CKIA 5EH0A 3FMKA 3PJ1A 3T9TA 4EQCA 2GQSA 4BCQA 4G5PA 5CF5A 2PPQA 5E8YA 1OL2A 3NUNA 4WUAA 5T6KA 4A4LA 3KEXA 4PX6A 5EM5A 2CN5A 4L53A 3R7OA 5I4NA 4OR5A 3HRBA 2RSVA 4OBOA 4GFGA 2C4GA 3E8EA 3LZBA 4XG7A 4AZEA 4FTRA 5I0BA 4I20A 2OG8A 2C0IA 2W7XA 4YURA 2OF4A 5IZFA 4O7YA 2ZAZA 3QLFA 4HGLA 4K33A 2UZTA 3C4CA 2J5FA 3PFQA 2HYYA 2P4IA 3IW6A 3OCTA 4IWQA 1YRPA 2I6LA 3AT4A 4JI9A 1IAJA 4O7ZA 4FIGA 1I09A 2BR1A 4FIEA 4YJNA 3D4QA 3PJ3A 1Q8YA 1MP8A 5E8UA 5K0XA 2XIKA 1OECA 3BLRA 4JBOA 4BKJA 4R7HA 5HD7A 5BVFA 3ORZA 4FI1A 5GINE 3CQUA 1ZOHA 3OCBA 2HAKA 1J91A 3DNEA 2ACXA 3EQBA 3KXZA 3FHRA 2XNGA 5KHXA 1YXVA 3ZDUA 5CEMA 4QTCA 3QTWA 5CNNA 3I5NA 3EZVA 4CYJA 5AR5A 2C69A 3BHUA 3UO4A 5CAVA 3EYHA 2VU3A 3FZTA 4M68A 5CLPA 5ACBC 4RA5A 3OEFX 3SOAA 3K5VA 4DFNA 2XRUA 1CKPA 4G3DA 3U9CA 2BFXA 4MXXA 4GIIA 1YDTE 4U43A 4FNXA 1FQ1B 5FM3A 4O83A 2WTDA 4RQKA 4ANSA 1WMKA 3EB0A 4PDYA 3VO3A 2R3FA 5FBOA 4FX3A 4YJOA 3RK5A 3K3JA 4OTPA 5KKRC 2C3JA 4O7LA 3CP9A 5HG9A 2XUUA 3DAJA 3C4EA 2ZMCA 2WMUA 3KXGA 1Z9XA 2XJ2A 2VO0A 3P23A 4P7EA 3BQCA 4EEVA 4EOQA 4JQ8A 3DLZA 5G1XA 4AP7A 4IAKA 3A7GA 5CI7A 3TV7A 4WNOA 5AR2A 4EBVA 1F0QA 3OBJA 4BDEA 5IEVA 2IVUA 2JIUA 4R5YA 4LUEA 1SVEA 3LKMA 3MY1A 4WNMA 2ITNA 4U5JA 4ZSLA 3HRFA 3QX4A 4BBEA 4EK4A 3F5UA 5LMAA 1Y8GA 3WF8A 5A54A 5H8GA 1ZYSA 2J90A 1GIJA 1WFCA 3EL7A 3FSKA 3ROYA 2CKOA 3PXKA 3ZONA 3QCSA 1YXTA 3MFSA 2OLCA 2FA2A 4DT9A 5DA3A 4JAJA 2ONLC 4G2FA 3QRIA 4FZAB 4PMSA 5CEIA 1R39A 3VS2A 4KKEA 2OH0E 4RG0A 3VS5A 3WE8A 4TXCA 3L8VA 4I5MA 5M53A 4ERWA 4Z7HA 4UXQA 3NW6A 4XG8A 1XH7A 3S3IA 4QYFA 3A7IA 2W1FA 5HE2A 3VUTA 1Y6AA 4FKTA 4MAOA 5KMKA 2JEDA 4N4SA 2YIXA 3WE4A 3IKAA 4BWPA 5A4QA 5LARA 5ICPA 4JIAA 5AUWA 5ETAA 2PULA 3E8CA 4UB7A 3ZMMA 3TN8A 3QYZA 5M4FA 2UVXA 3BEGA 2QOIA 3SLSA 1MUOA 1H0VA 2PMLX 4QT1A 2WMWA 3ETAA 4QYYA 3UNKA 3JVRA 4FGRA 4QMOA 3CE3A 4FK6A 4HPTE 4C4IA 3FLYA 4FZDB 4BHZA 4O6EA 4O0UA 2BRGA 2OI4X 2PVNA 1ZAOA 2WO6A 1NT2A 4B9DA 2J2IB 4X7QA 4Z55A 3O50A 4W9XA 4FGBA 5LWMA 2VWXA 2FSMX 3PE1A 2IW6A 4RPVA 2X2MA 3Q2MA 3JS2A 4LYNA 1KE5A 2A4LA 4FG8A 4YBKA 5BVWA 3ZUTA 2UW7A 5CSPA 4EZ7A 4ZK5A 4X2KA 3BKBA 1JOWB 4QPSA 3PLSA 3V8TA 1PMNA 4WNPA 3COIA 3IW7A 3NW7A 3TNWA 3WZUA 4DEHA 4FYOA 2E9NA 4B4LA 4S32A 4FIHA 4U8ZA 1JBPE 4Y85A 4GG5A 5HIEA 4DE4A 3CTJA 4BTJA 5LQFA 2AC3A 3H4JA 4L45A 4EZ3A 2E9OA 4LV8A 3DA6A 3JR1A 5B2LA 4U9AA 3OXTA 2QLUA 4D0WA 2VRXA 1LEZA 2QO9A 3LCTA 1H8FA 4HZSA 4ITIA 4FV6A 4YJSA 3QQKA 3NR9A 3VBXA 5FGKA 3ZO3A 1TQPA 3AD4A 2A1AB 3KF4A 3BWFA 3I79A 2IW9A 2BROA 2XM8A 4RJ3A 4O22A 2HXQA 4GT4A 5L2IA 5DGZA 5KNJA 5HNBA 4CG8A 3FQSA 3FQEA 3QUDA 2YACA 2QOKA 1ZYLA 3DK3A 1VYZA 3EFKA 4ACHA 1UKIA 1JNKA 5IUIA 3Q4UA 3E3PA 5AV4A 4RIXB 4ITHA 3R8VA 4CZUA 1ZARA 5L4QA 5EHLA 4EQMA 2P33A 3EFWA 5LVNA 4MBLA 3FE3A 3E3BX 3DDQA 1GIIA 4EKLA 1PF8A 4DGNA 1OL7A 3G0EA 4RVMA 4JG7A 3U4WA 4CLIA 3OZ6A 3QC9A 3W18A 3KMWA 4FSZA 3JUHA 3PY1A 4C62A 1YI4A 4IAIA 2GCDA 3OCGA 1BL7A 3CS9A 1T46A 4QYEA 3T8OA 4CGAA 4RMZA 5M4UA 3WZDA 4II5A 4QPAA 2QCSA 3ORLA 5AADA 3LFQA 2CNUA 1M2PA 2XA4A 4CEGA 4BICA 4D4SA 1Q8UA 2IO6A 3QALE 3WOWA 3DS6A 4OBQA 4CKRA 5DWRA 4W8DA 3S4QA 4FV2A 4Q5EA 4BDBA 4HYSA 3K3IA 3L9MA 4KIQA 4EC8A 3FUPA 3DBCA 3P1AA 5AP3A 1TKIA 4M15A 2J0IA 3TZ8A 3D5UA 4GG7A 5DOSA 5LMKC 4O86A 3U55A 2BKKA 2JKKA 2YCSA 5C8MA 4HVSA 3WZJA 3ZXZA 2IW8A 2RF9A 3UG1A 5KBRA 1AD5A 4O7TA 4W4WA 2WOUA 4NTTA 3R9DA 2CNVA 4GKHA 4IAFA 2OIQA 4I22A 