4OGRA

Crystal structure of p-tefb complex with aff4 and tat
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
314
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AFF4 binding to Tat-P-TEFb indirectly stimulates TAR recognition of super elongation complexes at the HIV promoter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/viral protein
molecule keywords Cyclin-dependent kinase 9
total genus 84
structure length 314
sequence length 323
chains with identical sequence E, I
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ogrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ogrA01
4AWIA 2O5KA 4D9UA 3AT4A 2XJ0A 5IQDA 5CXZA 3KU2A 4W4YA 3F7ZA 5DMZA 2C69A 1Y91A 5EI8A 3UQGA 4XHKB 2IZUA 3FMJA 4DYMA 4YMJA 5EOBA 4AZTA 2WMXA 3I81A 4DGLC 4QYEA 4HVGA 5HLNA 2V22A 4EZ5A 5BVEA 4ACMA 3P08A 3EZRA 5TKDA 2UW7A 4LOOA 3V5JA 5E8YA 4QPSA 3ZRMA 4J53A 3F2AA 3LFEA 3W8QA 2GPHA 1J7UA 1GIHA 5LMAA 3HP2A 1ERKA 4CT1A 5DT4A 4DTKA 4G1WA 3TUDA 4MXZA 4I5PA 4RWJA 2XH5A 5CSHA 2WEIA 1ZZLA 3QD4A 2EWAA 2WU6A 4OTRA 4TWCA 4EJ7A 2R4BA 3LFQA 2ZV7A 4BDEA 4Z55A 3IK3A 3KA0A 2HIWA 4DH8A 4IC8A 2ZMDA 4QO9A 4A7CA 4O6LA 4RG0A 2WXVA 1NY3A 5K4JA 2ITUA 2ITPA 2HELA 3A4OX 3PP0A 2WIHA 1UU9A 2WKMA 3LCDA 5DE2A 1PXOA 4EHGA 4FTUA 3EKNA 3SAYA 3P7AA 3MI9A 4FZ6A 4ZXTA 3DFCB 3L8PA 3LKMA 3F82A 3CTHA 5CNOA 3OOMA 2WB8A 2X6EA 5KMNA 3TM0A 2R5TA 3Q4CA 3A4PA 4JL9A 1Q8TA 4N6ZA 4NT4A 4X2GA 4X0MA 5AUWA 5C8MA 3ROCA 4O0YA 2YFXA 4XV9A 3AD6A 4ANSA 2BAQA 4JLCA 4ZTLA 3FZOA 1O6YA 4MH7A 5EK7A 4H1MA 3FLSA 3LZBA 1H26A 4BIBA 3KRRA 4ZP5A 3UZTA 3E88A 2JEDA 4YSMA 1DAYA 1KSWA 2JDRA 1JNKA 2ZMCA 4IX5A 4ZS0A 3H0ZA 3QTUA 5FBOA 4WOVA 1GIIA 2YIQA 4XX9A 2XA4A 3EQPA 2A19B 3SW4A 3UNZA 4DTAA 4IACA 3OUKA 5AMNA 3BE9A 5HG8A 3R7VA 3TT0A 4C61A 5LMBA 1ZYDA 3QUPA 1HCLA 2DUVA 2XIKA 5E7RA 4AT4A 4WBOA 2UVXA 5DT3A 4NM5A 4I4FA 3QTZA 5FBNC 5FQDC 4D2PA 4EC8A 5IUGA 2CKQA 4YP8A 1EH4A 4NIFB 5KZIA 4IJ9A 4IVBA 4QMWA 3MFUA 1KE5A 1ZYCA 4BYJA 2UZUE 3SQQA 4O2PA 3HV5A 4XG6A 3F9NA 3FZRA 2W96B 4IWQA 3VUIA 4FKLA 4FKSA 4ACHA 2RF9A 4GIHA 4RVTA 3R7YA 2VWUA 3R73A 3MH0A 4BCOA 3FXWA 3U8WA 4W8DA 2QQ7A 4BZNA 5DPVA 3G2FA 3BGPA 1M2RA 3TJDA 3AC1A 3ZRKA 3SXRA 1HOWA 4I6HA 1TKIA 3EZVA 3VJOA 3PDTA 4JNWA 4EJNA 3VBVA 2PY3A 3BHUA 5C8NA 4AA0A 1ZYJA 3GVUA 4KSQA 5DN3A 3LM0A 4QMLA 4X3FB 3UQFA 4W4VA 5IISA 5C01A 4Q2AA 3HAMA 4YBJA 3O8UA 4JIKA 4WUAA 5AP4A 3UOLA 4TWNA 3FAAA 5CX9A 2EXCX 4FKUA 1YOJA 2R7IA 1OVEA 3VUMA 4F99A 3TNQB 3QGWA 4FTCA 3HA6A 4AW2A 3TV6A 3UO5A 2YDIA 2XYNA 3GU5A 3NCZA 4ASZA 3KXXA 2VTIA 5BVWA 2F2CB 2XK6A 3ZO3A 3LIJA 4V04A 3ZSIA 4NJDA 3LCSA 5EYKA 2X2KA 5AUYA 4DGGA 3QD3A 4BB4A 3I0OA 3MH3A 2GFSA 2WMBA 4U80A 3GCSA 3PVWA 3W16A 4FV5A 4F09A 4E3CA 3BLHA 1GZOA 3VBXA 1RE8A 1QCFA 3HV4A 2CKPA 4L3LA 3R0TA 5IQAA 3BLRA 2JDVA 1OKYA 3T8OA 2XK8A 4EL9A 4HPTE 4PDPA 1NW1A 2YA9A 2WMWA 3D15A 4B9DA 2UVZA 2XJ1A 3L8XA 5CEMA 3VAPA 2FSMX 3C1XA 4FI1A 4A9UA 4EOOA 3Q2JA 4JXFA 2VTHA 4S30A 4K77A 3FQEA 4Y5HA 4F08A 1H24A 5I5ZA 4O7TA 3FY2A 1ND4A 4IXPA 1Q61A 2W1EA 1XH5A 3CS9A 3KEXA 3EQDA 4JQ8A 3UVRA 5JSMA 4I94A 4TZRA 3DZQA 5M06A 1H00A 2XNPA 2GCDA 4A9TA 1MRVA 4KRDA 4U7ZA 3RM6A 3CTJA 2HW7A 3LFFA 4TYIA 4TYEA 1XH4A 4XRLA 1REKA 2GMXA 2QO2A 4FKOA 1QPCA 1U59A 1KOBA 2C6OA 2CCHA 3DB6A 3R7GA 3H10A 4KKEA 3HMNA 1PF8A 4MF1A 4EH6A 4ZOGA 2YWVA 1KV2A 2F7XE 3PIZA 3MB6A 4IJPA 2BRMA 3AOXA 4MBIA 2UW4A 3E8EA 4QMZA 5EOLA 3EB0A 3ZM4A 2PVYA 2RFSA 5D10A 4LMUA 5HEZA 3OMVA 3KULA 5F20A 5AP7A 3GFWA 3TV7A 4C8BA 5CSPA 3AQVA 2F2UA 2IWIA 4U6RA 3UO4A 5DEYA 4O7YA 4A9RA 4JRVA 4FV9A 4BYIA 4U43A 5CSWA 3UIUA 3NS9A 2NNWB 4ITJA 5LOHA 3RAIA 1QMZA 3PIXA 3RPSA 2FA2A 4KWPA 4FNXA 3UVPA 2OFVA 4TYGA 4N6YA 4QQTA 5C4LA 3U4WA 3DGKA 2JKQA 4XBUA 5EI6A 5HVJA 1BKXA 2QODA 4GU6A 3DQWA 4M3QA 1LUFA 2CGXA 5HORA 1GAGA 1PXNA 2WMQA 4O96A 4J8MA 3P78A 4RC3A 4RQKA 5C26A 4YPSA 4ANBA 5CTPA 1YXTA 3LFCA 3Q53A 1OUYA 2Z7LA 4DG0E 4AT5A 3Q9WA 4EOJA 4RFZA 3SVVA 3PUPA 3LFBA 3LJ2A 2J7TA 4DTBA 5HO8A 3WI6A 2B9IA 4AA5A 4MQ2A 5A4TA 2YEXA 4G9CA 3GBZA 4H39A 5IA0A 3DQXA 4NEUA 3RKBA 2PVNA 2ZB0A 5ETIA 5EHLA 2CNUA 2PVJA 1FMKA 1S9IA 3QRIA 5AR7A 2WTDA 4YJUA 3DJ6A 3WARA 2GS6A 2BVAA 2OZAA 4C35A 1ZOEA 3PVGA 3PJ3A 2XIYA 4MXCA 1R3CA 2VTLA 2EU9A 1YKRA 1SVHA 2GNJA 2XKDA 4R1VA 2GNHA 4AN2A 5CAOA 2UZEA 5CVFA 5K5XA 5GINE 1VJYA 1YDSE 4TW9A 4YNOA 4RWKA 2R3IA 2WEVA 3ORLA 3B2WA 4WHZA 4E26A 5B2MA 3PSCA 3O7LD 5H8EA 4MF0A 4CZYB 4I22A 2B0QA 4R7BA 2EVAA 2V7OA 2PE2A 3EIDA 1MRYA 5LWMA 4E6DA 3ZLSA 5B7VA 2XS0A 1OL7A 2VU3A 4JBVA 4NM3A 3V8TA 2VO7A 1OL1A 3GC7A 3LXNA 2WGJA 1CDKA 5AUZA 4EZ3A 4FF8A 2WOTA 3KXNA 3OCBA 3TNWA 3SW7A 2HY0A 4EH2A 4F9CA 4WG3A 5DFPA 3Q52A 3KXZA 1XH8A 5CNNA 3MSSA 5CU3A 2VRXA 4YTHA 4BKZA 4F7JA 3N51A 4QMYA 4RX5A 4HOKA 3H9OA 4F9BA 3R7OA 2OO8X 2W7XA 5BQ0A 4C4JA 3OBGA 4BIEA 3QX2A 4G31A 3QHRA 5L3AA 3S1HA 2VTAA 1FOTA 2PYWA 3AT2A 3ZDIA 3VW8A 4G34A 3HP5A 1OBGA 3MV5A 2Y4IC 3DAEA 3G0FA 5CU4A 2E9PA 3GP0A 4USDA 4UWYA 1YI4A 4CFFA 5L6OA 3EFJA 3V6RA 3KMMA 3V01A 5ICPA 4YC6A 2W1DA 2ITZA 4FICA 3VS2A 4QPMA 1QPEA 3F2NA 2PUNA 4YHFA 4R78A 1J1CA 1R0PA 2FB8A 2R64A 1ZYLA 4I0TA 2H9VA 2V62A 3MN3A 3QTQA 3R2YA 