4OGRA

Crystal structure of p-tefb complex with aff4 and tat
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
323
structure length
314
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/viral protein
molecule keywords Cyclin-dependent kinase 9
publication title AFF4 binding to Tat-P-TEFb indirectly stimulates TAR recognition of super elongation complexes at the HIV promoter.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 314
sequence length 323
chains with identical sequence E, I
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ogrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ogrA01
3VQHA 1DS5A 1ZWSA 4TYGA 3DB8A 3R7VA 3R9HA 4FSRA 4DH1A 2EVAA 2ITQA 5CAUA 1PXMA 4JS8A 4WG4A 4A06A 4CFMA 5C8NA 4QMXA 5AP5A 3DQWA 3ENHA 3KRRA 5IH5A 3FKLA 3EN9A 4KIKB 4XV2A 5M09A 4DINA 4CFXA 2P0CA 4F0FA 3EN4A 4IVAA 4BTKA 4C59A 4C62A 1R0PA 1JKLA 4FC0A 1E9HA 1WBWA 4LI5A 1GY3A 2HK5A 2XK6A 4G6OA 4MYGA 5AR8A 4FG9A 5IQDA 1DI8A 3CC6A 3F5GA 5T3QA 2WMVA 3GT8A 4LMNA 4M69A 4CYIA 4PX6A 4CZYB 3PJ2A 2G2HA 4IWQA 2PY3A 4FTNA 4NWMA 1OL7A 4QOXA 1CKIA 1ZY5A 3VBXA 5B0XA 3QLFA 2QR7A 4EK5A 3NVKI 5AP7A 4BCFA 3MFTA 4FSUA 3SOCA 2OU7A 4YJQA 5CT0A 3TNWA 3VF8A 4CLJA 4Z55A 1U59A 5J79A 3K3IA 4JG6A 4HCVA 2QQ7A 3LCSA 4O0XA 5IKWA 4DFZE 5A4TA 3LMHA 4AGWA 3A7JA 5L2TA 5ANDA 3FYJX 3NR9A 4IVBA 5EM7A 5I9UA 4AAAA 3FLNC 3PRIA 4JT3A 5B7VA 3D7ZA 4OBQA 2LGCA 4O1PA 4YJTA 3TZ8A 2C3KA 1L3RE 2A27A 4GT4A 2YM4A 4CD0A 3WYYA 2V62A 3T9IA 3ZZWA 3P0MA 4HZSA 4APCA 2P33A 5T68A 4MX9A 4UXLA 4FKRA 3OTVA 3Q5ZA 3RK9A 5JGBA 5LVLA 4XYFA 5JRSA 4LRJA 2BAQA 5HVJA 1UWJA 4B99A 3MJ1A 5E8WA 1JSTA 4U8ZA 3HMIA 5FDPA 5EOLA 1DI9A 3V6SA 4ASDA 3AT2A 5JN2A 1OGUA 5ETAA 3TEIA 2IVUA 1JSUA 3IOPA 4PUZA 4ARKA 4KWPA 4WBBB 5AA9A 4AUAA 4FYNA 5HOAA 4M67A 5AV0A 2YWPA 4O0UA 3O8UA 3TDVA 4UV0A 2V5QA 4OTDA 2F4JA 3Q53A 4QQJA 3RAWA 4II5A 3RHXA 2JIIA 3F5PA 3DKGA 3RAHA 2UW7A 2ACXA 3SRVA 2IO6A 3QD4A 4BBMA 3LHJA 3OBGA 3C9WA 4ID7A 5C27A 3GU5A 2WKMA 2XBAA 3JS2A 4F0GA 3HUBA 5EQEA 5DIAA 4EOMA 4FEUA 2AC5A 4RVMA 4IB3A 4YTHA 2NP8A 5E92A 2IZSA 3IK3A 1KE5A 4HJOA 2F7XE 2O8YA 3EN5A 4MD7E 3ZCLA 4MD8E 2WD1A 1W8CA 3A4PA 2EB3A 3NAYA 3ORMA 3QHRA 2C6EA 5FQDC 4YSMA 3GC8A 4FSMA 4J95A 3BI6A 5CVGA 3COKA 1U4DA 1ZMVA 1XWSA 3KRWA 2H6DA 4I41A 3WZKA 4YC6A 2GFSA 3Q5IA 2Y6OA 5GZ9A 5A14A 3ID6C 4N6YA 5FEDA 2RGPA 3OY1A 2GNJA 4YZBA 3DDQA 4MEDA 5AV1A 1LR4A 4FKGA 4KABA 4NT4A 3THBA 4CT1A 2VWXA 3OT8A 5IA2A 3EJ1A 4R1VA 4EORA 4B9DA 3GC7A 4FL3A 4EZ5A 4AFJA 4BBEA 3Q96A 3TL8A 4IFCA 1ND4A 3MFUA 5JQ8A 1QPCA 4U81A 3QQFA 2FO0A 3P5KA 4K77A 4NEUA 3RPSA 4R7HA 2BROA 3UP7A 4C0TA 4OR5A 4B6LA 1SVEA 3QLGA 3K2LA 4KIQA 4G16A 4GG5A 4YSJA 2WB8A 4XP2A 4RX5A 4DTBA 2Z8CA 3K54A 3LQ3A 1YDTE 2OJ9A 3F6XA 1JKSA 4UMUA 4IX4A 1QPEA 5AP1A 5DRDA 3MS9A 4HYHA 1MUOA 4QP7A 3VN9A 3LMIA 4YBKA 1CDKA 2XRWA 3KF4A 5C01A 3WF6A 4BICA 4TRLA 3EL7A 3OXZA 3Q60A 3GCSA 3NCZA 2UW9A 1GZ8A 1XBAA 2PVNA 4ANNA 2Q83A 5JMSA 2BZKB 3QTQA 4JR3A 4UALA 5BUJA 3WYXA 3F82A 1VYWA 3AC8A 2JDSA 3O7LD 4BWPA 2R0IA 3PIZA 5KZIA 1AD5A 3FWQA 3BRBA 3D15A 4BL1A 3QX4A 1SM2A 3IG7A 4BCHA 4FV0A 2PTKA 3VUMA 3AG9A 2P2HA 3C1XA 4G9RA 3UDBA 3FUPA 3K3JA 4IX3A 2IVVA 4I6BA 4JX7A 5BYYA 3WZDA 3OP5A 4KKEA 3PJ3A 4HNIA 4ZTMA 2Y4IB 3JR1A 4M8TA 1ZMWA 4GU9A 2NPQA 2WHBA 4O6EA 4A7CA 4S31A 4AOJA 2J9MA 3DFAA 4XRJA 3FC1X 5KMOA 4ZSGA 4DLJA 5DBXA 4O7WA 3KMMA 3R04A 4OLIA 5E8ZA 3E87A 5IQCA 3HA8A 4BDGA 1Q97A 4IAKA 4C4IA 2UZUE 3AC3A 3PZEA 3QFVA 4DEEA 2B0QA 4E3CA 5CNOA 2CKQA 3AMBA 2Z7RA 2R64A 3CJFA 4I5MA 1OKWA 2ITOA 2CLXA 2J4ZA 3EZRA 4HVDA 4BHZA 5L6OA 4DG3E 4RJ4A 5ETFA 5HORA 5LVOA 1G3NA 2C6KA 3R71A 4RWLA 4I5CA 4FTOA 4XP0A 5FP6A 1M52A 3KU2A 2OJFE 2UV2A 5CTPA 3IONA 4ANSA 4AS0A 4YURA 4IAIA 5I9VA 3PWYA 4DFUA 1Z57A 5AUYA 4IWDA 2H9VA 2VO3A 3FHRA 2R3FA 5IA1A 4Y8DA 5JFVA 4RVTA 3RZBA 4CCBA 2O0UA 3T3VA 3QTSA 3BGZA 2A1AB 1U5RA 4RSSA 3KREA 2JKKA 1PF8A 4IH8A 5HNGA 2V7OA 3H0ZA 5TOZA 3ORIA 1FVRA 4G34A 3F3TA 2JAVA 2XNMA 4H3QA 1P2AA 4F1MA 5EH0A 3VWAA 1OVEA 5CALA 4RFZA 4AE9A 3W2PA 4USEA 1WBTA 4XG4A 3DLZA 5DFPA 4AE6A 4MF1A 3N51A 4I5PA 1Q8YA 4KD1A 5CAQA 1PRYA 3A61A 4NFMA 2O64A 3NZ0A 3NS9A 3MH2A 4QP6A 4NKSA 1L8TA 3I1AA 2JGZA 4CTCA 2XJ0A 4JRVA 4BDKA 5IEVA 3QKMA 2DQ7X 4E6QA 1NVQA 3BIZA 1YKRA 5ANKA 4O81A 4F1TA 4PPAA 2C6LA 2ETRA 2PZYA 2YDJA 5LJJA 1U54B 3ACJA 3ZM9A 3QZHA 4O38A 3LMGA 4AOIA 4YZDA 4ZS0A 1Q5KA 3TWJA 3LKMA 4NL0A 2HZNA 4AN3A 4EQCA 2WMUA 3GOKA 3HMNA 4K11A 4FVPA 4IAYA 4QYYA 4U3YA 3RJCA 3VBYA 4DTAA 3D0EA 3HZTA 1NY3A 4GVAA 4LV5A 1TKIA 1A06A 2ZVAA 4TNDA 4ASZA 3U8WA 5EW9A 2VZ6A 2C3JA 3KY2A 4DC2A 4EH6A 1V0OA 1KSWA 2YWVA 2BRMA 2E9UA 3U9CA 1ZLTA 4S34A 1Q8WA 3LFQA 2HW6A 4MH7A 5E1EA 4CNHA 2RKUA 2BIKB 2ZM1A 4RBLA 3UOHA 5BX0A 3ZONA 4GKHA 1J3HA 2R3OA 1VZOA 3F3ZA 4IMYA 5AWMA 3QTWA 1ZYSA 3G0FA 4B0GA 3OTUA 5FUTA 3R1YA 3GCUA 4Y73A 4FKSA 2WO6A 2XNNA 4TTHB 3VHKA 1R39A 4BIEA 3MIAA 4C37A 4EHVA 1FPUA 5J9YA 3KXHA 2QC6A 3F3VA 2WIPA 2PUNA 3QX2A 4D1ZA 5HX8A 1PHKA 5CF8A 4UYNA 2C5XA 3FAAA 2XIXA 2Z7LA 3KKVA 5E8VA 3BZ3A 4O22A 4XOYA 5KMKA 4I93A 3C7QA 3UO4A 4EWHA 4U0IA 3WARA 5BVOA 2BKKA 5FGKA 3KVWA 3BEAA 5CEOA 3AD4A 5BPYA 