3TNIA

Structure of cdk9/cyclin t f241l
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
297
Chain Sequence
b'SVECPFCDEVSKYEKLAKIGQEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 297
sequence length 319
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tniA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tniA01
5J9LA 5TKDA 4CYIA 4DEHA 3FQSA 3Q04A 2PE0A 4F65A 5AR4A 3EN6A 1H25A 1V0PA 3FLZA 4PNKA 3BHHA 3KCFA 3CE3A 2C5YA 4XG8A 3R1YA 4LG4A 5HG5A 4FVPA 3S1HA 5CAOA 1WAKA 3NGAA 4QMMA 3LJ0A 4L44A 4FZ7A 4ERKA 4OBQA 3PE1A 5C4LA 1JOWB 2HZ4A 3B2WA 3CBLA 1JAMA 4Q5EA 2YEXA 3DAEA 4ANQA 2X4FA 1XR1A 3KA0A 4H3QA 4ZJVA 4TRLA 1UU7A 2WTDA 4KRDA 3GB2A 3VC4A 4FIFA 2C0IA 1IG1A 3PJCA 4NIFA 4TYEA 2WEVA 1SMHA 2VN9A 3VRYA 2WGJA 4C38A 5CI6A 4DEGA 5FP5A 2VWWA 2XB7A 5M51A 2A27A 4EORA 3FY0A 3V8TA 4R7IA 4B7TA 1OUYA 2X2LA 3Q4UA 2C1BA 3OTUA 2BUJA 3MN3A 5IA4A 5AUUA 2XBJA 2I0VA 5A4CA 2VTRA 3NZ0A 4ZY4A 3PA4A 1GAGA 4RA4A 2RFEA 3CCNA 4BGQA 1OZ1A 2C6TA 2YJSA 3G6HA 3W2QA 4Z7GA 4RVLA 1CM8A 3H3CA 3K54A 5JSMA 4K2RA 2HY0A 4FR4A 5DMZA 4AN2A 2G01A 4IVBA 2GS6A 1CKJA 3NW5A 4EK8A 5G6VA 4DEDA 4EHGA 4EYMA 2PVRA 4HYIA 4UZDA 5L2TA 4MBJA 4ID7A 4G6LA 3W55A 4QYHA 5CXZA 2B9JA 3D2KA 4FODA 5DRBA 4FEVA 3CIKA 4FG7A 4GW8A 1VEBA 4XRLA 4BDJA 3QU0A 4JDKA 4E4XA 1OPKA 5KHXA 4O7TA 3G2FA 5C4KA 3ALOA 2R3JA 2UZEA 3I60A 4FEUA 4Q9SA 3SW7A 3II5A 2CKQA 3JR1A 4FIGA 5AUVA 1UU9A 4O83A 2J5FA 4I5PA 3COIA 4CFMA 4EI4A 5DT4A 5AUZA 2QODA 4I92A 3UDBA 2PE2A 3W2PA 3NAXA 4J95A 3U55A 3CPCA 3I4BA 4F0GA 1W0XC 4BTFA 2B55A 2JDVA 1STCE 3AG9A 3DU8A 3UO6A 3QD4A 4FTLA 4YZNA 4F6SA 3FZTA 3VQUA 3SOCA 3QD0A 3MVMA 3V6SA 3JVSA 4FT5A 4R5SA 2HXLA 