4D2PA 3BHHA 3LJ1A 4YZMA 2PMOX 3AGLA 3NW5A 4J7BA 3TJDA 2PVMA 3DJ6A 4ZTQA 2ITYA 4FL2A 4IVDA 4GK4A 4PP9A 3FKOA 3CD3A 3GCUA 5CTPA 3RJCA 1BLXA 3CIKA 4V01A 3VVHA 4ANNA 3PVUA 2XYNA 4ITJA 3GP0A 2QOOA 1WZYA 2XNEA 2J4ZA 2Y6MA 4HCUA 4O7WA 4ENXA 2OO8X 2X4FA 5EQPA 2CGVA 5DT3A 3IW4A 4K1BA 1VEBA 3R30A 4RQVA 2VTLA 2WEVA 3ERKA 3QZFA 4G1WA 3HEGA 4ACMA 4ANBA 3ZO2A 3EFJA 5L6PA 4S2ZA 2XK6A 4UMQA 3E7OA 4D28A 2HZNA 4FKWA 2VWWA 4CFUA 3QLGA 2GFCA 1GZOA 1PKGA 3K2LA 4FR4A 3BYUA 1Q5KA 3CQEA 4AN2A 2R3OA 3UG2A 2PVKA 1KE9A 4XP3A 1PMVA 4NYEA 4IW0A 2ITOA 5AA9A 4Q9SA 4AU8A 2HXLA 5AP2A 5CAQA 3W55A 4U6RA 2IZSA 5IG1A 2VX0A 5LMBA 3D2KA 4U7ZA 4ZZMA 5K0KA 4YU2A 3NYOA 4FKUA 4KIOA 4CV8A 3R7IA 2UZDA 5FP5A 5I9ZA 4UALA 4C3PA 3W2OA 2GS6A 4C61A 5AX9A 2BRNA 2XNNA 4GL9A 4QNYA 3RM7A 4K77A 1YWRA 3FYJX 3S95A 4ZMFA 2PUNA 2YERA 1WBVA 2IVTA 1SNXA 5CZHA 2GNGA 3F6XA 2F2CB 2EXEA 2QOCA 4I3ZA 2W9ZB 5GZAA 2WMQA 2QURA 1ZYJA 3E92A 3CPBA 5FRIA 2VV9A 1YWNA 3TDWA 4OTIA 3KK9A 3MJ1A 2CCHA 5A6NA 4XJ0A 4BCPA 3ODYX 4EQUA 5HCZA 4FSRA 2O0UA 4D1ZA 4QMZA 2QHMA 5FXRA 3DQXA 3HLLA 4WD5A 5C01A 4B8MA 5L6OA 1J1BA 4PPAA 5ANIA 2BUJA 5EHYA 2LAVA 3VRZA 4ZY5A 3MN3A 4WSYA 3N4UA 3ZZWA 3GB2A 4FVQA 3SG9A 3RHKA 2F7XE 2EU9A 1Q24A 4P5QA 4YTCA 5ETCA 4QP6A 2HIWA 5CVHA 4KIKA 5K4JA 2IVVA 4O0XA 3VJOA 4FKOA 3NLBA 4BKZA 2XBAA 2PU8A 4W4XA 4IBMA 4K2RA 3CLYA 4M84A 3MFRA 5I5ZA 2C30A 1ZYCA 3MBLA 4M3QA 4RIYA 2W05A 5GIPE 2NRYA 1W98A 2W5BA 4CNHA 2C6MA 3COMA 3JY0A 3KMMA 2GFSA 3L8PA 3MJ2A 4DFYA 4F9CA 4ZAUA 4JOAA 3ULIA 2HW6A 2V7OA 3COHA 1S9JA 2B9HA 3D14A 4ZY6A 2ESMA 3OC1A 1SYKA 3QTQA 5DI1A 5D12A 3P9JA 3VS6A 3KRLA 3KA0A 3ORNA 3RNYA 1T45A 4HVIA 1PXOA 4CMUA 3EN6A 2QOLA 4L8MA 3FMJA 2NP8A 3IQ7A 1W0XC 3WF7A 4I5HA 2XK9A 4ZJJA 2PTKA 3N9XA 4JDKA 2C5NA 4MVFA 4CRSA 3S0OA 4IQ6A 2IVSA 2UV2A 3FMMA 2EXMA 4NWMA 1XH9A 2G01A 3G33A 2OK1A 3IOKA 4L7SA 2BDJA 1WBPA 3QQUA 1NW1A 3W2PA 1H28A 2YAKA 4NU1A 4RVLA 5EOLA 3ZZEA 3UZTA 4FEQA 1PXJA 2O8YA 3POZA 1GY3A 2HZIA 1MQBA 3HMPA 4EK5A 3FL4A 2CNQA 4H3QA 4E4NA 4K0YA 2QONA 4FKVA 4DH7A 2C6LA 4YZDA 2OZOA 4O96A 3ENHA 1WAKA 3E7VA 3KFAA 4KB8A 3FY2A 4KIPA 4C35A 4CV9A 1ZOGA 4MF1A 4PTGA 4BTKA 3JXWA 4IFGA 4KAOA 2AYPA 1ZWSA 1MQ4A 3DKOA 4USDA 4F08A 1E1XA 4HOKA 2C5YA 3Q5ZA 3SOCA 3Q9WA 4EH2A 3QHRA 1W84A 4YC3A 5M4CA 5GNKA 2XEZA 3QKMA 4J71A 2JDSA 5E8ZA 2ZB1A 4EH8A 4FOBA 4BDDA 3MTFA 4R3PA 5BUJA 3OF0A 4IXPA 4JAIA 2GNJA 2CHLA 5J7HA 3F69A 3DV3A 2C6EA 3EN4A 3ORTA 4ZJVA 5J79A 3PIYA 2NNWB 1OPJA 2UW8A 3ACJA 3M11A 3ZTXA 5HD4A 2BHEA 3R1YA 1R1WA 2W1DA 1W83A 3L9LA 4KIKB 3W2RA 5JH6A 1RW8A 2IZUA 3GU8A 3IW5A 4M69A 4P90A 3KRRA 3HAVA 4F65A 1GOLA 4JX7A 4CFXA 3TKHA 4EJNA 3MFTA 5F9EA 3KXXA 3OMVA 5IH4A 3UP2A 3OTVA 5AV2A 1OL6A 3BV3A 4AW1A 1KOBA 3OEZA 3SXRA 4BL1A 3NRMA 3S1HA 3H9OA 3WI6A 4O2PA 3F2NA 5FDPA 3D5VA 1Z5MA 3GEQA 4FYNA 3VWAA 2J0MB 3O96A 4X2GA 3EFLA 2R7BA 3ITZA 4LL0A 3PPKA 4HGSA 1K2PA 4C3FA 5EM6A 5BYLA 4EKKA 2XF0A 1ZXEA 2FB8A 5EK7A 5H9BA 3TI1A 4C8BA 4FOCA 4DCEA 4U45A 4FV1A 3E8DA 3NAXA 5DT4A 1FVRA 5FP6A 4F6UA 4NH1A 2OICA 3FI3A 4OLIA 4UZHA 5TOZA 3LLTA 3P5KA 3GU4A 4Y73A 3FY0A 4ASEA 4ZTLA 2EB3A 1AQ1A 4IANA 4HVHA 2VZ6A 3E62A 1G8AA 2R5TA 3MH1A 2PK9A 4L46A 3W33A 5KMJA 3UIUA 4AOJA 4MQ2A 4F0IA 5JGAA 3DPKA 1WVWA 4LI5A 1CDKA 2V62A 3LXLA 5A4LA 4F0FA 3TWJA 2WQBA 4YJUA 4BCFA 4DTKA 1TVOA 5KCVA 3EQPA 3Q6WA 1STCE 4YPSA 3NAYA 5BVNA 4RA4A 4NT4A 4KKGA 2ZM4A 4FKRA 4R3RA 