2Z60A 3EYHA 2DS1A 4O0YA 2XYUA 2PZ5A 3E8EA 1J91A 3OOMA 3Q9YA 4XG9A 5DN3A 5HCXA 4C3PA 4EOLA 1KE6A 4UYAA 4GJ2A 2PMOX 4QTAA 2B7AA 4QP3A 4O7YA 5CVHA 3ZFYA 4IQ6A 3WF9A 3IDBA 4XMOA 5J1VA 4GVJA 3FXWA 2XKFA 4ZY4A 2BZJA 2GNFA 1ZARA 4BYIA 1XBBA 3KMUA 4O27B 3E8NA 4XG7A 4PDOA 4E20A 1OBGA 2PZRA 3QCSA 3TKIA 4PP9A 4ZJVA 2HY0A 5C8KA 5HG9A 5FXQA 4ASXA 3CTHA 4JRNA 5KO1A 3UMXA 4K18A 1S9JA 4W4XA 4QP1A 4RC2A 2WAJA 4RGJA 3LCOA 3LLTA 4OTPA 2X2LA 3I0OA 5LVMA 4FE2A 4RPVA 4NJ3A 2J5EA 3NMUF 3H4JA 2UZOA 3PP0A 4QMTA 3ROCA 4C35A 4A9YA 3GB2A 3GP0A 4M68A 3FI8A 2JDOA 2UW3A 2PK9A 5EYMA 4FTAA 3E3BX 3U51A 1H1RA 3QUDA 4FKWA 3BLHA 4RLLA 4L7SA 4FKIA 4ZZOA 3FSKA 3EB0A 5CEPA 1PJKA 4U41A 2CGWA 4ZTSA 3DFCB 4I5HA 2Y4PA 3AGMA 2YCFA 1OUYA 3EN6A 2CLQA 4V05A 3QA8A 2P3GX 3FYKX 5EYCA 4J97A 3EMGA 4FTTA 4D1SA 2C6MA 2PL0A 2XEYA 2IW9A 4L00A 2QCSA 3SDJA 1E1XA 2QVSE 4CQEA 4FV7A 4FIEA 3PVGA 3DB6A 4HOKA 1IA8A 1O6YA 5KZ0A 3UMWA 1H07A 4AW2A 5J5SA 3DXNA 3NSZA 3SXRA 4JDHA 4DG0E 5H8GA 4FMQA 3KRXA 4EK4A 2QONA 2WNTA 3SW4A 2VTOA 3FMLA 3QTRA 2X39A 4ZLYA 2W1IA 1PMEA 2CJMA 3BLRA 2QOHA 4TYHA 2BAKA 1P14A 2OSCA 5K3YA 3R8VA 3WZEA 2OH4A 2A4LA 2BPMA 2YIYA 2E9VA 4KSQA 3HYHA 4FTUA 4GUBA 4P5ZA 5HZNA 4GT5A 3P7CA 2PVJA 5EHOA 5EYKA 1UU8A 4CTBA 3WIKA 3CD3A 3KK8A 4MXZA 5HCYA 2CNVA 1M14A 2QNJA 4FNXA 2Y4IC 4JIAA 4PDPA 5H8EA 4C2VA 2XVDA 3NUYA 5ANEA 5HE1A 5HU3A 4AW0A 2G2IA 3TJCA 4J8MA 2BRHA 1M2RA 3O0GA 4KS8A 4L01A 4EOQA 2CDZA 5CASA 4K6ZA 4AT5A 2YCRA 3O71A 3WZJA 4A9TA 3FMKA 3VS7A 2YM3A 3BYOA 5A6OA 2X7FA 4EC8A 2BILB 3ORXA 3QBNA 5LARA 3AMAA 2YCQA 3JVRA 5K9IA 2UW5A 1BYGA 1OL2A 3BE2A 3DNDA 5BVDA 4K0YA 3R30A 5EK7A 2I0EA 5AR3A 4RIYA 3QTXA 2JDVA 2X8IA 4BDBA 3LVPA 1YXSA 4G3CA 4BDEA 4Q9ZA 1REKA 5AJQA 1K9AA 4QTBA 1PYEA 2QO9A 4H1MA 2WTVA 3R7YA 3GOPA 3TJDA 4ZY6A 4FV3A 5DR6A 4FK3A 4NU1A 4HPUE 5DMZA 3O2MA 2BRGA 4PMMA 5E9EA 2C3IB 1UNHA 3OUNB 2UUEA 3ANQA 4DCEA 4FOCA 5CWZA 4HCTA 4XP3A 4CMUA 4ENYA 2W99B 3D4QA 3NNWA 4NW6A 2ZMCA 4L3JA 3DBCA 2JLDA 5BVNA 2WMTA 5J7HA 4FBXA 2WOTA 2I40A 2R2PA 1YOJA 3WZUA 1YVJA 4WKQA 4RWJA 3BEGA 5HE3A 4CSVA 3PZHA 3ALOA 3A99A 4UZHA 3GENA 3BYVA 4PNKA 2W7XA 3LAUA 1H0WA 3JY0A 3R1NA 3ZRLA 3ZBXA 2F2CB 3E62A 3QXOA 2YAAA 3QTUA 1XQZA 5CI6A 5DOSA 3SG9A 4D2VA 1JBPE 2W1HA 1OIRA 4F7NA 3WOWA 4BTFA 3HV3A 4ACMA 2C1BA 2QG5A 2VD5A 4ZTHA 2PVYA 3QRTA 5EFQA 4MNEB 3ZO3A 4AWIA 3PSDA 3QQHA 4O21A 1GNGA 4W4YA 3VUTA 5M07A 3QQLA 4ZOGA 3G2FA 3D14A 3DBDA 4PMPA 4XS2A 3Q3BA 4AX8A 4R78A 5AIRA 1JWHA 3AC2A 4ZTLA 1ZYDA 3OFMA 3R9NA 4QNAA 3ZLYA 5CU6A 5DEYA 5EI2A 3ORPA 2OO8X 3UPXA 3DBEA 4FKUA 5H3QA 5AP2A 3AGLA 5AV4A 3T9TA 2JAMA 2WFYA 1Q3DA 4I94A 3NLBA 1M7QA 5IQBA 2XM9A 4USDA 5CENA 3ZXZA 3IDPA 3QRIA 4UWCA 2R3JA 2KULA 3R7GA 4K1BA 4N6ZA 3U4WA 1Y57A 2ESMA 2QHNA 5EHYA 5TR6A 1MRUA 2B55A 2DWBA 4O2PA 4BI0A 5IH6A 4EOSA 3ATTA 4EK8A 1Y8YA 3WF7A 4O7SA 3VC4A 2OJJA 3CGFA 2GHMA 2P4IA 4B8LA 4YJPA 4YC3A 4USFA 1QCFA 4YJVA 2BVAA 2J5FA 5HX6A 4IJ9A 1IAHA 3NDMA 2XF0A 5AR2A 4BGQA 1STCE 4C4FA 4KRDA 4EUTA 4C38A 3ZSHA 4RZWA 4H58A 3FLZA 3ODZX 2XM8A 1OPKA 4ALVA 3RAIA 4FIJA 5AAEA 4KIPA 4PNIA 1NVRA 3OCSA 4RIWB 3SVVA 3FKOA 5GIPE 3TNPC 3UOLA 3V8WA 2ZOQA 4BDJA 4ZTNA 4GS6A 3H30A 5JRQA 3F3UA 5CAOA 3R00A 3V5TA 5LMKC 3R1QA 2UVXA 4QMUA 3RK7A 4F1OA 3PFQA 3R21A 2X1NA 4ANOA 3FI3A 3QCYA 3VS1A 4ANQA 5BYZA 4KSPA 1F0QA 3FZPA 4E4NA 3N4TA 5DR9A 4RA4A 4TT7A 3MESA 4FNYA 1GIHA 5LVNA 3MGYA 4IDVA 2RFDA 4B4LA 4O91A 2PVKA 4AZSA 3PXQA 5IQFA 4L6QA 2XNPA 3UG2A 4IZAA 3QZGA 4X6RA 3SXSA 2R3KA 3V5QA 5DR2A 4BTMA 1XH7A 3Q9XA 3QL8A 2OICA 4BWKA 4D9UA 3UQGA 1WBVA 4YMJA 1BL6A 4ERWA 3ANRA 4YUQA 4E5AX 2WQMA 5JGAA 3AD5A 5D9HA 3E88A 3LW0A 4CG9A 5ETCA 4GEOA 1W82A 3H10A 5KUPA 4M84A 3RVGA 4QPAA 3MV5A 4FSZA 4FZFB 4HYUA 4X3JA 3PY0A 4NTTA 3EZVA 4JAIA 2C0TA 3R83A 2YM8A 5L3AA 4ZJJA 3ACKA 4KIKA 2HENA 3GFEA 4AFEA 4WRSA 5C26A 2JKMA 2E9NA 5F1ZA 5JKGA 4JBPA 4TL0A 2IVSA 3Q9ZA 4QP8A 3TV6A 2JBOA 4ZZNA 3WF5A 5IQGA 5GZAA 3GCVA 2VX0A 3I5ZA 1NW1A 3HMOA 2GHLA 2OG8A 1W7HA 2J7TA 4DLIA 2ERKA 4IVCA 4RJ8A 2RG6A 3EKNA 3L8XA 3HL7A 4RJ3A 4KKHA 4RRVA 5DPVA 5C9CA 3VUHA 2YIWA 4E8AA 2X2MA 4EZ7A 2FYSA 3O23A 4AP7A 4F9YA 4Y5QA 4YTIA 2OF4A 3K5VA 4XRLA 4DA5A 4JX3A 4AT4A 4DEGA 2G1TA 3ZTXA 4U3ZA 3TIYA 2PMIA 4E73A 4GL9A 4WRGA 5AM7A 2QOKA 4HZRA 3R8MA 4XEYA 5GZ8A 3FPMA 1ERKA 1UWHA 2AUHA 2C5VA 2JFMA 4M66A 5AMNA 5FTQA 3V8SA 4CFNA 4ACDA 4EKKA 4LMUA 4DT9A 4LFIA 3LFFA 4C57A 2UW0A 2C0OA 5IUIA 3OWPA 2G2FA 5FLFA 3RZFA 3WIGA 5AUTA 2BDJA 5CLPA 4ZTRA 5HGIA 5KMJA 3G0EA 1FBNA 2OXYA 2XNOA 1RQQA 5EKNA 3IW5A 2GQRA 5CSPA 2GQSA 2O65A 4L68A 4TXCA 5CU0A 5GINE 3Q32A 3UO5A 3Q2JA 3PIXA 4H36A 3Q2MA 3IGGA 4AT3A 5IEXA 5IG1A 4IACA 3TTIA 2WTKB 2HWOA 4UZDA 4IIRA 5HKMA 2UVZA 3ZRMA 5LWNA 2QOBA 2Y7JA 4BFMA 3KL8A 1H08A 1QPJA 4LOPA 3CBLA 3E92A 4QMSA 3TI1A 4QNYA 5CU4A 5HD7A 3PDTA 4PRJA 4DH7A 2RIOA 5CZIA 3QC4A 4JIKA 3DU8A 4BCGA 2CHLA 4ANBA 3C5IA 4ZSEA 3V04A 4EYMA 2EB2A 4RFMA 1GZKA 2OZAB 3CQEA 4RX9A 4QMMA 4TNBA 5BQ0A 1IR3A 4IM2A 4PY1A 4FTMA 1TQPA 4GFGA 4Z16A 2YACA 5HD4A 2VTQA 3S4QA 2YIQA 1OBDA 1M17A 3GBZA 2ONLC 2JEDA 2R3RA 4BDCA 5JK3A 2NO3A 3PJCA 4QMZA 2CKEA 3KGAA 5TO8A 3EL8A 3NRMA 3DAJA 2VGOA 4I24A 