3BU3A 2ITVA 4GFGA 4TT7A 3DPKA 4ENXA 3GOPA 4AACA 4KABA 1PYXA 4FSZA 2PVRA 5KZ0A 4X7QA 4K9YA 3NMUF 2C0IA 1U46A 3DLZA 4IB0A 3V5TA 4NTTA 2C5VA 4KUJA 2Z8CA 3S95A 5HGIA 3VC4A 3BYVA 3L8SA 4GFMA 3QCXA 3RK5A 3PFQA 2XK9A 4MBLA 3T9IA 5ETAA 3PJCA 4XH6A 3H0YA 1L3RE 4CZTA 1PRYA 3IS5A 4JDJA 4UMTA 5ITAA 3U6IA 1IA9A 4XV1A 3REPA 3OP5A 3S2PA 5ACKA 5EHYA 4YJSA 3RNYA 4AZFA 1P4OA 3JPVA 3NWWA 3R9OA 4CV8A 4KS7A 4N0SA 4FIFA 4P90A 3R22A 1IA8A 5GHVA 4BTKA 4BY9E 2ETRA 3DK7A 2VWZA 4K18A 2P55A 3HMMA 4QMPA 5AP1A 5C9CA 2XEZA 3ZEPA 5JN2A 3ITZA 2Y8OA 4AOTA 4AN3A 3KFAA 2ITXA 2BUJA 2UUEA 3WE8A 3TEIA 4YZCA 2BPMA 2OXXA 3A60A 4I6BA 5KX8A 2HWPA 3NX8A 2UZVA 4CTCA 1M14A 2QCSA 3TACA 4E6AA 3BEGA 4IDTA 3QKMA 1YWVA 3I60A 3WBLA 1YHWA 3HKOA 4FVQA 4J8NA 4O22A 4ALWA 3KCFA 4EH4A 4WRGA 1JPAA 5E8XA 3UJGA 4MNEB 3L1SA 4KNBA 4ZY6A 3HUBA 2GNFA 4CFXA 4BWPA 3R8VA 4EH5A 4QRCA 5FP6A 5CF6A 4G5PA 4NL0A 3ZONA 5BNJA 1S9JA 1OPKA 1WMKA 3EQIA 1WFCA 4RSSA 3AG9A 3SLSA 3E63A 2WQOA 5D7AA 5AWMA 5JK3A 5BVKA 2I0HA 5J7HA 1XBCA 3WF8A 3EQGA 2OJFE 5JFWA 4FTNA 5J1WA 3DAJA 3VN9A 4AAAA 3RINA 4BC6A 4K2RA 2LAVA 4RBLA 5BVFA 4BR3A 2IVVA 1J7LA 4FT9A 4RFMA 2PZIA 2A0CX 3LFSA 1NT2A 2YISA 3K3JA 4M0ZA 3DNEA 3FMLA 5M4FA 5HX6A 3KRXA 1NVRA 3AD4A 2VTSA 3ERKA 5A9UA 1U5RA 4K6ZA 4C4IA 4FL3A 5GIPE 1ZY4A 2JDTA 2PZ5A 4LRJA 3BELA 3KN5A 3C4CA 5HLWA 5FEDA 3WILA 4BDHA 1UNHA 1R39A 3R21A 4ARKA 3NVKI 3IGOA 3ENMA 3CXWA 3PXYA 1KOAA 4XP2A 4IAIA 1YQJA 4BN1A 4IZYA 3ZC6A 1PY5A 4L42A 3SHEA 2AC5A 2O8YA 3ORPA 1CKJA 4Q5EA 4PNKA 1NVSA 4PL3A 3BPRA 3ACJA 1GZKA 3ZSGA 4IVAA 4LGHA 2B7AA 4H3QA 5E8TA 4BCHA 3MB7A 5AP2A 4FTOA 5AEPA 5H8BA 4CZUA 3EOCA 4DFBA 4M13A 5H8GA 5FXSA 2VWBA 2EB3A 2XCKA 5HVKA 5IQEA 3JVRA 4WG5A 3WE4A 4J98A 5HTBA 2HAKA 4O2ZA 2CHLA 3FMEA 4X2FA 4G3EA 4GKHA 2ETKA 3QA8A 1UNLA 2R9SA 4IW0A 5L2TA 5TR6A 5CF5A 1GJOA 3FPMA 4RJ4A 1KE6A 5M4CA 3G5DA 3GCQA 5CS6A 5BVNA 3PXFA 2XK3A 4LV8A 1DS5A 4J97A 4QNYA 2QC6A 4TTHB 2OGVA 3PA3A 3LXKA 4I6QA 3DOGA 5D12A 4BCIA 4A07A 3BYSA 2XIZA 3Q6UA 2Q0BA 1FBNA 3GI3A 2XMYA 3BHYA 2FSLX 2PTKA 2X9EA 3QRKA 4GFOA 4J95A 5EKNA 4YURA 1W7HA 5KMLA 4ALVA 1Q8WA 3UP7A 4L9IA 1JQHA 1WVWA 4BZDA 3S4QA 5HI2A 1OGUA 3D7TB 2P2IA 3NW5A 4RIWA 3R01A 5C27A 4EH3A 5LXMA 3BU6A 2WMVA 3SG8A 3QQLA 3F61A 4YHJA 3OWLA 4O7SA 4C4GA 4AP7A 3GXLA 4CRSA 2QOHA 4QP3A 3DK6A 3KVWA 4OT5A 4RPVA 4LGGA 4JX7A 2C6DA 3QU0A 4L3PA 5CU2A 4A9YA 5M57A 4JJRA 2C4GA 3FI8A 3THBA 4WT6A 2O2UA 2E9OA 4ZSJA 4C3PA 4DEBA 4AGCA 1IRKA 2Y7JA 4PP7A 3ZHPC 1M17A 2OH0E 1FQ1B 4EONA 3CKWA 1JKLA 3U87A 2O3PA 2F7EE 4GIIA 3W10A 3M1SA 5IQGA 2YJRA 3D83A 4E6QA 3FEGA 2BRBA 3RMFA 3WZJA 1E9HA 2YM8A 4W9XA 3R9HA 3NYOA 4HVSA 3P23A 3DB8A 4AE6A 4E4LA 1OPJA 3DS6A 4JOAA 4CMOA 4WKQA 4EH7A 3C4EA 4G5JA 4TN6A 2PUPA 3C50A 3E3BX 4RVKA 1X8BA 3U9NA 1H08A 5DR2A 5JEBA 1BL6A 2Y0AA 4OTGA 4KBKA 5ETCA 4EKKA 1YW2A 5JFXA 4KKGA 3I0QA 4JDIA 2HZ0A 3SXFA 3FE3A 5G6VA 4YSJA 3FC2A 2QOBA 4DEDA 5C8KA 3GU4A 3R1NA 4MK0A 3IW5A 4S2ZA 5AR5A 4P5ZA 3QCSA 4R1YA 1PJKA 4D0XA 4NW6A 2R3QA 1IAJA 2JBOA 2KTYA 2XKFA 4R5YA 4XLVA 4F0IA 3BCEA 3F6XA 3UZRA 4LOQA 3QQFA 4E5AX 4DC2A 3W2OA 2RKUA 3VS0A 4F0GA 4YU2A 4DT9A 2QKWB 1JKKA 2WAJA 4ZJVA 3GT8A 3HUCA 3LQ5A 5EYMA 3VQUA 3GB2A 4EHEA 1Q5KA 2XM9A 1Z9XA 2PZPA 4FZ7A 2ZYBA 2XB7A 4PRJA 1URWA 4NJ3A 4O0UA 3VS1A 4DN5A 1Y8YA 4WRSA 2YCSA 2V5QA 2ZV9A 4D28A 5J1VA 3RALA 3EQCA 2JBPA 5BUEA 5HD7A 4E4MA 3UPZA 4DCEA 3S00A 3BQRA 5EHOA 4H1JA 3MJ2A 3E87A 1OKZA 3ULZA 4IWOA 3HV7A 3NUNA 4LYNA 3CGFA 4DG3E 3L9NA 4NCTC 4BDBA 1TVOA 2QLQA 3AMBA 1H1QA 1OL2A 4EK6A 4AU8A 2IW8A 3DK3A 4AZWA 4C2WA 5CF4A 3MVHA 4TXCA 1FVRA 3O51A 3QXOA 4F1OA 4HVIA 5CEOA 4BCMA 4I93A 4RJ5A 1PMVA 4C62A 2QO7A 5AAGA 3V51A 3I5NA 4FV7A 3GNIB 4ITIA 5A4QA 5C1QB 5M51A 4N4SA 4AFJA 4AXAA 2I0VA 1UKHA 3AGMA 3VF8A 3ANRA 4GEOA 4MYGA 4O1PA 5JQ5A 4DCAA 2BCJA 4L52A 5ETFA 2GNIA 4R8QA 4V01A 3SG9A 3IGGA 2XK4A 1ZOGA 1Q99A 3FWQA 4EQCA 2PUUA 3IW7A 4O91A 1J7IA 3PRIA 4DH7A 1U4DA 3GC0A 2WMRA 3A2CA 3R9DA 5EQYA 4E1ZA 4JIAA 4CYIA 4F7SA 3Q4UA 3EWHA 4M14A 4O6EA 4AX8A 2VWIA 5EI2A 5CASA 5HTCA 3P5KA 3F5UA 4IM0A 4JDHA 2OIDA 4ZTHA 4KBAA 5KMKA 2YZAA 5AAEA 4FK3A 5CANA 4FG7A 5DRDA 3ULIA 3ORTA 4BTFA 1OKWA 3SGCA 2I6LA 2J51A 4LL5A 4LUEA 2WOUA 3ZXZA 3G90X 1KE9A 5HIBA 4IFCA 3P7BA 3TZ9A 3JY9A 5E1EA 5M4UA 3AC2A 4U3YA 4RIYB 2J0MB 1PXPA 5FTQA 2JGZA 3A7GA 1M52A 2X2MA 3DU8A 2PE0A 2X4ZA 3ZOSA 3I5ZA 5AR4A 3T3UA 3R7IA 3HV3A 4BCFA 3F3ZA 3HEGA 2BFXA 3OUNB 3U51A 2J0LA 3FMHA 4DINA 4FV3A 2C47A 3ET7A 4XNEA 4AZSA 3NYXA 4KSPA 4YZMA 4O7LA 2QR8A 4A4XA 1KE8A 4C7TA 3MTFA 5FTGA 1OIQA 3KULB 3SA0A 4FKRA 4XEYA 1GZNA 3W8LA 3BIZA 1STCE 2YAKA 3MY5A 3OTVA 3NW7A 5CXHA 3W2RA 4PDSA 3RI1A 4OW8A 3COKA 4HGTA 3I1AA 1ZMVA 4GUEA 3IO7A 3DDPA 3LW0A 3UOHA 2QHNA 4IX6A 3TN8A 3TL8A 3M2WA 4ZLYA 4QQJA 3FMKA 3NVMB 4XG9A 1K3AA 4WNPA 3VNTA 1ATPE 4RLLA 5CZIA 3PVBA 5ACBC 4D5KA 3SC1A 4ANOA 4BDDA 5CWZA 4XG4A 5I9XA 2YN8A 3GENA 4O21A 4PNIA 3E8CA 4EHZA 2PHKA 2WTKC 2QNJA 3W2PA 4X3FA 4FTAA 4C0TA 5B2KA 1PXLA 3MBLA 4HYHA 4BCPA 1YOLA 2JD5A 3CGOA 5I9UA 2QOFA 4K1BA 1H01A 3UNJA 2OIQA 3OC1A 4WIHA 1SNXA 3VHEA 1TQMA 1UV5A 3D94A 4FKIA 1JAMA 4EOPA 2WMUA 3QFVA 3BI6A 3Q5IA 2ZDTA 