4HZSA 3V5JA 3G0FA 1B6CB 4F7NA 5BMSA 4GL9A 4J98A 2Z2WA 2XRUA 4H39A 1PMNA 5IMXA 3JS2A 5B0XA 1KE9A 1E9HA 5DT0A 3EQHA 5CANA 3L9MA 4L3LA 1K3AA 2XIYA 4GUBA 2WFYA 2BKKA 2E9VA 4IVDA 3QXOA 3QD2B 2QONA 3AC2A 4E73A 3R1QA 2WMVA 3BYVA 4ZJJA 5KMMA 5EI2A 5ACBC 3RP9A 4J1RA 5J95A 3ROCA 3VBWA 5HLWA 3PSDA 1YI3A 3OT8A 3GC9A 3PPKA 5HE0A 4UB7A 4WSQA 4C34A 5KHWA 3FWQA 3KB7A 4D58A 4IMYA 3CY3A 3L9NA 3RM7A 2RSVA 4RIXA 1V0OA 4CCBA 1E1VA 3GUBA 5HE3A 4A4OA 2YAKA 2W99B 5L2SA 4BIBA 4FV3A 2R3MA 3NVMB 4FE2A 4G3EA 3RAWA 3U4UA 3OOMA 2H6DA 1PYEA 1Y91A 3B8RA 4D1SA 2YM8A 4TYHB 2E9OA 2XEZA 2XNEA 5BNJA 4EH3A 2GPHA 3LMIA 1YVJA 1J1CA 1YWNA 3LHJA 3NVKI 4R77A 1U54B 4BCQA 1LEZA 5D10A 3REPA 4O7LA 3UOLA 3O71A 4GK2A 3DBQA 3K2LA 5DHJA 3NIZA 1PXJA 3IKAA 2F2UA 4C3FA 4QP4A 4W9WA 4ARKA 2OH4A 4J53A 5JT2A 5L3AA 3IOPA 3ZLSA 4ZS4A 2ZDUA 4CV9A 4GIHA 4M97A 2P4IA 3EIDA 3HP2A 4M14A 3SRVB 4UWCA 4RJ3A 3ORTA 1KSWA 4WNKA 3LQ5A 3W16A 3W2CA 4EOJA 2OF2A 2HXQA 2OF4A 3TTIA 4CRSA 2B4SB 1RDQE 5CSVA 2BCJA 2XK6A 3BEGA 4EH4A 4CFVA 3PZEA 2XJ2A 3NLBA 3SD0A 4FNYA 2ZYBA 2X8IA 3SG9A 2W1DA 4NUSA 4DT8A 1Y8YA 2HIWA 4XG4A 4CMOA 2VV9A 5KBQA 3PPJA 3HP5A 4H3PA 3BE9A 4G3FA 1OL6A 2OICA 2W4OA 5CT7A 4BR3A 4DA5A 1S9JA 1KE8A 4RVMA 4XRJA 4XV1A 4AZFA 4HVIA 5FXRA 4I5MA 1ATPE 4O0VA 4XV9A 3FLQA 4Q9ZA 3QLGA 3GXLA 1YI4A 4PPCA 5JKGA 4FIIA 3BYUA 3COKA 4BDIA 4FTMA 4QMUA 3HA6A 3WILA 5CEPA 2XM9A 3R8UA 4C4FA 5B2MA 3DXPA 4CKRA 4M0ZA 5H2UA 4E93A 4FICA 1OBGA 4O96A 4O7ZA 3BX5A 1SNUA 1WZYA 3QWKA 2BZJA 3ZYAA 3AOXA 3NNXA 1OL2A 4AS0A 4CCUA 4YO4A 5GJFA 1NVQA 3UZTA 4N6ZA 4CKJA 3PA5A 4CLJA 1YWVA 4AOJA 2VTOA 5D41A 4IB1A 4KKGA 4OTGA 3VQHA 2ETMA 1XO2B 4NKSA 5LVMA 3R00A 4F1TA 