3V5LA 5G6VA 4TZRA 5C03A 2WMBA 5A6NA 4MXYA 4FSWA 4AZFA 4FTCA 2EUFB 5KNJA 3ZBFA 3OCTA 4FIGA 4OTFA 2X9EA 1KUTA 5ANJA 3KC3A 4V0GA 4AN2A 4APPA 5IA4A 4P5QA 1H1PA 2XK8A 2DYLA 5DWRA 3GQIA 3WF8A 3FMMA 4CLIA 2BMCA 3UQCA 1MQBA 1W98A 1YDRE 5L8JA 3TXOA 3TTJA 5IDPA 4R3RA 3D5VA 3P08A 3S00A 4FI1A 4OUCA 5B2LA 2BRBA 3UQFA 5I9WA 5LMBA 4XV9A 1VEBA 3F3WA 3MVHA 3NYVA 2HCKA 4S32A 3VW8A 4F08A 2HZ0A 2UZTA 3KK9A 2GU8A 2C6DA 4RIXB 4O0RA 3BWFA 3ORLA 4YJNA 5AR4A 3FZTA 3VAPA 3W8QA 4W8DA 3BU3A 2VWWA 4AA5A 3TUDA 1F3MC 2UZEA 3F66A 4ZP5A 3MPMA 4F6SA 5BVKA 4NKAA 2YJRA 4P90A 3EFKA 3OW3A 3VRZA 4CVAA 4EHGA 4TYJA 3W18A 3O8PA 3OZ6A 4FKTA 5EG3A 4WT6A 3KCFA 5HQ0A 3P79A 4DH5A 3EFLA 3JPVA 4GH2A 3MTLA 5HLPA 1PXJA 1ZOGA 2X81A 5J1WA 4A9UA 3FL4A 3LFBA 2R3GA 4EOOA 4CYJA 4X2FA 4A9RA 3NUAA 4O0SA 4BB4A 3RNIA 4BKJA 4NSTA 4YZMA 3TNHA 3C4ZA 3FMJA 4WOVA 4F63A 3FXZA 4F64A 1IAJA 4CZTA 4JQEA 2F49A 2YN8A 2W1DA 5IF1A 1XH8A 2VTNA 3CS9A 1KOBA 3HNGA 2B9JA 4PDYA 3L9LA 4PWNA 5K0XA 1GIIA 4ZJIA 5J87A 5CAPA 3QXPA 3PSBA 5CEIA 3RCDA 5E4HA 4BCMA 2CCHA 4FKQA 2QU6A 3N4VA 1SYKA 4L52A 1PY5A 3PJ1A 5JGDA 1Q62A 4AG8A 4ZS4A 5IU2A 2Z02A 2VO6A 3PP1A 4CMOA 2ITYA 4ITJA 3KRJA 4HVSA 1PXNA 2VTHA 3G6HA 5I9YA 4AZTA 3GEQA 2VTIA 3PIYA 3QRUA 4C3RA 4FV6A 3BHVA 3OW4A 5L6WL 3VRYA 3IS5A 4X6QC 5CU3A 2W5AA 4YO6A 5D12A 2W5HA 3ZOSA 4CGAA 1JQHA 2BFXA 2XS0A 4D5HA 2X0GA 3EKKA 4UN0C 4D2WA 2CNUA 4DF3A 2QR8A 1OL1A 3PXYA 1RDQE 5AUWA 3UYSA 3LCTA 5FTOA 3O8TA 1JNKA 3HECA 5A4LA 3ZO1A 4D5KA 3M42A 4YJSA 4QTDA 2IW6A 5AP4A 3F9NA 4BTJA 4I1ZA 2UW6A 5M55A 2W9ZB 2R3QA 4EEVA 1NA7A 2VTTA 4U43A 4XJ0A 3U87A 2DUVA 4X0MA 3I60A 4TN6A 1PMNA 4E7WA 3IW8A 4QPMA 4QT1A 3W8LA 4CRLA 1DM2A 1GZNA 1REJA 2E9PA 4NM3A 4QMLA 2PUIA 2PYWA 3DJ6A 5HBHA 4EYJA 3ZH8A 2YCSA 4E6CA 4D4YA 5FDXA 4IHPA 3KEXA 4YLKA 2IG7A 4QMPA 3ZRKA 5C1QB 4WG3A 2VUWA 3VIDA 2Y9QA 3W2RA 1Y91A 2Z2WA 3KN6A 1YI3A 3EQGA 5AP6A 2J6MA 3I5NA 5HI2A 3F7ZA 5LCJA 4O2ZA 4IANA 3R9OA 1GOLA 3SLSA 5HEZA 3UZPA 3OWKA 1UVRA 3ZYAA 5AAGA 2WMXA 3LFNA 1S9IA 3TNQB 2YA9A 3MYGA 4LQMA 4AU8A 4XG8A 3R8ZA 5L6PA 3IECA 5IPJA 3MA6A 5BUIA 4OW8A 3U4UA 3VS3A 4BN1A 5CSWA 3A60A 3BCEA 4E1ZA 5CEKA 2BALA 4A4OA 3LCKA 3G6GA 2J0LA 1IEPA 4G17A 5FM2A 4CKJA 3RMFA 2WTCA 3DTWA 3HV7A 1URWA 4AGCA 2XRUA 2C6IA 3R1SA 3A7IA 3ORTA 4FX3A 4ZIMA 3VS2A 2EU9A 1SVHA 1M7NA 1NXKA 4Q5EA 4RVKA 3QRJA 5LCKA 3PXZA 3PA5A 1WAKA 2C68A 3WI6A 5KMNA 3R02A 3NGAA 3A7FA 4QQ5A 4PPBA 4U44A 2ZMDA 4YO4A 3R73A 2VO7A 4OTRA 4YZNA 5DLSA 1ZXEA 3PG1A 2XK7A 3DZQA 3OEZA 2OIBA 4I6QA 3L1SA 4DG2E 1ZYJA 3PVUA 4BDHA 5AA8A 3V8TA 4TYEA 3CGOA 3P23A 2ZV8A 2J0JA 4JBOA 2HW7A 2R4BA 5EI8A 4AN9A 4QMYA 1KOAA 3COHA 4HVIA 3B2WA 3BPRA 3NAXA 4JI9A 1ZOEA 4EI4A 3EYGA 4DFNA 3SHEA 4PTGA 3MFRA 2YITA 4BWXA 3RM6A 3C4CA 2XYNA 1UU9A 3Q4CA 2WMQA 1WMKA 4HYSA 3COIA 3RHKA 3Q6UA 5HVYA 5LMKA 5AUZA 2WMWA 1ZYCA 2XJ1A 3OT3A 3TN8A 3WILA 4E5WA 3RALA 1FMKA 1SMHA 2X9FA 3I7CA 4EZ3A 5I5ZA 3IO7A 3REPA 3QQJA 4F4PA 4R7BA 2W96B 5KKRB 3POOA 4NM0A 1O9UA 2GTNA 4ZSAA 1UA2A 3NW5A 4GK2A 2W4KA 3BHHA 3ENMA 4RC3A 2ZB0A 3NUUA 4LRMA 3O51A 1DAWA 2H34A 2CKOA 4FZAB 3DDPA 4NZWB 2ZM3A 4IM0A 5C8MA 4AZEA 4BDAA 4UMPA 4H3BA 3NYNA 4FV2A 4HVHA 3LZBA 1OM1A 4GYGA 2HY81 4OGRA 4V04A 2PE2A 1XHAA 2WTIA 3A4OX 3E7VA 4YU2A 2FSOX 3GCQA 3HKOA 2VGPA 1H01A 3IW4A 3DK3A 4TWPA 3E5AA 1OIQA 3F5UA 3L9MA 5F94A 2GMXA 3C0GA 4RT7A 4CFVA 5JFWA 5HCZA 3ZLXA 3F88A 3NIEA 3FLYA 4FKLA 3MA3A 4H1JA 4YTCA 4KIOA 2ITPA 4BCIA 3IKAA 3Q9WA 4CV9A 3LJ2A 2PU8A 1G8SA 4Q9SA 4FT7A 4GT3A 2G9XA 3IW6A 1H0VA 3EQDA 3A8WA 1XH6A 3DJ5A 4ITIA 4KA3A 3W2QA 3CE3A 5DA3A 4TWNA 3BHTA 3ZSIA 1V0PA 4RX8A 3GU6A 3RPYA 4ZY5A 5KBRA 2C6OA 3GFWA 2WELA 2YABA 4CKIA 1XO2B 4J71A 2FGIA 1BI7A 3QGWA 4ZLZA 5J95A 4X7QA 4MKCA 4DEAA 2ZV9A 2P55A 2HYYA 4WO5A 2F57A 5DT0A 4BI1A 4ALUA 3R8PA 5CF6A 2ETKA 3LXNA 2PVHA 3FBVA 4RJ5A 2IWIA 2YZAA 5HIBA 1H4LA 2ZJWA 3EWHA 3GQLA 2BFYA 2C5NA 3AC1A 5CY3A 4ZLOA 2HOGA 3QAME 2PVRA 5HTIA 2QKWB 4O82A 2W17A 3CQUA 2C69A 3BHUA 3QKKA 4PMTA 2IVTA 3VBQA 5CX9A 1UV5A 3R6XA 2OGVA 2XIKA 4U80A 2WU6A 3LQ8A 3H3CA 2FVDA 5EKOA 4C33A 2VNWA 5EOBA 3HEGA 1JSVA 5GJGA 3PG3A 3I7BA 4IWOA 3VJOA 2V7AA 4F6UA 1M2QA 3QQKA 4E4XA 4LYNA 3VUKA 4J7BA 4X2KA 3TDWA 2CSNA 2O3PA 3CPCA 4MBJA 2R3HA 4UY9A 3GC9A 2WQNA 3DKFA 4IDTA 1FGKA 5AR7A 1CTPE 3TT0A 5A46A 3CKXA 1WBOA 4XLIA 3R01A 2J51A 2YERA 4S33A 5K4IA 1RJBA 3PA3A 3DJ7A 4DEDA 4FK6A 5EW8A 2J50A 5E7RA 4EBWA 3PVWA 3NX8A 3PVBA 2I0YA 3NYXA 4YZ9A 3S0OA 5M51A 5CI7A 2FUMA 3E3PA 3R9RA 3AD6A 5EI6A 2O5KA 1QMZA 2ITUA 4MWHA 4KINA 4UXQA 4HGSA 3DV3A 4J96A 1LP4A 1KE8A 4O1OA 2IZTA 2G15A 4I23A 1XR1A 3TNIA 5CF4A 5IISA 5CXHA 4L43A 4NFNA 4P7EA 4LUEA 2QOCA 4BCQA 1H8FA 4QMVA 3SGCA 5AUXA 2RFSA 4KBCA 3DAEA 2GNGA 3GU8A 4OT5A 4DFLA 2OW3A 5K5XA 5GJDA 3M1SA 4BY9E 3HRCA 3QUPA 1G8AA 4MD9E 4G9CA 3EQRA 2Q0NA 4MQ2A 3ZU7A 4FT3A 4KAOA 1O6KA 4L45A 4EK3A 3SG8A 4XH6A 4GYIA 4OTQA 4YHJA 2QOIA 1OL6A 4BDFA 3EQIA 2CGXA 3FLQA 4LGGA 4YP8A 3D5WA 4K9YA 5L8KA 4WD5A 5M56A 4AGUA 2HXQA 3RK5A 3TUBA 3BKBA 4X2NA 5IZFA 1NVSA 2X6DA 3HP5A 3SOAA 4FSNA 1WVYA 3DK6A 4FYOA 4GK4A 5F20A 3VF9A 2ZV7A 4XG3A 3Q4UA 3UC4A 3OF0A 4Z3VA 3DA6A 2Q0BA 2HWPA 4I4FA 3DXQA 