4F7NA 3QRJA 4NUSA 3E8NA 3FLWA 4PP9A 4S33A 4CXAA 2OXDA 4CG9A 2IVUA 2FH9A 2OF2A 2R3OA 1XKKA 2GS7A 3UIMA 2J0JA 1E1XA 5I3RA 3C7QA 3FPQA 4YC8A 2A4LA 3G9LX 3PY1A 2W4KA 4FL2A 3CCNA 1WBNA 3DA6A 3Q9YA 4J7BA 3HZTA 3N4TA 5BX0A 3L8VA 5AX3A 1PKDA 1DM2A 3MA3A 1HCKA 1H27A 1Q24A 5H3QA 5KMMA 3PYYA 2W17A 2XKEA 5GIOE 4IAFA 3BRBA 4S34A 5HU3A 4ZSAA 1JOWB 2BKKA 1BYGA 4O86A 3C4FA 5I9ZA 5FLFA 3U9CA 3HNGA 4D55A 4GL9A 2OIBA 5IEXA 1IR3A 2IVSA 4G17A 3KVXA 2A1AB 3DBEA 2F57A 5FM2A 3D7TA 4DH3A 2GTNA 4YJTA 4FEUA 3BKBA 3P0MA 2QOIA 4BIDA 3CY3A 4DBXA 2CKEA 3DT1A 4F7LA 3F5PA 3QUDA 3UMXA 3FZ1A 3LLTA 2BAJA 2JDSA 2GDOA 3CJFA 2P2HA 2R3MA 1V0BA 3BHVA 2HY81 4FSNA 4RX9A 5TT7A 3V8WA 4IZ7A 3ENHA 4JVGA 4ANMA 4BKJA 4CMTA 4DEIA 5EM5A 1KUTA 5AV2A 3Q6WA 2OG8A 3DY7A 3TTJA 1UA2A 3EQBA 3KY2A 1OPLA 5K5NA 4CKIA 2YLEA 3DKGA 4YR8A 1PXIA 3WYXA 2HWOA 3RK9A 4RJ3A 4UY9A 4NKSA 3KRLA 4C33A 2UW5A 2WHBA 1FINA 5HG7A 4FTQA 1B38A 2C3JA 4AFEA 3TNIA 3QLGA 2J6MA 4XP0A 5IG1A 4KKHA 2PE1A 3RZBA 2JC6A 4FTIA 3AD5A 4M68A 2IJMA 3FXXA 4RX7A 5E92A 3KL8A 3L9PA 3HMOA 2PVFA 2A2AA 3DTCA 3FHRA 5CVGA 3DKOA 4U40A 2JFMA 4TWOA 2WQEA 3PZEA 3ZS5A 3FQHA 3QGYA 5DWRA 3BYUA 3E93A 3F3UA 4JBPA 4BTMA 3IECA 3MPTA 3E3PA 3G51A 2NPQA 2ZV2A 4XLIA 4E93A 3BBTB 2PZYA 5EM6A 1YRPA 5FEQA 4AN9A 5AAFA 5KMOA 1YXSA 3LVPA 3COHA 4GW8A 4FYOA 3R8MA 1B6CB 3BV2A 3EMGA 3ORNA 3PLSA 2X0GA 3QTRA 3ZTXA 4D4RA 4F9WA 2XBJA 4D2SA 2BRNA 2X8DA 4BDFA 4XCUA 1OUKA 2W5HA 1XWSA 3OHTA 4V05A 5AR8A 5F95A 3QCQA 2NRUA 4O82A 3TWJA 3GOKA 4JI9A 1RQQA 4FSTA 4DFUA 3FQSA 3OFMA 3O8TA 3HECA 3JS2A 4C02A 2OJIA 2ZB1A 3RK7A 3VF9A 1WCCA 4O0XA 3W55A 2F49A 2YM4A 2YHVA 3COMA 3NYVA 4I4EA 4YLJA 1BUHA 2HCKA 3MFSA 3VS3A 3RVGA 3UIXA 3R9RA 3FSKA 3EN7A 4FR4A 3V04A 4BDIA 4C57A 5CSXA 4NM7A 4ZSEA 3P9JA 4MNEA 2HK5A 5IA2A 4QMSA 1JSUA 2CGWA 3NIZA 4RVMA 3SRVA 5HE2A 2GQRA 4QMNA 5IPJA 5DEWA 3A7FA 1XH7A 3O2MA 5CLPA 4EC9A 2R0IA 2DWBA 4XG3A 4U44A 2ONLC 5E90A 2QU5A 4QMUA 4NIFA 2R3NA 1DAWA 2A27A 5CVHA 2BRHA 4QQ5A 4FKVA 3TG1A 5AP3A 2YAAA 4GH2A 3G6GA 3EQFA 2VTMA 1P2AA 4I23A 1U54B 2C68A 3VUKA 4AUAA 4A4OA 4DEHA 3PA5A 3ZO2A 3KN6A 3G0EA 4R7IA 2WO6A 3KMUA 2XZSA 4F64A 3QZFA 5CU0A 5CU6A 3KF4A 5ANEA 3N4VA 5F94A 2YCRA 2W1GA 4CD0A 3NNWA 2Z60A 1PW2A 4QOXA 5FEEA 5CEQA 4DEGA 5TF9A 4O0VA 1M2QA 4M8TA 4H3PA 4RLKA 1R0EA 4IFGA 3QTXA 4YO6A 5EW9A 1FGKA 3PY0A 1UWJA 2C5YA 3ZXTA 4ASEA 3ATTA 4CNHA 2R3HA 4L68A 5BPYA 4WNMA 4DGNA 2C3LA 2QKRA 3CIKA 2BAKA 4U41A 5HQ0A 2J5EA 1U5QA 4DFYA 3Q32A 3EQHA 3ACKA 4U79A 4RWLA 4L46A 3RGFA 2NRYA 4JQEA 4MTAA 3POOA 2PWLA 3VWAA 4BI1A 4F1TA 4AZEA 4CQEA 1P5EA 2X39A 1XBAA 2WFYA 3B8QA 3PXZA 3OW4A 5DVRA 3VBTA 1OBDA 5BMMA 2OJJA 3D5WA 3F5XA 5AV0A 3RAHA 2PVHA 4D2WA 1YHVA 4QTEA 1YXVA 4RIXB 2CCIA 3DBQA 3UODA 3DZOA 3AC3A 5K9IA 4RGJA 2QOOA 5E8WA 5TOZA 1UU3A 4NM0A 3PTGA 3POZA 5EDPA 3UE4A 4DGMA 2VTNA 1NVQA 3AXWA 4KRCA 2OF4A 4BFMA 4RJ8A 2E2BA 4FMQA 4O7RA 3C5UA 5GZ8A 1H07A 2C1AA 2ZM4A 5FM3A 4YTIA 3ODZX 5J87A 1H0WA 3WZDA 3UP2A 4IMYA 4O7WA 4ACCA 4XP3A 5IA1A 4FV1A 4FYNA 4CRLA 5I9VA 4RRVA 2C5XA 3LJ1A 4FNWA 1M7QA 3NNVA 2Z7QA 4R7HA 5DGZA 3NW6A 5JH6A 3FHIA 1JSTA 2XEYA 2GQGA 4FX3A 3ZCLA 4FTMA 2HZ4A 4UZDA 3RPRA 4XOZA 2RG5A 3R2BA 3CP9A 4Y95A 4WA9A 3FJQE 1VYWA 5GJDA 4HCTA 4P5QA 4BWXA 5IA4A 5CYIA 5JKGA 4B99A 3SD0A 2YM7A 5GNKA 2CNVA 1OZ1A 2V55A 2XF0A 2R3RA 2C5NA 3Q4ZA 5EDQA 3VBYA 5AP6A 3Q3BA 4FVPA 4ENYA 3FY0A 3R8PA 4FUXA 2YDKA 1OI9A 4M12A 3DTWA 4FOCA 2JLDA 3VW6A 2OFUA 4L67A 1GOLA 3UIBA 4C36A 1GY3A 4YZDA 5CF8A 3BYOA 4HYIA 3HLLA 4B7TA 5L2SA 2C30A 4YJVA 2XCHA 2WPAA 3TZ8A 3BBWA 5T68A 1TQIA 3LQ8A 3F5GA 3B2TA 4QTBA 3OCGA 4I92A 3HAVA 4FKQA 1YDRE 2P0CA 5I9WA 4B8MA 2C0TA 4E8AA 2IZTA 1WZYA 3LFAA 3O0GA 4FTKA 4HGEA 4TRLA 2QU6A 4H36A 2ITNA 3DV3A 4GMYA 2GHMA 5HG9A 2W4JA 3IPHA 2RFNA 4FKPA 1PYEA 2BHEA 3HVCA 2YIYA 3VULA 5KBQA 5AM7A 1MQBA 4BRXA 2VNWA 3FL5A 2GNLA 4DE4A 4N57A 4BBFA 3ZEWA 5M44A 3EJ1A 4ONAA 4PDOA 5IUIA 3ZO1A 4EK8A 5FDXA 3LOKA 5E8VA 2GHGA 4NKAA 4QP4A 4NW5A 3OWJA 3R7EA 4OTIA 2XNNA 4FSRA 4C34A 5AADA 3CQWA 4YZNA 4ZY4A 3CD8A 5K0XA 2ETMA 1YI3A 4HVDA 2XKCA 2WMAA 1Q8YA 5LMKC 3KXMA 4G3FA 3I6WA 1VZOA 2UZWE 2XNEA 1DI8A 3F69A 3IW6A 3LCOA 5LVLA 3F3VA 4H58A 3LMHA 4O7ZA 3QBNA 2R3KA 4QQCA 3QZGA 2J0IA 4TYHB 4U9AA 2C3IB 3AC4A 3C0HA 2RSVA 4YLLA 1UU7A 2G9XA 2YWPA 3QF9A 1SZMA 1LP4A 5FTOA 4YJNA 2X4FA 2EXMA 4DITA 1OIUA 5IQFA 2UV2A 3V5QA 5HIEA 3KXGA 5E8ZA 4W4XA 4P4CA 3EHAA 3RM7A 4QMMA 4AA4A 1F0QA 2CPKE 5JFSA 2WTCA 3Q5ZA 3ZMMA 4EK4A 4ZTMA 4QTDA 5HX8A 4V0GB 4R77A 3H30A 2QVSE 4BGQA 3ZM9A 3KXHA 2WIPA 3QRUA 2B1PA 3BX5A 2W9ZB 4EORA 4AGUA 4EHVA 3LE6A 5L8LA 4I0SA 1JKSA 4YTCA 3NSZA 3R83A 3U55A 4UEUA 3PE1A 4MEDA 3BE2A 4NWMA 4Y46A 2JIIA 3SV0A 2NP8A 2WZJA 4FK6A 1VR2A 4LI5A 3QCYA 4PX6A 3MESA 5LWNA 5A54A 2W9FB 3R8UA 3CJGA 2WQNA 4BVUA 5IKWA 4ZS4A 1W0XC 4HPUE 5J5SA 5CY3A 3FI2A 3FZPA 4RX8A 4YLKA 1CMKE 2VO0A 2CN8A 4BICA 1V0PA 3QYWA 4D4VA 2RFEA 3QALE 4G6NA 2EXEA 5I4NA 3NRMA 5CI7A 1Y8GA 2F9GA 1YOMA 1PMEA 4AQCA 1YXXA 1OIRA 4QD6A 5EKOA 4EI4A 2UZNA 4FOBA 5LCKA 3ZH8A 4CFVA 4ZAUA 4OTWA 2FSTX 4PUZA 4FV0A 2YM5A 3QTSA 5A4LA 5JRQA 2BILB 4MD8E 2CSNA 3V8SA 2PL0A 3BHHA 1GZ8A 2HZNA 5T6KA 5DG5A 