4F7SA 1RJBA 3L9NA 5ITAA 3FKNA 2BDFA 4FKPA 3TZMA 4M14A 4OTFA 3A2CA 1M14A 3ZLYA 1KSWA 3UC4A 1WVYA 4OTWA 4A4OA 2BAJA 4GV1A 4FKJA 3BCEA 5D11A 1WBNA 3R8LA 5CENA 4EH9A 2JKQA 4PL4A 5JN2A 5AUVA 2P2HA 1M7QA 2ETMA 5KX8A 5CU4A 4EZ5A 5LVPA 2JDTA 4ANQA 2GPHA 2KTYA 3F5XA 3VUKA 5IQCA 4DFZE 5IQGA 3M2WA 2JAMA 4A06A 1F3MC 3EKKA 3NZ0A 2JFLA 4H36A 5A9UA 5AR8A 3LJ0A 3BRBA 1FOTA 4IADA 5FD2A 2OBJA 2A27A 4E5AX 5IA1A 2FSTX 2WNTA 3NX8A 3DZOA 4NW5A 4ZSJA 3LM5A 5F1ZA 4C4EA 5J1VA 3KY2A 3RPYA 5CXHA 3FZ1A 4M66A 4H05A 3VAPA 4YC8A 5AA8A 1OKZA 4PDPA 4MX9A 1U5QA 4QP1A 2RFDA 3NUSA 3DDPA 4QOXA 1KV2A 4O7NA 3W8LA 2UW3A 3G6GA 3T3UA 1H1SA 3FWQA 3ZM9A 3P7BA 4G17A 1SVGA 1ZMVA 4FUXA 1FGKA 4O7VA 3B8QA 5EDRA 2DQ7X 5TE0A 3V5PA 4QTBA 4WKQA 5J95A 5HTIA 4ZLOA 2WMAA 2R64A 3C7QA 5AV0A 2YZAA 1DAYA 3DY7A 2ZV8A 4FSUA 4I4FA 4IX3A 3GFWA 3I6UA 3IDCA 3LVPA 4I21A 4AX8A 5HLNA 1UU7A 1KE8A 3A7JA 2YLEA 3F7ZA 1BX6A 4S30A 1UWJA 4CXAA 1OB3A 3VBYA 3KK8A 1CSNA 3F3WA 4E26A 4QNAA 1J7IA 4I1ZA 2HY81 4G6OA 2VTJA 4HGEA 5E1EA 4JBVA 4PQNA 3MV5A 4IM2A 3WYYA 1OPLA 4FA2A 3QD3A 3BIZA 2PVYA 3QHWA 4H39A 4I23A 5GZ9A 5CXZA 3RNIA 2OH4A 4FNYA 3C1XA 4JLCA 2RG5A 4I5PA 1HCKA 3ZO4A 2ITVA 2WMTA 3DTCA 3I4BA 1WBOA 3L9PA 3QA0A 4RWJA 2ITQA 4TYHA 2WQOA 5EOBA 5JT2A 4Z7GA 5IQHA 3DK7A 4FT3A 5DMZA 3H9RA 2QC6A 3LM0A 3IDBA 4BBFA 4AFJA 1CKJA 4DH5A 2Y4IC 5A4CA 1R78A 2PWLA 3E8NA 3WILA 2ZJWA 5HZNA 5KMOA 3EKNA 4FV9A 4MF0A 1LUFA 1QPDA 3C4WA 3AQVA 4RIXA 3RWPA 4FV4A 4BGGA 5BVOA 3PXZA 3R9RA 2ITUA 4V05A 5EW8A 2HY0A 4ASZA 5HIBA 4RIWA 3VS4A 5T68A 3TCPA 1XQZA 3QKLA 4FTJA 4ZSEA 2V7AA 4FZ6A 3N4VA 2B0QA 4TYHB 4AE9A 5HVYA 4F63A 1RE8A 3KC3A 4L6QA 3MVMA 3F66A 4U80A 2J7TA 3KREA 2R2PA 3KXHA 4YJVA 1H26A 3BU3A 3HV3A 1ZY5A 4K18A 2RFSA 3GCVA 4CFFA 1NXKA 4ZLYA 5CEPA 2X6DA 3PWDA 4FNWA 3QQHA 4JVGA 2E9PA 2YIRA 4G9RA 2GNIA 2C1BA 4ZTSA 5IA5A 3PPJA 4V04A 4USFA 3SX9A 5E8VA 4QTDA 3S2PA 4FTTA 3DBFA 3OVVA 4FTAA 4I0RA 5IDPA 3DBEA 3GU6A 1OIQA 3II5A 5EYDA 5C9CA 3OXIA 4BCIA 4QP8A 3ZFYA 1WBSA 4RLKA 4E4MA 5EQEA 4EK3A 1UV5A 4X0MA 5K4IA 5EYKA 2GQGA 2JIIA 2UW5A 2Y9QA 3D5XA 3UNJA 3PLAE 2EXCX 5A6OA 5K3YA 4EYMA 4MNEA 3O8UA 5FM2A 2PSQA 3FAAA 1YI6A 3BYOA 4DTAA 2PUUA 2RFNA 4EUUA 3ACKA 4OT5A 3I0QA 2VTNA 2J50A 5E8TA 2FYSA 4L01A 2CJMA 4LFIA 4RWIA 5ANDA 2VWYA 3T9IA 4AOIA 3R28A 4CCBA 4LMUA 5J9ZA 4TKSA 2WIHA 2ZM1A 2PZ5A 5ANOA 2VTSA 3QKKA 2W4OA 1ND4A 4ANMA 5EM7A 5AEPA 3UOKA 1YXXA 5FTQA 4JDJA 4RFYA 3VRYA 3EZRA 3L8XA 5CT7A 3DFAA 1H1QA 1JSTA 4FE2A 4LRJA 4MTAA 3KRJA 1CM8A 4JS8A 2PZPA 2KULA 3TG1A 4EOOA 4LOPA 5JKGA 3LMIA 4G6NA 3ANRA 4AUAA 4O0RA 2WMVA 3C5IA 1XH6A 4U3YA 1M7NA 3P0MA 4QMPA 3ORMA 4CFNA 4UMUA 5M57A 3NVMB 2O64A 3VHEA 2XNOA 2C6TA 4IX5A 2XM9A 2F4JA 4EOLA 4IDVA 2ZB0A 2X8IA 4DA5A 4LGGA 4A4XA 4OBPA 4PPCA 4EOSA 5LVLA 4YJRA 4LL5A 3RZFA 4FKSA 3VBQA 3UE4A 2RKUA 4RBLA 4BDJA 2X1NA 3R1SA 3UOJA 3Q2JA 1J7UA 5C03A 2HZ0A 2YAAA 4MCVA 4AE6A 4FICA 1JVPP 4ALUA 5J7BA 1NA7A 2DYLA 3C5UA 2W4JA 2QODA 2F49A 4GFOA 2I40A 4U44A 3F3TA 4TW9A 3HUBA 3G9LX 5AR7A 5TF9A 4RRVA 2PMIA 3TIYA 4KWPA 5DR2A 3FKLA 4H1JA 4QQ5A 4YTFA 1Q3WA 3PZEA 5BYYA 3TDVA 1PXNA 1OL1A 2UZUE 3KB7A 3FLQA 4IIRA 4KS7A 4PV0A 4PUZA 3R04A 4QP2A 3SG8A 4I0SA 5IF1A 4R3CA 2BTRA 5C26A 1YI3A 3QBNA 3A8WA 5D10A 3BE9A 3ALNA 1P4OA 5BX0A 1W82A 5HU9A 3LIJA 4HW7A 4FG7A 4BVUA 2YCRA 4UZDA 3MA6A 3OW3A 3QWKA 1QMZA 2F9GA 3FXWA 4HNIA 3FEGA 3P86A 2WFYA 4E5BA 3V51A 3FDNA 2BTSA 