2X6EA 3PXRA 5FEQA 3MPTA 2PUUA 4XG6A 3Q52A 5TF9A 2EWAA 5KX8A 1LUFA 3TZ7A 3DBFA 4R8QA 4FV5A 1OKVA 3AC4A 3TG1A 3P7AA 2VX3A 4FR4A 4YJRA 1A9UA 2B9HA 3KXGA 1ZZLA 4FGBA 5HIDA 4IB5A 3ZSGA 5M4UA 4QP2A 4F9CA 3MI9A 4AQCA 5FXSA 4FGRA 1ZRZA 4K8AA 2BKZA 4I0SA 2ITWA 4OTHA 1Q3WA 1UKHA 1H28A 3MY5A 1TQMA 3RNYA 3V51A 2HIWA 3JY9A 2SRCA 5FWKK 2P2IA 3HLLA 3WBLA 4L46A 1OECA 3CY2A 3UVPA 3B8QA 3DOGA 5D10A 4DHFA 2C30A 3MVLA 2KTYA 5EQPA 4MNEA 2CNQA 3UNKA 1R0EA 2OZOA 3QZIA 2W05A 3E8DA 1RE8A 4QP9A 3BV2A 4FEXA 2ITZA 4D28A 1X8BA 4I6HA 4V01A 3VBVA 1GJOA 3RBWA 2W1GA 3DT1A 2ZV2A 5CS6A 3UIXA 2FSTX 4Z9LA 3W1FA 3CIKA 4W9XA 3BWJA 2YM6A 4FT9A 1PXKA 1VJYA 5EM8A 3W33A 3FZSA 3I0QA 2VWUA 3PPKA 3KXNA 4GMYA 1YHWA 2A0CX 3I6WA 4IX5A 3UVRA 3GGFA 3OS3A 3DKOA 5FBOA 4IX6A 4MQ1A 4E6AA 4QMNA 1T45A 3DZOA 4F09A 3ZUTA 1YXTA 2XUUA 4MCVA 1ZZ2A 3ETAA 5CNNA 2QKRA 3RINA 3BLQA 1PKGA 3NUPA 4RJ7A 4IBMA 3ET7A 5ANGA 5AEPA 5JZNA 3QTIA 3CP9A 1Z9XA 3MB7A 4X3FB 2IZUA 4BCOA 4F70A 4FUXA 3L8VA 4X2GA 1YHSA 4E93A 2JKOA 3FSFA 4W4WA 3ZEWA 2VTRA 3KULB 2GDOA 4N0SA 3MW1A 1R3CA 4AW5A 4EC9A 2RF9A 1F5QA 3O96A 3QYWA 3UPZA 1YI6A 4JL9A 4EH4A 1T46A 2WU7A 3CTJA 4XX9A 1YOMA 3OXTA 4O6LA 4RIWA 4NM5A 2PMLX 5CSXA 3SAYA 4ORKA 3O50A 1M2PA 5C4LA 4EOJA 3IQ7A 4FTLA 4P2KA 2X8DA 4Y83A 2WOUA 4AACA 4I21A 3HV5A 2GS7A 3PUPA 3R7OA 2C47A 1WVWA 3E7OA 1H26A 3C0HA 5LVPA 3IPHA 2RG5A 4IAAA 4UB7A 4CV8A 3LXKA 5KKRC 4LGHA 5F9EA 3A7GA 3MY1A 5JFXA 4QMWA 4JOAA 2QURA 3UP2A 2CPKE 2GNHA 2HELA 4QMQA 2PVLA 3F7WA 3P7BA 2E9OA 3BE9A 2YDIA 5IQAA 3VJNA 4I20A 2BUJA 2VNYA 3CXWA 3MVJA 3QALE 4NK9A 2BCJA 2J2IB 4Y95A 4BKYA 4EH5A 1BL7A 4IZ7A 4ERKA 3BBTB 4GSBA 4YTFA 1ZYLA 4QYGA 1B38A 5K5NA 5AM6A 4QQTA 4PV0A 3QUEA 4OTWA 3CQWA 2XEZA 4PL3A 4GUEA 4I3ZA 4DEBA 2OIQA 4G3GA 4MWIA 3ZDUA 4FODA 5I0BA 4ACHA 5JFSA 5JH6A 3U6JA 1OIUA 4WG5A 4IEBA 4MXXA 5G1XA 1FQ1B 3SKCA 3HMMA 5IUGA 5M08A 2I1MA 4AA0A 5E8XA 3BX5A 4FL1A 2R0UA 1PXIA 4ACGA 4EUUA 2VTLA 3BGQA 4HGLA 4K33A 4NIFB 2E2BA 2EXEA 3NNVA 4O84A 3BU6A 4CFUA 2XZSA 1OPLA 4F9AA 5CSVA 1DAYA 4U7ZA 3MB6A 4PPCA 3JYAA 4BRXA 5AP3A 5IA5A 5AADA 3ALNA 4TKSA 5HG7A 4I0RA 3TZMA 4U45A 4RLKA 1UKIA 4GCJA 3MPAA 1OPJA 3MDYA 2ITTA 5CAVA 3NUXA 4NM7A 2IN6A 1MP8A 5ITAA 5IDNA 3KXZA 2X8EA 5GJFA 4WNPA 2YFXA 5EDRA 1Y6AA 3AC5A 4BDDA 1JVPP 4RVLA 2WTDA 3BV3A 3PPJA 4XBUA 3CY3A 1SVGA 4F0IA 4DE4A 4H39A 2W1CA 3BQRA 4Z7GA 2CN5A 4CFFA 3F2RA 4ITHA 5HHWA 2BTRA 3LQ5A 2PULA 3FMDA 3HRBA 3H9OA 4DT8A 4EJ7A 2GCDA 4HNFA 4XCUA 2ZDTA 4DGMA 1ZOHA 5CF5A 3BYUA 2CN8A 5D11A 3AT3A 3IDCA 4DAWA 1P4OA 3V5JA 4EQMA 4FTIA 2WQEA 4D1XA 2C0IA 5IA0A 5KMMA 2OWBA 4ACCA 3PYYA 4F65A 3GC0A 3R28A 3RPRA 3QD0A 4LM5A 5F95A 5A4CA 3BHYA 3SV0A 1YW2A 3E93A 2ZM4A 3UODA 3GUBA 3ZLWA 3DKCA 3ZUVA 4FL2A 4PP7A 3FMNA 4N70A 5DHJA 3HGKA 5AUVA 5HNBA 4BBFA 2C4GA 4L44A 2IW8A 4I4EA 2BZIB 2J0IA 2OIDA 3ORZA 3QZFA 3UOJA 3R22A 2XK3A 4WSQA 2H8HA 4CEGA 4NW5A 4WNOA 4G1WA 5A3XA 1W84A 4EL9A 3FXXA 4XHKB 4JDJA 5I9XA 2X7OA 3MTFA 1H1WA 3SC1A 2CKPA 4FTJA 4J8NA 1SZMA 4PL5A 5DRBA 4PTCA 5CSHA 3ZZEA 4LGDA 4M13A 3FI4A 5IUHA 5L4QA 3DQXA 1I09A 3C13A 4JDIA 4NH1A 5DNRA 4B8MA 4GFMA 2UW8A 4ZZMA 3D7TB 3H9RA 3JVSA 1U46A 2UW4A 3LM0A 1B39A 2AC3A 4I22A 2A2AA 4MNFA 3EH9A 1XH4A 4YPDA 2C3LA 4EOKA 2GSFA 2B54A 4BHNA 3P4KA 2QLUA 3QYZA 2JD5A 1JAMA 3DK7A 4O0VA 4WA9A 4GRBA 5AAFA 5J7BA 4O86A 3AOXA 2OH0E 2OXXA 3FEGA 3U55A 4XBRA 4PQNA 4F7SA 4IE9A 3NUSA 3OUKA 2W1FA 3F61A 5H8BA 3O17A 5EDPA 5AIKA 4L3PA 4HGTA 3CSVA 2J0KA 3TKUA 2Z7QA 4GK3A 3VVHA 2ZB1A 2B1PA 3FE3A 4D0WA 5CYIA 3V01A 5ANOA 3VUIA 1YXVA 2HZ4A 5E90A 4RIXA 4IC7A 3QQUA 2VAGA 4NJDA 4FTKA 2YLEA 5I9ZA 2YZLA 4EKLA 4Y5HA 5TE0A 3UJGA 1XH5A 3VS4A 4BCJA 4BZNA 4C3FA 4G3EA 4LRKA 3QA0A 4QTEA 3LCDA 4U97A 2XCKA 3MY0A 4E4LA 5DH3A 4W9WA 5HO6A 4D2TA 2YIXA 2FA2A 4OAVB 4DEIA 3MH3A 4G2FA 5HIEA 3OC1A 1XBCA 4M0YA 3ULIA 1GZOA 2V0DA 2OFVA 4MXAA 4J98A 4QMOA 5EW3A 2PSQA 4FF8A 2W1EA 5DG5A 2ERZE 4C58A 2CGUA 4FG7A 4C8BA 2JC6A 3R63A 4TYIA 3FKNA 4FKJA 5CQUA 5AV3A 4CCUA 4GIHA 4R7IA 4M69B 2NRYA 1WVXA 3PY1A 2XK4A 3C4FA 4JVGA 4F7LA 1FOTA 5AX3A 3FHIA 5DYJA 5D41A 3HA6A 1P4FA 4TWCA 3QRKA 4WNKA 2RL5A 4FSQA 3PJ8A 5ACKA 1Q24A 2VTJA 1YXXA 1YI4A 3HRFA 3OXIA 3VBWA 4PMSA 2NNWB 4MTAA 1LEWA 2VWZA 2IZRA 5GIOE 2QOQA 2VTSA 3OWLA 3I6UA 4C4GA 4ZMFA 2X7GA 4ONAA 1JKTA 4J52A 1FVVA 3IOKA 4G31A 2IJMA 5E91A 3QQGA 4CFWA 4BR3A 3D83A 5IMEA 4EH2A 1Q8TA 3EIDA 3PXFA 3CCNA 2F7EE 3FMEA 4JJRA 1JLUE 4QYFA 4X3FC 4D2SA 4M97A 2OJGA 5I3RA 1BUHA 2JIUA 3EQFA 3KCKA 5D1JA 4FT5A 1GAGA 1MRYA 3Q4TA 3RP9A 5DT4A 3ORKA 4F7JA 3HP2A 1BLXA 5BVEA 2ITNA 5K0KA 3DCVA 3C5UA 1HOWA 4JQ7A 1CSNA 3G9NA 4L7FA 4JNWA 5E8SA 3VS5A 3MH1A 4IC8A 3RAKA 4KUJA 5E8TA 3TIZA 1ZY4A 3OD6X 3ZDIA 5BUEA 4KBKA 1KE7A 3OCGA 3CTQA 4FV4A 2GTMA 4A9SA 4DBXA 4W8EA 5C4KA 3QCQA 2O63A 4UEUA 4WHZA 4L67A 4C2WA 2QHMA 4EH8A 4BI2A 2QD9A 3BU5A 4V0GB 3P86A 2W9FB 4WBOA 3U54A 1AGWA 4BKZA 2XJ2A 3G90X 3LXPA 2GPHA 3JUHA 3CD8A 3TACA 5LWMA 4CG8A 2O2UA 5HTBA 2BHHA 1KE9A 3PE1A 2V22A 5FRIA 4ANMA 3SRVB 4M7IA 2R7IA 3NEWA 5IQHA 3FV8A 3VW6A 5CEMA 4O7NA 3R8UA 1PW2A 4YLJA 5FXRA 4GJ3A 5L2WA 5KMLA 4Y85A 1FGIA 4G3FA 4NCTC 4Q5HA 4FKPA 5K4JA 2OFUA 5DT3A 3G15A 