4OGRA

Crystal structure of p-tefb complex with aff4 and tat
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
314
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title AFF4 binding to Tat-P-TEFb indirectly stimulates TAR recognition of super elongation complexes at the HIV promoter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/viral protein
total genus 84
structure length 314
sequence length 323
chains with identical sequence E, I
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ogrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ogrA01
4MD8E 2GNGA 1RW8A 2WPAA 2HK5A 5M4IA 5CTPA 1J3HA 4H1MA 3QRKA 4BYIA 2OJFE 4ITIA 2VO3A 3QCQA 3RCJA 3ZO4A 4D5HA 3MFTA 1Y6BA 1P14A 5HG9A 1H01A 4U7ZA 2AC3A 5A6NA 2QOQA 2XK3A 3D5UA 3KF7A 3TTIA 4E6CA 5EH0A 1MRYA 4G6LA 4CKJA 5GZ8A 2HW7A 4J98A 4UZDA 3PA4A 1QMZA 3SAYA 2J0LA 3GI3A 3UDBA 5BUJA 4IZAA 4D55A 5A4CA 2DS1A 3R73A 1UWJA 2J2IB 5I9XA 2X7FA 2QKRA 3DAEA 4GEOA 4ALUA 5BVNA 4OTHA 2XNBA 4IW0A 4R77A 4D5KA 4QO9A 3I6WA 1H26A 2O5KA 4AGUA 5DLSA 3EQIA 3NUNA 3ALNA 3SX9A 4DE4A 2VWUA 2JAVA 2XKFA 3FXXA 2CKOA 2IO6A 2XEZA 4IMYA 4ZIMA 4EH9A 2Z7LA 4I5HA 1URCA 2X7GA 3IDCA 3CD3A 4WT6A 2UZUE 3D83A 3MY0A 4ANNA 4G6NA 3MGYA 4D28A 3SD0A 4IQ6A 4QMUA 4YJNA 4LRJA 3HAVA 1UKIA 1JKKA 3LXKA 3AC4A 3FPQA 1A48A 4O22A 3DQXA 3GXLA 4EQUA 4ZJJA 5IUHA 3A7HA 1OM1A 2IZTA 2E9NA 2JITA 3T3UA 3FL4A 4DGGA 2BILB 4O7RA 3COHA 4AACA 5E8UA 3DBQA 2UW8A 3VRZA 2O2UA 4G3CA 5CASA 4UMTA 5J95A 3OOGA 4JLCA 3WF6A 3K5UA 4L3JA 4ZTLA 4QPAA 4CNHA 3D4QA 3NNVA 4TYGA 3MWUA 2P2HA 5CT7A 3O2MA 3NW6A 4IAYA 4IM0A 3U87A 5M57A 3R04A 5HU9A 2VO7A 4FV4A 4J99A 5BVEA 2YIWA 1H07A 3UO6A 2G9XA 2GNIA 5DH3A 1IA8A 3ZC5A 1ZMUA 5HO8A 4EC8A 4ZY6A 2CNQA 3DV3A 3ERKA 3L1SA 2VTTA 5TKDA 5E4HA 3HMMA 2JDTA 1WZYA 3W2CA 5CSPA 3Q9XA 4CYJA 5EKNA 3QU0A 4C62A 3FAAA 3MB7A 2WMTA 2RGPA 5EYCA 4CMUA 1XBBA 2VUWA 5IQCA 2X9EA 1XH7A 5HD4A 5KHXA 2P0CA 3NVMB 4OTDA 5CS6A 3BGZA 4QP1A 2X2LA 4FICA 2PK9A 2XRUA 1CKPA 3KKVA 3CY2A 2F7ZE 2A27A 3QF9A 4NUSA 2C68A 4X2JA 4EHEA 4FV3A 4Z9LA 4QYGA 1I09A 2BZIB 3SXSA 1B39A 5HE1A 4F0IA 3BCEA 2R3HA 3QTWA 4IAIA 4AN9A 2C47A 1K2PA 4NH1A 4O81A 4K9YA 4ZY4A 2WELA 3WILA 3QKKA 5FLFA 3CQWA 5HNBA 4WOVA 2GFCA 4R6VA 1H1WA 1H08A 3RAHA 3N4TA 2W06A 3IO7A 4BTKA 4RA5A 5FEQA 3FE3A 4NM3A 1TQIA 3G0FA 4NW6A 1NVRA 4Y95A 3GBZA 3TIZA 5CALA 4LUDA 4QQJA 2VTSA 3LJ2A 3Q4ZA 4I0SA 1PF8A 4QYHA 2OICA 3UO4A 5EOBA 4L9IA 1CKJA 3RM6A 5K0KA 2ZB1A 2W4OA 2HZ0A 3UP7A 3F3WA 3MIAA 5DNRA 5LVMA 2YEXA 3FXZA 5BVDA 5AV3A 3C50A 3M2WA 4MD7E 4L52A 4LL5A 3FC2A 3VW8A 4AX8A 4CQGA 3BYOA 2HYYA 1QCFA 3UYTA 5KMMA 4ZK5A 4AW2A 4TWPA 3W55A 4BICA 2GQRA 2UW6A 4DT9A 2C4GA 4XG2A 4CT1A 3AGLA 4A9RA 4CEGA 3ATSA 2GTNA 5FTOA 1BKXA 2BCJA 2UZNA 3R22A 4K1BA 4B0GA 4C58A 3LW0A 3A99A 4YHFA 5AP7A 4NTTA 4BTFA 4CG8A 2OBJA 2PMLX 2QD9A 4JDJA 1G3NA 4O84A 4TWOA 4QQTA 1H1QA 3MY1A 4W8DA 1KE8A 5IF1A 1DI9A 4NKSA 4ALVA 2PZPA 4C37A 1H0WA 4I6FA 5E8VA 4Y83A 4EOPA 2I6LA 2UZVA 4F9YA 4GG7A 2UW0A 4IE9A 2FYSA 3EYGA 4JL9A 2BAJA 2FSOX 2PVLA 4OTRA 3R01A 4TPTA 4D2SA 3QTZA 2OJJA 3LCOA 3VUHA 5E8ZA 4ZTMA 3CJFA 2QHNA 3PUPA 5ACBC 3RNYA 3E7OA 3W8LA 5FTQA 4C02A 4NKAA 4U6RA 4L8MA 4EK5A 3FSFA 4IWPA 1Q24A 1JSTA 2RG6A 4RIWA 3V6RA 4DFUA 3U4UA 3HP5A 2PL0A 3ZRKA 4LOPA 3I5ZA 3JR1A 2B9HA 1ATPE 2V7AA 4I0RA 1KE6A 3F66A 4YHJA 1M17A 2F9GA 2UW7A 1H28A 2F2UA 2ONLA 3EFKA 3ETAA 3GNIB 3PP1A 3UIMA 3V5TA 3VUMA 5JRQA 3AMAA 4C3PA 2XH5A 5GHVA 3TCPA 2R3JA 3HA6A 4U43A 3UIUA 5EI6A 4CCBA 2WTDA 5CF6A 3K3JA 2B0QA 1YDTE 3FHRA 3C4WA 4FV5A 3DDQA 1NA7A 4LQMA 5I9UA 2YN8A 4YMJA 5DPVA 2OZAB 3MJ2A 3OF0A 3SC1A 5M08A 5HO7A 2X81A 1XH8A 5KMJA 2WFYA 5AV2A 4CLJA 2B54A 3PXFA 1H25A 4D0WA 3S0OA 3V5PA 4QTCA 3LAUA 4CCUA 4W9WA 4UB7A 4GT4A 3VUDA 2OXYA 3V5QA 4R3RA 4BCQA 4R5SA 3ZRMA 3KMMA 3LCSA 3OVVA 2EB3A 4FNXA 4PUZA 2QO9A 4U80A 4TNDA 3RM7A 3LCDA 3V8SA 1H1PA 5EG3A 3ZM9A 3FI4A 4LYNA 2PVFA 3ZUUA 3S3IA 3CSVA 4F7NA 4JG8A 3C4ZA 2W9ZB 2XVDA 4FSMA 3VBVA 2Z7SA 5TO8A 2B9FA 4FVRA 1OL5A 4NCTC 4RPVA 3ANQA 5CANA 5IQEA 2IVUA 3SV0A 3VULA 2ZM4A 4PL3A 3R9RA 1XWSA 4C33A 3D0EA 5CAOA 4G3DA 4GFMA 4YBJA 3EZRA 5K9IA 4FKTA 3F9NA 3WZEA 1UU7A 4FOCA 2ITXA 5EDRA 3C0IA 3KK9A 3L9NA 3PRIA 2YM6A 1WVWA 2QOHA 2X8DA 2A0CX 3KC3A 4NK9A 4WNOA 3MH1A 4ZTHA 1REJA 4DFZE 3TKHA 5A14A 3PSCA 4O91A 5DIAA 2GTMA 3FZOA 4IHPA 4I92A 3ZUTA 1DS5A 1VJYA 3PY0A 4DFBA 4PNKA 1KSWA 3OXIA 4WBOA 5DMZA 3NSZA 3FZ1A 4FKVA 3RPVA 5IMXA 4XV2A 3PPKA 4LV5A 3QQLA 4RGJA 1BL6A 5C01A 2ZDUA 4BL1A 3GC8A 3RGFA 4USDA 5BMSA 5M4CA 3POOA 3KK8A 4UXQA 5DOSA 4FK3A 3LJ0A 4R1VA 3BHHA 4AA4A 4IX3A 4QMZA 1NT2A 4BBFA 4YHTA 4O7LA 2X8EA 5BYZA 1JPAA 4UX9A 5ITAA 2YWPA 2X4FA 4GFGA 5K5XA 2XNPA 2W96B 3SXRA 4E93A 4FZ6A 2X2KA 1W83A 4WNKA 4A07A 3E5AA 2J51A 3I0QA 3PE2A 3ZRLA 2Z7RA 4APCA 4O0VA 4EH8A 1E1XA 3DGKA 3QZFA 5GZAA 4PL4A 5FD2A 3KCKA 1WFCA 3QRUA 2BPMA 4IAFA 4L67A 1YOLA 4EKLA 4IVCA 2CKQA 3LFFA 2Y0AA 4DN5A 2JDRA 5I9ZA 3F69A 5M06A 3IKAA 3UC3A 3EN5A 2Z02A 5JZNA 3R9DA 3ULIA 3ZO2A 3ZU7A 2XK8A 5FXQA 2PULA 4G5JA 3II5A 4EJ7A 1OGUA 2J0JA 2AUHA 1H1RA 2QR7A 4FV0A 4IH8A 5LJJA 4DHFA 4EOQA 4D2TA 2CDZA 2WMRA 1ZY5A 4B6LA 