4F70A 3U6JA 4ZSGA 2HZIA 3W33A 4I0RA 4IAKA 5K0KA 3FZTA 3GCPA 4RIOA 3C5IA 5E9EA 4WUNA 2YERA 3RWPA 2YABA 2VZ6A 4GK2A 5ANDA 3RCJA 4IM2A 3FKLA 3O7LB 4OTQA 1PHKA 3HMPA 4C2VA 5LQFA 3LLAA 3DAKA 3FI4A 3WIGA 3ZZWA 4E7WA 1O9UA 2J4ZA 4JBQA 5KCVA 3VJNA 4UWBA 3UC3A 2CDZA 4OBPA 5H2UA 3ID6C 2UW8A 4IX3A 3TDWA 3TNHA 2Z2WA 2QONA 4DLJA 4IAAA 1OMWA 4PMMA 5J79A 4JG8A 4OBQA 3QZHA 1WBVA 5KMJA 3DDQA 2XNMA 4QYGA 1XO2B 5LVMA 2VV9A 4FZFB 2HYYA 3KRWA 2W99B 3QD2B 4X2KA 4IM3A 1I44A 3CKXA 4EQMA 4L44A 2GNGA 4GS6A 1BL7A 1YHSA 1SVGA 3TTIA 4XV2A 3TKIA 5DA3A 4IB3A 4CLIA 3A99A 3JYAA 4GJ3A 3EYHA 4HYUA 4X21A 3ORXA 3F3WA 4XRJA 2UZOA 3E92A 3ZUUA 1WAKA 3C51A 3JVSA 5M4IA 2XRUA 4Q5HA 3KB7A 4Y5QA 3QL8A 1JVPP 3HGKA 4JT3A 5EM7A 1ZOHA 2BROA 3K2LA 4ZMEA 3O8PA 2O65A 3RBWA 2I1MA 4EQUA 1ZARA 4QP6A 3W18A 1H0VA 3TUCA 1W8CA 4KS8A 4BF2A 5HO6A 4EUTA 1CKPA 5AP5A 3VIDA 5I9YA 1UVRA 2CNQA 1BI8A 2PUIA 1IG1A 2PULA 4BDJA 4UMRA 2WU7A 1IASA 2PVMA 3AGLA 3IOKA 4M97A 4RT7A 3CQEA 2Y6OA 2CLXA 5EH0A 1WBWA 3QX4A 3NCGA 5IEVA 3NAXA 5E4HA 3R8LA 2FO0A 3BEAA 5KMIA 2CJMA 3WZUA 1QPDA 4C3RA 3PPKA 5AUXA 4XJ0A 5HBHA 4DHFA 2BRGA 2VNYA 5J8IA 2HENA 2UW6A 2W05A 4ZTRA 1PKGA 1BLXA 3MYGA 3H9RA 4I5HA 2W1ZA 3R04A 5HVYA 3ATSA 3TZMA 3EFLA 4QP7A 3KREA 4JG6A 3DCVA 1AD5A 3NYNA 3PP1A 3SOAA 5KE0A 1H8FA 3FZSA 5CALA 4FNZA 2WMTA 4JG7A 3LFNA 3FC1X 5AX9A 5DYJA 4C3FA 2GQSA 4FG9A 4UN0C 4FGRA 3C4WA 3QRTA 4OGRA 3R02A 4ZZMA 1PMUA 2PVKA 1Z57A 3RHXA 3OW3A 3V5LA 4R3CA 5AV3A 3DXPA 3NAYA 4FSYA 5TO8A 3V3VA 1K9AA 3VRZA 3FKOA 4YBKA 4H05A 5CT7A 4I3ZA 4U81A 1Z5MA 2OWBA 4A4LA 4E73A 2YDJA 2CN5A 2BIYA 2XBAA 4C59A 5KKRC 2H96A 2PU8A 3ETAA 1CM8A 1Y6BA 4QP1A 5FG8A 3NUXA 4QYYA 2QI8A 1KV1A 4UXQA 2W5AA 3RZFA 4EOSA 3OT3A 4GSBA 4F65A 4S31A 4D5HA 1OL6A 2WMSA 4F6SA 1Q62A 1SVEA 2BZIB 2JAMA 3P4KA 3D5VA 1H28A 1OM1A 2Y9QA 2QHMA 1F3MC 3OY1A 4DBNA 3E5AA 4D2TA 5JZJA 5M07A 3PRFA 2JFLA 4IZAA 3OD6X 5HE1A 5CQUA 4QTCA 4PL5A 4R5SA 4JR3A 3PXKA 4G3CA 1MUOA 5J9ZA 1TQPA 2VTOA 4JRNA 5ANOA 4ORKA 5L8KA 2B53A 4FEXA 1SNUA 2UZTA 4CKJA 1ZY5A 5DT0A 3PG1A 1Y6AA 3UGCA 3I79A 3KC3A 4L43A 4KINA 4OLIA 4Z3VA 5HHWA 4EOQA 3ORKA 4FNYA 4IVCA 3EN6A 4IZ5A 2X7FA 1W98A 3VS7A 4UWCA 4E5WA 3RP9A 5HBEA 3BLQA 4FVRA 4U5JA 3EYGA 4RJ6A 4KIKA 3VRYA 3UO6A 5B2LA 2WNTA 2GTMA 2G15A 4LM5A 1YWRA 2JKKA 4FV4A 5IUHA 3FLQA 2J2IB 1H1WA 3FDNA 5HE3A 3FXZA 4GCJA 4LUDA 4MNFA 4LQMA 2IPXA 5IH5A 3LXPA 4CGAA 1SYKA 2EUFB 1UWHA 4OTHA 4HCVA 3IW8A 4I21A 4EOIA 3ZLYA 3RAWA 5IQCA 2YIXA 3Q04A 5AUTA 3VS5A 5IMXA 1A06A 2ACXA 4JR7A 1ZZ2A 4YJQA 3NUPA 4EUUA 3ZLWA 2YJSA 3ZC5A 4CQGA 1Y57A 1YXUA 5DR9A 3T3VA 5I3OA 4B6LA 4M69A 3P86A 2UZLA 3QWKA 1UU8A 4W4WA 4Y72A 5IA5A 4EH8A 2XIRA 3TKUA 4EZ7A 4PV0A 5JGDA 4UYAA 4ZK5A 3LCTA 5JGAA 2YITA 3O17A 4GK4A 5B0XA 1XH6A 3I7CA 4FTRA 3D5UA 1BI7A 3MVJA 5HOAA 3II5A 4AOIA 4MAOA 1WBSA 4PPAA 4Z9LA 2JIUA 2C6EA 3PSBA 5JMSA 2Q0NA 3VBQA 2W5BA 4FSMA 4YZBA 2B54A 1ZMWA 3HDNA 4MVFA 3DBFA 2PMOX 3DXQA 4D4SA 2AYPA 5CEIA 3LMIA 4DH1A 3A7IA 3R7UA 3KQ7A 4O38A 1OITA 2IN6A 3KK9A 3R8ZA 4E20A 4AGWA 2CGUA 3N4UA 2GS2A 3AMYA 1CKIA 4HNIA 5BYYA 4BBEA 4EH9A 3D4QA 4I5CA 3FMMA 4FUYA 4DFXE 3ELJA 3TIZA 2H6DA 3BQCA 4FTJA 3U4UA 4F0FA 2OU7A 4F9YA 2PVLA 4QT1A 5DOSA 5BVDA 2WQMA 4YJPA 4BCKA 3I4BA 1DI9A 1LR4A 2CGVA 3MY1A 5C4KA 4IB1A 3MTLA 4M67A 4OTDA 3GFEA 4GYIA 3W1FA 3IW4A 3QLFA 2JAVA 4L45A 2PMNX 5BYLA 2CMWA 2ITQA 3QKLA 2WTIA 1UNGA 3CY2A 2F4JA 4FSQA 4MXXA 4BI0A 5J5TA 4FEWA 4MCVA 4EOLA 3HDMA 3UG2A 3ZLXA 4BHZA 2BMCA 3BV3A 3NGAA 2Z02A 4R6VA 3QAME 4ZSLA 4UBAA 4CFUA 3WF6A 5J9YA 4EK5A 1MQ4A 2OK1A 4MX9A 4UV0A 4C58A 4F6WA 4RQVA 3E7OA 4LRMA 3FYKX 4X2NA 4GYGA 5HZNA 3MIAA 4DGOA 4DG2E 4AGDA 4MBJA 4FV8A 5FRIA 2R3PA 4IVDA 4QPAA 2QO9A 1W84A 5GJGA 4XG7A 3GQLA 3W2QA 3MJ1A 4ZJIA 2IW9A 5LVPA 3IDPA 4G6LA 4RC2A 3OT8A 3LHJA 3OVVA 5D7VA 1PMNA 4EOKA 3BGZA 2AC3A 2BDFA 3DJ5A 4FL1A 2OW3A 3F3TA 5CQWA 1PXMA 5F1ZA 5EFQA 2HOGA 5LJJA 4L8MA 3MFTA 3PPZA 4I5MA 4X6QC 5BYZA 1H1RA 4C37A 4TYJA 4IAZA 2Z7RA 1JBPE 3DBCA 3UMWA 1F5QA 1LPUA 2ZOQA 2DYLA 3Q4TA 3RPOA 2C6MA 4CTBA 3QC4A 3FLZA 3ZDUA 4ACDA 5A46A 1YI6A 3NUUA 3EFWA 4GT4A 2G2HA 3KKVA 2J5FA 3D9VA 3VUGA 3V5WA 2UZDA 4BKYA 3WZKA 2BFYA 2VTJA 3CQUA 1ZYSA 4F1MA 4I41A 4R3PA 4FEQA 3UOKA 5HO7A 2C5OA 3I6UA 3VUHA 4DT8A 3FUPA 3ZBXA 3OBJA 5EW8A 4P2KA 3EH9A 5L4QA 3TIYA 3PIYA 3Q9ZA 3MWUA 4FT0A 5D41A 1H25A 4DH5A 5FXQA 3AC8A 3RHKA 4M15A 4PWNA 5EYDA 3MPAA 5C03A 2IO6A 3HRCA 3R1QA 5AA8A 1Q3WA 3K54A 3UTOA 1E1VA 4JS8A 1CTPE 4NZWB 4FTTA 5D9HA 5CAVA 4UX9A 4FZAB 4Z16A 4D9TA 4FT5A 3FYJX 3EN4A 3O50A 2W1IA 4K8AA 4YTFA 3GC8A 3ANQA 1H1SA 3FSFA 3UG1A 2OJ9A 4OT6A 2ITYA 3R30A 4ZTSA 4O81A 4L01A 5IA3A 3NZ0A 4QMVA 5JGBA 4TNDA 1Q8UA 5L2WA 1OIYA 4GU9A 2QOKA 2E9NA 3IDCA 3P1AA 3QHWA 4IHPA 4KB8A 2BALA 4TNBA 4NFNA 5HLPA 4BGHA 4YGAA 2BDJA 2W06A 4FC0A 3FMDA 3NUSA 5FGKA 4BCQA 5D1JA 3KGAA 1Q41A 1JWHA 2ZJWA 4OTFA 1APME 2C6LA 3EL7A 3D5XA 4FIHA 5CZHA 3FI3A 5HESA 4EWQA 3C4ZA 5IF1A 4E4XA 3MDYA 5AP0A 4ZTQA 3QC9A 5CENA 4XS2A 2ZV8A 1OB3A 5KHXA 4J71A 2P3GX 2X8IA 1SMHA 1MP8A 4QP2A 3CE3A 3F88A 2C3KA 3E64A 5AFVA 4FIIA 3CPBA 3GU8A 1OKVA 4FTLA 1K2PA 3FBVA 4GG7A 4HGLA 3GCUA 4ALUA 3HRFA 4YPDA 3MIYA 