4DGGA 4CZUA 2XH5A 4P4CA 2B9FA 2WQBA 4JXFA 1PYXA 3KXXA 4YJUA 5AFVA 2J0MB 4D4SA 4FTQA 3LJ0A 4UMTA 3KF7A 2ZDUA 4IVDA 1KV2A 4BCKA 4QD6A 2RFNA 4YHFA 4A4LA 3QGYA 2VRXA 4FOBA 1Q8UA 3DGKA 1NT2A 1OIYA 4OT6A 1UU7A 3LXLA 3BYMA 5IMXA 3MFSA 4I6FA 4J99A 3F2AA 3VO3A 4FSTA 2BAJA 5AR5A 3F69A 1OKZA 4RZVA 4M12A 3L8PA 5HU9A 4DCAA 2JFLA 1UNLA 2QOOA 2WMAA 3PWDA 4LOOA 4G3DA 3VHEA 2WTWA 3L8SA 4KS7A 2HZIA 3VBTA 4FSYA 4PL4A 2I0HA 1ATPE 4R5YA 3EQBA 3DY7A 3W16A 5A4QA 4QTCA 5M57A 3RM7A 4X2JA 3OEFX 3W2OA 1XKKA 2QOLA 3UE4A 2XKCA 4FNWA 4OTIA 1GIJA 1LEZA 3NUNA 4YNOA 3S1HA 1BKXA 2PHKA 5TKDA 3R8LA 3EQHA 3SQQA 1PMVA 5DE2A 2PMNX 5TT7A 3II5A 3I79A 3VQUA 4Q2AA 3ZHPC 1XH9A 3OCBA 1JKKA 4LV8A 5CXZA 4MK0A 1Q41A 4DFXE 1PXLA 4YPSA 3NWWA 4G5PA 5DVRA 3NNXA 3HV6A 4AF3A 5FBNC 2CGVA 2I0VA 4FIFA 4GG7A 4O7ZA 1U54A 3FLWA 2QO7A 1OZ1A 4HGEA 4YLLA 5EHLA 2UZWE 2F9GA 2F7ZE 3LFAA 3R2YA 2F2UA 4J1RA 3EFWA 3FJQE 3UBDA 5EDQA 3UOKA 3EQPA 4RA5A 5AX9A 4AXAA 4D58A 4IJPA 4CRSA 4D0XA 3ZLSA 5GNKA 2R3PA 3PSCA 3QD3A 2JDRA 3W2CA 5J5TA 2FH9A 4I92A 4BIBA 1V1KA 2XKDA 4NYEA 3D5XA 4JBQA 3CPBA 2GS2A 4S2ZA 4BIDA 4FV1A 4YR8A 4WNMA 5CU2A 1O6LA 2XNGA 2UZBA 5A54A 1HCKA 2EXMA 3C51A 4EOIA 1FMOE 4BCPA 5H2UA 5IH4A 1JPAA 4FICA 3NVMB 4EH3A 2XCHA 3KQ7A 1OB3A 5I3OA 4BCNA 4QYEA 5M44A 4YBJA 4YJOA 3PRFA 4DN5A 4GV1A 4QQCA 2WTKC 3R7IA 4IB1A 3QF9A 2Y6MA 3UZTA 3OBJA 3L9NA 4L8MA 2GFCA 3ODYX 2VX1A 4HVGA 2W06A 3ZO4A 1WBPA 4RJ6A 5AP0A 3AMYA 3DLSA 3V5PA 4HCUA 5ICPA 3LOKA 4IZYA 4DEHA 1YOLA 2V55A 1IA9A 2XA4A 3FMHA 3NYOA 3ZUUA 2GS6A 3TKHA 5JQ5A 4FZ6A 3GVUA 3TCPA 5HLNA 1WCCA 3CLYA 1JOWB 4IXPA 4R1YA 2ITXA 5GHVA 4EHZA 4KNBA 5LMAA 1G5SA 2ZYBA 4DGNA 2QOFA 2BR1A 3IW7A 2VO0A 3FLSA 3FQHA 3P1AA 2WTJA 5HBEA 2BHEA 4JQ8A 2XK9A 5DGZA 4EQUA 3QHWA 4XLVA 5FM3A 5FG8A 4TWOA 4JDKA 3VUDA 4C34A 3UZRA 3C4EA 4YGAA 2OF2A 4RQVA 4DH8A 1OL5A 4ZK5A 4O7LA 1HCLA 2Y8OA 4H05A 4F9WA 3CJGA 4EBVA 4FA2A 2X4FA 3UYTA 3UIBA 3ZO2A 4PF4A 5L2SA 3A8XA 4EJNA 3POZA 5EM6A 3MIYA 3G33A 4BF2A 3NPCA 4FTRA 4RMZA 3ERKA 5HVKA 2X2KA 4QRCA 4XUFA 3UC3A 3H0YA 3R0TA 5JT2A 4C4EA 4IADA 4E26A 3G51A 2XBJA 3MJ2A 4BGHA 3NNUA 4Z7HA 3ZS5A 5BMMA 1YWRA 4W4VA 3EFJA 3FC2A 4DITA 1OI9A 2I6LA 4WUAA 2CCIA 3BQCA 5A9UA 3PXKA 4TY1A 3HVCA 3TM0A 1V0BA 4BZOA 1CM8A 3UNZA 3Q6WA 3RKBA 2C6TA 3QKLA 3B8RA 4FZ7A 4RWKA 4DFYA 4F6WA 3PLAE 4HPTE 1H27A 2WGJA 2YJSA 3ROYA 2VWVA 2JIVA 3OMVA 1J1BA 5M4FA 4UWBA 5E8UA 1KV1A 2A19B 3BELA 4O7VA 3HDMA 5LXMA 4FKVA 2LAVA 2OJIA 4ALWA 1CMKE 4BYJA 5J8IA 3DAKA 3KB7A 3RWQA 2PZIA 3MVMA 5EYDA 4G5JA 4ZEGA 4C61A 3U6HA 1MQ4A 2I7QA 4O83A 5L8LA 3C4WA 5HO8A 4FEVA 3KA0A 2VWYA 3DNEA 4R5SA 5KCVA 3Q4ZA 4WUNA 4ZSLA 4CMTA 4QYHA 2G01A 2AYPA 3FY2A 3HUCA 3UO6A 3GNIB 3OHTA 2VTPA 5E1SA 1Q99A 1QL6A 3FZ1A 2WXVA 4O96A 3ORNA 3OOGA 4AW1A 2C1AA 1YQJA 3FDNA 2QI8A 2YISA 3TUCA 3SA0A 2PPQA 4EH7A 2JBPA 3E64A 3GI3A 3NCGA 4IFGA 5IQIA 4LOQA 1PXOA 4KKGA 5B2MA 3ZFMA 2WMSA 3S2PA 2JKQA 2C5OA 3ITZA 4Y46A 2GNIA 2FSLX 3MSSA 2UZDA 2C5YA 4E5BA 1Y6BA 2QODA 3T3UA 5A4EA 4O0WA 3FQSA 3OY3A 1H24A 1K3AA 3LJ1A 5IA3A 4DTKA 3I81A 2VTMA 2FB8A 3D5UA 4XV3A 3ZM4A 4A4XA 4FG8A 2ONLA 3P78A 2XNBA 3UIUA 2UZVA 2UZLA 3CEKA 5HNIX 3KN5A 2ETMA 2R3IA 2YM7A 4JR7A 3FZRA 2WQOA 1Y8GA 3RTPA 1WBSA 4N57A 4IM3A 5HG8A 5HBJA 1IASA 3RI1A 5CANA 4QPSA 4R3CA 3C0IA 2YIRA 3V3VA 3WE8A 2CMWA 3M2WA 4AA4A 4C36A 2XIZA 4AOTA 4OBPA 4ZXTA 2PUPA 3N9XA 4U40A 4H3PA 3VS0A 2Z7SA 3D9VA 3MN3A 2PWLA 5D7AA 3W10A 3E8CA 4MAOA 3HV4A 4IB0A 4FEQA 4M14A 2XKEA 4FEWA 3DS6A 2OXDA 5HG5A 2WIHA 3COMA 2WEVA 2YDKA 1OITA 5BNJA 3N4UA 3LFEA 4AZVA 3HDNA 1PMUA 3RGFA 2HAKA 4HW7A 4EK6A 1TQIA 1MRVA 4U6RA 2H96A 4JBVA 3RPVA 4DGLC 3DXPA 4ZSJA 4DYMA 4LG4A 5BMSA 3OG7A 5B2KA 2ZAZA 2W0JA 4KB8A 4D55A 4IWPA 4UWYA 2W4OA 1J7UA 4MXCA 1VYZA 2JITA 2QLQA 3LPBA 4R6VA 5J9ZA 2B4SB 2BIYA 3QC9A 4JLCA 3W2SA 3DBQA 4X3FA 1YDSE 3JXWA 3QD2B 5CQWA 1SNXA 1SNUA 4RG0A 2PZPA 3MWUA 2YHVA 3DPKA 4JG7A 5HESA 3V5WA 4DBNA 1OMWA 4TPTA 5LOHA 3FZOA 1KWPA 2XB7A 3BYSA 2OKRA 3KULA 2XIRA 1YWNA 2OK1A 3K5UA 3PTGA 4FUYA 4DGOA 4HYIA 4XOZA 4FV9A 1IRKA 2R7BA 4E6DA 3NIZA 4CKRA 3OROA 5KHXA 4QP4A 4CXAA 4XG2A 2PE1A 3SXFA 5JSMA 5FEEA 2BRNA 4TYHB 1R78A 5E8YA 5EM5A 5L2QA 1E1VA 2VN9A 3ZFXA 2XIYA 4BVUA 1K2PA 1FINA 3F5XA 4BDIA 4R77A 2GQGA 3R7EA 2VU3A 2YM5A 4M0ZA 4A07A 1H25A 2ITVA 2XP2A 4RIOA 4FVQA 3ULZA 4CT2A 2YLFA 3EOCA 4X21A 1YXUA 5HO7A 5M4CA 3G5DA 3SW7A 4NTSA 1YRPA 4R3PA 4CQGA 4LL5A 3Q04A 3PLSA 4IW0A 2REIA 3U9NA 5IEYA 1BMKA 1AQ1A 4UMQA 1J7IA 1Q4LA 3LFCA 4FIHA 1CKJA 4ANLA 3HX4A 1WZYA 1I44A 1VR2A 2RSVA 3CR0A 4NCTA 4C7TA 3VUGA 3FY0A 1U5QA 3LLAA 3P9JA 3KRLA 3VS6A 4D2PA 5IQEA 3UNJA 3A7HA 2HXLA 2QO2A 4FZDB 4RIYB 4N4SA 2R3NA 4L3LA 4LL0A 5CEQA 1Q61A 1UNGA 2QU5A 4KBAA 3EHAA 4F99A 2NRUA 3RCJA 3M11A 4IAFA 1APME 1IG1A 1BI8A 3ZC6A 3O7LB 3QWJA 4RFYA 4RQKA 2VV9A 5HE2A 3HAMA 3T8OA 2B53A 5DEWA 5HTCA 1FVTA 2OI4X 4RWIA 1P5EA 1LPUA 2GHGA 2Y0AA 4L53A 4NIFA 3V6RA 4BC6A 5EQYA 3CKWA 4ASEA 5AV2A 1OUKA 4JAJA 2WZJA 4GFOA 2B52A 4PTEA 3QTZA 4Y72A 5KBQA 4YC8A 3C4XA 2R9SA 3LFDA 4U42A 4O7RA 2X4ZA 3EQCA 3FQEA 4QO9A 3AT4A 4XV1A 1A48A 4GW8A 3NW7A 3ZEPA 1URCA 2PE0A 4G6LA 4XNEA 2PVFA 5FD2A 4GU6A 5CT7A 4F9BA 