2H9VA 4EC8A 2ITNA 5M44A 2LAVA 4CGAA 1ZYDA 2DYLA 5FDXA 3D15A 3JY9A 4AZEA 3O8UA 3PXYA 2XKCA 1PF8A 4QP3A 2UZLA 4XLVA 3LLTA 4ANSA 5JMSA 4CRLA 3HEGA 4OAUC 1JQHA 5K0XA 3LXPA 2ZAZA 4Q5HA 3CEKA 1PXMA 2QURA 2UW9A 3N51A 3BGZA 4IAZA 3OWPA 4L3PA 4L53A 3SKCA 2VNWA 5HOAA 5LCJA 5CF4A 4BKJA 5ETCA 3F61A 1ZAOA 4IX6A 4X2KA 3LFFA 4FEQA 5DN3A 5HE1A 3UOHA 4FA2A 5M4IA 2J7TA 1LP4A 5HESA 2Y9QA 4EBVA 3RPVA 2PY3A 2F7EE 3WI6A 1H00A 1Z5MA 3CQEA 4FKWA 2JDSA 3GENA 5FM2A 4G6OA 4DF3A 3GNIB 5CNOA 4AW2A 1FBNA 3GU4A 5L8KA 4G9RA 2QKRA 3IDBA 3U6JA 3EN9A 4X3JA 3UP2A 4Z16A 1KV1A 4FV9A 4NL0A 4QPAA 3NUUA 4TN6A 4ANLA 1XBAA 5E8VA 4K33A 1V0BA 2EB3A 2VWZA 3I6WA 1H4LA 2JBPA 2YWPA 3D14A 4K6ZA 4EKKA 3N9XA 4KIKB 2Y4IC 4RIWB 3ZXTA 3EQRA 4EOMA 5BPYA 5LVOA 1PXIA 3MSSA 5LVPA 3MB7A 3IQ7A 5HORA 5AR2A 3QCQA 5CF6A 2WTKB 1JKSA 4M69A 5HHWA 4O0XA 2E9PA 4LYNA 2XYNA 2XK3A 3CC6A 3TUBA 1RJBA 3BRBA 5EYDA 3KRRA 4BDHA 5M57A 2VUWA 3E7OA 3PUPA 1OVEA 2QOBA 5DGZA 5CI7A 5I9UA 3NRMA 2XNBA 2WMXA 4GYIA 2QR7A 2X2KA 3G0EA 3ACKA 3CKWA 4B4LA 4DN5A 5KKRC 4EOPA 2XNNA 4BDAA 4QP1A 5DVRA 3UMWA 3NEWA 2HW6A 3BLHA 3CGFA 4HZRA 4USEA 2AC5A 3ENMA 1KV2A 5I3RA 2R64A 2WIHA 4MD7E 5DYJA 3UPXA 3ZEPA 1I44A 4LMUA 4WA9A 4UMTA 2XCHA 4EHZA 2OGVA 3D7TA 3QRTA 4PMMA 2IZTA 3HMIA 3RPSA 2GTNA 1BI7A 3DTCA 3PVBA 2JAMA 4DEBA 5HBHA 5F20A 4ZZOA 5C26A 2QOLA 3DLSA 4XBRA 2ZM4A 3AT4A 4O84A 2QC6A 3F5GA 4RBLA 4X3FB 4PX6A 4U43A 2OG8A 4FT7A 2IVTA 4OTQA 1H1WA 4O0YA 5D12A 5E8WA 4ZTLA 4EH5A 4CVAA 4IQ6A 2C6KA 5IH6A 3I0OA 4V05A 2JKQA 3PY0A 3NX8A 2ZB0A 2FYSA 2YIWA 4J7BA 3ZM4A 2OIQA 4X21A 3HRBA 3L8PA 4U41A 4B9DA 5TR6A 1FQ1B 4L7FA 2WMAA 4FSZA 5AMNA 4DCEA 5LQFA 2R3LA 3R22A 4JIKA 1UA2A 