3SDJA 5HX8A 2JIVA 3DBEA 3EN7A 4FT0A 5C4LA 3DK3A 1ZYLA 3S95A 5L6WL 3UPXA 1PKDA 1LUFA 2UVYA 5LXMA 1GOLA 3Q60A 3OW4A 4MYGA 3Q6UA 4C38A 2J5FA 2YA9A 1WBOA 4FTOA 3ORNA 2W4KA 1OBDA 3A7FA 4FK6A 2BFYA 2QU5A 2B53A 3PVWA 2CMWA 3UZRA 2OJIA 5CAPA 3QXOA 2ITUA 1M52A 4PRJA 4BGHA 2P55A 3DXNA 5FP6A 2I40A 3BBWA 2W1ZA 3ELJA 3CD8A 1XO2B 4ERKA 4Z16A 2CSNA 4LMUA 2PVRA 3NW7A 4MD9E 4K18A 4E6DA 4FODA 4U45A 1AD5A 3TUCA 4GK2A 3FWQA 5L8LA 1IEPA 5ANIA 4K11A 3VS3A 4AP7A 3NVKI 5B0XA 3F61A 4BKYA 2BDJA 5IA0A 5KUPA 2J0MB 2B52A 3F82A 3QZHA 3RHXA 2IVTA 4FVPA 4L3LA 2OIQA 3N9XA 5LMAA 1RE8A 2BR1A 3WE8A 2VD5A 3CXWA 4UEUA 4I21A 5F1ZA 2A19B 3AG9A 1PXIA 3COIA 3MI9A 4KBAA 1B6CB 4O0XA 4EH3A 1UU3A 2ZMDA 5CX9A 1H0VA 1Q4LA 4XLVA 5E1SA 4BN1A 2WMBA 4FG7A 2PVNA 4QTBA 4PDOA 4EUUA 4MF0A 3MA6A 2OI4X 2XYUA 3EL7A 4QMVA 5EFQA 3V6SA 4AWIA 4FBXA 1M2PA 5AV1A 3ZLWA 3NUUA 4BTJA 4XG7A 2IWIA 4R1YA 3V3VA 2OLCA 3PLSA 1OZ1A 1ZMWA 3RMFA 2X1NA 3M42A 3UZPA 4HPUE 1FINA 3P78A 4DLJA 1FPUA 4F9BA 2C5VA 2GCDA 4HVHA 5FDPA 4FSRA 4X2NA 3S1HA 5BX0A 2ITZA 4U41A 3MESA 4KINA 5K5NA 2J50A 3SHEA 4UWYA 2JKKA 2BRNA 2CGWA 4G9CA 2VWBA 3OEFX 4GT3A 4EH6A 1BLXA 2V0DA 3ORXA 4W9XA 3EQFA 2R3IA 4QTAA 4ZZNA 4IB0A 5BNJA 5C8MA 2YCSA 5HBEA 3ATTA 3Q5ZA 2QO2A 3DY7A 4F64A 3UGCA 1F3MC 4PQNA 2JBOA 3R02A 4TXCA 2BKZA 1WVXA 2JDOA 3OY1A 4EOSA 4EOIA 3FQSA 1YWVA 4IZYA 1NW1A 2XKDA 2YM3A 3FMHA 2PZIA 2YHVA 3F5GA 5GJGA 3CGOA 4JBVA 4IBMA 4KS8A 2Z60A 2PPQA 4H3QA 3R28A 5ETAA 4OTIA 2PUUA 2HIWA 5BVWA 4P7EA 4G31A 5BYLA 4UMUA 4BRXA 2ITVA 5J1VA 2ZB0A 3OTUA 3JVSA 3KL8A 4AS0A 2C6MA 4S33A 3R8UA 5JSMA 4NM5A 4HZSA 5HLNA 4IACA 3DK7A 3C0GA 3OXZA 3F3TA 3V5LA 1JSVA 2XB7A 5F95A 4H05A 3G0EA 2OIBA 3D7TB 4OGRA 3RBWA 3CPCA 4FL3A 2OO8X 4Y85A 5FXRA 4PV0A 5D41A 2R3QA 5F94A 4BDIA 3TN8A 2QOKA 1MQBA 4EORA 1MUOA 4UMPA 3BI6A 3VBWA 4U40A 4HPTE 2OH0E 2UZOA 2XNNA 4YGAA 2NNWB 2W0JA 5FEEA 3O7LB 4JG6A 3OS3A 3H9OA 5B2KA 3S00A 3GOPA 2WGJA 1PXKA 3O51A 4EQCA 5IQGA 5K3YA 4AN3A 2ZV2A 4KS7A 1P5EA 4AFEA 1Q8ZA 4I41A 4MF1A 1NVQA 5LVLA 3R7UA 4C4FA 4PDYA 1FMKA 4FA2A 3BU3A 3GP0A 4FL1A 3ZFYA 4E73A 3OXTA 4KIKA 1SM2A 2WQEA 4YNOA 4OLIA 2FA2A 2XIKA 4YNEA 3BU5A 4RFMA 4EI4A 4OT5A 3E8DA 3I5NA 4IX5A 3ULZA 4HNIA 4YJOA 3TI1A 3WIKA 4O7TA 5FM3A 4FKLA 3VF9A 4E6AA 3RZBA 2WOUA 2ZM3A 3TZ7A 3BLQA 3QTRA 3PXQA 4BDEA 4EH2A 2YJSA 2W1DA 3DTCA 2CGXA 3QHWA 4XG3A 5HO6A 4ZTRA 2Y4IB 4ZTQA 4ZS4A 3TEIA 2W1HA 1OL6A 2H8HA 3CTHA 2OFUA 3ZBFA 3R30A 4YTHA 3F88A 2P33A 4GW8A 3QCSA 4C4HA 4EK8A 4RQKA 4FG8A 4DEAA 4EK6A 3C9WA 2XK6A 1ZARA 3PWYA 3CBLA 2EXEA 4GFOA 3DB8A 2QURA 4YTIA 4AF3A 3EN9A 5J8IA 4TWNA 2YM7A 3Q52A 4A7CA 4DG2E 4IWDA 4V0GA 3FLWA 3CTJA 5GJFA 1PXOA 5CF4A 4RWJA 3IW7A 4RIXA 1XH6A 3FBVA 4QP6A 2XK9A 3JY9A 4D2WA 4XJ0A 4XV1A 4ITJA 3GU5A 4JX3A 4LG4A 5ETIA 3U9CA 5DI1A 4O1PA 4BDAA 4U97A 2PE2A 2IW8A 2HZ4A 3LJ1A 4DGOA 4DC2A 3OCGA 1XBAA 3PXKA 4RC3A 2WXVA 3QGWA 4BCPA 3AT2A 5AA9A 5IEYA 4E1ZA 4JDHA 4L7SA 3W2OA 1GNGA 3DDPA 5TOZA 4M68A 4NCTA 4MXYA 3V8TA 5I9WA 2R0UA 3UODA 4ZMEA 2Q83A 4Z7HA 5AUZA 4O21A 1REKA 4NW5A 4O7ZA 5IH6A 4P90A 5E8SA 4RJ7A 2UW3A 4CZYB 5LMKC 5AP5A 3CKWA 4L44A 5B2MA 5L3AA 3WOWA 4ITHA 4BHNA 4RX9A 1XH9A 3VIDA 4A9UA 2BRGA 4EQMA 4F7JA 3FPMA 4LFIA 2UZDA 3AT4A 3MSSA 1G8AA 5BVKA 3MDYA 2QOOA 4DEDA 2DYLA 1XQZA 3FI2A 4BGGA 4Z3VA 3OCBA 4IZ5A 5HLPA 3VBXA 4FYNA 3CR0A 3GU4A 4FTQA 4QTDA 4F1TA 5AR4A 1CSNA 4DEHA 1YOJA 3P7AA 1WVYA 4F99A 1Q61A 3FQHA 4ZTSA 3LOKA 1P4FA 2NRYA 4EBWA 2R64A 3F3VA 5H8GA 4QP2A 1XR1A 1OECA 3PJ2A 1GIHA 1PMNA 4LRKA 4PP7A 3I0OA 3R7VA 5HCXA 4PTGA 2G01A 2YIQA 2CCIA 4RIWB 4QTEA 4BYJA 5HVKA 3VS2A 4LM5A 1ZWSA 2R3FA 4JIAA 4O7VA 5CNNA 3KXMA 3EN6A 2VTOA 3LM0A 1JVPP 2C6OA 2GSFA 4FSZA 3GQLA 4L46A 2G15A 2IW6A 3NYXA 1R1WA 5CVGA 2VTRA 3TKUA 4MH7A 4P2KA 1YXVA 4FTRA 5HIEA 2FB8A 3QL8A 1OUYA 2UZTA 3BHYA 4NWMA 3L9MA 3FLYA 4N57A 3HX4A 2ZOQA 4C4JA 4HYHA 4HGLA 2BRHA 2XYNA 2AYPA 4DTBA 3I7CA 3KVXA 2F57A 3G6GA 4YJVA 3DT1A 1OIYA 3NLBA 3QC4A 3U6HA 4EKKA 4FUXA 5HD7A 1J91A 3CEKA 3ORPA 4JVGA 3Q32A 3A7JA 1J1CA 3SG9A 1OL7A 1PXLA 3VO3A 1M2RA 5AFVA 4I4EA 5L2QA 3HMPA 2A1AB 1WBNA 1U46A 2UZEA 1UNGA 4DH5A 4DLIA 1K3AA 2RFDA 5DE2A 1DAYA 1YI4A 2B55A 4CLIA 1W98A 5EHOA 3AD5A 2GMXA 3P0MA 4BHZA 4KKEA 2X6DA 2DUVA 2X2MA 3I1AA 4FL2A 4KRDA 2PYWA 4DTAA 3AC5A 3EL8A 3HZTA 3L8XA 4I94A 4J53A 5AP4A 5AP2A 2GQSA 2ITYA 3F2AA 2C5YA 3MV5A 3QBNA 4V04A 4XYFA 2YIYA 2C3KA 4MBLA 3DQWA 4TKSA 2WMQA 3AT3A 5DEYA 2CJMA 5CI6A 3TNHA 3ZSHA 4O82A 4BDDA 4EK3A 4DEIA 2WTVA 4PTEA 4IB1A 3VS0A 1RQQA 3COMA 3P79A 4ANBA 1PXJA 3GC0A 2BRBA 1XBCA 4GRBA 2IG7A 2BZHB 3HRCA 4A9SA 1WMKA 3G9NA 1OKWA 5ANEA 4QMWA 3R8LA 4O6EA 4DYMA 5AV4A 3QHRA 5JFWA 4S32A 2VNYA 2XF0A 4QRCA 3MH0A 4ZY5A 5ANGA 1XHAA 4BIDA 5HI2A 3HKOA 3UVQA 3PY1A 4FV9A 5KO1A 3VC4A 3UVRA 3D2KA 1LEZA 4PDSA 3D7TA 4JJRA 4YPDA 1O6LA 1SMHA 5HIDA 3PYYA 2R4BA 2NP8A 1GAGA 4QMSA 5GIPE 5HOAA 2BUJA 4JAIA 3L8VA 4YLLA 2W9FB 3E62A 4KIQA 4R78A 4FGRA 3B2TA 4FKGA 5ANDA 3PP0A 3FLNC 3UPZA 3K2LA 1P4OA 2HAKA 5IISA 4GYIA 2BAQA 4KIPA 5EQPA 3T9IA 3ZO3A 4I3ZA 4RJ5A 3O7LD 3I79A 4FIFA 1Y57A 3VBYA 3FKLA 5L2IA 2XJ1A 5DT4A 3FXWA 3BV2A 3CGFA 4GIHA 4FTAA 2IVSA 3CE3A 3FUPA 4K2RA 