3ELJA 4FT0A 4IZ5A 5KE0A 4C02A 3PA4A 5L2IA 4FKOA 4FV8A 4O7TA 5FP5A 1WBNA 3G9LX 3HAVA 3EN7A 4E4MA 3W32A 4I0TA 4OAUC 1YWVA 3IGOA 5BVWA 3S95A 4MXOA 5ACBC 1R1WA 1YHVA 4O0TA 4S30A 2R5TA 3BGPA 4D4RA 5J9LA 4MVFA 4EWQA 4ENXA 5M53A 2UVYA 4JG8A 3BBWA 2JDTA 3ATSA 1UU3A 5BYLA 2BDWA 2VWBA 3R7UA 3ZC5A 3AXWA 4YNEA 3UGCA 5FTGA 1H1QA 3GCPA 3AQVA 5M06A 4MHAA 3R9DA 2IPXA 3LE6A 1RW8A 3HMPA 4U9AA 4DH3A 4D9TA 3ZXTA 2WMRA 3ZMMA 4M15A 4G6NA 5DI1A 4EONA 3S3IA 5JEBA 4FVRA 4OBOA 3MBLA 2OLCA 1Q8ZA 5F4NA 1PKDA 5H9BA 3SX9A 3LM5A 2BTSA 4YHTA 5HE0A 1J1CA 5ANIA 3MH0A 3I4BA 3PY3A 4WSYA 4J53A 3WE4A 4MBLA 2R3LA 4D2RA 5KMIA 4M3QA 1OKYA 3KMWA 4BGGA 2WEIA 4PDSA 1QPDA 4L42A 4TW9A 3RWPA 4C4HA 2WPAA 3D2KA 1Z5MA 3L9PA 2YAKA 4AGDA 1CKPA 2QG7A 3UVQA 4ZTQA 3SD0A 2GNLA 4EHEA 3FL5A 2VTAA 3OVVA 4RX7A 3A2CA 3UTOA 4D4VA 1BX6A 4RC4A 4YZCA 3QCXA 1J7LA 1EH4A 5AUUA 2UZNA 1PXPA 2BZHB 4FIIA 3LFSA 4U5JA 3OWJA 3W55A 1ZAOA 2XNEA 2J90A 4WIHA 1W0XC 3KFAA 5CZHA 3A62A 1ZMUA 2B9IA 5T6KA 1H1SA 2VWIA 5HLWA 5KHWA 1XJDA 4U79A 4BZDA 5I4NA 4GKIA 2EXCX 4K2RA 3D7TA 5ETIA 4LUDA 4EOPA 3GU4A 4IAZA 5LQFA 2W5BA 3UG1A 3U6IA 1W83A 3TV4A 4KRCA 3UIMA 3F2NA 3PPZA 3R2BA 3GU7A 4B7TA 4C4JA 5JZJA 4MBIA 5BVFA 3GXLA 3H9FA 1WFCA 4AZWA 1TVOA 4GIIA 3FPQA 3QU0A 3KXMA 4L9IA 3C50A 1H00A 4FNZA 3B2TA 3PE2A 4ZMEA 3NW6A 2W1ZA 2BDFA 2FSMX 4EH9A 2OBJA 4UBAA 2PVMA 2W4JA 2YEXA 5CVFA 5M4IA 2RFEA 2XMYA 3D2IA 5HICA 2OZAA 3QWKA 3TZ9A 3VULA 4ZAUA 5D7VA 4MF0A 3RPOA 3VNTA 4UMRA 2R3MA 3D94A 4DFBA 4NUSA 4OTGA 3LIJA 3E63A 4UX9A 3KVXA 1B6CB 3DTCA 3TV7A 3FI2A
chains in the Genus database with same CATH superfamily
3VQHA 1DS5A 1ZWSA 4TYGA 3DB8A 3R7VA 3R9HA 4FSRA 4DH1A 2EVAA 2ITQA 5CAUA 1PXMA 4JS8A 4WG4A 4A06A 4CFMA 5C8NA 4QMXA 5AP5A 3DQWA 3ENHA 3KRRA 5IH5A 3FKLA 3EN9A 4KIKB 4XV2A 5M09A 4DINA 4CFXA 2P0CA 4F0FA 3EN4A 4IVAA 4BTKA 4C59A 4C62A 1R0PA 1JKLA 4FC0A 1E9HA 1WBWA 4LI5A 1GY3A 2HK5A 2XK6A 4G6OA 4MYGA 5AR8A 4FG9A 5IQDA 1DI8A 3CC6A 3F5GA 5T3QA 2WMVA 3GT8A 4LMNA 4M69A 4CYIA 4PX6A 4CZYB 3PJ2A 2G2HA 4IWQA 2PY3A 4FTNA 4NWMA 1OL7A 4QOXA 1CKIA 1ZY5A 3VBXA 5B0XA 3QLFA 2QR7A 4EK5A 3NVKI 5AP7A 4BCFA 3MFTA 4FSUA 3SOCA 2OU7A 4YJQA 5CT0A 3TNWA 3VF8A 4CLJA 4Z55A 1U59A 5J79A 3K3IA 4JG6A 4HCVA 2QQ7A 3LCSA 4O0XA 5IKWA 4DFZE 5A4TA 3LMHA 4AGWA 3A7JA 5L2TA 5ANDA 3FYJX 3NR9A 4IVBA 5EM7A 5I9UA 4AAAA 3FLNC 3PRIA 4JT3A 5B7VA 3D7ZA 4OBQA 2LGCA 4O1PA 4YJTA 3TZ8A 2C3KA 1L3RE 2A27A 4GT4A 2YM4A 4CD0A 3WYYA 2V62A 3T9IA 3ZZWA 3P0MA 4HZSA 4APCA 2P33A 5T68A 4MX9A 4UXLA 4FKRA 3OTVA 3Q5ZA 3RK9A 5JGBA 5LVLA 4XYFA 1W2FA 5JRSA 4LRJA 2BAQA 5HVJA 1UWJA 4B99A 3MJ1A 5E8WA 1JSTA 4U8ZA 3HMIA 5FDPA 5EOLA 1DI9A 3V6SA 4ASDA 3AT2A 5JN2A 1OGUA 5ETAA 3TEIA 2IVUA 1JSUA 3IOPA 4PUZA 4ARKA 4KWPA 4WBBB 5AA9A 4AUAA 4FYNA 5HOAA 4M67A 5AV0A 2YWPA 4O0UA 3O5AA 3O8UA 3TDVA 4UV0A 2V5QA 4OTDA 2F4JA 3Q53A 4QQJA 3RAWA 4II5A 1G8KA 3RHXA 2JIIA 3F5PA 3DKGA 3RAHA 2UW7A 2ACXA 3SRVA 2IO6A 3QD4A 4BBMA 3LHJA 3OBGA 3C9WA 4ID7A 5C27A 3GU5A 2WKMA 2XBAA 3JS2A 4F0GA 3HUBA 5EQEA 5DIAA 4EOMA 4FEUA 2AC5A 4RVMA 4IB3A 4YTHA 2NP8A 5E92A 2IZSA 3IK3A 1KE5A 4HJOA 2F7XE 2O8YA 3EN5A 4MD7E 4AXFA 3ZCLA 4MD8E 2WD1A 1W8CA 3A4PA 2EB3A 3NAYA 3ORMA 3QHRA 2C6EA 5FQDC 4YSMA 3GC8A 4FSMA 4J95A 3BI6A 5CVGA 3COKA 1U4DA 1ZMVA 1XWSA 3KRWA 2H6DA 4I41A 3WZKA 4YC6A 2GFSA 3Q5IA 2Y6OA 5GZ9A 5A14A 3ID6C 4N6YA 5FEDA 2RGPA 3OY1A 2GNJA 4YZBA 3DDQA 4MEDA 5AV1A 1LR4A 4FKGA 4KABA 4NT4A 3THBA 4CT1A 2VWXA 3OT8A 5IA2A 3EJ1A 4R1VA 4EORA 4B9DA 3GC7A 4FL3A 4EZ5A 4AFJA 4BBEA 3Q96A 3TL8A 4IFCA 1ND4A 3MFUA 5JQ8A 1QPCA 4U81A 3QQFA 2FO0A 3P5KA 4K77A 4NEUA 3RPSA 4R7HA 2BROA 3UP7A 4C0TA 4OR5A 4B6LA 1SVEA 3QLGA 3K2LA 4KIQA 4G16A 4GG5A 4YSJA 2WB8A 4XP2A 4RX5A 4DTBA 2Z8CA 3K54A 3LQ3A 1YDTE 2OJ9A 3F6XA 1JKSA 4UMUA 4IX4A 1QPEA 5AP1A 5DRDA 3MS9A 4HYHA 1MUOA 4QP7A 3VN9A 3LMIA 4YBKA 1CDKA 2XRWA 3KF4A 5C01A 3WF6A 4BICA 4TRLA 3EL7A 3OXZA 3Q60A 3GCSA 3NCZA 2UW9A 1GZ8A 1XBAA 2PVNA 4ANNA 2Q83A 5JMSA 2BZKB 3QTQA 4JR3A 4UALA 5BUJA 3WYXA 3F82A 1VYWA 3AC8A 2JDSA 3O7LD 4BWPA 2R0IA 3PIZA 5KZIA 1AD5A 3FWQA 3BRBA 3D15A 4BL1A 3QX4A 1SM2A 4O4BB 3IG7A 4BCHA 4FV0A 2PTKA 3VUMA 3AG9A 2P2HA 3C1XA 4G9RA 3UDBA 3FUPA 3K3JA 4IX3A 2IVVA 4I6BA 4JX7A 5BYYA 3WZDA 3OP5A 4KKEA 3PJ3A 4HNIA 4ZTMA 2Y4IB 3JR1A 4M8TA 1ZMWA 4GU9A 2NPQA 3PUFC 2WHBA 4O6EA 4A7CA 4S31A 4AOJA 2J9MA 3DFAA 4XRJA 3FC1X 5KMOA 4ZSGA 4DLJA 5DBXA 4O7WA 3KMMA 3R04A 4OLIA 5E8ZA 3E87A 5IQCA 3HA8A 4BDGA 1Q97A 4IAKA 4C4IA 2UZUE 3AC3A 3PZEA 3QFVA 4DEEA 2B0QA 4E3CA 5CNOA 2CKQA 3AMBA 2Z7RA 2R64A 3CJFA 4I5MA 1OKWA 2ITOA 2CLXA 2J4ZA 3EZRA 4HVDA 4BHZA 5L6OA 4DG3E 4RJ4A 5ETFA 5HORA 5LVOA 1G3NA 2C6KA 3R71A 4RWLA 4I5CA 4FTOA 4XP0A 5FP6A 1M52A 3KU2A 2OJFE 2UV2A 5CTPA 3IONA 4ANSA 4AS0A 4YURA 4IAIA 5I9VA 3PWYA 4DFUA 1Z57A 5AUYA 4IWDA 2H9VA 2VO3A 3FHRA 2R3FA 5IA1A 4Y8DA 5JFVA 4RVTA 3RZBA 4CCBA 2O0UA 2A98A 3T3VA 3QTSA 3BGZA 2A1AB 1U5RA 4RSSA 3KREA 2JKKA 1PF8A 3NFGB 4IH8A 5HNGA 2V7OA 3H0ZA 5TOZA 3ORIA 1FVRA 4G34A 3F3TA 2JAVA 2XNMA 4H3QA 1P2AA 4F1MA 5EH0A 3VWAA 1OVEA 5CALA 4RFZA 4AE9A 3W2PA 4USEA 1WBTA 4XG4A 3DLZA 5DFPA 4AE6A 4MF1A 3N51A 4I5PA 1Q8YA 4KD1A 5CAQA 