2WQMA 2OZAB 5CANA 2AUHA 3T3VA 3QD4A 4DEAA 2YLFA 4RIYB 3QRKA 5IMEA 5A14A 5M08A 4I4EA 2EWAA 3E5AA 4IM3A 2QNJA 5DVRA 4FG9A 5HE3A 4ASDA 5BNJA 4C34A 3O7LB 3A7HA 5HVKA 5TKDA 4FL3A 3ATTA 2XJ1A 2DS1A 3I81A 3E63A 3GOKA 4E7WA 1WBWA 3P79A 5CQUA 1XBBA 4XP2A 1MRYA 5IH5A 3HDMA 4IB1A 3F9NA 1H1PA 1TQIA 1QCFA 2R3LA 1JAMA 4ZTMA 5JZJA 3AGMA 5C4KA 3IONA 5JFSA 5HICA 4AQCA 3UQFA 3ZEPA 2JKMA 4DG0E 3PA3A 3PJCA 3HV5A 3PSCA 5DG5A 3OG7A 3CSVA 5BUEA 3IGOA 2RGPA 4BIBA 4I94A 3CKWA 2W06A 3FZSA 1H0WA 3VULA 5CAPA 4O7RA 5HX6A 5LCKA 3P4KA 2PMNX 4E4XA 3QUPA 2F7ZE 4H1MA 3KQ7A 2X7GA 3ZCLA 2RIOA 1XBAA 4XV9A 4BZOA 5AM7A 5AFVA 3C0IA 2YWVA 3CY2A 5CYIA 4R1VA 4DG3E 2C1AA 2Q0NA 2Y4PA 5E1SA 2WMXA 5EI8A 3VS7A 5LXMA 3AD5A 3TT0A 5BQ0A 2FUMA 2FGIA 2CGWA 2J9MA 3OWLA 3LFSA 1YQJA 2CGXA 1PXPA 5AUUA 2R3PA 4JG8A 4YR8A 3SGCA 3DT1A 4I24A 4JG6A 3I60A 4DEDA 4W4YA 2ITPA 5J8IA 3Q9XA 4JNWA 4A9YA 1ZZLA 3NNWA 3OOGA 4IWOA 5IEXA 2Z60A 3AMAA 4W4VA 5AAEA 3R83A 3ZS5A 3G5DA 4RJ6A 4U0IA 3WZKA 5HCXA 4EOMA 3Q6UA 4QMTA 3DK6A 3R9HA 4GRBA 1ERKA 3V3VA 5HE1A 2E9UA 4C02A 3O51A 4ZMEA 5CSXA 3CTQA 2YN8A 4BFMA 4B0GA 3V8WA 4TWCA 4KRCA 3PDTA 4CMOA 1H4LA 3Q3BA 5B2KA 4NKSA 3HX4A 3UZPA 1Q41A 5EW3A 4GUEA 3BLHA 3OUNB 5L2QA 4DEBA 3MW1A 3EH9A 1FMOE 3HECA 1XO2B 3KCKA 2QU5A 2XK7A 2W1HA 4RWKA 2WPAA 2ZVAA 5IEYA 3F2AA 3MB7A 3OW4A 5HU3A 2CKPA 3MA3A 4MK0A 4E6QA 2CSNA 1KE7A 2WTVA 3F3VA 3V5WA 4TT7A 5GJDA 4FTCA 2QKRA 2VX3A 3D5WA 4RJ4A 4IAAA 4NCTA 4XV3A 4FV0A 5J1WA 5AAFA 4XOZA 4MHAA 4H58A 1Z57A 3ZSIA 4IZ7A 2OJJA 3FJQE 4CVAA 1PW2A 1P2AA 2X7FA 3Q9ZA 3QF9A 4PMMA 4EC9A 5DR6A 2YZLA 4FEVA 3SXSA 2JBPA 3ALOA 4ZIMA 4AW5A 3VNTA 3A61A 3ANQA 3CY3A 4D5HA 5FQDC 3SW7A 4G31A 4GYIA 4R6VA 1S9IA 5D1JA 1ZYDA 2B54A 4BYJA 2GHMA 4ZLZA 5JMSA 5FDXA 4A07A 4Y95A 1BMKA 5CU6A 4R78A 5D7AA 4J53A 5FG8A 2HW7A 2H6DA 2BFYA 4ACGA 4XEYA 4NM5A 1P5EA 4F9AA 4FSMA 3OS3A 3FMEA 4GH2A 4GCJA 4UMPA 2XEYA 4IZ5A 1PMUA 5EM8A 5AM6A 4F64A 3CQWA 5C8KA 4J95A 3ZUVA 4LRKA 4NM3A 3V6SA 2P0CA 4BRXA 4MXCA 1ATPE 2OIDA 4P5ZA 5IQDA 2GHLA 3DFCB 3VUHA 2CDZA 1P4FA 3DB8A 2V0DA 4F9YA 3EQRA 4BDIA 5FEQA 1XWSA 2WU7A 1JKLA 1U5RA 4EORA 2BILB 4L44A 4EYJA 2O2UA 4PWNA 4L52A 1GZKA 5FEDA 5E91A 3LFDA 3SAYA 2YJSA 4B99A 4ZTRA 1PYXA 3H3CA 4EHEA 2X9EA 4O6LA 3PPZA 3LCKA 1U54A 2C6IA 5D7VA 2GTMA 5L6WL 4BCKA 3OOMA 5KMIA 1KV1A 2YDKA 2F57A 2PVFA 5AMNA 3F61A 2QR8A 3R7GA 4GK2A 4NM7A 3UJGA 2WTJA 2GMXA 2QKWB 2XRWA 4G3GA 3EQIA 4LOQA 4FZFB 4HZRA 5TR6A 3ORIA 1OIUA 4JT3A 4TN6A 2WOTA 3ZDIA 3ZBFA 3Q9YA 4PNKA 3I6WA 4LM5A 3ZEWA 2B55A 3A4OX 3C4XA 4BCMA 4DGLC 4L9IA 4EBWA 4Z16A 4NKAA 4NFMA 4PL5A 3LFEA 5I9UA 1G5SA 3F5PA 2CMWA 3UBDA 1Y8YA 5L8JA 4ZY4A 4J8MA 4J99A 4J8NA 4GU9A 4PMTA 3PG1A 2O3PA 4TYIA 4X6QC 4FTOA 2Z8CA 4IB3A 4GKIA 2OXDA 4BDHA 3PRIA 4RLLA 5KKRB 4KINA 5KUPA 4O21A 2OF2A 2UZLA 3Q60A 4K6ZA 4F4PA 4D2SA 3FI8A 2BKZA 3SQQA 2YIWA 1CKIA 4JRVA 3BGQA 3GENA 4J1RA 3D7TA 2E9VA 5CSHA 3QCXA 3VUIA 1JPAA 1U4DA 3GOPA 4NL0A 3BU6A 1ZLTA 2R0UA 5CEKA 2UUEA 4MEDA 5HO6A 4U97A 2PZYA 4FT0A 2HCKA 3D7ZA 1NVSA 3G0FA 3QTIA 4WUNA 4XLIA 5M4IA 2ZDUA 4BTMA 4RIWB 5HE0A 2UW0A 1FGIA 3HMNA 3HP2A 4WA9A 5DE2A 3V6RA 4IAZA 2H8HA
chains in the Genus database with same CATH superfamily