2XMYA 4HCUA 3DK6A 4GU9A 4QD6A 5CAVA 3GU7A 1OVEA 3HLLA 4TTHB 4DBXA 5K0XA 4BI0A 2WO6A 2GHGA 4IADA 4G17A 3DFCB 5AUYA 4NFMA 2W1IA 5L4QA 4AW5A 1J7LA 1R39A 2FVDA 1F5QA 3IW4A 3KXZA 1OITA 5H2UA 2J5EA 4RFYA 3I81A 1UKHA 2CGUA 3VNTA 5M53A 2W1FA 2E9UA 4MXOA 4JAJA 2H34A 1Q3DA 4X21A 4FSYA 4JQEA 4MNEA 3A60A 4BCIA 2YM5A 4YZNA 4AFJA 4AOIA 5EM7A 2ZDTA 2W99B 3RKBA 5KNJA 4I20A 4NIFA 4WSYA 3LXPA 2J7TA 4KBKA 4XH6A 4CT2A 2C5NA 4EK4A 2I7QA 4N70A 2F7EE 3KMUA 4H39A 1MQ4A 2XKEA 3DKGA 3UQGA 3ZEWA 3ZM4A 4D1SA 4U0IA 1IAHA 2QODA 4DH3A 3R2YA 2YIXA 5BMMA 3R9NA 2VTNA 1M7NA 5ANKA 5FQDC 4DFYA 4Y8DA 3LLAA 1R78A 3OW3A 4LL0A 1YXSA 5L6PA 4K0YA 5IQFA 2X8IA 4EOMA 4WUNA 4KABA 2PVJA 4J95A 4CFVA 2UZBA 3ZDIA 4UALA 4B99A 3F6XA 3DJ7A 4D2RA 4E8AA 4PPCA 4AT3A 3FJQE 4FIGA 5IH4A 1OIQA 3LXLA 2GPHA 2ITNA 3VVHA 2JAMA 3OWKA 5HHWA 1PRYA 4RJ3A 1V1KA 4KSPA 2RSVA 5DEWA 4ANLA 3VS4A 5BUIA 3Q4CA 3E87A 4AW1A 2YAKA 3MFSA 1A9UA 4LV8A 5HE0A 1RDQE 4AA0A 1JAMA 2WD1A 3F5UA 5KMIA 1H1SA 4ACHA 2WZJA 3UIBA 3VS7A 4GVAA 3HV3A 4FEWA 3Q96A 4XHKB 2XP2A 4F7SA 3AC2A 3ID6C 4RC4A 5AR2A 3FLSA 3C7QA 3VBQA 5JGAA 5LVNA 3AC8A 4BDHA 4EJNA 4J1RA 4FR4A 5LCKA 4CFWA 2R3PA 5F9EA 4FIHA 3TZ8A 4GT5A 3VUIA 4BDCA 3QXPA 1KUTA 1TQPA 3ORMA 5DFPA 4NTSA 5CEQA 1YDRE 3FY0A 4BWKA 4D1XA 2GS2A 5CSWA 5JKGA 3R7IA 4F9WA 3TL8A 4PDPA 5KKRC 4WSQA 5GNKA 2XRWA 3BU6A 2YERA 4IX6A 5CT0A 5D7VA 1QPEA 4PX6A 4WUAA 4L45A 4YC8A 3P4KA 4FTKA 4RVMA 3LKMA 4X0MA 3SXFA 1HOWA 4BF2A 4U42A 4G34A 3V51A 4TW9A 1ZXEA 1E9HA 4XMOA 4D2VA 5CAUA 2XJ2A 4GV1A 1PJKA 3PRFA 3WZJA 1Q8WA 2UUEA 4FUYA 2R7BA 5GINE 3KEXA 3RI1A 3PIXA 5FGKA 3UZTA 2ACXA 5T68A 3RCDA 5JN2A 1GZOA 3BE2A 1MRUA 3OWPA 1HCKA 2XUUA 3QQGA 2XNMA 4CV9A 3BEAA 1VEBA 4CSVA 3A8WA 3Q6WA 4II5A 4ASEA 2FGIA 4AGDA 1RJBA 3HP2A 2J6MA 4QPMA 2JIUA 4D1ZA 4BCKA 3KRXA 3ZOSA 3GU8A 3NUYA 4PMSA 3NUPA 5AP1A 3HMNA 5CZIA 5M51A 3EZVA 1JSUA 4QP4A 5C8NA 3CQEA 5CYIA 5B2LA 3ZC6A 2GS7A 3HDNA 1SYKA 3GCVA 4RIYB 5AR3A 5TT7A 3BHVA 4WG3A 3H10A 3Q2JA 3TIYA 2PU8A 1SZMA 5CU3A 2RL5A 3EMGA 5DR2A 3T9TA 1ZYCA 3VUGA 2Q0NA 4L7FA 4U3ZA 1W0XC 3RTPA 2OU7A 1EH4A 1WBTA 3I60A 1OKYA 4M7IA 2XIYA 3IW5A 4JI9A 4U81A 4E4MA 3E88A 2Y6OA 2XNEA 5J1WA 3V5WA 4WNPA 3ZLXA 3VS6A 3N51A 5AUUA 1PXNA 3CTQA 2G2IA 3PSDA 4E20A 1STCE 3HA8A 1SVGA 4HNFA 3NAXA 1ZOEA 3G9LX 4HVGA 2BDWA 2F4JA 5J5SA 5LMKA 4E3CA 5JFVA 4FEQA 4J71A 2C6TA 5IQDA 3WYXA 5CVFA 3RWQA 4FEXA 1YRPA 2CCHA 3NDMA 4XP2A 3HVCA 4BI1A 3O50A 3C51A 4TZRA 4XEYA 3CLYA 4FV7A 4IX4A 5EI8A 3DAKA 4C4IA 3GUBA 5FG8A 4KIKB 4L43A 5IDPA 3BIZA 4YSJA 3EIDA 2BROA 4EL9A 2C6EA 2IZSA 2ZV7A 4FKJA 3BQCA 2JGZA 4EONA 5I3OA 3VUTA 2BIYA 2O63A 3CP9A 4K6ZA 5DRBA 2PSQA 4U79A 5AX3A 4FG9A 3V01A 4DGNA 4DCAA 3DS6A 4M69A 3DBDA 4OTPA 5EK7A 2PZ5A 2VNWA 3JXWA 4MWIA 4YZCA 3VQHA 1W8CA 2ITPA 3PJ1A 2R9SA 5M55A 4CXAA 3GVUA 2YFXA 2JDSA 1U4DA 3LQ8A 4KBCA 3TZMA 2QOLA 1BMKA 4YZMA 4NL0A 2V55A 4IWOA 4QQCA 4TL0A 3TNWA 5HTCA 3KQ7A 5HBJA 1PXPA 3DJ6A 4ZOGA 4GMYA 4EUTA 4PP9A 2YLFA 4HOKA 3MPAA 5H8BA 2R3NA 3LFQA 3BEGA 3D9VA 1UNHA 2YDKA 3L9PA 2OXDA 4FTCA 5AADA 4AG8A 4XP3A 5AUWA 2EU9A 3ORIA 3FYKX 5DR9A 3NS9A 4E6QA 3FMEA 2YZAA 3PTGA 2FUMA 3GENA 3LMGA 4D0XA 4F6WA 4BDGA 4DA5A 4YJTA 2Q0BA 3P23A 4V0GB 3FC1X 4I5PA 4AW0A 4IWQA 3HUCA 2JIIA 4RIXB 2WEVA 3EQCA 5DGZA 3ITZA 4OAVB 2Z2WA 1IA9A 4TNBA 1PMUA 3CIKA 3OCSA 4GUEA 3C1XA 4EZ5A 2X4ZA 3F2RA 2BHEA 4J96A 3OROA 4CFFA 5CY3A 4FZ7A 3E3PA 1OL2A 5AM7A 2YCRA 3OUKA 5EYKA 3PE1A 5M44A 4QP3A 4FT7A 4GUBA 3NR9A 3MFUA 4O0SA 1YI3A 4FT9A 4D4VA 2QNJA 3CY3A 3SKCA 2O8YA 4YJRA 3AD4A 3O71A 3A2CA 3VHEA 4GJ3A 4NU1A 3NZ0A 4O96A 4KWPA 2IZUA 4BZNA 5BUEA 4L3PA 3PSBA 4DH8A 3PWDA 2WOTA 4E5BA 2IZRA 4AZSA 1T45A 4P4CA 4BCGA 3VS5A 4KB8A 4QNYA 5JRSA 3KRLA 4G3FA 5FDXA 1M7QA 1YHWA 2O3PA 4Z7GA 4ZMFA 4DGLC 4I1ZA 4AUAA 3L9LA 5F4NA 5HG7A 3W8QA 4YC6A 2CLXA 2V62A 4FSTA 4APPA 4S2ZA 4CRLA 4O86A 4AE9A 2HWOA 4RMZA 5KZ0A 4IM2A 3HRFA 5HIBA 2QOFA 2QONA 2RFSA 2YM8A 4NM7A 3C5UA 4IJPA 4OTWA 2VN9A 3MVHA 2VU3A 1BI7A 2XJ0A 1ZYDA 4PTCA 3EQDA 1OL1A 3KN5A 2RKUA 3Q4UA 5DN3A 4P5QA 3E64A 2JD5A 5AM6A 5I0BA 2R5TA 1SNUA 5E8TA 3PPZA 5JFSA 3RAKA 4F0FA 4YR8A 1JKLA 1PXMA 4XG8A 5BQ0A 2ZAZA 4JG7A 2R0IA 5AUTA 3A4OX 3QUDA 2JKMA 3ANRA 4MTAA 3GB2A 4YJUA 3KXGA 3LE6A 2W4JA 4AZVA 4DEBA 4X2GA 3FMDA 4YZDA 2OKRA 3UP2A 3ZLYA 4XUFA 1WBSA 2VX3A 4UBAA 5JGDA 4IB5A 2EXCX 4S34A 1F0QA 1Q99A 4RVTA 4JRVA 2VTLA 3D5VA 3Q04A 5EW8A 4DITA 4G6OA 3NX8A 3UG2A 5CXHA 2QKWB 3KULB 4YO6A 3SG8A 1CTPE 2QCSA 2PY3A 3QCXA 4WRGA 3M1SA 3OP5A 5K4IA 4DT8A 1FBNA 1Q97A 2I1MA 4FZAB 4IVAA 2UW9A 5T3QA 4FVQA 4X3FC 3HECA 3ACJA 4CFUA 5KHWA 5A3XA 5CU6A 4PNIA 4WBBB 1YKRA 5I3RA 3R8MA 3KB7A 4IEBA 3Q3BA 4MKCA 5DA3A 3BGQA 4G5PA 4YTFA 3UQCA 3Q53A 3LFCA 5CSVA 4KAOA 3DNDA 2WTWA 3EYHA 5AP3A 4FSUA 3R7OA 1TKIA 4WKQA 5HEZA 2XS0A 3ROCA 5EDQA 2ESMA 4RIYA 3HDMA 4LMNA 4M13A 5HGIA 4EEVA 4HGSA 2C0IA 2GFSA 4WA9A 5C26A 2C30A 4O0WA 4I24A 4YZBA 4FYOA 5E8WA 3RK7A 4RA4A 4YJSA 4CKRA 5HNIX 1IASA 2B9IA 3NMUF 2XM8A 3HRBA 3LFSA 5IKWA 5JQ5A 3E8EA 5EW9A 4DFNA 4CMOA 2WTIA 4RX7A 4G3EA 3BWFA 4WO5A 3UIXA 4WNMA 1JBPE 3R9HA 5C27A 4IDVA 4J8MA 2J9MA 2E9PA 3QLFA 4X6RA 4CFNA 4PPBA 4V05A 4G3GA 5G6VA 