2E9VA 4FSWA 5ANKA 2B4SB 2JIVA 3LAUA 5IMEA 3UNKA 2VTQA 1RW8A 3D2IA 4MD7E 4Q9SA 4DFZE 5IH4A 3ORZA 4D1ZA 1XBBA 3W2CA 2VWWA 3ROYA 3PE2A 3VQHA 3G6HA 4U0IA 3C13A 3MGYA 2X7OA 1Q97A 2WQBA 4FBXA 4FIJA 3MS9A 5H9BA 3OOGA 4MXAA 4U8ZA 4UALA 3ORMA 2OZAB 3S0OA 2QLUA 2ONLA 4IWDA 3RAKA 3GU6A 3H9FA 3MA6A 1G5SA 3TZ7A 4CEGA 4HNFA 2QURA 4I24A 4HYSA 2IZSA 3RNIA 2FSOX 4FZDB 4O0RA 4EKLA 2R2PA 2LGCA 4GJ2A 3UVQA 4EBWA 4EEVA 1WBOA 2X1NA 3W32A 3R1YA 4CFWA 1GNGA 3RWQA 3C9WA 4NH1A 5FWKK 5GZ9A 4D4YA 5LVOA 3R00A 3OS3A 4RA5A 4CSVA 2ITOA 4OR5A 4UB7A 3PJ2A 3Q9XA 4FV6A 1YWNA 4D0WA 4ZLZA 3D7ZA 2X81A 1ZAOA 2HXQA 4FT3A 4APPA 4CMUA 4WSYA 1H4LA 3G15A 2JDOA 2YIRA 3M42A 1OECA 2OJGA 4NTSA 4U3ZA 5AUVA 1ZRZA 2UW9A 1XR1A 3QXPA 3MY0A 3WF7A 2VTTA 5HICA 3ORIA 1W83A 3TNPC 5BUJA 2X7GA 2VX1A 3VHKA 3ZUTA 4IB5A 3FLNC 4IX4A 3GGFA 4CVAA 5G1XA 4RZWA 2WD1A 4QMOA 3O96A 2C6IA 3UYTA 2VTRA 2C6KA 4EYMA 3UYSA 2UVYA 4TKSA 2R3GA 4FG8A 3IONA 3NPCA 5HTIA 4PF4A 3WF9A 4ANLA 4YZ9A 4QTAA 4ANQA 4F9AA 4G2FA 2J50A 1V1KA 1SM2A 1YVJA 2YIWA 3NNUA 5KHWA 5DBXA 3TKHA 3PA4A 3FL4A 2OI4X 5HCYA 4LOPA 2GHLA 2RGPA 1REJA 5E91A 3G9NA 4M84A 3JR1A 4CG8A 4QP9A 4PDYA 1Q4LA 3ALNA 4L7FA 3C0IA 5LCJA 3HA8A 2C0OA 4RVLA 4KIOA 4OAUC 3EKKA 4BHNA 5DIAA 5HKMA 2J90A 3GUBA 2RG6A 2PK9A 2VGPA 4LMNA 5GJFA 2ZAZA 5ANIA 4X2JA 5E8UA 3GQIA 2IW6A 4O84A 5M09A 1KWPA 1RJBA 2G01A 3D0EA 2ZDUA 4U45A 4X3JA 5EM8A 3D2KA 4DFNA 4AE9A 3OZ6A 4M7IA 4M69B 4QP8A 3EN9A 4IH8A 4D1XA 2XNOA 4AT3A 2QG7A 5JRSA 2DQ7X 5BVOA 2R3JA 1L8TA 5EQPA 1IEPA 3DKFA 2XUUA 2R0UA 3OWKA 4OBOA 4PQNA 1GIJA 3KK8A 3E8DA 4O7NA 3V5PA 3LXLA 3NUAA 2QOLA 5L2QA 3RCDA 3PLAE 2ZM1A 3FV8A 5IQIA 2VX0A 2W0JA 2OLCA 2B9JA 5CEPA 3RTPA 4O83A 4KA3A 4FKJA 4D2VA 4DLIA 4HJOA 3PWYA 4ERKA 4QMTA 5KNJA 1NA7A 3NR9A 4KBCA 2CKOA 2PPQA 1WVYA 3Q2MA 4M0YA 3M11A 4ASDA 4WD5A 4RA4A 3FMNA 3NIEA 4AG8A 1Q3DA 2O63A 4I6FA 5EG3A 3ZBFA 2XK7A 2ERKA 4YJRA 1ZWSA 4ZIMA 3IOPA 3QQGA 4KIQA 2QR7A 3BU5A 2XIXA 4CLJA 5M55A 3HRBA 4MXYA 4QMQA 5IEYA 2OBJA 3PPJA 1WBTA 2PZRA 4M66A 4ANNA 4F63A 4CFNA 4QNAA 2REIA 3HL7A 4HZSA 4Z7HA 3OY3A 4X6RA 4FIEA 5IQBA 5AIKA 1JLUE 3MFRA 2X6DA 4FKGA 5JQ8A 1FVVA 5E1SA 3F66A 3DXNA 2Y6MA 2C1BA 3TJCA 3MH2A 4UXLA 4UYNA 3EFKA 2O64A 5FDPA 3SDJA 5AA9A 4CKRA 3QD0A 3BHTA 2P4IA 4JDKA 2BTSA 3EN5A 4D58A 4UMPA 5A6NA 5KO1A 3W2SA 4F6UA 5IDNA 4K33A 1ZLTA 1JKTA 1U54A 3R6XA 4AF3A 2Y4PA 1G8AA 2VWVA 1JSVA 4P7EA 4QMXA 3U54A 3DBDA 4Y85A 4Y73A 2W1FA 3UPXA 4GRBA 3A8XA 5K4IA 3QTIA 1V0OA 5M56A 1VYZA 4IIRA 1BX6A 3ZSHA 1WBPA 4G16A 3A61A 4O0TA 2OICA 2CLQA 5HCZA 4HVHA 2XJ2A 2BR1A 4WG4A 4EBVA 2G2FA 4UMQA 3KRJA 4LV5A 4TL0A 4FSUA 4RWIA 4XV3A 4B0GA 4MD9E 3R28A 3KCKA 1A48A 1RDQE 4JQ7A 5AV4A 3PWDA 3K5UA 3TV4A 4L6QA 2ERZE 4IANA 4FODA 1R78A 4NCTA 4PMSA 5DH3A 4C38A 4J99A 5J9LA 4ZMFA 3Q60A 4Y83A 2OZOA 4DEAA 2YM3A 4WNKA 2Y4IB 3QQJA 1AQ1A 2G1TA 2DS1A 4K11A 3T9TA 3TDVA 4PTEA 4XMOA 4RIYA 3CBLA 1BMKA 4FV2A 4R3RA 4GT5A 2F7ZE 3G33A 2GU8A 5JFVA 4HGSA 5HIDA 3V6SA 4WSQA 5ANGA 4PPBA 4PL4A 1PXKA 3OTUA 4YHTA 5HNBA 3NEWA 3LPBA 4FGBA 5JT2A 4KAOA 3ZFMA 4UMUA 4YUQA 3F2RA 2G2IA 3UC4A 3UDBA 5AR2A 3PY3A 3ZFYA 4L7SA 3HX4A 3WYYA 3ZZEA 4RJ7A 5DHJA 1VEBA 2PMLX 4RFYA 4XG8A 3OROA 5HG5A 5KUPA 4IADA 3DKCA 4IE9A 2XRWA 4LRKA 3D14A 4DFLA 2QD9A 1G8SA 3CTQA 5DR6A 4OAVB 4FKWA 4LGDA 4UZHA 3UZPA 4L3JA 2RIOA 2W4OA 4PMPA 2BTRA 2ESMA 4G9RA 2VO6A 4CCUA 3U6HA 4Y8DA 2R7BA 4I1ZA 2I7QA 3OWPA 4NYEA 3A7JA 1M2PA 3A7HA 4O27B 3QQKA 4QYHA 2ITWA 2BZHB 2Z7SA 2GFCA 2VD5A 5IQHA 2X9FA 5AM6A 4RZVA 2WTJA 1P4FA 3WOWA 3I7BA 3OXTA 4G6OA 4PTGA 2X2LA 2JITA 3O23A 2QOQA 5A14A 4W9WA 4BCGA 2E9UA 3VS4A 3MW1A 3ZYAA 2O0UA 4NFMA 5L2IA 2B52A 2C6TA 1CSNA 2VWYA 2W1HA 3QWJA 4BBMA 2ITTA 4BWKA 3UOJA 1FGIA 5CT0A 4F4PA 5IH6A 4OTPA 3VUDA 3PG3A 3PXQA 3ZO4A 4ZEGA 5L6PA 2XNBA 2BDWA 4GK3A 2B55A 5L6WL 4YC3A 4C4FA 5A4EA 2YM6A 4FE2A 4W8EA 3CSVA 4EYJA 2VX3A 5LVNA 4IQ6A 5CEKA 4CT2A 5DNRA 4B8LA 2RL5A 4CYJA 3A8WA 5AJQA 5AR3A 5A4CA 4D1SA 5HNGA 3FLYA 3WIKA 5ANJA 4BDAA 3SRVB 3LM5A 3R1SA 3MVMA 3DJ7A 3LJ0A 4G3GA 2IZRA 3HYHA 2BKZA 2SRCA 4DF3A 1R1WA 5L8JA 4C4EA 5F9EA 3RPYA 3OXIA 3CEKA 1M7NA 3PXRA 4GV1A 4IEBA 3F7WA 5FP5A 2VN9A 4E5BA 3CR0A 4DEEA 5FXRA 4RC4A 2IVTA 2YACA 1J1BA 3R63A 4IAYA 4JX3A 5AUUA 3FKNA 4L00A 4MXOA 2B9HA 1T45A 3C4XA 4G3DA 3OCTA 3H4JA 4XYFA 2P33A 2BZJA 2B9FA 4U42A 4USEA 2XVDA 3EL8A 3BWFA 5J95A 3ZFXA 4DAWA 2FYSA 3JY0A 3RPVA 5KBRA 3HMIA 2I40A 4GT3A 2H34A 2VGOA 3QYZA 4WBBB 3QQHA 4DA5A 5EYCA 1PXJA 3HV6A 3OXZA 3QA0A 5K3YA 4BGGA 4O7VA 5D11A 2ZVAA 4WO5A 4IWPA 2UW0A 3CPCA 3S3IA 5AV1A 1KE7A 3AC5A 3B8RA 1IAHA 2HW6A 4LFIA 4BTJA 3DLSA 4K0YA 3P7CA 5IU2A 3JUHA 1AGWA 2VTPA 3ODYX 3SXSA 2JKMA 5DLSA 2KULA 4RMZA 2HXLA 4XOYA 5DI1A 3IG7A 1OL5A 2QOCA 3IKAA 3LMGA 5FUTA 2QG5A 2YLFA 4AOJA 5BMSA 4Z7GA 2J0KA 5I0BA 2ZM3A 3R71A 4V0GA 1J3HA 5AIRA 4AW1A 2YCQA 3PZHA 5HCXA 2VUWA 2WTWA 2PMIA 5HU9A 1WVXA 3JXWA 4WNOA 3RJCA 4XG2A 5FD2A 3PJ8A 3H3CA 2NO3A 3L9MA 4MWHA 2RFDA 3E62A 2YZLA 4ZY5A 4JAIA 4BDGA 3OCSA 3QQUA 3CD3A 4YNEA 4A06A 5KKRB 3TUBA 4MQ1A 4KIKB 3SKCA 3MPMA 4E6CA 3GCVA 1FVTA 4S32A 5DRBA 3COIA 4ASXA 3K5VA 4BDCA 1W82A 1XH9A 4GUBA 4ITHA 2OH4A 3L9LA 2XP2A 3CLYA 2GSFA 