2YEXA 4F99A 4HYIA 3TUCA 3CD8A 3ELJA 3KN6A 4ASXA 3TIZA 2YITA 5HO7A 1YW2A 3DXQA 4O91A 4O7SA 3D94A 5DPVA 2IZTA 3JY9A 3W1FA 4F09A 2WZJA 2QOBA 5ANJA 3RKBA 3R7VA 4AT5A 2OZAA 4U3ZA 3TNIA 3VQHA 1G8SA 2I0HA 2V5QA 3EOCA 3QQFA 4GIHA 3EQDA 2W5HA 3QXPA 4G3FA 3ROCA 3VS1A 3COKA 3Q32A 4KKHA 2R3NA 4MXAA 5DBXA 5HORA 5J5SA 5JFXA 3TL8A 2Z7LA 4D58A 5HCYA 2UZVA 4DTBA 4RZWA 4XG9A 3DGKA 3O71A 4X6RA 3S00A 4LMNA 2XH5A 3ORKA 3LCSA 4QD6A 4YBJA 3UO6A 3W32A 4CFWA 4KS8A 4C37A 3UZRA 5IISA 4JQ7A 5AX3A 4EOPA 2YABA 5HKMA 1XH4A 4D5KA 3RVGA 4ACCA 4I6HA 4AN9A 4XBUA 4MWIA 5DN3A 2NO3A 3GCSA 4BN1A 4F0GA 2WMSA 4YUQA 3R00A 5CALA 1UNHA 4ZSGA 4DGGA 2X2KA 3FLNC 4IJPA 4ACDA 5BVKA 4B8LA 3SVVA 4KA3A 2X2LA 5CNOA 2I0YA 3NUYA 3QGWA 4RVKA 4AGWA 4L3PA 4LV5A 3VC4A 3TKIA 1FVTA 4F1OA 3BYVA 2CCIA 4NUSA 1XHAA 4FSYA 3DJ5A 1RDQE 2PVJA 4QQJA 5K5XA 5LWNA 3FZRA 1JQHA 3QX2A 3W2QA 4XBRA 2ZOQA 4D2WA 3WF9A 4XH6A 1Q61A 3LFNA 3QU0A 4D55A 4YC6A 1JSUA 1NY3A 3HV7A 3C0HA 4J52A 2VTIA 3E88A 3NNUA 1B6CB 1JKKA 3AT2A 4FUYA 2XB7A 4F6WA 4GS6A 2ZV7A 4OTHA 2OW3A 2JLDA 2PE1A 3RI1A 4FK3A 4JBQA 1YOJA 2JDRA 4FTUA 5EYMA 3RAHA 5M44A 3PWYA 3MPAA 5IPJA 4WIHA 2C6KA 4BIEA 3MSSA 1DS5A 3VUGA 4M8TA 4BWKA 1R0EA 1OBDA 4M67A 5HGIA 5LJJA 4XOYA 4ALWA 2VTMA 2WTWA 3TUBA 1J3HA 5HNGA 2W96B 2VO3A 3ZC6A 2XAMA 4UXLA 4BCJA 4IM0A 4QQTA 4XRJA 3OP5A 1P14A 2WQEA 3N51A 3OFMA 4YNEA 3SD0A 2WU6A 5J9LA 3DAKA 5HBHA 4YNOA 4DLIA 5F4NA 2O5KA 5H8EA 2B9IA 4GVJA 5DR9A 3CXWA 4UWYA 2Y8OA 3TV4A 2OJ9A 2Z2WA 3HP5A 1HOWA 3GVUA 4XG4A 3IOPA 4AW0A 2WQNA 1GIHA 4UX9A 1JKSA 2JIVA 3R63A 3NCGA 3FQHA 3ZUUA 2RL5A 5E8XA 5A3XA 4BIDA 2VWIA 3RPVA 4ZS0A 3ENMA 4DEIA 3F2RA 3R7EA 2R3JA 2VTOA 3MPTA 3QAME 3RINA 5BUIA 3KN5A 3UVPA 3RMFA 2YCQA 4LV7A 2JFMA 4TY1A 2OKRA 4CRLA 4QP9A 2H96A 3EN5A 3EQGA 3GQLA 2GHGA 2YIYA 4XCUA 4YLLA 5AP4A 3O17A 3HL7A 4F7NA 5C8NA 2QOFA 1SM2A 3PUFC 2ITTA 3TJCA 4DH8A 4YZ9A 5I9VA 3ORPA 2W9FB 3KRWA 4Y72A 2XYUA 2Z02A 3LLAA 2VWUA 4N57A 3RHXA 1UWHA 5EHOA 4HVDA 4O82A 5IQFA 3FYKX 4N0SA 4DFBA 3GXLA 4W8EA 5AUZA 4M7IA 4FTKA 4FTIA 5E8WA 4Z3VA 1M17A 4OTQA 3GI3A 4NCTC 3U51A 2BRBA 2R3MA 3VS0A 1IG1A 4HPUE 4HGTA 4M0ZA 4ANOA 3VW6A 1H00A 1IA9A 3DOGA 2G15A 3HV6A 3TNQB 3KULA 2BPMA 2W5AA 4K9YA 1REKA 4IWDA 5I3RA 2QQ7A 3AG9A 2YFXA 3FI4A 4D1XA 1H24A 3WIGA 1Q8WA 4BI2A 3VBTA 1SMHA 4IC8A 4FEXA 3FMHA 3KL8A 4I41A 4Q2AA 4RC2A 2HELA 3CGOA 3GUBA 4L7FA 4CFVA 4CZYB 1PKDA 1U54B 4AOTA 5E92A 3UYSA 3FPQA 4ENYA 5CEOA 5J9YA 3SHEA 1OGUA 4FSWA 4D4YA 1M2QA 5AP1A 1OZ1A 3ZOSA 4RGJA 3UQGA 5LMKA 3OT3A 4IJ9A 5JFWA 2W1IA 3DB6A 3D0EA 3UOHA 1Q8ZA 2VTHA 4C4GA 4TYEA 3C51A 4CKJA 5AAGA 4C3RA 3ZYAA 4A9TA 2P3GX 4FVPA 4S34A 3W8QA 4O1PA 4BB4A 1DM2A 4NZWB 4DHFA 5A46A 5IUHA 1YOLA 4QP7A 5GJFA 2OXYA 4QMQA 3DQWA 5HESA 3GFEA 4EWHA 1UU9A 4DGOA 3O2MA 4HYHA 1LEWA 2B4SB 2J0JA 3VF9A 4RJ8A 5HIDA 4QMSA 4Y46A 3W2CA 3ZLWA 4BDCA 5L8KA 2OIBA 2W17A 1WVXA 2BRMA 1A48A 3HZTA 5LOHA 2UW9A 1H07A 1V0OA 4GU6A 1VJYA 3QXOA 4F9WA 2VAGA 4X2NA 5LVOA 2YJRA 5IKWA 4FL1A 4CT1A 4N70A 5AIRA 3MI9A 3SDJA 4EHGA 4ORKA 3IGGA 3RAKA 2YA9A 5HLPA 3QTZA 4DLJA 3MY5A 4WHZA 4CZTA 4ZTNA 5ANEA 3ZHPC 1AGWA 3CKXA 3HAMA 3U6JA 4QTEA 4HCVA 5D9HA 4C2VA 1H27A 3NNXA 1IR3A 2Z7RA 1O6YA 4LOOA 4FIJA 2FSOX 2JKOA 3U4UA 2IZRA 5DFPA 3L8SA 4IFCA 1FVVA 3A8XA 3GT8A 2W0JA 2PZRA 3KCFA 4UWBA 5L8LA 2HENA 5AIKA 3NYXA 3CPCA 3QWJA 4WRGA 1O9UA 3RZBA 3BYSA 3FBVA 4N6ZA 2YDJA 3HKOA 3R8UA 4IB0A 5L2TA 3FZPA 3IK3A 3R6XA 1VYWA 3H10A 3RBWA 3C50A 3BZ3A 5JQ5A 2BMCA 2PUPA 3PSBA 2B7AA 4XP0A 1YHVA 3THBA 2IEWA 1CMKE 3QZIA 2HWPA 3PXQA 2Z7SA 2C3KA 4TNDA 3ATSA 2EB2A 5DEWA 3ODZX 4QQCA 3MYGA 