3DBCA 3HV6A 3NWWA 2C3IB 3I6UA 2BTRA 2YLEA 3G33A 4K8AA 1YHSA 3D15A 4C8BA 3QUEA 3ZZWA 3JVRA 4C7TA 3EJ1A 1B38A 3UNKA 4DFXE 2R3MA 2R3OA 4O7SA 3RALA 3CJGA 3VF8A 5KBRA 4BKZA 3Q9YA 4ANOA 4FEVA 4ENXA 2QI8A 2V22A 4UZHA 3MYGA 5D9HA 3TWJA 1FOTA 2C1BA 3OMVA 3UG1A 1V0PA 3D5WA 1JKSA 5JQ8A 4AOJA 4FTUA 1Z57A 2UVXA 4G2FA 1CDKA 4J7BA 3FV8A 5LVPA 5EYDA 5JH6A 3P5KA 2V7OA 2UW5A 4YPSA 4IJ9A 2WTJA 3VJNA 3RWPA 2C6LA 3R1YA 4GK4A 1H27A 3OY3A 1GJOA 2PHKA 3U51A 3QKMA 2E9OA 1G5SA 4FKQA 4QMTA 5CVHA 4FTJA 1Y8YA 3FMNA 4PMPA 3KY2A 3UVPA 4RVLA 1Q5KA 3QFVA 4OAUC 4CKIA 3HMIA 3DU8A 3E63A 4IAAA 3WF8A 3W32A 3EN4A 3O23A 3NPCA 4HYSA 4O0TA 5F20A 3K3IA 3QCYA 3RHKA 4D2PA 5HTBA 4BCNA 4DEEA 4O0UA 4U3YA 2CHLA 4MNEB 2YZLA 2W5AA 4X3FB 2VO0A 2RG5A 1YXXA 1U54A 5LWMA 3TDWA 4NIFB 4RLKA 3RPYA 4C57A 3ZS5A 4AZEA 3FMKA 4JOAA 2WTKC 3KXHA 4NFNA 1FQ1B 3RAIA 4DTKA 4F6SA 5BPYA 4MXAA 4XG6A 2WIPA 4BWPA 4BY9E 4YJQA 4QMNA 4N4SA 3ZZEA 1XH5A 4PY1A 5DBXA 5IA5A 2ZV8A 3R6XA 3BBTB 5TR6A 5AWMA 2NRUA 3BHUA 4QMPA 1OB3A 5ETCA 3PPJA 3OFMA 5T6KA 3Q2MA 2YCFA 4EOKA 4LUEA 3VUKA 3BGPA 4NJDA 3MVLA 3KRWA 2VTJA 3LMHA 4BZDA 2QOIA 2ZJWA 3LM5A 4W4VA 2A4LA 3UOLA 4XCUA 2WHBA 3MN3A 5EW3A 3IGOA 4PWNA 3ACKA 4B7TA 4OBPA 4HVSA 4DF3A 3QAME 3AQVA 4ANSA 4EWQA 3EFWA 2PTKA 3PA3A 4UMRA 3TDVA 3ZTXA 4QP7A 3B2WA 4XNEA 3FDNA 1OI9A 4CTBA 3ODYX 3OBGA 4XG4A 1ZZLA 3E92A 1KWPA 4I4FA 3LFAA 3Q9WA 4PMMA 4Y5HA 4USFA 5I9VA 2YDJA 3BYMA 1VYWA 3JS2A 4OT6A 3DLZA 5H3QA 1VYZA 5DVRA 5AAFA 5JFXA 5HZNA 3P08A 1K9AA 2WMVA 5KX8A 2X0GA 4IM3A 4FSNA 4MX9A 5C1QB 2GHLA 2GHMA 2BMCA 2VTMA 4KNBA 3DNEA 3FEGA 4HJOA 1I44A 5L8JA 5HQ0A 4S31A 5A4QA 4EOOA 5GIOE 3VHKA 4IAZA 5IZFA 4BCOA 1PYEA 4A9YA 4ZZOA 4XS2A 5I9YA 1JNKA 2OXXA 2HY0A 5FRIA 2QG7A 2VTPA 4FIEA 3RPOA 1UU8A 3GC9A 4IANA 3SOCA 1KV1A 1Q41A 4FKUA 4H58A 3QUPA 5KCVA 4FIIA 4F09A 5EM6A 3H3CA 3THBA 2VX0A 4FKIA 5LMBA 2BFXA 5AR7A 4EOLA 1GY3A 2OK1A 3VRYA 1S9JA 4GK3A 2ZM1A 3IQ7A 4ZTNA 3SVVA 3W18A 4O7YA 2I0VA 5DR6A 3KREA 1LR4A 4J52A 2XK4A 3R1QA 4CGAA 4QMXA 1PW2A 3TUDA 1YDSE 5DT0A 4B8MA 4C2WA 3PVUA 3GFWA 1YXTA 3QQKA 4JR7A 1XJDA 4N6ZA 3BHTA 3P7BA 4O2ZA 1ZOGA 4TT7A 2Y4PA 2C6IA 4M0ZA 3JY0A 2F7XE 5KE0A 3ZSIA 4CYIA 4ZJIA 3UBDA 1U5RA 3MH2A 3UMXA 4UWCA 1YXUA 2FSTX 4A9TA 2VWWA 4MQ1A 5IA2A 3KULA 4KSQA 3D94A 2RF9A 3AMBA 2HOGA 3K5VA 2VGPA 3PXZA 4P5ZA 3T8OA 4C34A 3R8VA 4O1OA 5IEVA 1SVHA 3MPMA 4IDTA 5A6OA 3VS1A 1DM2A 2QOBA 2WTCA 2GQGA 4R7BA 3R83A 4D58A 3NEWA 2ITQA 3TV6A 3WYYA 4IFCA 3DB6A 4O7WA 4EBVA 4ID7A 5HX6A 4LOQA 3TUBA 3U6IA 1OIRA 4A4OA 1FVTA 1YOMA 3FQEA 2OF4A 4X6QC 3FYJX 4DFLA 3QRIA 4C35A 3DTWA 4GKHA 2B7AA 3TV4A 3TNPC 5C8KA 2EXMA 5FBNC 3NAYA 5EHLA 4M97A 3UOKA 2ETMA 3QD0A 5FP5A 4C3FA 5IQHA 3BWJA 3G5DA 3QWJA 4N6YA 4A06A 4I6BA 5FBOA 2Y6MA 4WRSA 4EYMA 4F9AA 2KULA 2W5BA 5IEXA 2CLQA 2ZYBA 2JEDA 3UJGA 1Q3WA 2PVKA 4JX7A 4XV9A 3ORKA 3AC3A 2VWIA 4H1JA 5A46A 1VZOA 4L68A 2I0EA 2VZ6A 3NYOA 3RPSA 3UNJA 4ANMA 1OKVA 4CFXA 4FZDB 2JC6A 2JLDA 4FTMA 4GL9A 4GU6A 3A4PA 3GT8A 3PZHA 2C6KA 3G6HA 4JS8A 3WF9A 3U4WA 1DI8A 1KOAA 3S4QA 5C4KA 4TYHB 3VN9A 5HESA 1ZY4A 2PE1A 1YQJA 2W1CA 2XKCA 3I4BA 5AMNA 2IPXA 4KKHA 3KRRA 3EQPA 2AC5A 5H9BA 5CQWA 2WAJA 4FT5A 4C61A 1AQ1A 2DQ7X 2G2FA 2QOCA 3CS9A 4RJ4A 3TNIA 3FMMA 3P86A 4FKRA 2C3JA 4WHZA 4R7HA 4HVIA 1M2QA 5AP6A 5CNOA 5JEBA 2C0OA 3KA0A 3MY5A 4M69B 3ZXTA 4L00A 2PZRA 3ODZX 4FKSA 4RLLA 3EWHA 5DWRA 2IW9A 3RVGA 4RZVA 2XA4A 3L8PA 4HGEA 4I6HA 2GU8A 2HXLA 2XZSA 3VWAA 4JR3A 2CN5A 3QD2B 3M11A 1H8FA 2HW6A 4F6UA 3SW7A 1LPUA 4WG4A 2E2BA 2YITA 1OUKA 2WEIA 3BELA 3LXNA 4FNZA 4R5YA 4DEGA 4LGGA 4GKIA 4CTCA 2WQMA 1YVJA 4OTQA 4CFMA 2X6EA 2VRXA 1FMOE 2VV9A 5J7BA 2VTQA 2JKOA 2OW3A 4EHGA 2B4SB 4NT4A 5KMKA 3PJCA 3ORLA 4QMOA 4EZ3A 4MQ2A 5L2TA 4JIKA 3R7YA 5IDNA 4GYGA 4KD1A 4BDBA 2C3LA 4YLJA 4HZRA 4E4NA 4Y72A 4N0SA 3GCSA 2ERZE 3ORZA 3RAWA 4E26A 1GZ8A 5HG8A 5CF5A 5CENA 2CGVA 2OIDA 3IDBA 4L01A 3A7GA 5IQBA 4X3FA 4R3CA 4EH4A 2ITOA 2WU7A 3DZQA 2BZKB 2C5XA 3A62A 3BLRA 4BC6A 4RJ6A 1PHKA 4NSTA 4I22A 4RQVA 1QPDA 3V8WA 2XEYA 3HYHA 4Y46A 5E90A 3A61A 4CVAA 4RT7A 3F7WA 3FZRA 4GG5A 5HTIA 3WZDA 3PZEA 3AXWA 3VW6A 2HWPA 3JYAA 4TYEA 3R2BA 2BVAA 3HV5A 2DWBA 4BGQA 1KE5A 3EH9A 3IW8A 4FKPA 3NGAA 4S30A 3EKNA 2BDFA 4BIEA 5HICA 2WNTA 3F7ZA 3E7VA 4DH7A 4ACGA 4RIOA 4MWHA 5HCZA 4AT4A 3UQFA 3N4VA 3MJ1A 3DJ5A 3ZFXA 5IA1A 5IQAA 1TVOA 5LWNA 2WIHA 3K54A 3HGKA 2UVZA 2PVHA 4XLIA 3GCQA 3MW1A 3TNQB 1BL7A 4W4YA 3D5XA 4IVBA 2QC6A 5L2WA 5DYJA 3FZPA 2R3LA 3QALE 2ETRA 3PFQA 4M15A 4YSMA 1ZAOA 4AT5A 5J79A 3FI8A 3W16A 4QYEA 1OIUA 4BI2A 4ENYA 5G1XA 1Y6AA 5BVFA 2XIXA 3WZKA 3P9JA 3RK9A 4F63A 3FLZA 4FC0A 4TY1A 4QMQA 5HNGA 2GS6A 2REIA 2X39A 4FV8A 3OCTA 5CXZA 3QWKA 3MS9A 2RIOA 4R7IA 5D1JA 1J7UA 5IA3A 3NRMA 3DA6A 3ZUVA 4XOZA 1CKIA 4FTTA 4I5MA 2J90A 2XM9A 3E8NA 4M12A 2X7OA 3R00A 4PL5A 4IC8A 1YWNA 2W7XA 2WU6A 3NNWA 4C36A 2ERKA 4FT3A 4UV0A 2XCKA 4J97A 2OSCA 4FSQA 2QHMA 3GCPA 3H4JA 3KU2A 4IAKA 3ENHA 4WD5A 3V04A 4FE2A 4O83A 3WI6A 4OR5A 2QVSE 3P1AA 3ZBXA 4DGMA 4BDFA 4ASXA 3DFAA 4ZLOA 4FEUA 1V0OA 3WE4A 4B4LA 2YM4A 2UW4A 3QQUA 4W4WA 5HCYA 5CLPA 2VX1A 3FKNA 1GZNA 3GCUA 4A4LA 4AN2A 3QTXA 4V01A 3ENMA 