3KCKA 4GT4A 3OOGA 2FSMX 2P33A 3GU6A 1YOMA 4IAKA 4LQMA 3RMFA 4GT5A 5EW9A 3BHTA 4YURA 4PDYA 2VTNA 2H96A 4QMNA 2C0OA 4CTBA 3QTXA 5IQHA 1UKIA 3NUXA 3BHVA 3P78A 4HPTE 4BDFA 3TUCA 1ZZLA 3FSFA 4FSWA 1MP8A 3LMGA 5K5NA 4E6CA 4BIDA 2OJGA 2A4LA 1U59A 4FV0A 2PZ5A 4QT1A 4M7IA 3ZO4A 1CKIA 4W4VA 5BVNA 1SYKA 4UMPA 2EXCX 2OSCA 3KXHA 1JSVA 3LKMA 1YOJA 3ZSIA 4JL9A 4R7HA 3NNVA 3PWDA 3W18A 3A7IA 3F7ZA 4UV0A 5AWMA 2QLUA 4ZTRA 2J4ZA 2X7GA 4IC7A 5IUIA 3QQHA 1LEWA 3CQUA 4AZTA 4EQCA 2JKOA 5D9HA 5IQCA 1OBDA 3MH3A 4TWCA 4O7NA 4ACDA 3G90X 3QQFA 4U79A 4WNPA 5HZNA 2Y0AA 4R6VA 3KRJA 4L3JA 4XV2A 3F3UA 2W5HA 2UVYA 3DB8A 4A7CA 4UZHA 4C4HA 1KUTA 4AGDA 3UOJA 1W84A 1Q4LA 2OIDA 4RJ5A 4H58A 3D83A 3O0GA 4JS8A 4ASEA 4UMUA 3RHKA 5BUJA 1ZMWA 3H0YA 2XJ0A 4IDTA 3WYYA 3I5ZA 4IADA 2VU3A 4GIIA 3TJDA 4I3ZA 5IA5A 4I21A 4B99A 5AV0A 4CFUA 4EK4A 4QYYA 1IA9A 4FKOA 4ZSEA 5FEQA 3CD8A 3LQ3A 4EOLA 3ORLA 4IFGA 2VTAA 3DB6A 4RVTA 3ZCLA 5IQAA 5L6WL 4C3PA 3HMNA 1GZ8A 4RMZA 1VJYA 4L9IA 2WO6A 1U4DA 3D7ZA 3HNGA 4V0GA 5AV4A 4YJOA 1IAJA 3Q52A 1IA8A 2IW6A 3TCPA 4FV7A 1PKGA 4V04A 3ZRMA 5JEBA 4USDA 5KMNA 3NYNA 4I24A 5CU2A 3FLNC 1G3NA 2ITUA 3FQHA 4F64A 3RINA 4S33A 4ONAA 4EZ3A 3BEAA 4K8AA 4F99A 4DINA 2OFUA 3DXQA 3H10A 3SXSA 3DY7A 2JGZA 4PWNA 3I6UA 2UZDA 3A2CA 3NSZA 1ND4A 2UW5A 2QU5A 1XH9A 3MH1A 2O3PA 4FG8A 4QMXA 5E8TA 5H8EA 3PLSA 4A9UA 4EUTA 3E63A 3LPBA 4AFEA 1JKKA 1PXLA 2J0KA 2OLCA 2ACXA 2P0CA 2X6DA 4FIHA 2J2IB 3IOKA 3R8PA 3GCPA 3AT2A 3Q2MA 4OGRA 3RKBA 4EUUA 3PFQA 4FGBA 4FNXA 3VUKA 4XLIA 3HYHA 1W7HA 3C4WA 4MKCA 2EWAA 3NNUA 3UVPA 2C6IA 3FLWA 3DBCA 3G5DA 2ZV9A 1P4FA 2X1NA 3ZSHA 4FX3A 1H1SA 3L9PA 4U42A 2CJMA 4YTHA 4MHAA 4D9UA 3BHYA 