4I20A 4KIPA 5CAPA 3GU7A 1I09A 3WF5A 3WZEA 3PVUA 4X3FC 3QTWA 3QZIA 4H3BA 1J91A 4TY1A 5E8SA 5IDPA 3VS6A 5GZAA 2I0EA 4II5A 1O6LA 4ZZOA 1LEWA 1B39A 1ZMUA 5CAUA 3DNDA 4HZRA 4XUFA 4YJOA 3ALOA 3AMAA 3GEQA 4MWIA 4BI2A 4ZLOA 2Q83A 2WTVA 1A9UA 3N9XA 4AZVA 3ZRLA 4MKCA 4LG4A 1UKIA 2BZKB 2PSQA 1URCA 4D2RA 2X8EA 2AUHA 4BCJA 5HNIX 5CAQA 3IQ7A 1QL6A 5F4NA 3AT3A 4AW5A 3NLBA 3DFAA 3A62A 2FUMA 3TCPA 3TXOA 4J1RA 3OG7A 4BCNA 4QYFA 4EOMA 4NSTA 4RIWB 4FEVA 4GVAA 4KD1A 2OKRA 2JKOA 4CV9A 2OSCA 4EWHA 4NK9A 4ERWA 2UZBA 5EQEA 5M08A 4JBOA 2V0DA 4O0WA 3OEZA 3NDMA 2R3FA 1FPUA 2FVDA 3QKKA 5HE0A 5M53A 4GVJA 4NU1A 2BIKB 2VO3A 4TWPA 4USFA 1NXKA 5TE0A 3ZUVA 3TI1A 3UBDA 1MRUA 4C4HA 1Q8ZA 3VUTA 4J96A 2J9MA 3BYMA 4HW7A 5BUIA 3BWJA 2R3LA 4IDVA 5HD4A 5LMKA 4N70A 2UW3A 3Q96A 1T46A 1FMOE 4AW0A 2VAGA 4APCA 4BL1A 1ZXEA 1H1PA 3PJ1A 5A6OA 3KMWA 1XQZA 5EDRA 2WTKB 4PMTA 4TPTA 3OF0A 4FIGA 3NUYA 4PTCA 2BHHA 3E7VA 4JAJA 3SOCA 1P14A 4BZOA 3QUEA 4J52A 1LEZA 3LCKA 4ID7A 4O1OA 3LFDA 4U97A 1YDTE 4CCBA 3C0GA 4L53A 4MHAA 2YCFA 4FT7A 5A3XA 3VO3A 4FKTA 2IG7A 3BZ3A 3IDBA 4PY1A 5J7BA 4XBRA 3MVLA 4GKIA 3KF7A 3PSDA 3VVHA 5T3QA 4RIXA 4GG5A 5JZNA 2V7AA 4IBMA 4LL0A 1O6KA 3VBWA 3ZU7A 2VWXA 4TYHA 4B4LA 5CSVA 5EW3A 2EB2A 4E4NA 3GC9A 3EQRA 3OEFX 4ZJJA 2I0YA 2XYUA 2FGIA 3BGQA 4IC7A 3R9NA 2XM8A 2H8HA 2W1CA 3MH1A 1XJDA 3O71A 4AS0A 4HCUA 4FA2A 5HBJA 5IZFA 2XNGA 3LQ3A 3SX9A 4A9SA 4YO4A 4ZZNA 1G3NA 4PPCA 4ZTNA 3CC6A 4BDKA 4OUCA 5LARA 4CFMA 3NNXA 4ACGA 1QPJA 5CI6A 4EK3A 4Q9ZA 1XHAA 3K3IA 3P79A 4O0SA 2OXYA 2WELA 3UQCA
chains in the Genus database with same CATH superfamily
4AWIA 2O5KA 4D9UA 3AT4A 2XJ0A 5IQDA 5CXZA 3KU2A 4W4YA 3F7ZA 5DMZA 1VLRA 2C69A 1Y91A 5EI8A 3UQGA 4XHKB 2IZUA 3FMJA 4DYMA 4YMJA 5EOBA 3W0OA 4AZTA 2WMXA 3I81A 4DGLC 4QYEA 4HVGA 5HLNA 2V22A 4EZ5A 5BVEA 4ACMA 3P08A 3EZRA 5TKDA 2UW7A 4LOOA 3V5JA 5E8YA 4QPSA 3ZRMA 4J53A 3F2AA 3LFEA 3W8QA 2GPHA 1J7UA 1GIHA 5LMAA 3HP2A 1ERKA 4CT1A 5DT4A 4DTKA 1XMLA 4G1WA 3TUDA 4MXZA 4I5PA 4RWJA 2XH5A 5CSHA 2WEIA 1ZZLA 3QD4A 2EWAA 2WU6A 4OTRA 4TWCA 4EJ7A 2R4BA 3LFQA 2ZV7A 4BDEA 4Z55A 3IK3A 3KA0A 2HIWA 1W2DA 4IC8A 4DH8A 2ZMDA 4QO9A 4A7CA 4O6LA 4RG0A 2WXVA 1NY3A 5K4JA 2ITUA 2ITPA 2HELA 3A4OX 3PP0A 2WIHA 1UU9A 2WKMA 2X0OA 3LCDA 5DE2A 1PXOA 4EHGA 4FTUA 3EKNA 3SAYA 3P7AA 3MI9A 4FZ6A 4ZXTA 3DFCB 3L8PA 3LKMA 3F82A 3CTHA 5CNOA 3OOMA 2WB8A 2X6EA 5KMNA 3TM0A 2R5TA 3Q4CA 3A4PA 4JL9A 1Q8TA 4N6ZA 4NT4A 4X2GA 4X0MA 5AUWA 5C8MA 3ROCA 4O0YA 2YFXA 4XV9A 3AD6A 4ANSA 2BAQA 4JLCA 4ZTLA 3FZOA 1O6YA 4MH7A 5EK7A 4H1MA 4BJJB 3FLSA 3LZBA 1H26A 1G8KA 4BIBA 3KRRA 4ZP5A 3UZTA 3E88A 2JEDA 4YSMA 1DAYA 1KSWA 2JDRA 1JNKA 2ZMCA 4IX5A 4ZS0A 3H0ZA 3QTUA 5FBOA 4WOVA 1GIIA 2YIQA 4XX9A 2XA4A 3EQPA 2A19B 3SW4A 3UNZA 4DTAA 4IACA 3OUKA 5AMNA 3BE9A 5HG8A 3R7VA 3TT0A 4C61A 5LMBA 1ZYDA 3QUPA 1HCLA 2DUVA 2X0QA 2XIKA 5E7RA 4AT4A 4WBOA 2UVXA 5DT3A 4NM5A 4I4FA 3QTZA 5FBNC 5FQDC 4D2PA 4EC8A 5IUGA 2CKQA 4YP8A 1EH4A 4NIFB 5KZIA 4IJ9A 4IVBA 4QMWA 3MFUA 1KE5A 1ZYCA 4BYJA 2UZUE 3SQQA 4O2PA 3HV5A 4XG6A 3F9NA 3FZRA 2W96B 4IWQA 3VUIA 4FKLA 4FKSA 4ACHA 2RF9A 4GIHA 4RVTA 3R7YA 2VWUA 3R73A 3MH0A 4BCOA 3FXWA 3U8WA 4W8DA 2QQ7A 4BZNA 5DPVA 3G2FA 3BGPA 1M2RA 3TJDA 3AC1A 3ZRKA 3SXRA 1HOWA 4I6HA 1TKIA 3EZVA 3VJOA 1TFFA 3PDTA 4JNWA 4EJNA 3VBVA 2PY3A 3BHUA 5C8NA 4AA0A 1ZYJA 3GVUA 4KSQA 5DN3A 3LM0A 4QMLA 4X3FB 3UQFA 4W4VA 5IISA 5C01A 4Q2AA 3HAMA 2A98A 4YBJA 3O8UA 4JIKA 4WUAA 5AP4A 3UOLA 4TWNA 3FAAA 5CX9A 2EXCX 4FKUA 4AXFA 1YOJA 2R7IA 1OVEA 3VUMA 4F99A 3TNQB 3QGWA 4FTCA 3HA6A 4AW2A 3TV6A 3UO5A 4I6LA 2YDIA 2XYNA 3GU5A 3NCZA 4ASZA 3KXXA 2VTIA 5BVWA 2F2CB 2XK6A 5BV3A 3ZO3A 3LIJA 4V04A 3ZSIA 4NJDA 3LCSA 5EYKA 2X2KA 5AUYA 4DGGA 3QD3A 4BB4A 3I0OA 3MH3A 2GFSA 2WMBA 4U80A 3GCSA 3PVWA 3W16A 4FV5A 4F09A 4E3CA 3BLHA 1GZOA 3VBXA 1RE8A 1QCFA 3HV4A 2CKPA 4L3LA 3R0TA 5IQAA 3BLRA 2JDVA 1OKYA 3T8OA 2XK8A 4EL9A 4HPTE 4PDPA 1NW1A 2YA9A 2WMWA 3D15A 4B9DA 2UVZA 2XJ1A 3L8XA 5CEMA 3VAPA 2FSMX 3C1XA 4FI1A 4A9UA 4EOOA 3Q2JA 4JXFA 2VTHA 4S30A 4K77A 3FQEA 4Y5HA 4F08A 1H24A 4O4DA 5I5ZA 4O7TA 3FY2A 1ND4A 4IXPA 1Q61A 2W1EA 1XH5A 3CS9A 3KEXA 3EQDA 4JQ8A 3UVRA 5JSMA 4I94A 4TZRA 3DZQA 5M06A 1H00A 2XNPA 2GCDA 4A9TA 1MRVA 4KRDA 4U7ZA 3RM6A 3CTJA 2HW7A 3LFFA 4TYIA 4TYEA 1XH4A 4XRLA 1REKA 2GMXA 2QO2A 4FKOA 1QPCA 1U59A 1KOBA 2C6OA 2CCHA 3DB6A 3R7GA 3H10A 4KKEA 3HMNA 1PF8A 4MF1A 4EH6A 4ZOGA 2YWVA 1KV2A 2F7XE 3PIZA 3MB6A 4IJPA 2BRMA 3AOXA 4MBIA 2UW4A 3E8EA 4QMZA 5EOLA 3EB0A 3ZM4A 2PVYA 2RFSA 5D10A 4LMUA 5HEZA 3OMVA 3KULA 5F20A 5AP7A 3PUFC 3GFWA 3TV7A 4C8BA 5CSPA 3AQVA 2F2UA 2IWIA 4U6RA 3UO4A 5DEYA 4O7YA 4A9RA 4JRVA 4FV9A 4BYIA 4U43A 5CSWA 3UIUA 3NS9A 2NNWB 4ITJA 5LOHA 3RAIA 1QMZA 3PIXA 3W0MA 3RPSA 2FA2A 4KWPA 4FNXA 3UVPA 2OFVA 4TYGA 4N6YA 4QQTA 5C4LA 3U4WA 3DGKA 2JKQA 4XBUA 5EI6A 5HVJA 1BKXA 2QODA 4GU6A 3DQWA 4M3QA 1LUFA 2CGXA 5HORA 1GAGA 1PXNA 2WMQA 4O96A 4J8MA 3P78A 4RC3A 4RQKA 5C26A 4YPSA 4ANBA 5CTPA 1YXTA 3LFCA 3Q53A 1OUYA 2Z7LA 4DG0E 4AT5A 3Q9WA 4EOJA 4RFZA 3SVVA 3PUPA 3LFBA 3LJ2A 2J7TA 4DTBA 5HO8A 3WI6A 2B9IA 4AA5A 4MQ2A 5A4TA 2YEXA 4G9CA 3GBZA 4H39A 5IA0A 3DQXA 4NEUA 