5GZ9A 2XBJA 4RFZA 4MNFA 4JDIA 4D4RA 3AOXA 5CEMA 5EQEA 3U8WA 2CNVA 4JXFA 5E91A 3IPHA 3H0ZA 4OTFA 2R3KA 3ZCLA 1IG1A 2F2CB 2VTHA 2BTSA 2R3GA 3LFEA 1O9UA 3PXYA 2P4IA 2H6DA 2P3GX 4LOOA 5HE2A 4DINA 1CM8A 2PMOX 4GVJA 4RVKA 4XOYA 5IUGA 4TYJA 4MAOA 2VWZA 2FO0A 4NJ3A 3W2QA 3TM0A 4AA5A 3DLSA 2W05A 4YLKA 1PMEA 1SNXA 3QZIA 4BCJA 5EM8A 4CZUA 4RWLA 3LLTA 4MXZA 5HE3A 5ANOA 4BCFA 1VR2A 3QKLA 4UYAA 2PUPA 3QX2A 3G90X 5HVJA 5BVOA 3GQIA 2YJRA 3Q9ZA 1H4LA 3SA0A 4F4PA 4YUQA 1JQHA 2XIZA 1G8SA 3QGYA 1WBVA 4ZSLA 1PMVA 3PJ8A 1L3RE 2YACA 3TTJA 3QA0A 3ZLSA 2VO6A 5I5ZA 2EUFB 2UZLA 5DHJA 3TXOA 2VWYA 2KTYA 4AZFA 3MBLA 3IW6A 5FXSA 3ZONA 4JQ8A 3DKFA 3W1FA 4ZLYA 2QU6A 5AX9A 5M56A 4IIRA 3EQBA 1FVVA 5HBHA 4BBMA 4FTIA 3BYVA 1ZMVA 3TT0A 5HG5A 4CD0A 4ZAUA 4BDJA 3BLHA 3NIEA 3SRVB 2HY81 3LFBA 2BAKA 2BRMA 3C13A 3ZSGA 4CMTA 4B8LA 4E5AX 1W82A 2WQOA 4CZTA 4R3PA 1WBPA 2YAAA 3OBJA 3PLAE 3IOPA 3OEZA 4BWXA 3ZMMA 2W1GA 3NYNA 4DH1A 5M4UA 1QPCA 4L6QA 5IUIA 3DCVA 4ZSAA 4CG9A 2HZNA 1WBWA 2V5QA 4FTNA 4L53A 4MHAA 2ZVAA 4TRLA 4TYHA 4ONAA 2PVYA 5AEPA 2OGVA 3DXQA 4U8ZA 3QYWA 3T3VA 3NCZA 3ZYAA 4ZP5A 1BX6A 2UZWE 3BYUA 3ROYA 2RFEA 3C0HA 3QTSA 2XIRA 1OPLA 3A8XA 3VBTA 3BYSA 5A4TA 3IONA 5CEPA 4QT1A 5E8YA 1J1BA 4BKJA 4IB3A 3OT8A 3NW5A 5A9UA 1JWHA 4GSBA 4CV8A 5KKRB 3HV7A 1LP4A 4FMQA 5CQUA 1HCLA 3BV3A 3QQHA 3QRJA 5D11A 4ALWA 3OD6X 3R63A 2R2PA 2ITWA 2XNOA 2Y9QA 4JBPA 4X7QA 4GS6A 5EI2A 1O6YA 3IECA 4I5CA 4D4SA 3FHIA 4JRNA 1R3CA 2G1TA 3V5JA 1L8TA 5C03A 4PMTA 2WQBA 3SGCA 2O64A 3OG7A 3TJCA 1U54B 4DG3E 2JFLA 4ZS0A 2XNGA 2VAGA 5AR8A 5TF9A 1QL6A 4YP8A 5CEOA 3N4UA 2YABA 5L6OA 3CKXA 3PJ3A 3OHTA 5FTGA 2JKQA 2BIKB 2WMXA 2NO3A 3LCKA 4NM0A 2PUIA 4QOXA 3KN6A 5CSXA 4BTMA 4FGBA 2W1EA 3SLSA 3TACA 5IH5A 3LQ3A 3FSKA 4QMYA 3QRTA 4AGWA 3TKIA 3WIGA 1UU9A 1SVEA 3DXPA 4U5JA 5ANJA 2UV2A 4MXXA 1MP8A 3O0GA 4R8QA 2NPQA 2C0TA 5AP0A 3GOKA 1WAKA 1O6KA 2OJ9A 3TZ9A 5K4JA 3GFEA 4YO4A 2WMUA 4AZWA 5GJDA 1PYXA 2CKEA 2YCQA 2ETKA 3F5XA 2PVMA 3KRJA 4F70A 4FZFB 1JLUE 3HAMA 4ORKA 4ERWA 2SRCA 2CKPA 4IZ7A 4MEDA 1M14A 5FWKK 4KA3A 3DZOA 4M0YA 3SOAA 1GIIA 3QQFA 4M3QA 3D14A 4CQEA 4EYJA 1YI6A 5CF8A 1TQMA 1NY3A 3EKKA 2YDIA 1Z5MA 2EWAA 1W7HA 3ALOA 3DOGA 4QP8A 5D10A 4Q5EA 1OBGA 4O0RA 4OBOA 4MK0A 4MBJA 3TJDA 2IJMA 3DPKA 3NUSA 4RJ8A 4I0TA 3R1SA 5HU3A 3HEGA 4IFGA 2WMWA 4WG5A 5FUTA 4OW8A 3GC7A 2QLQA 4TWCA 4W8EA 5CAQA 5L8KA 4EWHA 3KGAA 3UTOA 2JFMA 4ZSGA 1U5QA 3GGFA 3E93A 5IU2A 4EOJA 4MCVA 1W84A 2BALA 3L8SA 1V0BA 5ICPA 3LIJA 5J9LA 4JDKA 2FSMX 3ZO1A 4C2VA 3IS5A 1ZRZA 4MXCA 5EYMA 5CU0A 4E5WA 3R0TA 3OT3A 2OZOA 3ZEPA 4ACDA 4E7WA 3COKA 5FEDA 4CRSA 4BZOA 4XBRA 4DCEA 1WCCA 3C4XA 5AIRA 3EQRA 2C6DA 3NUXA 4J8NA 4C59A 4C0TA 4ASZA 3HUBA 4JBQA 3QD3A 4UMQA 4BCMA 3P7CA 4QNAA 3Q5IA 5TE0A 4YURA 4AXAA 1ZYSA 5JMSA 4AOTA 4F1MA 4W4XA 3PVGA 4GIIA 1Q8YA 2YISA 1IRKA 3W2RA 2J0KA 5E8XA 2JDVA 3HL7A 2GNJA 4YZ9A 2OFVA 2BZJA 2I0HA 2VWVA 4AZTA 5A4LA 2WMAA 1UA2A 4G9RA 3EQGA 4OUCA 3LMIA 5IQIA 2VTIA 4FNWA 1R0EA 5AJQA 3DBFA 2I0YA 4BCHA 4EC9A 5IA4A 5JT2A 4F08A 1OKZA 4I23A 3LVPA 5IG1A 3G51A 3QTUA 3JUHA 4LI5A 4O0YA 2ITTA 4K77A 4DG0E 3F5PA 3FMLA 3LPBA 3ZXZA 5EQYA 3CC6A 3FZTA 1ZLTA 3LFDA 3QTQA 3QTIA 2HZIA 4L42A 3W33A 2OF2A 4ARKA 1MRVA 3KCFA 4HVDA 3UNZA 3E3BX 4XX9A 1YHVA 3WF7A 2QQ7A 4X2KA 3LFNA 4H3BA 3RJCA 5D12A 1QPJA 3PVBA 4RWIA 4M67A 2Y4IC 4GH2A 1T46A 3RNIA 4X2FA 5KMLA 4Q9SA 3KMWA 3LCTA 3QX4A 4NZWB 3BRBA 3FY2A 3RP9A 1FGIA 3FLQA 3GEQA 4PPAA 1IR3A 3U54A 3PY3A 5CWZA 1OMWA 3GU6A 2EVAA 2QO7A 3UMWA 3CPBA 3SW4A 4UY9A 4Q2AA 3UOHA 3LQ5A 1Y8GA 2OG8A 4AE6A 3MIYA 4M84A 2O65A 3OWJA 1J7IA 4MBIA 2WMSA 1UVRA 3SQQA 3TG1A 5EOLA 2OZAA 3JPVA 4LRMA 2C5OA 4FV1A 4XP0A 2OJGA 1ZYJA 1UV5A 3UC4A 4B9DA 4C4EA 4QMLA 5KMOA 2BKKA 3REPA 3D2IA 3ZH8A 4DBNA 1Q8TA 4YTCA 5LVOA 5A54A 5IPJA 1BYGA 3AGMA 3NNXA 4RWKA 4TYIA 3EHAA 3KXXA 5HVYA 3VQUA 1U59A 2WQNA 3FKOA 3R71A 2CPKE 3WF5A 3B8QA 3D7ZA 3WARA 4G1WA 4D9UA 5AR5A 5A4EA 5FM2A 3SRVA 1KV2A 1OPJA 4EHVA 1YW2A 4JNWA 3U6JA 5M09A 3ET7A 5AA8A 1AGWA 4O6LA 3C5IA 3BZ3A 3KVWA 5IMEA 4O2PA 4GCJA 4NEUA 2Y7JA 2HCKA 1H24A 1LEWA 1BI8A 3MB6A 2Y8OA 1FVRA 3DKCA 4F0GA 3ORTA 2PE0A 2VGOA 2B9JA 4FKOA 3BKBA 5EDPA 3ZDUA 3OC1A 2HXQA 4Y73A 3O8PA 2QG5A 2PMNX 4RSSA 4KUJA 3R8PA 3BE9A 2QR8A 5DRDA 3IGGA 2E9VA 3QD4A 3AD6A 4EH7A 4Q5HA 5CI7A 4FI1A 4UWBA 2R3RA 4U44A 5E1EA 5HKMA 2P2IA 5AIKA 5KZIA 2CN8A 5AUVA 3FI3A 5J9YA 4HCVA 5L2SA 4AAAA 4RBLA 5B7VA 2J4ZA 4Z55A 2W17A 2PMIA 4D4YA 4FIJA 1CMKE 4ACCA 1GZKA 3Q4TA 4FV6A 5DT3A 4K33A 5DG5A 3KF4A 2RFNA 3O17A 4UYNA 4C4GA 4RZWA 3TV7A 4FSWA 5EKOA 3FMJA 4E4LA 1X8BA 1ZZ2A 3U9NA 3O8UA 4TN6A 4HYUA 3R7EA 2YWVA 5EHYA 3DAJA 1S9IA 3R7GA 3PA5A 5J7HA 4I93A 4USEA 5EM5A 3NYVA 4O7NA 3AMYA 2X9FA 5E92A 3HV4A 3QA8A 4FOBA 4HYIA 4KKGA 5HORA 2IN6A 2B1PA 2GNHA 3C4CA 3QQJA 5E9EA 4ZSJA 5D7AA 4YJPA 3HNGA 3I7BA 5CEIA 4AU8A 3KFAA 1BUHA 2BHHA 4BBEA 3RPRA 2Z8CA 2O0UA 4KIOA 3W2PA 4YU2A 3U55A 3IOKA 4BFMA 4M8TA 3MFRA 3W10A 3R1NA 2J0IA 4UXLA 3H9FA 2ONLC 4FKWA 4IXPA 1Q8UA 1E1VA 3MVJA 4XG9A 3IDPA 3S2PA 3MPTA 3W2SA 4JBOA 1YWRA 2FSLX 1PY5A 2WB8A 1ERKA 3BQRA 3EOCA 3MTLA 3F3UA 2C69A 3UOJA 3QLGA 4H36A 3OWLA 4QYYA 4Y5QA 