4YTCA 5GIPE 3OWLA 4FOCA 3POZA 3KVXA 3HDMA 4JR7A 2FUMA 3OCGA 3FI2A 2X7FA 3F9NA 3P08A 3CPBA 5AP6A 3RK9A 3H0ZA 2C6DA 2C0TA 1XBCA 4JJRA 4RFMA 3TT0A 4O6LA 4TKSA 1QPDA 5CAQA 3F3ZA 1REKA 3F3WA 2VGPA 5IU2A 3N4UA 3KVWA 3V8SA 4NYEA 3MYGA 5FTQA 2GU8A 1PW2A 4Y83A 2PZYA 5EQEA 1YWRA 5CQWA 1XBBA 2UVZA 4NSTA 4YC8A 4ACGA 4WHZA 1PY5A 2XNMA 5JGDA 1SVHA 4IJPA 4EC9A 2QOIA 3CLYA 5EQYA 2WTVA 2GTMA 4O6EA 5EYMA 1QCFA 5EI6A 3D4QA 4CNHA 3OY3A 1JSUA 4FKSA 4DE4A 5T3QA 3A8XA 4AT4A 3MY1A 3QC4A 3HAMA 1OKZA 3F82A 4RX7A 3Q9YA 1YDTE 3DLZA 4J52A 3TV7A 4YTFA 4FV6A 4L8MA 3QKMA 3IG7A 3FZ1A 2XJ1A 3AC3A 4YC3A 3TNQB 4OTIA 3ZBXA 4EH2A 3C1XA 3F5UA 3MWUA 3A4PA 4BWKA 3CSVA 3BI6A 4QMQA 2HOGA 3EMGA 4FL1A 5IQFA 5FTGA 2GNHA 2YACA 2YLFA 4F7LA 4Z7HA 3A7GA 3P7CA 2ITYA 4M68A 3OHTA 3T3VA 4O27B 5BQ0A 4RIYB 2X6EA 3JVRA 3LJ1A 3QA8A 3GU7A 3P4KA 4MWHA 4UWYA 2F9GA 3E93A 4D28A 4DG3E 4E5WA 2CGVA 3MFSA 3R02A 3E3BX 2W9ZB 4JX3A 3Q53A 2CKPA 2GDOA 3E8NA 5J9YA 3K3IA 3QCSA 2ZMDA 3B8QA 1CTPE 4MTAA 3SGCA 4IAFA 4DAWA 1M17A 3C4CA 4MXAA 3Q3BA 4J8MA 4GJ3A 3MIYA 4IZYA 4OTWA 3FQEA 3F5PA 5D1JA 3U51A 5EKNA 1SZMA 2DWBA 5J8IA 3MFUA 4I0TA 1DI9A 3QQLA 2R4BA 5HO6A 2OW3A 2PVYA 5F1ZA 4HGTA 5HCZA 4CYJA 3DBEA 4L00A 5AJQA 4HVDA 4JX7A 1YDSE 4JXFA 3ZHPC 2ITZA 4G6NA 1R0EA 4BCKA 5BVEA 3VF8A 1ZYJA 4YC6A 5A14A 4FTUA 5DA3A 3OUNB 4EZ7A 2YM7A 5CEMA 3WBLA 5J1WA 1BI8A 2G15A 3AC5A 1V1KA 4BDCA 4CMTA 3VULA 5I9WA 4PQNA 3WOWA 4FMQA 2I40A 1J7UA 5DH3A 4WSYA 5DE2A 2VGOA 3ACJA 4EONA 3BU6A 3E8DA 3KMMA 4UXLA 3ULZA 4ANOA 5CZHA 1W98A 2IJMA 3ZZWA 3KXNA 3R04A 1BX6A 2V7OA 4IXPA 3TNWA 3CP9A 4AW1A 4DH8A 4N0SA 1VR2A 1Q41A 5CALA 4IB5A 1F3MC 3LCKA 5BMMA 3BLQA 4X2GA 4ZJIA 5DRDA 