3RKBA 2PVNA 2ZB0A 5ETIA 5EHLA 2CNUA 2PVJA 1FMKA 1S9IA 3QRIA 5AR7A 2WTDA 4YJUA 3DJ6A 3WARA 2GS6A 2BVAA 2OZAA 4C35A 1ZOEA 3PVGA 3PJ3A 2XIYA 4MXCA 1R3CA 2VTLA 2EU9A 1YKRA 1SVHA 2GNJA 2XKDA 4R1VA 2GNHA 4AN2A 5CAOA 2UZEA 5CVFA 5K5XA 5GINE 1VJYA 1YDSE 4TW9A 4YNOA 4RWKA 2R3IA 2WEVA 3ORLA 3B2WA 4WHZA 4E26A 5B2MA 3PSCA 3O7LD 5H8EA 4MF0A 4CZYB 4I22A 2B0QA 4R7BA 2EVAA 2V7OA 2PE2A 3EIDA 1MRYA 5LWMA 4E6DA 3ZLSA 5B7VA 2XS0A 1OL7A 2VU3A 4JBVA 4NM3A 3V8TA 2VO7A 1OL1A 3GC7A 3LXNA 2WGJA 1CDKA 5AUZA 4EZ3A 4FF8A 2WOTA 3KXNA 3OCBA 3TNWA 3SW7A 2HY0A 4EH2A 4F9CA 4WG3A 5DFPA 3Q52A 3KXZA 1XH8A 5CNNA 3MSSA 4O4BB 2VRXA 5CU3A 4YTHA 4BKZA 4F7JA 3N51A 4QMYA 4RX5A 4HOKA 3H9OA 4F9BA 3R7OA 2OO8X 2W7XA 5BQ0A 4C4JA 3OBGA 4BIEA 3QX2A 4G31A 3QHRA 5L3AA 3S1HA 2VTAA 1FOTA 2PYWA 3AT2A 3ZDIA 3VW8A 4G34A 3HP5A 1OBGA 3MV5A 2Y4IC 3DAEA 3G0FA 5CU4A 2E9PA 3GP0A 4USDA 4UWYA 1YI4A 4CFFA 5L6OA 3EFJA 3V6RA 3KMMA 3V01A 5ICPA 4YC6A 2W1DA 2ITZA 4FICA 3VS2A 4QPMA 1QPEA 3F2NA 2PUNA 4YHFA 4R78A 1J1CA 1R0PA 2FB8A 2R64A 1ZYLA 4I0TA 2H9VA 2V62A 3MN3A 3QTQA 3R2YA 3BU3A 2ITVA 4GFGA 4TT7A 3DPKA 4ENXA 3GOPA 4AACA 4KABA 1PYXA 4FSZA 2PVRA 5KZ0A 4X7QA 4K9YA 3NMUF 2C0IA 1U46A 3DLZA 4IB0A 3V5TA 4NTTA 2C5VA 4KUJA 2Z8CA 3S95A 5HGIA 3VC4A 3BYVA 3L8SA 4GFMA 3QCXA 3RK5A 3PFQA 2XK9A 4MBLA 3T9IA 5ETAA 3PJCA 4XH6A 3H0YA 1L3RE 4CZTA 1PRYA 3IS5A 4JDJA 4UMTA 5ITAA 3U6IA 1IA9A 4XV1A 3REPA 3OP5A 3S2PA 5ACKA 5EHYA 4YJSA 3RNYA 4AZFA 1P4OA 3JPVA 3NWWA 3R9OA 4CV8A 4KS7A 4N0SA 4FIFA 4P90A 3R22A 1IA8A 5GHVA 4BTKA 4BY9E 2ETRA 3DK7A 2VWZA 4K18A 2P55A 3HMMA 4QMPA 5AP1A 5C9CA 2XEZA 3ZEPA 5JN2A 3ITZA 2Y8OA 4AOTA 4AN3A 3KFAA 2ITXA 2BUJA 2UUEA 3WE8A 3TEIA 4YZCA 2BPMA 2OXXA 3A60A 4I6BA 5KX8A 2HWPA 3NX8A 2UZVA 4CTCA 1M14A 2QCSA 3TACA 4E6AA 3BEGA 4IDTA 3QKMA 1YWVA 3I60A 3WBLA 1YHWA 3HKOA 4FVQA 4J8NA 4O22A 4ALWA 3KCFA 4EH4A 4WRGA 1JPAA 5E8XA 3UJGA 4MNEB 3L1SA 4KNBA 4ZY6A 3HUBA 2GNFA 4CFXA 4BWPA 3R8VA 4EH5A 4QRCA 5FP6A 5CF6A 4G5PA 4NL0A 3ZONA 5BNJA 1S9JA 1OPKA 1WMKA 3EQIA 1WFCA 4RSSA 3AG9A 3SLSA 3E63A 2WQOA 5D7AA 5AWMA 5JK3A 5BVKA 2I0HA 5J7HA 1XBCA 3WF8A 3EQGA 2OJFE 5JFWA 4FTNA 5J1WA 3DAJA 3VN9A 4AAAA 3RINA 4BC6A 4K2RA 2LAVA 4RBLA 5BVFA 4BR3A 2IVVA 1J7LA 4FT9A 4RFMA 2PZIA 2A0CX 3LFSA 1NT2A 2YISA 3K3JA 4M0ZA 3DNEA 3FMLA 5M4FA 5HX6A 3KRXA 1NVRA 3AD4A 2VTSA 3ERKA 5A9UA 1U5RA 4K6ZA 4C4IA 4FL3A 5GIPE 1ZY4A 2JDTA 2PZ5A 4LRJA 3BELA 3KN5A 3C4CA 5HLWA 5FEDA 3WILA 4BDHA 1UNHA 1R39A 3R21A 4ARKA 3NVKI 3IGOA 3ENMA 3CXWA 3PXYA 1KOAA 4XP2A 4IAIA 1YQJA 4BN1A 4IZYA 3ZC6A 1PY5A 4L42A 3SHEA 2AC5A 2O8YA 3ORPA 1CKJA 4Q5EA 4PNKA 1NVSA 4PL3A 3BPRA 3ACJA 1GZKA 3ZSGA 4IVAA 4LGHA 2B7AA 4H3QA 5E8TA 4BCHA 3MB7A 5AP2A 4FTOA 5AEPA 5H8BA 4CZUA 3EOCA 4DFBA 4M13A 5H8GA 5FXSA 2VWBA 2EB3A 2XCKA 5HVKA 5IQEA 3JVRA 4WG5A 3WE4A 4J98A 5HTBA 2HAKA 4O2ZA 2CHLA 3FMEA 4X2FA 4G3EA 4GKHA 2ETKA 3QA8A 1UNLA 2R9SA 4IW0A 5L2TA 5TR6A 5CF5A 1GJOA 3FPMA 4RJ4A 1KE6A 5M4CA 3G5DA 3GCQA 5CS6A 5BVNA 3PXFA 2XK3A 4LV8A 1DS5A 4J97A 4QNYA 2QC6A 4TTHB 2OGVA 3PA3A 3LXKA 4I6QA 3DOGA 5D12A 4BCIA 4A07A 3BYSA 2XIZA 3Q6UA 2Q0BA 1FBNA 3GI3A 2XMYA 3BHYA 2FSLX 2PTKA 2X9EA 3QRKA 4GFOA 4J95A 5EKNA 4YURA 1W7HA 5KMLA 4ALVA 1Q8WA 3UP7A 4L9IA 1JQHA 1WVWA 4BZDA 3S4QA 5HI2A 1OGUA 3D7TB 2P2IA 3NW5A 4RIWA 3R01A 5C27A 4EH3A 5LXMA 3BU6A 2WMVA 3SG8A 3QQLA 3F61A 4YHJA 3OWLA 4O7SA 4C4GA 4AP7A 3GXLA 4CRSA 2QOHA 4QP3A 3DK6A 3KVWA 4OT5A 4RPVA 4LGGA 4JX7A 2C6DA 3QU0A 4L3PA 5CU2A 4A9YA 5M57A 4JJRA 2C4GA 3FI8A 3THBA 4WT6A 2O2UA 2E9OA 4ZSJA 4C3PA 4DEBA 4AGCA 1IRKA 2Y7JA 4PP7A 3ZHPC 1M17A 2OH0E 1FQ1B 4EONA 3CKWA 1JKLA 3U87A 2O3PA 2F7EE 4GIIA 3W10A 3M1SA 5IQGA 2YJRA 3D83A 4E6QA 3FEGA 3KIOC 2BRBA 3RMFA 3WZJA 1E9HA 2YM8A 4W9XA 3R9HA 3NYOA 4HVSA 3P23A 3DB8A 4AE6A 4E4LA 1OPJA 3DS6A 4JOAA 4CMOA 4WKQA 4EH7A 3C4EA 4G5JA 4TN6A 2PUPA 3C50A 3E3BX 4RVKA 1X8BA 3U9NA 1H08A 5DR2A 5JEBA 1BL6A 2Y0AA 4OTGA 4KBKA 5ETCA 4EKKA 1YW2A 5JFXA 4KKGA 3I0QA 4JDIA 2HZ0A 3SXFA 3FE3A 5G6VA 4YSJA 3FC2A 2QOBA 4DEDA 5C8KA 3GU4A 3R1NA 4MK0A 3IW5A 4S2ZA 5AR5A 1ST4A 4P5ZA 3QCSA 4R1YA 4O4EA 1PJKA 4D0XA 4NW6A 2R3QA 1IAJA 2JBOA 2KTYA 2XKFA 4R5YA 4XLVA 4F0IA 3BCEA 3F6XA 3UZRA 4LOQA 3QQFA 4E5AX 4DC2A 3W2OA 2RKUA 3VS0A 4F0GA 4YU2A 4DT9A 2QKWB 1JKKA 4O4CA 2WAJA 4ZJVA 3GT8A 3HUCA 3LQ5A 5EYMA 3VQUA 3GB2A 4EHEA 1Q5KA 2XM9A 4O4FA 1Z9XA 2PZPA 4FZ7A 2ZYBA 2XB7A 4PRJA 1URWA 4NJ3A 4O0UA 3VS1A 4DN5A 1Y8YA 4WRSA 2YCSA 2V5QA 2ZV9A 4D28A 5J1VA 3RALA 3EQCA 2JBPA 5BUEA 5HD7A 4E4MA 3UPZA 4DCEA 3S00A 2AEGA 3BQRA 5EHOA 4H1JA 3MJ2A 3E87A 1OKZA 3ULZA 4IWOA 3W0PA 3HV7A 3NUNA 4LYNA 3CGFA 4DG3E 3L9NA 4NCTC 4BDBA 1TVOA 3UDTA 2QLQA 3O5AA 3AMBA 1H1QA 1OL2A 4EK6A 4AU8A 3BL7A 2IW8A 3DK3A 4AZWA 4C2WA 5CF4A 3PFYA 3MVHA 4TXCA 1FVRA 3O51A 3QXOA 4F1OA 4HVIA 5CEOA 4BCMA 4I93A 4RJ5A 1PMVA 4C62A 2QO7A 5AAGA 3V51A 3I5NA 4FV7A 3GNIB 4ITIA 5A4QA 5C1QB 5M51A 4N4SA 4AFJA 4AXAA 2I0VA 1UKHA 3AGMA 3VF8A 3ANRA 4GEOA 4MYGA 4O1PA 5JQ5A 4DCAA 4DDGA 2BCJA 4L52A 5ETFA 2GNIA 4R8QA 4V01A 3SG9A 3IGGA 2XK4A 1ZOGA 1Q99A 3FWQA 4EQCA 2PUUA 3IW7A 4O91A 1J7IA 3PRIA 4DH7A 1U4DA 3GC0A 2WMRA 3A2CA 3R9DA 5EQYA 4E1ZA 4JIAA 