2H96A 4AQCA 4H3PA 4FV2A 5JZJA 4QQ5A 3EFJA 3UE4A 3A7IA 4F7LA 4IC7A 4FX3A 2F49A 4RRVA 5M4FA 2C1AA 4O38A 3H0YA 2A2AA 1OPKA 4ZJVA 3BPRA 2R7IA 4LGDA 1UWHA 5I4NA 4QPSA 2XK7A 2VTAA 3MTFA 4OBQA 4JT3A 5C9CA 1KE7A 3CCNA 1Z9XA 4FNYA 4U9AA 3RZFA 3VAPA 3VJOA 3C4EA 4Q9ZA 1UNLA 4C3RA 3RINA 3FL5A 2XBAA 3AC1A 3PIZA 5BYYA 3BX5A 4D9TA 5JGBA 5CU4A 1NVSA 4ZLZA 2GDOA 4JQ7A 5HLWA 1JOWB 2LAVA 4M66A 4QYFA 4WIHA 4BIBA 5CEKA 5J9ZA 3F2NA 1H00A 1XH4A 4NYEA 4XRJA 5CZHA 1KE9A 2VWXA 2LGCA 3LZBA 3O8TA 3KXNA 3WBLA 2XCHA 3HMOA 3OTVA 4FTLA 4DAWA 3LHJA 1Y91A 2FH9A 3MH3A 4QP9A 4AGCA 2HENA 3G2FA 4G16A 3QC9A 5H8EA 1JKTA 4OTGA 2EB2A 2H9VA 3EFLA 2PUNA 5E7RA 5LARA 3EQHA 4ZEGA 3PIYA 3O96A 4HW7A 2Z7QA 3NCGA 5LOHA 4YC3A 4QMMA 4ZZMA 1URWA 4E4XA 4RX8A 1DAWA 4HCTA 5LCJA 2HELA 4ASDA 4MVFA 3B8RA 4XBUA 1FGKA 4XV3A 4RX5A 1P2AA 2OH4A 3E8CA 5AAEA 4EZ7A 2G2HA 4FF8A 3NUAA 3OZ6A 4M14A 3UO5A 3R9OA 2ZV9A 4XRLA 4RC2A 4HGTA 1IAJA 3PG3A 3H30A 4ANQA 2JBPA 5KBQA 5CSHA 4PF4A 4ACMA 4KRCA 5CU2A 1XKKA 2WTKB 5AUXA 1GIJA 1NXKA 4BVUA 1A06A 3ZHPC 4F65A 4A4XA 1APME 1R0PA 2WKMA 3PG1A 3WZUA 3R8ZA 3NIZA 3QYZA 3MA3A 4YBKA 2QLUA 3EB0A 4BR3A 3G15A 2IVVA 4BDKA 4ZXTA 4EH5A 1ND4A 3IG7A 4EHZA 5LQFA 3F3ZA 4LGHA 5M07A 1KOBA 2YIRA 3OUNB 2OWBA 3MVMA 3UYSA 2CNUA 2PWLA 3PDTA 2GNFA 3H9RA 3QZGA 1Q62A 5ETFA 5JK3A 5KMNA 3C4FA 3CQUA 2GNLA 2ZMCA 3FZSA 3OOMA 4I6QA 4ZSEA 3ZFMA 3NNUA 4F9CA 4O27B 1PKGA 3DKOA 2PZYA 4RG0A 3POZA 4GJ2A 4BB4A 4F1OA 4IVDA 4UN0C 5ACKA 5J5TA 2W5HA 5J87A 3IK3A 3PXRA 4X3JA 3RK5A 5AAGA 5AV0A 3R21A 1ZOHA
chains in the Genus database with same CATH superfamily
4MD8E 2GNGA 1RW8A 2WPAA 2HK5A 5M4IA 5CTPA 1J3HA 4H1MA 3QRKA 4BYIA 2OJFE 4ITIA 2VO3A 3QCQA 3RCJA 3ZO4A 4D5HA 3MFTA 1Y6BA 1P14A 5HG9A 1H01A 4U7ZA 2AC3A 5A6NA 2QOQA 2XK3A 3D5UA 3KF7A 3TTIA 4E6CA 5EH0A 1MRYA 4G6LA 4CKJA 5GZ8A 2HW7A 4J98A 4UZDA 3PA4A 1QMZA 3SAYA 2J0LA 3GI3A 3UDBA 5BUJA 4IZAA 4D55A 5A4CA 2DS1A 3R73A 1UWJA 2J2IB 5I9XA 2X7FA 2QKRA 3DAEA 4GEOA 4ALUA 5BVNA 4OTHA 2XNBA 4IW0A 4R77A 4D5KA 4QO9A 3I6WA 1H26A 2O5KA 4AGUA 5DLSA 3EQIA 3NUNA 4AXEA 3ALNA 3SX9A 3ML1A 4DE4A 2VWUA 2JAVA 2XKFA 3FXXA 2CKOA 2IO6A 2XEZA 4IMYA 4ZIMA 4EH9A 2Z7LA 4I5HA 1URCA 2X7GA 3IDCA 3CD3A 4WT6A 2UZUE 3D83A 3MY0A 4ANNA 4G6NA 3MGYA 4D28A 3SD0A 4IQ6A 4QMUA 4YJNA 4LRJA 3HAVA 1UKIA 1JKKA 3LXKA 3AC4A 3FPQA 1A48A 4O22A 4O4EA 3DQXA 3GXLA 4EQUA 4ZJJA 5IUHA 3A7HA 1OM1A 2IZTA 2E9NA 2JITA 3T3UA 3FL4A 4DGGA 2BILB 4O7RA 3COHA 4AACA 5E8UA 3DBQA 2UW8A 3VRZA 2O2UA 4G3CA 5CASA 4UMTA 5J95A 3OOGA 4JLCA 3WF6A 3K5UA 4L3JA 4ZTLA 4QPAA 4CNHA 3D4QA 3NNVA 4TYGA 3MWUA 2P2HA 5CT7A 3O2MA 3NW6A 4IAYA 4IM0A 3U87A 5M57A 3R04A 5HU9A 2VO7A 4FV4A 4J99A 5BVEA 2YIWA 1H07A 3UO6A 2G9XA 2GNIA 5DH3A 1IA8A 3ZC5A 1ZMUA 5HO8A 4EC8A 4ZY6A 2CNQA 3DV3A 3ERKA 3L1SA 2VTTA 5TKDA 5E4HA 3HMMA 2JDTA 4DHJA 1WZYA 3W2CA 5CSPA 3Q9XA 4CYJA 5EKNA 3QU0A 4C62A 3FAAA 3MB7A 2WMTA 2RGPA 5EYCA 3VONA 4CMUA 1XBBA 2VUWA 5IQCA 2X9EA 1XH7A 5HD4A 5KHXA 2P0CA 3NVMB 4OTDA 5CS6A 3BGZA 4QP1A 2X2LA 4FICA 2PK9A 2XRUA 1CKPA 3KKVA 3CY2A 2F7ZE 2A27A 3QF9A 4NUSA 2C68A 4X2JA 4EHEA 4FV3A 4Z9LA 4QYGA 1I09A 2BZIB 3SXSA 1B39A 5HE1A 4F0IA 3BCEA 2R3HA 3QTWA 4IAIA 4AN9A 2C47A 1K2PA 4NH1A 4O81A 4K9YA 4ZY4A 2WELA 3WILA 3QKKA 5FLFA 3CQWA 5HNBA 4WOVA 2GFCA 4R6VA 1H1WA 1H08A 3RAHA 3N4TA 2W06A 3IO7A 4BTKA 4RA5A 5FEQA 3FE3A 4NM3A 1TQIA 3G0FA 4NW6A 1NVRA 4Y95A 3GBZA 3TIZA 5CALA 4LUDA 4QQJA 2VTSA 3LJ2A 3Q4ZA 4I0SA 1PF8A 4QYHA 2OICA 3UO4A 5EOBA 4L9IA 1CKJA 3RM6A 5K0KA 2ZB1A 3AKKA 2W4OA 2HZ0A 3UP7A 3F3WA 3MIAA 5DNRA 5LVMA 2YEXA 3FXZA 5BVDA 5AV3A 3C50A 3M2WA 4MD7E 4L52A 4LL5A 3FC2A 3VW8A 4AX8A 4CQGA 3BYOA 2HYYA 1QCFA 3UYTA 5KMMA 4ZK5A 4AW2A 4TWPA 3W55A 4BICA 2GQRA 2UW6A 4DT9A 2C4GA 4XG2A 4CT1A 3AGLA 4A9RA 4CEGA 3ATSA 2GTNA 5FTOA 1BKXA 2BCJA 2UZNA 3R22A 4K1BA 4B0GA 4C58A 3LW0A 3A99A 4YHFA 5AP7A 4NTTA 4BTFA 4CG8A 2OBJA 2PMLX 2QD9A 4JDJA 1G3NA 4O84A 4TWOA 4QQTA 1H1QA 3MY1A 4W8DA 1KE8A 5IF1A 1DI9A 4NKSA 4ALVA 2PZPA 4C37A 1H0WA 4I6FA 5E8VA 4Y83A 4EOPA 2I6LA 2UZVA 4F9YA 4GG7A 2UW0A 4IE9A 2FYSA 3EYGA 4JL9A 2BAJA 2FSOX 2PVLA 4OTRA 3R01A 4TPTA 4D2SA 3QTZA 2OJJA 3LCOA 3VUHA 5E8ZA 4ZTMA 3CJFA 2QHNA 3PUPA 5ACBC 3RNYA 3E7OA 3W8LA 5FTQA 4C02A 4NKAA 4U6RA 4L8MA 4EK5A 3FSFA 4IWPA 1Q24A 1JSTA 2RG6A 4RIWA 3V6RA 4DFUA 3U4UA 3HP5A 2PL0A 3ZRKA 4LOPA 3I5ZA 3JR1A 2B9HA 1ATPE 2V7AA 4I0RA 1KE6A 3F66A 4YHJA 1M17A 2F9GA 2UW7A 1H28A 2F2UA 2ONLA 3EFKA 3ETAA 3GNIB 3PP1A 3UIMA 3V5TA 3VUMA 5JRQA 3AMAA 4C3PA 2XH5A 5GHVA 3TCPA 2R3JA 3HA6A 4U43A 3UIUA 5EI6A 4CCBA 2WTDA 5CF6A 3K3JA 2B0QA 1YDTE 3FHRA 3C4WA 4FV5A 3DDQA 1NA7A 4LQMA 5I9UA 2YN8A 4YMJA 5DPVA 2OZAB 3MJ2A 3OF0A 3SC1A 5M08A 5HO7A 2X81A 1XH8A 5KMJA 2WFYA 5AV2A 4CLJA 2B54A 3PXFA 1H25A 4D0WA 3S0OA 3V5PA 4QTCA 3LAUA 4CCUA 4W9WA 4UB7A 4GT4A 3VUDA 2OXYA 3V5QA 4R3RA 4BCQA 4R5SA 3ZRMA 3KMMA 3LCSA 3OVVA 2EB3A 4FNXA 4PUZA 2QO9A 4U80A 4TNDA 3RM7A 3LCDA 3V8SA 1H1PA 5EG3A 3ZM9A 3FI4A 4LYNA 2PVFA 3ZUUA 3S3IA 3CSVA 4F7NA 4JG8A 3C4ZA 2W9ZB 2XVDA 4FSMA 3VBVA 2Z7SA 5TO8A 2B9FA 4FVRA 1OL5A 4NCTC 4RPVA 3ANQA 5CANA 5IQEA 2IVUA 3SV0A 3VULA 2ZM4A 4PL3A 3BL9A 3R9RA 1XWSA 