3ZUTA 4XP3A 4MK0A 2CNQA 3ZS5A 4ZLZA 4P90A 4ZZMA 2Z02A 3OROA 2P2HA 3PG1A 2YM6A 4FV2A 5EHYA 4Y8DA 3KF4A 2XKEA 2VTLA 3IDCA 4PV0A 3LJ2A 4XV3A 3TG1A 3T3UA 4DHFA 3U6HA 4QPSA 3OCSA 2JC6A 4IW0A 4P5ZA 5IQIA 4LMNA 1JBPE 2BPMA 3QYWA 5LCKA 1SVGA 3QRKA 2BALA 4W4WA 4WRGA 5BVWA 5M4FA 4H05A 3PSBA 3T8OA 4G2FA 2KTYA 4IM3A 3R7EA 3NAYA 3QZIA 4MXCA 4FYNA 4ZY5A 2CGXA 1URCA 1O9UA 5DBXA 4YHJA 3R1NA 3FI4A 5H3QA 3R7UA 3F2NA 1PKDA 1E1XA 4AWIA 5H9BA 2R3GA 3FMNA 2ZMCA 4HGEA 2WQOA 4GSBA 4MNEA 4ZXTA 2PVHA 1PXNA 3QX2A 2JDOA 2UZTA 2VTQA 4PP9A 4FYOA 5D7AA 3PXFA 3H9RA 2ERZE 4KBAA 5EH0A 2WQEA 4AA4A 3HECA 3MFRA 3V6RA 3FMJA 1VZOA 4L68A 5FP6A 1FMOE 3U9NA 2CMWA 3BV3A 3FE3A 3NS9A 4UMRA 4C02A 4AN3A 5DG5A 3R71A 4XH6A 3TZ9A 5JZJA 3E7VA 5HIDA 1OL5A 4FSYA 5B2LA 2GNLA 4RG0A 5HICA 1YXXA 3LFCA 3Q96A 4U80A 5EK7A 1UNHA 3S95A 3VW6A 1R3CA 4ALUA 5M4CA 2ETRA 3VS3A 4C61A 4F0FA 2J0LA 1BKXA 3FZRA 4CQGA 3OXTA 3UE4A 4L43A 3KU2A 4U7ZA 4G5JA 2QOHA 3KN5A 1BL7A 2NO3A 4USFA 4DFNA 3U6IA 4YPSA 1Q8YA 2IVUA 2J9MA 5EFQA 2F7XE 3ZLXA 2W5AA 1DS5A 3PY3A 3MPAA 4O7RA 4CT2A 3LXKA 2CLXA 3VS2A 4W8EA 4TNBA 1OMWA 2I1MA 3RZFA 5CLPA 2QVSE 4O0TA 1OKVA 3D9VA 3VIDA 4BCHA 4HW7A 5CY3A 3KL8A 1PXPA 3RAIA 2R3RA 4FOBA 4QTBA 4QMVA 4YU2A 2E9UA 4LV5A 3MY0A 4ZSAA 3PVGA 3R9DA 1ZYLA 3OXIA 4DLJA 4PPAA 3NWWA 3PA3A 3G33A 4JLCA 4QP2A 5FD2A 4NJDA 1FVTA 4C7TA 3FMHA 2IWIA 5FTOA 3RWQA 1P14A 4QMSA 1MRVA 4D4VA 4RSSA 4EWQA 3I7BA 3DFCB 4I6FA 4YGAA 5IUHA 3UQGA 5EM6A 1T45A 4YJQA 4CT1A 3K3JA 1ZZ2A 2R3FA 4I6BA 4U0IA 5J7HA 5TT7A 5J5TA 1G8SA 1XKKA 4IM0A 1J3HA 3QRJA 5FUTA 3FZSA 5DOSA 3BU5A 2BZHB 3GCUA 1R1WA 4BZNA 5HVYA 1XH6A 2WMUA 3PRIA 5BVOA 3ID6C 3NCGA 3EQBA 3ZFYA 2WNTA 3EB0A 