1BYGA 4EH5A 3NUAA 2IJMA 1A06A 2VWZA 4IDTA 4R7IA 4AS0A 4F9BA 4NJDA 4Q9ZA 3ZBXA 3D15A 1JWHA 3AC8A 3ZSGA 4I5CA 4EH7A 4ZP5A 3NNVA 3QUEA 1QPCA 3O7LD 3DXNA 5I9YA 4C58A 3A99A 4E1ZA 1YHWA 3LFCA 2XKEA 4X3FA 3RAWA 3NUPA 4KRDA 4HCTA 3EHAA 2A98A 2BAKA 1JLUE 4I93A 2XKCA 3HNGA 4A9RA 2WKMA 5CVGA 5KO1A 4ZZNA 1W8CA 4EK6A 3MVLA 4LQMA 3B2TA 3JVSA 3EIDA 4Y8DA 5AUYA 4DYMA 1URWA 3MS9A 4D2VA 1OMWA 2CLQA 4E4LA 2ONLA 3GU7A 4YHJA 5HG7A 3UODA 3WYXA 5JFVA 4O81A 4FKLA 4D0XA 2LGCA 4L3JA 3HA6A 3HMIA 2B9JA 1FPUA 3G15A 3L1SA 3VBVA 3EJ1A 2CN8A 4YO6A 4UN0C 3KVWA 4QRCA 4BGHA 2UZWE 2R4BA 3IW8A 4IACA 3Q4TA 4FBXA 5CASA 5GIOE 3R22A 2XK4A 4X2JA 4QO9A 2X0PA 3F3ZA 4MYGA 3VUMA 2R0IA 5HHWA 2XANA 1OIYA 4OTRA 5BYZA 2HWOA 2WEIA 3RAIA 4XMOA 3RWQA 2OJFE 4X21A 4ARKA 5DYJA 4OUCA 3HUCA 4ZSAA 2QG7A 1BI7A 4RJ7A 3IO7A 2Z7QA 3RM6A 4R7BA 3WF6A 4OAUC 1Q3DA 3KRXA 2BRHA 3NSZA 3FL5A 2G9XA 4EH3A 3LFBA 4PNIA 3E87A 1OIRA 3ULZA 3EYGA 4RVTA 2YM4A 4L00A 5JGDA 3F82A 1OKVA 3KVXA 3TV6A 5HBJA 4R77A 4I6BA 4AACA 3TM0A 2G2HA 2PY3A 3V8SA 3AMBA 3EQCA 4JR7A 4F7JA 5BVDA 5EG3A 1OUKA 2XMYA 2W4KA 4WBBB 1V1KA 2OU7A 2ZMDA 4C57A 3GU5A 3LJ2A 5GZ8A 3IS5A 2J5EA 1O6LA 3ZRMA 3D2IA 3V04A 3ZFXA 3UIBA 1YWVA 3H9FA 3U8WA 5IA3A 1L8TA 5IQAA 4FTLA 1FMKA 4W9WA 2W99B 2YM3A 2YM7A 3MIAA 3PXYA 2QO2A 4JQEA 4UYAA 2QVSE 3NVKI 4AG8A 2GS7A 3GC9A 2X39A 3QCYA 3R2BA 3R7YA 5DRBA 1A9UA 2O65A 3BWJA 3WARA 2R3GA 4GT5A 4P2KA 4C33A 2X81A 5GJGA 4CYIA 4E5WA 2AQXA 4YSJA 3BU5A 4G5JA 1W2CA 4XRLA 4RX8A 2ZYBA 3P5JC 3ZU7A 3FZOA 2UW4A 2UZEA 2V55A 3UPXA 5M09A 3ZC5A 3GBZA 1PMEA 2BZKB 3OT8A 4O27B 4OW8A 4ZOGA 5EKNA 3MTLA 3UMXA 2OJGA 3I7CA 3W2SA 4DT8A 2Q83A 4CSVA 5CSWA 1FINA 3FV8A 4B7TA 2CPKE 4AWIA 1XKKA 1GZNA 4RT7A 3AC5A 2WGJA 4FTQA 5E8SA 4CQEA 2PVRA 3WBLA 1UA2A 4HYUA 4M0YA 4L67A 4YJPA 1DAWA 3EMGA 3NIEA 4FTNA 2QO7A 4NM0A 4M12A 5LVMA 3NCZA 5J5TA 1EH4A 5A4TA 2VNYA 4NTSA 4J98A 4XV1A 5I3OA 3A7FA 3Q96A 4YZCA 4I0TA 2BAQA 4AA0A 1L3RE 3GCPA 4TPTA 4KNBA 3BLQA 4EOKA 1DI9A 3MH0A 3RPOA 2ZM3A 4X3FC 4FKQA 3NEWA 3BI6A 2XNPA 2XCKA 3DKGA 4JXFA 2E2BA 3R1QA 2R3KA 4EI4A 4XHKB 2IPXA 1E1VA 1U59A 4TWNA 3CBLA 3QYWA 2JC6A 4L68A 4XG3A 4D9TA 5JSMA 4U81A 1OBGA 4MXYA 5IMXA 2B53A 2ERZE 4TNBA 3DTWA 3OY1A 4A9SA 4QYHA 2CKEA 1XH5A 4FV8A 1H01A 3LQ8A 3P78A 3FLSA 3P7AA 4QP4A 3TACA 2PVLA 3ZRKA 5EI6A 4AZSA 4RZVA 4TWPA 3MESA 4YTIA 3HA8A 1K3AA 1B39A 2WELA 3QA8A 5AP6A 4GFMA 5KMMA 4FSTA 2W1EA 2YISA 4TTHB 2VN9A 3MDYA 2J6MA 3R1NA 4TL0A 4G34A 1BL6A 2XJ0A 4IAYA 2WAJA 4MNFA 3DBQA 4WG4A 5BVEA 4ANLA 3MH2A 2ETRA 4WRSA 4IZYA 4IZAA 2JGZA 3RTPA 4BC6A 3PY3A 4MD8E 2REIA 4C2WA 1ZMWA 4XUFA 3KGAA 5HOAA 4APCA 5K5NA 4R8QA 2UW6A 3PJ2A 2XP2A 3ZLXA 3PP1A 4BZDA 4FKGA 5BMSA 2X9FA 3C13A 4XYFA 4AA4A 4XG6A 3AMYA 4FV5A 5ANGA 2BDWA 3Q52A 2PE2A 4BBMA 3R73A 4MBIA 4IVCA 4FODA 3O8PA 5DIAA 5B0XA 5HX8A 4U40A 3HV4A 4EH4A 4IEBA 3BGZA 5DEYA 2G2FA 2BALA 3QCQA 3FHIA 3MY0A 4U79A 2VNWA 2FSLX 3MVHA 4AGUA 4NIFA 3FXZA 3D9VA 2OFUA 1LPUA 1Q4LA 2RFEA 1OM1A 4QMVA 4ALVA 3LXNA 3R21A 3QD2B 4NSTA 1Y57A 4MH7A 4JMQA 4BDGA 3QRUA 3CCNA 4UWCA 5CU3A 3SXFA 2B1PA 3LAUA 3LMHA 2W1GA 2O63A 4S33A 4YZBA 5C4LA 4FIFA 1KUTA 3UYTA 3AOXA 4AAAA 3QQLA 4I6QA 4QYGA 3UDTA 3UDBA 4AT4A 1XMLA 4O4CA 2XS0A 3VQUA 4EJ7A 3PG3A 4QMNA 2GNHA 2YWPA 4B6LA 3QZHA 3IDPA 2C0OA 3TNHA 4DAWA 4XX9A 4GSBA 4N6YA 5TO8A 4G3CA 4YMJA 4DBXA 2H9VA 1KWPA 3QQGA 5KE0A 2GQRA 1IEPA 5M06A 3NWWA 3P7CA 4E6CA 5T3QA 