4C33A 3D0EA 5CAOA 4G3DA 4GFMA 4YBJA 3EZRA 5K9IA 4FKTA 3F9NA 3WZEA 1UU7A 4FOCA 2ITXA 5EDRA 3C0IA 3KK9A 3L9NA 3PRIA 2YM6A 1WVWA 2QOHA 2X8DA 2A0CX 3KC3A 4NK9A 4WNOA 3MH1A 4ZTHA 1REJA 4DFZE 3TKHA 5A14A 3PSCA 4O91A 5DIAA 2GTMA 3FZOA 4IHPA 4I92A 3ZUTA 1DS5A 1VJYA 3PY0A 4DFBA 4PNKA 1KSWA 3OXIA 4WBOA 5DMZA 3NSZA 3FZ1A 4FKVA 3RPVA 5IMXA 4XV2A 3PPKA 4LV5A 3QQLA 4RGJA 1BL6A 5C01A 2ZDUA 4BL1A 3GC8A 3RGFA 4USDA 5BMSA 5M4CA 3POOA 3KK8A 4UXQA 5DOSA 4FK3A 3LJ0A 4R1VA 3BHHA 4AA4A 4IX3A 4QMZA 1NT2A 4BBFA 4YHTA 4O7LA 2X8EA 5BYZA 1JPAA 4UX9A 5ITAA 2YWPA 2X4FA 4GFGA 5K5XA 2XNPA 2W96B 3SXRA 4E93A 4FZ6A 2X2KA 1W83A 4WNKA 4A07A 3E5AA 2J51A 3I0QA 3PE2A 3ZRLA 2Z7RA 4APCA 4O0VA 4EH8A 1E1XA 3DGKA 3QZFA 5GZAA 4PL4A 5FD2A 3KCKA 1WFCA 3QRUA 2BPMA 4IAFA 4L67A 1YOLA 4EKLA 4IVCA 2CKQA 3W0RA 3LFFA 2Y0AA 4DN5A 2JDRA 5I9ZA 3F69A 5M06A 3IKAA 3UC3A 3EN5A 2Z02A 5JZNA 3R9DA 3ULIA 3ZO2A 3ZU7A 2XK8A 5FXQA 2PULA 4G5JA 3II5A 4EJ7A 1OGUA 2J0JA 2AUHA 1H1RA 2QR7A 4FV0A 4IH8A 5LJJA 4DHFA 4EOQA 4D2TA 2CDZA 2WMRA 2A98A 1ZY5A 4B6LA 3SDJA 5HX8A 2JIVA 3DBEA 3EN7A 4FT0A 5C4LA 3DK3A 1ZYLA 3S95A 5L6WL 3UPXA 1PKDA 1LUFA 2UVYA 5LXMA 1GOLA 3Q60A 3OW4A 4MYGA 3Q6UA 4C38A 2J5FA 2YA9A 1WBOA 4FTOA 4DDGA 3ORNA 2W4KA 1OBDA 3A7FA 4FK6A 2BFYA 2QU5A 2B53A 3PVWA 2CMWA 3UZRA 2OJIA 5CAPA 3QXOA 2ITUA 1M52A 4PRJA 4BGHA 2P55A 3DXNA 5FP6A 2I40A 3BBWA 2W1ZA 3ELJA 3CD8A 1XO2B 4ERKA 3PUFC 4Z16A 2CSNA 4LMUA 2PVRA 3NW7A 4MD9E 4K18A 4E6DA 4LDTA 4FODA 4U45A 1AD5A 3TUCA 4GK2A 3FWQA 5L8LA 1IEPA 5ANIA 4K11A 3VS3A 4AP7A 3NVKI 5B0XA 3F61A 4BKYA 2BDJA 5IA0A 5KUPA 2J0MB 2B52A 3F82A 3QZHA 3RHXA 2IVTA 4FVPA 4L3LA 2OIQA 3N9XA 5LMAA 1RE8A 2BR1A 3WE8A 2VD5A 2X0QA 3CXWA 4UEUA 4I21A 5F1ZA 2A19B 3AG9A 1PXIA 3COIA 3MI9A 4KBAA 1B6CB 4O0XA 4EH3A 1UU3A 2ZMDA 5CX9A 1H0VA 1Q4LA 4XLVA 5E1SA 4BN1A 2WMBA 4FG7A 2PVNA 4QTBA 2IF8A 4PDOA 4MF0A 3MA6A 2OI4X 4EUUA 2XYUA 3EL7A 4QMVA 5EFQA 3V6SA 4AWIA 4FBXA 1M2PA 5AV1A 3ZLWA 3NUUA 4BTJA 4XG7A 2IWIA 4R1YA 3V3VA 2OLCA 3PLSA 1OZ1A 1ZMWA 3RMFA 2X1NA 3M42A 3UZPA 4HPUE 1FINA 3P78A 4DLJA 1FPUA 4F9BA 2C5VA 2GCDA 4HVHA 5FDPA 4FSRA 4X2NA 3S1HA 5BX0A 2ITZA 4U41A 3MESA 4KINA 5K5NA 2J50A 3SHEA 4UWYA 2JKKA 2BRNA 2CGWA 4G9CA 2VWBA 3OEFX 4GT3A 4EH6A 1BLXA 2V0DA 3ORXA 4W9XA 3EQFA 2R3IA 4QTAA 4ZZNA 4IB0A 5BNJA 5C8MA 2YCSA 5HBEA 3ATTA 3Q5ZA 2QO2A 3DY7A 4F64A 3UGCA 3UDZA 1F3MC 4PQNA 2JBOA 3R02A 4TXCA 2BKZA 1WVXA 2JDOA 3OY1A 4EOSA 4EOIA 3FQSA 1YWVA 4IZYA 1NW1A 2XKDA 2YM3A 3FMHA 2PZIA 2YHVA 3F5GA 5GJGA 3CGOA 4JBVA 4IBMA 4KS8A 2Z60A 2PPQA 4H3QA 3R28A 5ETAA 4OTIA 2PUUA 2HIWA 5BVWA 4P7EA 4G31A 5BYLA 4UMUA 4BRXA 2ITVA 5J1VA 2ZB0A 3OTUA 3JVSA 3KL8A 4AS0A 2C6MA 4S33A 3R8UA 5JSMA 4NM5A 4HZSA 5HLNA 4IACA 3DK7A 3C0GA 3OXZA 3F3TA 3V5LA 1JSVA 2XB7A 5F95A 4H05A 3G0EA 2OIBA 3D7TB 4OGRA 3RBWA 3CPCA 4FL3A 2OO8X 4Y85A 5FXRA 4PV0A 5D41A 2R3QA 5F94A 4BDIA 3TN8A 2QOKA 1MQBA 4EORA 1MUOA 4UMPA 3BI6A 3VBWA 4U40A 4HPTE 2OH0E 2AQXA 2UZOA 4LV7A 2XNNA 4YGAA 2NNWB 2W0JA 5FEEA 3O7LB 4JG6A 3OS3A 3H9OA 5B2KA 3S00A 3GOPA 2WGJA 1PXKA 3O51A 4EQCA 5IQGA 5K3YA 4AN3A 2ZV2A 4KS7A 1P5EA 4AFEA 1Q8ZA 4I41A 4MF1A 1NVQA 5LVLA 3R7UA 4C4FA 4PDYA 1FMKA 4FA2A 3BU3A 3GP0A 4FL1A 3ZFYA 4E73A 3OXTA 4KIKA 1SM2A 2WQEA 4YNOA 4OLIA 2FA2A 4FJVA 2XIKA 4YNEA 3BU5A 4RFMA 4EI4A 4OT5A 3E8DA 3I5NA 4IX5A 3ULZA 4HNIA 4YJOA 3TI1A 3WIKA 4O7TA 3W0PA 5FM3A 4FKLA 3VF9A 4E6AA 3RZBA 2WOUA 2ZM3A 3TZ7A 3BLQA 3QTRA 3PXQA 4BDEA 4EH2A 2YJSA 2W1DA 3DTCA 2CGXA 3QHWA 4XG3A 5HO6A 4ZTRA 2Y4IB 4ZTQA 4ZS4A 3TEIA 2W1HA 1OL6A 2H8HA 3CTHA 2OFUA 3ZBFA 3R30A 4YTHA 3F88A 2XAMA 2P33A 4GW8A 3QCSA 4C4HA 4EK8A 4RQKA 4FG8A 4DEAA 4EK6A 3C9WA 1G8JA 2XK6A 1ZARA 3PWYA 3CBLA 2EXEA 4GFOA 3DB8A 2QURA 4YTIA 4JMQA 4AF3A 3EN9A 5J8IA 4TWNA 1ST4A 2YM7A 3Q52A 4A7CA 4DG2E 4IWDA 4V0GA 3FLWA 3CTJA 5GJFA 1PXOA 5CF4A 4RWJA 3IW7A 4RIXA 1XH6A 3FBVA 4QP6A 2XK9A 3JY9A 4D2WA 4XJ0A 4I6LA 4XV1A 4ITJA 3GU5A 4JX3A 4LG4A 5ETIA 3U9CA 5DI1A 4O1PA 4BDAA 4U97A 2PE2A 2IW8A 2HZ4A 3LJ1A 4DGOA 4DC2A 3OCGA 1XBAA 3PXKA 4RC3A 2WXVA 3QGWA 4BCPA 3AT2A 5AA9A 5IEYA 4E1ZA 4JDHA 4L7SA 3W2OA 1GNGA 3DDPA 5TOZA 4M68A 4NCTA 4MXYA 3V8TA 4O4CA 5I9WA 2R0UA 3UODA 4ZMEA 2Q83A 4Z7HA 5AUZA 4O21A 1REKA 4NW5A 4O7ZA 5IH6A 4P90A 5E8SA 4RJ7A 2UW3A 4CZYB 5LMKC 5AP5A 3CKWA 4L44A 5B2MA 5L3AA 3WOWA 4ITHA 4BHNA 4RX9A 1XH9A 3VIDA 4A9UA 2BRGA 4EQMA 4F7JA 3FPMA 4LFIA 2UZDA 3AT4A 3MSSA 1G8AA 5BVKA 3MDYA 2QOOA 4DEDA 2DYLA 1XQZA 3FI2A 4BGGA 4Z3VA 3OCBA 4IZ5A 5HLPA 3VBXA 4FYNA 3CR0A 3GU4A 4FTQA 4QTDA 4F1TA 5AR4A 1CSNA 4DEHA 1YOJA 3P7AA 1WVYA 4F99A 1Q61A 3FQHA 4ZTSA 4AXFA 3LOKA 1P4FA 2NRYA 4EBWA 2R64A 3F3VA 5H8GA 4QP2A 1XR1A 1OECA 3PJ2A 1GIHA 1PMNA 4LRKA 4PP7A 3I0OA 3R7VA 5HCXA 4PTGA 2G01A 2YIQA 2CCIA 4RIWB 4QTEA 4BYJA 5HVKA 3VS2A 4LM5A 1ZWSA 2R3FA 4JIAA 4O7VA 5CNNA 3KXMA 3EN6A 2VTOA 3LM0A 1JVPP 2C6OA 2GSFA 4FSZA 3GQLA 4L46A 2G15A 2IW6A 3NYXA 1R1WA 5CVGA 2VTRA 3TKUA 4MH7A 4P2KA 1YXVA 4FTRA 5HIEA 2FB8A 3QL8A 1OUYA 2UZTA 1W2FA 3BHYA 4NWMA 3W0NA 3L9MA 3FLYA 4N57A 3HX4A 2ZOQA 4C4JA 4HYHA 4HGLA 2BRHA 2XYNA 2AYPA 4DTBA 3I7CA 3KVXA 2F57A 3G6GA 4YJVA 3DT1A 1OIYA 3NLBA 3QC4A 3U6HA 4EKKA 