4CYIA 4F7SA 3Q4UA 3EWHA 4M14A 4O6EA 4AX8A 2VWIA 5EI2A 5CASA 5HTCA 3P5KA 3F5UA 4IM0A 4JDHA 2OIDA 4ZTHA 4KBAA 5KMKA 2YZAA 5AAEA 4FK3A 5CANA 4FG7A 5DRDA 3ULIA 3ORTA 4BTFA 1OKWA 3SGCA 2I6LA 2J51A 4LL5A 4LUEA 2WOUA 3ZXZA 3G90X 1KE9A 5HIBA 4IFCA 3P7BA 3TZ9A 3JY9A 5E1EA 5M4UA 3AC2A 4U3YA 4RIYB 2J0MB 1PXPA 5FTQA 2JGZA 3A7GA 1M52A 2X2MA 3DU8A 2PE0A 2X4ZA 3ZOSA 3I5ZA 5AR4A 3T3UA 3R7IA 3HV3A 4BCFA 3F3ZA 3HEGA 2BFXA 3OUNB 3U51A 2J0LA 3FMHA 3UDZA 4DINA 4FV3A 2C47A 3ET7A 4XNEA 4AZSA 3NYXA 4KSPA 4YZMA 4O7LA 2QR8A 4A4XA 1KE8A 4C7TA 3MTFA 5FTGA 1OIQA 3KULB 3SA0A 4FKRA 4XEYA 1GZNA 3W8LA 3BIZA 1STCE 2YAKA 3MY5A 3OTVA 3NW7A 5CXHA 3W2RA 4PDSA 3RI1A 4OW8A 3COKA 4HGTA 3I1AA 1ZMVA 4GUEA 3IO7A 3DDPA 3LW0A 3UOHA 2QHNA 3P5JC 4IX6A 3TN8A 3TL8A 3M2WA 4ZLYA 4QQJA 3FMKA 3NVMB 4XG9A 1K3AA 1OGYA 4WNPA 3VNTA 1ATPE 4RLLA 5CZIA 3PVBA 5ACBC 4D5KA 3SC1A 4ANOA 4BDDA 5CWZA 4XG4A 5I9XA 2YN8A 3GENA 4O21A 4PNIA 2XARA 3E8CA 4EHZA 2PHKA 2WTKC 2QNJA 3W2PA 4X3FA 4FTAA 4C0TA 5B2KA 1PXLA 3MBLA 4HYHA 4BCPA 1YOLA 2JD5A 3CGOA 5I9UA 2QOFA 4K1BA 1H01A 3UNJA 2OIQA 3OC1A 4WIHA 1SNXA 3VHEA 1TQMA 1UV5A 3D94A 4FKIA 1JAMA 4EOPA 2WMUA 3QFVA 3BI6A 3Q5IA 2ZDTA 4F7NA 3QRJA 4NUSA 3E8NA 3FLWA 4PP9A 4S33A 4CXAA 2OXDA 4CG9A 2IVUA 2FH9A 2OF2A 2R3OA 4LDTA 1XKKA 2GS7A 3UIMA 2J0JA 1E1XA 5I3RA 3C7QA 3FPQA 4YC8A 4MUQA 2A4LA 3G9LX 3PY1A 2W4KA 4FL2A 3CCNA 1WBNA 3DA6A 3Q9YA 4J7BA 3HZTA 3N4TA 5BX0A 3L8VA 5AX3A 1PKDA 1DM2A 3MA3A 1HCKA 1H27A 1Q24A 5H3QA 5KMMA 3PYYA 2W17A 2XKEA 5GIOE 4IAFA 3BRBA 4S34A 5HU3A 4ZSAA 1JOWB 2BKKA 1BYGA 4O86A 3C4FA 5I9ZA 5FLFA 3U9CA 3HNGA 4D55A 4GL9A 2OIBA 5IEXA 1IR3A 2IVSA 4G17A 3KVXA 2A1AB 3DBEA 2F57A 5FM2A 3D7TA 4DH3A 2GTNA 4YJTA 4FEUA 3BKBA 3P0MA 2QOIA 2IEWA 4BIDA 3CY3A 4DBXA 2CKEA 3DT1A 4F7LA 3F5PA 3QUDA 3UMXA 3FZ1A 3LLTA 2BAJA 2JDSA 2GDOA 3CJFA 2P2HA 2R3MA 1V0BA 3BHVA 2HY81 4FSNA 4RX9A 5TT7A 3V8WA 4IZ7A 3ENHA 4JVGA 4ANMA 4BKJA 4CMTA 4DEIA 5EM5A 1KUTA 5AV2A 3Q6WA 2OG8A 3DY7A 3TTJA 1UA2A 3EQBA 3KY2A 1OPLA 5K5NA 4CKIA 2YLEA 3DKGA 4YR8A 1PXIA 3WYXA 2HWOA 3RK9A 4RJ3A 4UY9A 4NKSA 3KRLA 4C33A 2UW5A 2WHBA 1FINA 5HG7A 4FTQA 1B38A 2C3JA 4AFEA 3TNIA 3QLGA 2J6MA 4XP0A 5IG1A 4KKHA 2PE1A 3RZBA 2JC6A 4FTIA 3AD5A 4M68A 2IJMA 3FXXA 4RX7A 5E92A 3KL8A 3L9PA 3HMOA 2PVFA 2A2AA 3DTCA 3FHRA 5CVGA 3DKOA 4U40A 2JFMA 4TWOA 2WQEA 3PZEA 3ZS5A 3FQHA 3QGYA 5DWRA 3BYUA 3E93A 3F3UA 4JBPA 3TYKA 4BTMA 3IECA 3MPTA 3E3PA 3G51A 2NPQA 2ZV2A 4XLIA 4E93A 3BBTB 2PZYA 5EM6A 1YRPA 5FEQA 4AN9A 5AAFA 5KMOA 1YXSA 3LVPA 3COHA 4GW8A 4FYOA 3R8MA 1B6CB 3BV2A 3EMGA 3ORNA 3PLSA 2X0GA 3QTRA 3ZTXA 4D4RA 4F9WA 2XBJA 4D2SA 2BRNA 3W0SA 2X8DA 4BDFA 4XCUA 1OUKA 2W5HA 1XWSA 3OHTA 4V05A 5AR8A 5F95A 3QCQA 2NRUA 4O82A 3TWJA 3GOKA 4JI9A 4BJJA 1RQQA 4FSTA 4DFUA 3FQSA 3OFMA 3O8TA 3HECA 3JS2A 4C02A 2OJIA 2ZB1A 3RK7A 3VF9A 1WCCA 4O0XA 3W55A 2F49A 2YM4A 2YHVA 3COMA 3NYVA 4I4EA 4YLJA 1BUHA 2HCKA 3MFSA 3VS3A 3RVGA 3UIXA 3R9RA 3FSKA 3EN7A 4FR4A 3V04A 4BDIA 4C57A 4FRFA 5CSXA 4NM7A 4ZSEA 3P9JA 4MNEA 2HK5A 5IA2A 4QMSA 1JSUA 2CGWA 3NIZA 4RVMA 3SRVA 5HE2A 2GQRA 4QMNA 5IPJA 5DEWA 3A7FA 1XH7A 3O2MA 5CLPA 4EC9A 2R0IA 2DWBA 4XG3A 4U44A 2ONLC 5E90A 2QU5A 4QMUA 4NIFA 2R3NA 1DAWA 2A27A 5CVHA 2BRHA 4QQ5A 4FKVA 3TG1A 5AP3A 2YAAA 4GH2A 3G6GA 1W2CA 3EQFA 2VTMA 1P2AA 4I23A 1U54B 2C68A 3VUKA 4AUAA 4A4OA 4DEHA 3PA5A 3ZO2A 3KN6A 3G0EA 4R7IA 2WO6A 3KMUA 2XZSA 4F64A 3QZFA 5CU0A 5CU6A 3KF4A 5ANEA 3N4VA 5F94A 2YCRA 2W1GA 4CD0A 3NNWA 2Z60A 1PW2A 4QOXA 5FEEA 5CEQA 4DEGA 5TF9A 4O0VA 1M2QA 4M8TA 4H3PA 4RLKA 1R0EA 4IFGA 3QTXA 4YO6A 5EW9A 1FGKA 3PY0A 1UWJA 2C5YA 3ZXTA 4ASEA 3ATTA 4CNHA 2R3HA 4L68A 5BPYA 4WNMA 4DGNA 2C3LA 2QKRA 3CIKA 2BAKA 4U41A 5HQ0A 2J5EA 1U5QA 4DFYA 3Q32A 3EQHA 3ACKA 4U79A 4RWLA 4L46A 3RGFA 2NRYA 4JQEA 4MTAA 3POOA 2PWLA 3VWAA 4BI1A 4F1TA 4AZEA 4CQEA 1P5EA 2X39A 1XBAA 2WFYA 3B8QA 3PXZA 3OW4A 5DVRA 3VBTA 1OBDA 5BMMA 2OJJA 3D5WA 3F5XA 5AV0A 3RAHA 2PVHA 4D2WA 1YHVA 4QTEA 1YXVA 4RIXB 2CCIA 3DBQA 3UODA 3DZOA 3AC3A 5K9IA 4RGJA 2QOOA 5E8WA 5TOZA 1UU3A 4NM0A 3PTGA 3POZA 5EDPA 3UE4A 4DGMA 2VTNA 1NVQA 3AXWA 4KRCA 2OF4A 4BFMA 4RJ8A 2E2BA 4FMQA 4O7RA 3C5UA 5GZ8A 1H07A 2C1AA 2ZM4A 5FM3A 4YTIA 3ODZX 5J87A 1H0WA 3WZDA 3UP2A 4IMYA 4O7WA 4ACCA 4XP3A 5IA1A 4FV1A 4FYNA 4CRLA 5I9VA 4RRVA 2C5XA 3LJ1A 4FNWA 1M7QA 3NNVA 2Z7QA 4R7HA 5DGZA 3NW6A 3UDSA 5JH6A 3FHIA 1JSTA 2XEYA 2GQGA 4FX3A 3ZCLA 4FTMA 2HZ4A 4UZDA 3RPRA 4XOZA 2RG5A 3R2BA 3CP9A 4Y95A 4WA9A 3FJQE 1VYWA 5GJDA 4HCTA 4P5QA 4BWXA 5IA4A 5CYIA 5JKGA 4B99A 3SD0A 2YM7A 5GNKA 2CNVA 1OZ1A 2V55A 2XF0A 2R3RA 2C5NA 3Q4ZA 5EDQA 3VBYA 5AP6A 3Q3BA 4FVPA 4ENYA 1XMMA 3FY0A 3R8PA 4FUXA 2YDKA 1OI9A 4M12A 3DTWA 4FOCA 2JLDA 3VW6A 2OFUA 4L67A 1GOLA 3UIBA 4C36A 1GY3A 4YZDA 5CF8A 3BYOA 4HYIA 3HLLA 4B7TA 5L2SA 2C30A 4YJVA 2XCHA 2WPAA 3TZ8A 3BBWA 5T68A 1TQIA 3LQ8A 3F5GA 3B2TA 4QTBA 3OCGA 4I92A 3HAVA 4FKQA 1YDRE 2P0CA 5I9WA 4B8MA 2C0TA 4E8AA 2IZTA 1WZYA 3LFAA 3O0GA 4FTKA 4HGEA 4TRLA 2QU6A 4H36A 2ITNA 3DV3A 4GMYA 2GHMA 5HG9A 2W4JA 3IPHA 2RFNA 4FKPA 4AXCA 1PYEA 2BHEA 3HVCA 2YIYA 3VULA 5KBQA 5AM7A 1MQBA 4BRXA 2VNWA 3FL5A 2GNLA 4DE4A 4N57A 4BBFA 3ZEWA 5M44A