1PRYA 3A61A 4NFMA 2O64A 3NZ0A 3NS9A 3MH2A 4QP6A 4NKSA 1L8TA 3I1AA 2JGZA 4CTCA 2XJ0A 4JRVA 4BDKA 5IEVA 3QKMA 2DQ7X 4E6QA 1NVQA 3BIZA 1YKRA 5ANKA 4O81A 4F1TA 4PPAA 2C6LA 2ETRA 2PZYA 2YDJA 5LJJA 1U54B 3ACJA 3ZM9A 3QZHA 4O38A 3LMGA 4AOIA 4YZDA 4ZS0A 1Q5KA 3TWJA 3LKMA 4NL0A 2HZNA 4AN3A 4EQCA 2WMUA 3GOKA 3HMNA 4K11A 4FVPA 4IAYA 4QYYA 4U3YA 3RJCA 3VBYA 4DTAA 3D0EA 3HZTA 1NY3A 4GVAA 4LV5A 1TKIA 1A06A 2ZVAA 4TNDA 4ASZA 3U8WA 5EW9A 2VZ6A 2C3JA 3KY2A 4DC2A 4EH6A 1V0OA 1KSWA 2YWVA 2BRMA 2E9UA 3U9CA 1ZLTA 4S34A 1Q8WA 3LFQA 2HW6A 4MH7A 5E1EA 4CNHA 1ST0A 2RKUA 2BIKB 2ZM1A 4RBLA 3UOHA 5BX0A 3ZONA 4GKHA 1J3HA 2R3OA 1VZOA 3F3ZA 4IMYA 5AWMA 3QTWA 1ZYSA 3G0FA 4B0GA 3OTUA 5FUTA 3R1YA 3GCUA 4Y73A 4FKSA 2WO6A 2XNNA 4TTHB 3VHKA 1R39A 4BIEA 3MIAA 4C37A 4EHVA 1FPUA 5J9YA 3KXHA 2QC6A 3F3VA 2WIPA 2PUNA 3QX2A 4D1ZA 5HX8A 1PHKA 5CF8A 4UYNA 2C5XA 3FAAA 2XIXA 2Z7LA 3KKVA 5E8VA 3BZ3A 4O22A 4XOYA 5KMKA 4I93A 3C7QA 3UO4A 4EWHA 4U0IA 3WARA 5BVOA 2BKKA 5FGKA 3KVWA 3BEAA 5CEOA 3AD4A 5BPYA 2Z60A 3EYHA 2DS1A 4O0YA 2XYUA 2PZ5A 3E8EA 1J91A 3OOMA 3Q9YA 4XG9A 5DN3A 5HCXA 4C3PA 4EOLA 1KE6A 4UYAA 4GJ2A 2PMOX 4QTAA 2B7AA 4QP3A 4O7YA 5CVHA 3ZFYA 4IQ6A 3WF9A 3IDBA 4XMOA 5J1VA 4GVJA 3FXWA 2XKFA 4ZY4A 2BZJA 2GNFA 1ZARA 4BYIA 1XBBA 3KMUA 3W0MA 4O27B 3E8NA 4XG7A 4PDOA 4E20A 1OBGA 2PZRA 3QCSA 3TKIA 4PP9A 4ZJVA 2HY0A 5C8KA 5HG9A 5FXQA 4ASXA 3CTHA 4JRNA 5KO1A 3UMXA 4K18A 1S9JA 4W4XA 4QP1A 4RC2A 2WAJA 4RGJA 3LCOA 3LLTA 4OTPA 2X2LA 3I0OA 5LVMA 4FE2A 4RPVA 4NJ3A 2J5EA 3NMUF 3H4JA 2UZOA 3PP0A 3UDSA 4QMTA 3ROCA 4C35A 4A9YA 3GB2A 3GP0A 4M68A 3FI8A 2JDOA 2UW3A 2PK9A 5EYMA 4FTAA 3E3BX 3U51A 1H1RA 3QUDA 4FKWA 3BLHA 4RLLA 4L7SA 4FKIA 4ZZOA 3BL7A 3FSKA 3EB0A 5CEPA 1PJKA 4U41A 2CGWA 4ZTSA 3NFFB 3DFCB 4I5HA 2Y4PA 3AGMA 2YCFA 1OUYA 3EN6A 2CLQA 4V05A 3QA8A 2P3GX 3FYKX 5EYCA 4J97A 3EMGA 4FTTA 4D1SA 2C6MA 2PL0A 2XEYA 2IW9A 4L00A 2QCSA 3SDJA 1E1XA 2QVSE 4CQEA 4FV7A 4FIEA 3PVGA 3DB6A 4HOKA 1IA8A 1O6YA 5KZ0A 3UMWA 1H07A 4AW2A 5J5SA 3PFYA 3DXNA 3NSZA 3SXRA 4JDHA 4DG0E 5H8GA 4FMQA 3KRXA 4EK4A 2QONA 2WNTA 3SW4A 2VTOA 3FMLA 3QTRA 2X39A 4ZLYA 2W1IA 1PMEA 2CJMA 3BLRA 2QOHA 4TYHA 2BAKA 1P14A 2OSCA 5K3YA 3R8VA 3WZEA 2OH4A 2A4LA 2BPMA 2YIYA 2E9VA 4KSQA 3HYHA 4FTUA 4GUBA 4P5ZA 5HZNA 4GT5A 3P7CA 2PVJA 5EHOA 5EYKA 1UU8A 4CTBA 3WIKA 3CD3A 3KK8A 4MXZA 5HCYA 2CNVA 1W2DA 1M14A 2QNJA 4FNXA 2Y4IC 4JIAA 4PDPA 5H8EA 4C2VA 2XVDA 3NUYA 5ANEA 5HE1A 5HU3A 4AW0A 2G2IA 3TJCA 4J8MA 2BRHA 1M2RA 3O0GA 4KS8A 4L01A 4EOQA 2CDZA 5CASA 4K6ZA 4AT5A 2YCRA 3O71A 3WZJA 4A9TA 3FMKA 3VS7A 3TYKA 2YM3A 3BYOA 5A6OA 2X7FA 4EC8A 2BILB 3ORXA 3QBNA 5LARA 3AMAA 2AQXA 2YCQA 3JVRA 5K9IA 3VONA 2UW5A 1BYGA 1OL2A 3BE2A 3DNDA 5BVDA 4K0YA 3R30A 5EK7A 2I0EA 5AR3A 4RIYA 3QTXA 2JDVA 2X8IA 4BDBA 3LVPA 1YXSA 4G3CA 4BDEA 4Q9ZA 1REKA 5AJQA 1K9AA 4QTBA 1PYEA 2QO9A 4H1MA 2WTVA 3R7YA 3GOPA 3TJDA 4ZY6A 4FV3A 5DR6A 4FK3A 4NU1A 4HPUE 5DMZA 3O2MA 2BRGA 4PMMA 5E9EA 2C3IB 1UNHA 3OUNB 2UUEA 3ANQA 4DCEA 4FOCA 5CWZA 4HCTA 4XP3A 4CMUA 4ENYA 2W99B 3D4QA 3NNWA 4NW6A 2ZMCA 4L3JA 3DBCA 2JLDA 5BVNA 2WMTA 4AQKA 5J7HA 4FBXA 2WOTA 2I40A 2R2PA 1YOJA 3WZUA 1YVJA 4WKQA 4RWJA 3BEGA 5HE3A 4CSVA 3PZHA 3ALOA 3A99A 4UZHA 3GENA 3BYVA 4PNKA 2W7XA 3LAUA 1H0WA 3JY0A 3R1NA 3ZRLA 3ZBXA 2F2CB 3E62A 3QXOA 2YAAA 3QTUA 1XQZA 5CI6A 5DOSA 3SG9A 4D2VA 1JBPE 2W1HA 1OIRA 4F7NA 3WOWA 2XARA 4BTFA 3HV3A 4ACMA 2C1BA 2QG5A 2VD5A 2IEWA 4ZTHA 2PVYA 3QRTA 5EFQA 4MNEB 3ZO3A 4AWIA 3PSDA 3QQHA 4O21A 1GNGA 4W4YA 3VUTA 5M07A 3QQLA 4ZOGA 3G2FA 3D14A 3DBDA 4PMPA 4XS2A 3Q3BA 4AX8A 3BL9A 5AIRA 1JWHA 3AC2A 4R78A 4ZTLA 1ZYDA 3OFMA 3R9NA 4QNAA 3ZLYA 5CU6A 5DEYA 5EI2A 3ORPA 2OO8X 3UPXA 3DBEA 4FKUA 5H3QA 5AP2A 3AGLA 5AV4A 3T9TA 2JAMA 2WFYA 1Q3DA 4I94A 3NLBA 1M7QA 5IQBA 2XM9A 4USDA 5CENA 3ZXZA 3IDPA 3QRIA 4UWCA 2R3JA 2KULA 3R7GA 4K1BA 4N6ZA 3U4WA 1Y57A 2ESMA 2QHNA 5EHYA 5TR6A 1MRUA 2B55A 2DWBA 4O2PA 4BI0A 5IH6A 4EOSA 3ATTA 4EK8A 1Y8YA 3WF7A 4O7SA 3VC4A 2OJJA 3CGFA 2GHMA 2P4IA 4B8LA 4YJPA 4YC3A 4USFA 1QCFA 4YJVA 2BVAA 2J5FA 5HX6A 1VLRA 4IJ9A 1IAHA 3NDMA 2XF0A 5AR2A 4BGQA 1STCE 4C4FA 4KRDA 4EUTA 4C38A 3ZSHA 4RZWA 4H58A 3FLZA 3ODZX 2XM8A 1OPKA 4ALVA 3RAIA 4FIJA 5AAEA 4KIPA 4PNIA 1NVRA 3OCSA 4RIWB 3SVVA 3FKOA 5GIPE 3TNPC 3UOLA 3V8WA 2ZOQA 4BDJA 4ZTNA 4GS6A 3H30A 5JRQA 3F3UA 5CAOA 3R00A 3V5TA 5LMKC 3R1QA 2UVXA 4QMUA 3RK7A 4F1OA 3PFQA 3R21A 2X1NA 4ANOA 3FI3A 3QCYA 3VS1A 4ANQA 5BYZA 4KSPA 1F0QA 1ST4A 3FZPA 4E4NA 3N4TA 5DR9A 4RA4A 4TT7A 3MESA 4FNYA 1GIHA 5LVNA 3MGYA 4IDVA 2RFDA 4B4LA 4O91A 2PVKA 4AZSA 3PXQA 5IQFA 4L6QA 2XNPA 3UG2A 4IZAA 3QZGA 4X6RA 3SXSA 2R3KA 3V5QA 5DR2A 4BTMA 1XH7A 3Q9XA 3QL8A 2OICA 4BWKA 4D9UA 3UQGA 1WBVA 4YMJA 1BL6A 4ERWA 3ANRA 4YUQA 4E5AX 2WQMA 5JGAA 3AD5A 5D9HA 3E88A 3LW0A 4CG9A 5ETCA 4GEOA 1W82A 3H10A 5KUPA 4M84A 3RVGA 4QPAA 3MV5A 4FSZA 4FZFB 4HYUA 4X3JA 3PY0A 4NTTA 3EZVA 4JAIA 2C0TA 3R83A 2YM8A 5L3AA 4ZJJA 3ACKA 4KIKA 2HENA 3GFEA 4AFEA 4WRSA 5C26A 2JKMA 2E9NA 5F1ZA 5JKGA 4JBPA 4TL0A 2IVSA 3Q9ZA 4QP8A 3TV6A 2JBOA 4ZZNA 3WF5A 5IQGA 5GZAA 3GCVA 2VX0A 3I5ZA 1NW1A 3HMOA 2GHLA 2OG8A 1W7HA 2J7TA 4DLIA 2ERKA 4IVCA 4RJ8A 2RG6A 