4FUXA 5HD7A 1J91A 3CEKA 3ORPA 4JVGA 3Q32A 3A7JA 1J1CA 3SG9A 1OL7A 1PXLA 3VO3A 1M2RA 5AFVA 4I4EA 5L2QA 3HMPA 2A1AB 1WBNA 1U46A 2UZEA 1UNGA 4DH5A 4DLIA 4AQKA 1K3AA 2RFDA 5DE2A 1DAYA 1YI4A 2B55A 4CLIA 1W98A 5EHOA 3AD5A 2GMXA 3P0MA 4BHZA 4KKEA 2X6DA 2DUVA 2X2MA 3I1AA 4FL2A 4KRDA 2PYWA 4DTAA 4QDEA 3AKJA 3AC5A 3EL8A 3HZTA 3L8XA 4I94A 4J53A 5AP4A 5AP2A 2GQSA 2ITYA 3F2AA 2C5YA 3MV5A 3QBNA 4V04A 4XYFA 2YIYA 2C3KA 4MBLA 3DQWA 4TKSA 2WMQA 3AT3A 5DEYA 2CJMA 5CI6A 3TNHA 3ZSHA 4O82A 4BDDA 4EK3A 4DEIA 2WTVA 4PTEA 4IB1A 3VS0A 1RQQA 3COMA 3P79A 4ANBA 3TYKA 1PXJA 3GC0A 2BRBA 1XBCA 4GRBA 2IG7A 2BZHB 3HRCA 4A9SA 1WMKA 3G9NA 1OKWA 5ANEA 4QMWA 3R8LA 4O6EA 4DYMA 5AV4A 3QHRA 5JFWA 4S32A 2VNYA 2XF0A 4QRCA 3MH0A 4ZY5A 5ANGA 1XHAA 4BIDA 5HI2A 3HKOA 3UVQA 3PY1A 4FV9A 5KO1A 3VC4A 3UVRA 3D2KA 1LEZA 4PDSA 3D7TA 4JJRA 4YPDA 1O6LA 1SMHA 5HIDA 2IEWA 3PYYA 2R4BA 2NP8A 1GAGA 4QMSA 5GIPE 5HOAA 2BUJA 3AKLA 4JAIA 3L8VA 4YLLA 2W9FB 3E62A 4KIQA 4R78A 4FGRA 3B2TA 4FKGA 5ANDA 3PP0A 3FLNC 3UPZA 3K2LA 1P4OA 2HAKA 5IISA 4GYIA 2BAQA 4KIPA 5EQPA 1TFFA 3T9IA 3ZO3A 4I3ZA 4RJ5A 3O7LD 3I79A 4FIFA 1Y57A 3VBYA 3FKLA 5L2IA 2XJ1A 5DT4A 3FXWA 3BV2A 3CGFA 4GIHA 4FTAA 2IVSA 3CE3A 3FUPA 4K2RA 3BL7A 2XMYA 4HCUA 3DK6A 4GU9A 4QD6A 5CAVA 3GU7A 1OVEA 3HLLA 4TTHB 4DBXA 5K0XA 4BI0A 2WO6A 2GHGA 4IADA 4G17A 3DFCB 5AUYA 4NFMA 2W1IA 5L4QA 4AW5A 1J7LA 1R39A 2FVDA 1F5QA 3IW4A 3KXZA 1OITA 5H2UA 2J5EA 4RFYA 3I81A 1UKHA 2CGUA 3VNTA 5M53A 2W1FA 2E9UA 4MXOA 4JAJA 2H34A 1Q3DA 4X21A 4FSYA 4JQEA 4MNEA 3A60A 4BCIA 2YM5A 4YZNA 4AFJA 4AOIA 5EM7A 2ZDTA 2W99B 3RKBA 5KNJA 4I20A 4NIFA 4WSYA 3LXPA 2J7TA 4KBKA 4XH6A 4CT2A 2C5NA 4EK4A 2I7QA 4N70A 2F7EE 3KMUA 4H39A 1MQ4A 2XKEA 3DKGA 3UQGA 3ZEWA 3ZM4A 4D1SA 4U0IA 1IAHA 2ZFYA 2QODA 4DH3A 3R2YA 2YIXA 5BMMA 3R9NA 2VTNA 1M7NA 5ANKA 5FQDC 4DFYA 4Y8DA 3LLAA 1R78A 3OW3A 4LL0A 1YXSA 5L6PA 4K0YA 5IQFA 2X8IA 4EOMA 4WUNA 4KABA 2PVJA 4J95A 4CFVA 2UZBA 3ZDIA 4UALA 4B99A 3F6XA 3DJ7A 4D2RA 4E8AA 4PPCA 4AT3A 3FJQE 4FIGA 5IH4A 1OIQA 3LXLA 2GPHA 2ITNA 3VVHA 2JAMA 3OWKA 5HHWA 1PRYA 4RJ3A 1V1KA 4KSPA 2RSVA 5DEWA 4DDIA 4ANLA 3VS4A 5BUIA 3Q4CA 3E87A 4AW1A 2YAKA 3MFSA 1A9UA 4LV8A 5HE0A 1RDQE 4AA0A 1JAMA 3KIOC 2WD1A 3F5UA 5KMIA 1H1SA 4ACHA 2WZJA 3UIBA 3VS7A 4GVAA 2X0OA 3HV3A 4FEWA 3Q96A 4XHKB 2XP2A 4F7SA 3AC2A 3ID6C 4RC4A 5AR2A 3FLSA 3C7QA 3VBQA 5JGAA 5LVNA 3AC8A 4BDHA 4EJNA 4J1RA 4FR4A 5LCKA 4CFWA 2R3PA 5F9EA 4FIHA 3TZ8A 4GT5A 3VUIA 4BDCA 3QXPA 1KUTA 1TQPA 3ORMA 5DFPA 4NTSA 5CEQA 1YDRE 3FY0A 4BWKA 4D1XA 4QEBA 2GS2A 5CSWA 5JKGA 3R7IA 4F9WA 3TL8A 4PDPA 5KKRC 4WSQA 5GNKA 2XRWA 3BU6A 2YERA 4IX6A 5CT0A 5D7VA 1QPEA 4PX6A 4WUAA 4L45A 4YC8A 3P4KA 4FTKA 4RVMA 3LKMA 4X0MA 3SXFA 1HOWA 4BF2A 4U42A 4G34A 3V51A 4TW9A 1ZXEA 1E9HA 4XMOA 4D2VA 5CAUA 2XJ2A 4GV1A 1PJKA 3PRFA 3WZJA 1Q8WA 2UUEA 4FUYA 3BLAA 2R7BA 5GINE 3KEXA 3RI1A 3PIXA 5FGKA 3UZTA 2ACXA 5T68A 3RCDA 5JN2A 1GZOA 3BE2A 1MRUA 3OWPA 1HCKA 2XUUA 3QQGA 2XNMA 4FRFA 4CV9A 3BEAA 1VEBA 4CSVA 3A8WA 3Q6WA 4II5A 4ASEA 2FGIA 4AGDA 1RJBA 3HP2A 2J6MA 4QPMA 2JIUA 4D1ZA 4BCKA 3KRXA 3ZOSA 3GU8A 3NUYA 4PMSA 3NUPA 5AP1A 3HMNA 5CZIA 5M51A 3EZVA 1JSUA 4QP4A 5C8NA 3CQEA 5CYIA 5B2LA 3ZC6A 2GS7A 3HDNA 1SYKA 3GCVA 4RIYB 5AR3A 5TT7A 3BHVA 4WG3A 3H10A 3Q2JA 3TIYA 2PU8A 1SZMA 5CU3A 2RL5A 3EMGA 5DR2A 3T9TA 1ZYCA 3VUGA 2Q0NA 4L7FA 4U3ZA 1W0XC 3RTPA 2OU7A 1EH4A 1WBTA 3I60A 1OKYA 4M7IA 2XIYA 3IW5A 4JI9A 4U81A 4E4MA 3E88A 2Y6OA 2XNEA 5J1WA 3V5WA 4WNPA 3ZLXA 3VS6A 3N51A 5AUUA 1PXNA 3CTQA 2G2IA 3PSDA 4E20A 1STCE 3HA8A 1SVGA 4HNFA 3NAXA 1ZOEA 3G9LX 4HVGA 2BDWA 2F4JA 5J5SA 5LMKA 4E3CA 5JFVA 4FEQA 4J71A 2C6TA 5IQDA 3WYXA 5CVFA 3RWQA 4FEXA 1YRPA 2CCHA 3NDMA 4XP2A 3HVCA 4BI1A 3W0OA 3O50A 3P5JC 3C51A 4TZRA 4XEYA 3CLYA 4FV7A 4IX4A 5EI8A 3DAKA 4C4IA 3GUBA 5FG8A 4KIKB 4L43A 5IDPA 3BIZA 4YSJA 3EIDA 2BROA 4EL9A 2C6EA 2IZSA 2ZV7A 4FKJA 3BQCA 2JGZA 4EONA 5I3OA 3VUTA 2BIYA 2O63A 3CP9A 4K6ZA 5DRBA 2PSQA 4U79A 5AX3A 4FG9A 3V01A 4DGNA 4DCAA 3DS6A 4M69A 3DBDA 4OTPA 5EK7A 2PZ5A 2VNWA 3JXWA 4MWIA 4YZCA 3VQHA 1W8CA 2ITPA 3PJ1A 2R9SA 5M55A 4CXAA 3GVUA 2YFXA 2JDSA 1U4DA 3LQ8A 4KBCA 3TZMA 2QOLA 1BMKA 4YZMA 4NL0A 2V55A 4IWOA 4QQCA 4TL0A 3TNWA 5HTCA 3KQ7A 5HBJA 1PXPA 3DJ6A 4ZOGA 4GMYA 4EUTA 4PP9A 2YLFA 4HOKA 3MPAA 5H8BA 2R3NA 3LFQA 3BEGA 3D9VA 1UNHA 2YDKA 3L9PA 2OXDA 4FTCA 5AADA 4AG8A 4XP3A 5AUWA 2EU9A 3ORIA 3FYKX 5DR9A 3NS9A 4E6QA 3FMEA 2YZAA 3PTGA 2FUMA 3GENA 3LMGA 4D0XA 4F6WA 4BDGA 4DA5A 4YJTA 2Q0BA 3P23A 4V0GB 3FC1X 4I5PA 4AW0A 4IWQA 3HUCA 2JIIA 4RIXB 2WEVA 3EQCA 5DGZA 3ITZA 4OAVB 2Z2WA 1IA9A 4TNBA 1PMUA 3CIKA 3OCSA 4GUEA 3C1XA 4EZ5A 2X4ZA 3F2RA 2BHEA 4J96A 3OROA 4CFFA 5CY3A 4FZ7A 3E3PA 1OL2A 5AM7A 2YCRA 3OUKA 5EYKA 3PE1A 5M44A 4QP3A 4FT7A 4GUBA 3NR9A 3MFUA 4O0SA 1YI3A 4FT9A 4D4VA 2QNJA 3CY3A 3SKCA 2O8YA 4YJRA 3AD4A 3O71A 3A2CA 3VHEA 4GJ3A 4NU1A 3NZ0A 4O96A 4KWPA 2IZUA 4BZNA 5BUEA 4L3PA 3PSBA 4DH8A 3PWDA 2WOTA 4E5BA 2IZRA 4AZSA 1T45A 4P4CA 4BCGA 3VS5A 4KB8A 4QNYA 5JRSA 3KRLA 4G3FA 5FDXA 1M7QA 1YHWA 2O3PA 4Z7GA 4MUQA 4ZMFA 4DGLC 4I1ZA 4AUAA 3L9LA 5F4NA 5HG7A 3W8QA 4YC6A 2CLXA 2V62A 4FSTA 4APPA 4S2ZA 4CRLA