4D1SA 2G1TA 3O8TA 3ZM4A 5DNRA 5CY3A 3ZXTA 3ET7A 3NGAA 4X3FB 3ZRLA 4BI1A 3SRVB 3TUDA 3DZQA 1JKTA 3VBWA 1PHKA 3BQRA 2GNLA 3TTIA 3LXKA 4GYGA 3WF5A 4FJVA 2C5XA 1Q62A 2XIZA 3K54A 4E8AA 3PXFA 5ANKA 4AGDA 5HVJA 4UY9A 4O0WA 3WZEA 1OKYA 5HLWA 2QR7A 4IX4A 5HG5A 4XNEA 4C4JA 5L3AA 5IUGA 5HO8A 1YDSE 2WMBA 1XBCA 2WMRA 4UMTA 3ZFMA 5BMMA 5CAOA 4FSNA 3MGYA 3AXWA 4H3BA 3FC1X 3U9NA 4U41A 5H8BA 1GJOA 2ZDTA 3CJGA 3BELA 3DKCA 4QMMA 3E93A 5EDQA 3BV2A 2F2UA 4G16A 3BBTB 4FSQA 4KSPA 1ZZ2A 5JRSA 2W1CA 2QOHA 1JSVA 4LG4A 1OL5A 1PXKA 5AUXA 5C27A 2I7QA 3KF7A 3H0ZA 2FH9A 5CVFA 4O2ZA 4QTAA 4RSSA 1GNGA 4IX6A 4YLKA 4AF3A 3BHYA 5KHWA 3RALA 2C5OA 3H30A 5AWMA 5FXQA 3ZSHA 3G2FA 1Y91A 3JYAA 3PUPA 4BR3A 3TEIA 2ETKA 4NEUA 3VN9A 4TZRA 4BCNA 3A62A 3MVJA 3AC3A 3AC2A 5CAUA 3F88A 3FPMA 4EK8A 5E7RA 2I0EA 4IB5A 3QFVA 4PF4A 4CLJA 5IQBA 3DLSA 4C0TA 3VW8A 4ZXTA 1Q99A 5IQEA 2XCHA 2JD5A 3I0OA 2Y4IB 4MD7E 5AP5A 4CFMA 3LOKA 3FLWA 3Q4ZA 3UGCA 2XVDA 1H08A 1PXMA 4RFZA 4FMQA 3DKFA 2CKQA 2J51A 4JRNA 4QDEA 4WNKA 1ZRZA 5ETIA 1OKWA 3PA5A 3LHJA 4QMLA 5KMLA 4EOIA 4IWPA 5E90A 3NMUF 3QRTA 3BPRA 4LGHA 1KOAA 4EHVA 3OHTA 3QD0A 5FBNC 3AT3A 1V0BA 3F3UA 1F5QA 4IH8A 4OTGA 5DHJA 2XNBA 5FXSA 2VTAA 2VTPA 1URCA 1UU3A 3BBWA 3H0YA 4Y5QA 4YJQA 4KUJA 5CZIA 1NVQA 3NYVA 4DFUA 5KBQA 4V0GA 2JITA 4QDVA 2C3IB 1U46A 2GNFA 5IA0A 3FSFA 4X3JA 5FLFA 3GQIA 3UOLA 3FMLA 4ID7A 3V5JA 5JK3A 3A4PA 3GNIB 1YDRE 2QD9A 5AV3A 1OVEA 4LGDA 1Q8TA 4WBOA 3UMWA 2C6DA 4DH3A 4RX7A 4IE9A 3F5GA 4S31A 4JR3A 3UVQA 4RIOA 3UQCA 2BIKB 4HVGA 3HYHA 4LUDA 2QHNA 3QTUA 1UNGA 4I6FA 3LE6A 5AR3A 5IDNA 3PVWA 3SW4A 1REJA 3PA4A 3NS9A 3SC1A 2IWIA 3MWUA 3Q5IA 3QQJA 3EQHA 4YSMA 3PIZA 4PTEA 2EUFB 4NJ3A 5HNIX 3TZ7A 2AC5A 5IH6A 3C4FA 4Q5HA 4QEBA 4V0GB 2C5VA 5HQ0A 4GT3A 5AJQA 3NFFB 1K9AA 2ZV2A 4MNEB 2ITZA 2Y7JA 4OTDA 4WO5A 5B2MA 4AGCA 3CR0A 2WTCA 1Q97A 1J1CA 4AXAA 2I1MA 3MPMA 4KD1A 1TQMA 5ETFA 4CT2A 2R3HA 4O1OA 2HZ4A 2CGUA 3Q53A 4EH6A 5KMNA 2WTIA 5IA4A 2FVDA 4QP3A 2BCJA 4LRMA 3B2WA 1UNLA 3TKUA 3QTSA 1H1RA 3OROA 1QPEA 2PHKA 4GUBA 5F95A 3SA0A 2QI8A 2OGVA 3OTUA 3VJNA 3FMDA 4BWXA 4CD0A 4C7TA 4UBAA 4AZTA 3V5QA 2CLXA 3Q4CA 4QMUA 3R71A 1ZMUA 2P55A 3FI2A 5LCJA 2WTKC 2XZSA 1LR4A 3GGFA 2UZNA 5D41A 4TRLA 3N4TA 1XJDA 4X2FA 3OWPA 5CI6A 1W7HA 2JDOA 4YPDA 3GC7A 5CQWA 4BCGA 3CC6A 5CX9A 3AKKA 2R3QA 3KULB 3NUUA 1KE6A 5FUTA 3PXRA 4F1TA 2X7OA 4M69B 4O0YA 1OITA 1OPKA 4FRFA 4UMRA 2H34A 3PP0A 5FWKK 4E93A 2R3RA 4AN3A 1QPJA 5JQ8A 4JJRA 3ID6C 4PY1A 5EFQA 4RX5A 4RWLA 2G2IA 4KBAA 4D2TA 1DI8A 5B7VA 2I0VA 2VUWA 2XNMA 3EL8A 3ZO1A 3UVRA 4BDFA 3UIXA 2WHBA 1LP4A 4O0TA 5CF6A 3RCJA 1QL6A 2XIYA 3PSDA 4GVAA 4BTFA 4DGMA 4M97A 3SKCA 3W16A 1E9HA 5JGBA 5HEZA 4QMYA 3LQ3A 3OY3A 1PY5A 3HDNA 1WBTA 5KZ0A 3OWJA 4MXZA 4R5SA 4J96A 1XH8A 4YHFA 3ZH8A 3LMGA 4IHPA 2C6OA 3LPBA 3BHVA 5IU2A 4GK3A 4RC4A 4XG2A 3QC4A 2DWBA 2X8EA 1BI8A 2A19B 2B9FA 4FT7A 2PVHA 5CU2A 3I7BA 4BJJB 4FF8A 3DU8A 2J0KA 5E4HA 4Z9LA 5KZIA 4YTHA 3UO5A 4WG3A 3O23A 3R01A 2PL0A 4YZNA 4D4VA 3QRJA 5HBEA 5CF4A 4BHNA 3RK7A 3QTRA 3SV0A 2VO6A 3UNZA 4O0VA 5IQIA 1V0PA 2GTNA 3NPCA 4O0SA 3RGFA 5K9IA 5FTGA 3W0RA 4G6LA 5HTCA 3G90X 4Y5HA 5AP7A 5ACKA 4QMXA 3R9OA 3OCSA 3RPRA 3V5LA 3QL8A 4GJ3A 4EONA 3W10A 2YM5A 3CGFA 5FEEA 3R8MA 1IAHA 4XLVA 5CSVA 4J97A 4GJ2A 5M07A 3HRCA 1MRVA 3SRVA 2ITWA 3EQFA 4C59A 4AT3A 2WB8A 5DT0A 4AA5A 5HI2A 4E3CA 1YOMA 3R7UA 1TFFA 4JL9A 2BIYA 4D2RA 