3EKNA 3L8XA 3HL7A 4RJ3A 4KKHA 4RRVA 5DPVA 5C9CA 3VUHA 2YIWA 4E8AA 2X2MA 4EZ7A 2FYSA 3O23A 4AP7A 4F9YA 4Y5QA 4YTIA 2OF4A 3K5VA 4XRLA 4DA5A 4JX3A 4AT4A 4DEGA 2G1TA 3ZTXA 4U3ZA 3TIYA 2PMIA 4E73A 4GL9A 4WRGA 5AM7A 2QOKA 4HZRA 3R8MA 4XEYA 5GZ8A 2XAOA 3FPMA 1ERKA 1UWHA 2AUHA 2C5VA 2JFMA 4M66A 5AMNA 5FTQA 3V8SA 4CFNA 4ACDA 4EKKA 4LMUA 4DT9A 4LFIA 3LFFA 4C57A 2UW0A 4LDTA 2C0OA 5IUIA 3OWPA 2G2FA 5FLFA 3RZFA 3WIGA 5AUTA 2BDJA 5CLPA 4ZTRA 5HGIA 5KMJA 3G0EA 1FBNA 2OXYA 2XNOA 1RQQA 5EKNA 3IW5A 2GQRA 5CSPA 2GQSA 2O65A 4L68A 4TXCA 5CU0A 5GINE 3Q32A 3UO5A 3Q2JA 3PIXA 4H36A 3Q2MA 3IGGA 4AT3A 5IEXA 5IG1A 4IACA 3TTIA 2WTKB 2HWOA 4UZDA 4IIRA 5HKMA 2UVZA 3ZRMA 5LWNA 2QOBA 2Y7JA 4BFMA 3KL8A 1H08A 1QPJA 4LOPA 3CBLA 3E92A 4QMSA 3TI1A 4QNYA 5CU4A 5HD7A 3PDTA 4PRJA 4DH7A 2RIOA 5CZIA 3QC4A 4JIKA 3DU8A 4BCGA 2CHLA 4ANBA 3C5IA 4ZSEA 3V04A 4EYMA 2EB2A 4RFMA 1GZKA 2OZAB 3CQEA 4RX9A 4QMMA 4TNBA 5BQ0A 1IR3A 4IM2A 4PY1A 4FTMA 1TQPA 4GFGA 4Z16A 2YACA 5HD4A 2VTQA 3S4QA 2YIQA 1OBDA 1M17A 3GBZA 2ONLC 2JEDA 2R3RA 4BDCA 5JK3A 2NO3A 3PJCA 4QMZA 2CKEA 3KGAA 5TO8A 3EL8A 3NRMA 3DAJA 2VGOA 4I24A 3V5LA 5G6VA 4TZRA 5C03A 2WMBA 5A6NA 4MXYA 4FSWA 4AZFA 4FTCA 2EUFB 5KNJA 3ZBFA 3OCTA 4FIGA 4OTFA 2X9EA 1KUTA 5ANJA 3KC3A 4V0GA 4AN2A 4APPA 5IA4A 4P5QA 1H1PA 2XK8A 2DYLA 5DWRA 3GQIA 3WF8A 3FMMA 4CLIA 2BMCA 3UQCA 1MQBA 1W98A 1YDRE 5L8JA 3TXOA 3TTJA 4QDVA 5IDPA 4R3RA 3D5VA 3P08A 3S00A 4FI1A 4OUCA 5B2LA 2BRBA 3UQFA 5I9WA 5LMBA 4XV9A 1VEBA 3F3WA 3MVHA 3NYVA 2HCKA 4S32A 3VW8A 4F08A 2HZ0A 2UZTA 3KK9A 2GU8A 2C6DA 4RIXB 4O0RA 4O4CA 3ORLA 4YJNA 5AR4A 3FZTA 3BWFA 3VAPA 3W8QA 4W8DA 3BU3A 2VWWA 4AA5A 3TUDA 1F3MC 2UZEA 3F66A 4ZP5A 3MPMA 4F6SA 5BVKA 4NKAA 2YJRA 4P90A 3EFKA 3OW3A 4FJVA 3VRZA 4CVAA 4EHGA 4TYJA 3W18A 3O8PA 3OZ6A 4FKTA 5EG3A 4WT6A 3KCFA 5HQ0A 3P79A 4DH5A 3EFLA 3JPVA 4GH2A 3MTLA 5HLPA 1PXJA 1ZOGA 2X81A 5J1WA 4A9UA 3FL4A 3LFBA 2R3GA 4EOOA 4CYJA 4X2FA 4A9RA 3NUAA 4O0SA 4BB4A 3RNIA 4BKJA 4NSTA 4YZMA 3TNHA 2XAMA 3C4ZA 3FMJA 4WOVA 4F63A 3FXZA 4F64A 1IAJA 4CZTA 4JQEA 2F49A 2YN8A 2W1DA 5IF1A 1XH8A 2VTNA 3CS9A 1KOBA 3HNGA 2B9JA 4PDYA 3L9LA 4PWNA 5K0XA 1GIIA 4ZJIA 5J87A 5CAPA 3QXPA 3PSBA 5CEIA 3RCDA 5E4HA 4BCMA 2CCHA 4FKQA 2QU6A 3N4VA 1SYKA 4L52A 1PY5A 3PJ1A 5JGDA 1Q62A 4AG8A 4ZS4A 5IU2A 4DHZA 2Z02A 2VO6A 3PP1A 4CMOA 2ITYA 4ITJA 3KRJA 4HVSA 1PXNA 2VTHA 3G6HA 5I9YA 4AZTA 3GEQA 2VTIA 3PIYA 3QRUA 4C3RA 4FV6A 3BHVA 3OW4A 5L6WL 3VRYA 3IS5A 4X6QC 5CU3A 2W5AA 4YO6A 5D12A 2W5HA 3ZOSA 4CGAA 1JQHA 2BFXA 2XS0A 4D5HA 2X0GA 3EKKA 4UN0C 4D2WA 2CNUA 4DF3A 2QR8A 1OL1A 1TZDA 3PXYA 1RDQE 5AUWA 3UYSA 3LCTA 4QEBA 5FTOA 3O8TA 1JNKA 3HECA 5A4LA 3ZO1A 4D5KA 3M42A 4YJSA 4QTDA 2IW6A 5AP4A 3F9NA 4BTJA 4I1ZA 2UW6A 5M55A 2W9ZB 2R3QA 4EEVA 1NA7A 2VTTA 4U43A 4XJ0A 3U87A 2DUVA 4X0MA 3I60A 4TN6A 1PMNA 4E7WA 3IW8A 4QPMA 4QT1A 3W8LA 4CRLA 1DM2A 1GZNA 1REJA 2E9PA 4NM3A 4QMLA 2PUIA 2PYWA 3DJ6A 5HBHA 4EYJA 3ZH8A 2YCSA 4E6CA 4D4YA 5FDXA 4IHPA 3KEXA 4YLKA 2IG7A 4QMPA 3ZRKA 5C1QB 4WG3A 2VUWA 3VIDA 2Y9QA 1XMMA 3W2RA 1Y91A 2Z2WA 3KN6A 1YI3A 3EQGA 5AP6A 2J6MA 3I5NA 5HI2A 3F7ZA 5LCJA 4O2ZA 4IANA 3R9OA 1GOLA 3SLSA 5HEZA 3UZPA 3OWKA 1UVRA 3ZYAA 5AAGA 2WMXA 3LFNA 3W0NA 1S9IA 3TNQB 2YA9A 3MYGA 4LQMA 4AU8A 4XG8A 3R8ZA 5L6PA 3IECA 5IPJA 3MA6A 5BUIA 4OW8A 3U4UA 3VS3A 4BN1A 5CSWA 3A60A 3BCEA 4E1ZA 5CEKA 2BALA 4A4OA 3LCKA 3G6GA 2J0LA 1IEPA 4G17A 5FM2A 4CKJA 3RMFA 2WTCA 3DTWA 3HV7A 1URWA 4AGCA 2XRUA 2C6IA 3R1SA 3A7IA 3ORTA 4FX3A 4ZIMA 3VS2A 2EU9A 1SVHA 1M7NA 1NXKA 4Q5EA 4RVKA 3QRJA 5LCKA 3PXZA 3PA5A 1WAKA 2C68A 3WI6A 5KMNA 3R02A 3NGAA 3A7FA 4QQ5A 4PPBA 4U44A 2ZMDA 4YO4A 3R73A 2VO7A 4OTRA 4YZNA 5DLSA 1ZXEA 3PG1A 2XK7A 3DZQA 3OEZA 2OIBA 4I6QA 3L1SA 4DG2E 1ZYJA 3PVUA 4BDHA 5AA8A 3V8TA 4TYEA 3CGOA 3P23A 2ZV8A 2J0JA 4JBOA 2HW7A 2R4BA 5EI8A 4AN9A 4QMYA 1KOAA 3COHA 4HVIA 3B2WA 3BPRA 3NAXA 4JI9A 1ZOEA 4EI4A 3EYGA 4DFNA 3SHEA 4PTGA 3MFRA 2YITA 4BWXA 3RM6A 3C4CA 2XYNA 1UU9A 3Q4CA 2WMQA 1WMKA 4HYSA 3COIA 3RHKA 3Q6UA 5HVYA 5LMKA 5AUZA 2WMWA 1ZYCA 2XJ1A 3OT3A 3TN8A 3WILA 4E5WA 3RALA 1FMKA 1SMHA 2X9FA 3I7CA 4EZ3A 5I5ZA 3IO7A 3REPA 3QQJA 4F4PA 4R7BA 2W96B 5KKRB 3POOA 4NM0A 1O9UA 2GTNA 4ZSAA 1UA2A 3NW5A 4GK2A 2W4KA 3BHHA 3ENMA 4RC3A 2ZB0A 3NUUA 4LRMA 3O51A 1DAWA 2H34A 2CKOA 4FZAB 3DDPA 4NZWB 2ZM3A 4IM0A 5C8MA 4AZEA 4BDAA 4UMPA 4H3BA 3NYNA 4FV2A 4HVHA 3LZBA 1OM1A 4GYGA 2HY81 4OGRA 4V04A 2PE2A 1XHAA 2WTIA 3A4OX 3E7VA 4YU2A 2FSOX 3GCQA 3HKOA 2VGPA 1H01A 3IW4A 3DK3A 4TWPA 3E5AA 1OIQA 3F5UA 3L9MA 5F94A 2GMXA 3C0GA 4RT7A 4CFVA 5JFWA 5HCZA 3ZLXA 3F88A 3NIEA 3FLYA 4FKLA 3MA3A 4H1JA 4YTCA 4KIOA 2ITPA 4BCIA 3IKAA 3Q9WA 4CV9A 3LJ2A 2PU8A 1G8SA 4Q9SA 2XANA 4FT7A 4GT3A 2G9XA 3IW6A 1H0VA 3EQDA 3A8WA 1XH6A 3DJ5A 4ITIA 4KA3A 3W2QA 3CE3A 5DA3A 4TWNA 3BHTA 3ZSIA 1V0PA 4RX8A 3GU6A 3RPYA 4ZY5A 5KBRA 2C6OA 3GFWA 2WELA 2YABA 4CKIA 1XO2B 4J71A 2FGIA 1BI7A 3QGWA 4ZLZA 5J95A 4X7QA 4MKCA 4DEAA 2ZV9A 2P55A 2HYYA 4WO5A 2F57A 5DT0A 4BI1A 4ALUA 3R8PA 5CF6A 2ETKA 3LXNA 2PVHA 3FBVA 4RJ5A 2IWIA 2YZAA 5HIBA 1H4LA 2ZJWA 3EWHA 3GQLA 2BFYA 2C5NA 3AC1A 5CY3A 4ZLOA 2HOGA 3QAME 2PVRA 5HTIA 2QKWB 4O82A 2W