2VTRA 3W0OA 2C47A 2Y0AA 4FV7A 1OUYA 3U6HA 2OJIA 2W1ZA 1YKRA 3G51A 2BHHA 3PRFA 4RC3A 1R0PA 3OBGA 3PJ8A 1YXSA 4WT6A 3BEAA 1GZ8A 4ZJIA 3CJFA 3UIMA 3C4ZA 4K8AA 3IG7A 3I1AA 1I44A 4BCOA 4EWQA 3LXPA 2X8DA 4E20A 1APME 4XS2A 2R9SA 1ZY4A 5EKOA 3DAEA 2PZIA 2UZOA 3FLZA 2A0CX 4IC7A 1PYEA 4PL3A 1O6KA 1UKHA 4FV3A 5TT7A 4ERKA 4QPMA 4C36A 2BVAA 3POOA 3MB6A 2YM8A 2XK8A 4WSQA 4PMPA 4F70A 1PXIA 3Q04A 4DN5A 1M52A 4MUQA 5CEQA 3UTOA 5EI2A 4F78A 4Y83A 4MXOA 2NPQA 1GAGA 5I9WA 4FKIA 4WOVA 4BDAA 3W0NA 4PDOA 5F94A 4CTCA 4UEUA 4JDHA 3WIKA 4JDIA 3VHKA 4CTBA 5IA2A 4MKCA 2GU8A 1R3CA 1SZMA 1VR2A 2X6EA 4L42A 3C0GA 4NFNA 4A7CA 4F1MA 2XBJA 3PY0A 3RPSA 2VWVA 4DC2A 4E6AA 1UVRA 1YXUA 3PVGA 4PTCA 3OD6X 3AD6A 3V01A 2FO0A 2VGOA 3OXZA 4MBJA 3R8PA 2IG7A 3MH3A 1VZOA 2X4ZA 4CCUA 3LFFA 4D4RA 4DITA 4O4FA 4UYNA 2OFVA 3QTXA 4MQ1A 4DFXE 4TYGA 2JDVA 2YDIA 4FEWA 3LFAA 2BZJA 2YCFA 3A60A 2PYWA 1M2RA 2XKDA 3DJ7A 5F20A 4UV0A 2GDOA 3QZGA 3DXPA 2F7EE 3CEKA 3PTGA 4C38A 5AR4A 2SRCA 1ZOEA 2XKFA 2ITXA 1G3NA 3R2YA 3DBDA 4BGQA 4DF3A 4F7LA 2R7IA 2BZIB 2VTTA 3G6HA 2OSCA 3U6IA 2VGPA 4O84A 3UP7A 4FVRA 1IA8A 3IECA 3OWKA 4DH1A 4R1YA 5HG8A 3NDMA 3VUDA 4DHIB 3AC1A 4CG9A 3HGKA 2VWBA 5AV1A 4OT6A 2X0GA 3TZ9A 4E6DA 3FMNA 3LQ5A 4CMTA 4EHZA 4YLJA 4MWHA 1PXLA 2UVZA 2VX1A 4IMYA 5JEBA 2YM6A 4I92A 3NYNA 4NW6A 4ZS4A 4C4FA 5M56A 2OXXA 3U54A 2VTQA 3K5UA 2UVYA 5GHVA 3D7TB 3D83A 4DEEA 5CWZA 4NIFB 4BKYA 2QU6A 5DRDA 2XIXA 2WD1A 3KXMA 3DCVA 3RK9A 2VD5A 5G6VA 5FTOA 1BKXA 4YJTA 4O38A 4FT5A 1IRKA 2C3LA 4PDSA 5I9XA 1W2FA 4DEGA 4EOJA 5DLSA 4DBNA 4YHTA 1FBNA 1XR1A 4KSQA 3NIZA 3KKVA 4YGAA 2GS2A 4L3LA 4QMWA 3GC8A 3F7WA 4IVAA 4WG5A 4DCAA 2HK5A 4FIIA 4U42A 5J87A 2ERKA 5HTBA 4A9UA 3PVBA 2XIRA 3MFUA 3TNPC 3BGPA 3ORXA 2IN6A 4MD9E 3PYYA 1B38A 3NUXA 4L43A 5M55A 3REPA 2PUIA 2DUVA 3AC4A 3DNDA 4BZNA 2HOGA 1PJKA 3BX5A 2J0LA 4O4BB 3O0GA 4K11A 4APPA 4USEA 4DG2E 3ZLSA 5H3QA 2NRUA 4AZWA 4FNZA 3I5ZA 4RJ5A 2UZBA 1MRUA 3R0TA 4DFLA 4OGRA 5EDPA 3BE2A 4YO4A 1H1WA 3BHTA 4FC0A 2WTKB 4M13A 1J7LA 2QG5A 3UC3A 3EN7A 4GW8A 3U87A 4GEOA 3OUKA 4FZ7A 4H3PA 3R9NA 4DINA 2BZHB 4E73A 2V22A 3CTHA 3LW0A 1X8BA 3BYMA 3R8ZA 3VF8A 4AFEA 4ZEGA 5C1QB 3E64A 2A2AA 4CQGA 2XK3A 3B8RA 1SVHA 5M51A 3P08A 4FTMA 3C9WA 4RX9A 3RCDA 4PP7A 1IASA 4KABA 4JBPA 1YHSA 4JX3A 3VS3A 4G9CA 1PRYA 3R02A 2PE0A 5CT0A 3QGYA 4BY9E 3JPVA 5EYCA 1H25A 3GC0A 1WCCA 5EW9A 2WIPA 5JRQA 5E9EA 3HVCA 4BI0A 1BUHA 3M1SA 5L2WA 3PZHA 5BPYA 4G3EA 4ZZOA 3MIYA 3KMUA 3TXOA 4C4HA 4PPBA 3FC2A 4BCHA 4BDKA 4OAVB 2WXVA 3EN9A 4RFMA 4F6SA 5A4EA 3LCOA 4HJOA 1Y6BA 4EUTA 2GSFA 3IPHA 2QLQA 3FXXA 5L2SA 2C0TA 3PIXA 3VIDA 3TYKA 4JIKA 3V5TA 2C68A 3RP9A 5CF8A 3UPZA 4BYIA 4FEUA 5AP0A 3LCDA 3PE2A 4HNFA 3KXNA 1UU8A 2JAVA 4BF2A 4FT9A 2YHVA 3EWHA 4KBKA 1OI9A 3TTJA 1NVRA 5AUTA 5EQYA 2Y6OA 3G9NA 3KU2A 4GMYA 3HMOA 4XV2A 2P2IA 3HMMA 1RQQA 2OWBA 4PRJA 4YP8A 1YVJA 2RG6A 4ONAA 4TYJA 1SNUA 4AW2A 2YIQA 4TWOA 1CTPE 3M42A 1TZDA 4ZTHA 5JZNA 2VO7A 2JBOA 5DH3A 4AZFA 2ZFYA 2ZV9A 5CU0A 2B52A 3GCQA 4KBCA 1HCLA 2R3IA 4D9UA 2Q0BA 4IVBA 4EL9A 2EVAA 4NK9A 4P4CA 2QOQA 5CS6A 4AZVA 5H2UA 4CKIA 5EH0A 3FMKA 3PJ1A 3T9TA 4EQCA 2GQSA 4BCQA 4G5PA 5CF5A 2PPQA 5E8YA 1OL2A 3W0MA 3NUNA 4WUAA 5T6KA 4A4LA 3KEXA 4PX6A 5EM5A 2CN5A 4L53A 3R7OA 5I4NA 4OR5A 3HRBA 2RSVA 4OBOA 4GFGA 2C4GA 3E8EA 3LZBA 4XG7A 4AZEA 4FTRA 5I0BA 4I20A 2OG8A 2C0IA 2W7XA 4AAYA 4YURA 2XAOA 2OF4A 5IZFA 4O7YA