4K1BA 3PYYA 3FDNA 5AUXA 5IMEA 2BFYA 4MXXA 5CU0A 3R8VA 4F09A 3FV8A 3ORZA 2IZSA 3G9LX 3DFAA 2YCSA 4GVJA 3UIUA 3VVHA 4AZVA 5EQPA 3FKOA 2YM5A 4EBWA 3R7OA 2OJIA 2JKMA 3MA3A 2QQ7A 4M84A 4LRKA 5KO1A 3PP0A 3P5KA 4FSMA 2R3KA 5IPJA 5AIRA 1J7IA 3COHA 5IQEA 3KMUA 1PXKA 5EKOA 5HU9A 3DS6A 3NNWA 2R2PA 3EOCA 3A62A 3IW4A 4TWPA 4TYIA 4BI0A 4EEVA 3VS5A 4G3GA 3C5UA 4U44A 4ACMA 4C58A 3EN4A 4CV8A 3LFBA 3V5QA 2XS0A 2ZM3A 3FC2A 3MB6A 3W8LA 1Z57A 5AAEA 1NT2A 3VUMA 4WBOA 4C4EA 3P23A 4HGLA 1J7LA 1LR4A 4W8DA 5B7VA 1TQMA 5E9EA 4H1JA 4QYGA 3UVRA 2WTCA 4RZWA 3BBTB 3VUDA 4EH8A 4KB8A 2RFDA 2CN8A 3RK5A 1O6KA 4DBXA 5A4QA 4UY9A 5E8ZA 2W1FA 2R0UA 2QD9A 3C7QA 2Q0NA 4QPMA 4FL3A 4FVRA 5CS6A 3SOAA 4CZUA 5BUEA 4TYHA 3ZFXA 3Q60A 2I0EA 1WVXA 5I3OA 4FKVA 3V8WA 3QGYA 2X39A 4H36A 1Q3WA 5KUPA 2VTSA 3D0EA 2ZV7A 3TKIA 4NTSA 5CU4A 1K9AA 4G9CA 5CF5A 4UYAA 1R0PA 3EH9A 2UUEA 4GFMA 4HGSA 1GZOA 1BYGA 2Q0BA 3SRVA 3EQIA 4FEWA 1NA7A 4P2KA 1RW8A 4FKGA 2WEIA 1JKTA 5IDNA 5EHOA 4HNFA 2XNOA 1SNXA 2FVDA 4MF0A 4S2ZA 3UJGA 3P86A 2O0UA 3FMDA 3IGOA 5CSHA 2CSNA 3GC8A 3W1FA 4FSRA 3M11A 4HYHA 1FVVA 4YLLA 1Y6BA 4S34A 2WMRA 3Q9ZA 1PMUA 4E8AA 4Y85A 3R28A 4NCTA 1X8BA 3R30A 3QCYA 3ALNA 4TTHB 1AGWA 4JDIA 5E8YA 3RPYA 3DAJA 3F5XA 1H8FA 3PJ1A 3ORKA 1MQBA 5JFVA 2XKDA 5EOLA 3RNIA 3WF8A 4U40A 4DEAA 2X8EA 4B6LA 4ZLOA 3C4XA 3WIGA 4D0WA 5AV1A 4D2RA 3EZRA 4CEGA 2RFNA 2IPXA 2WTWA 2QLQA 2JITA 4FV8A 4GFOA 1PMVA 2PMOX 3E88A 3GC7A 4IVCA 4MVFA 3RNYA 3UIXA 1JKLA 3C0HA 3TN8A 1GIJA 4O0RA 3F7WA 3E87A 5AM6A 2UZNA 5J9ZA 2BFXA 2Z7LA 3PE2A 3W10A 4D5HA 4F9BA 1JNKA 3R7VA 3QZGA 3HRFA 3OCTA 4L46A 2V22A 2WMQA 4RRVA 3MGYA 4O0UA 3CGOA 4LOQA 2HZNA 2VTTA 4I6HA 4XG3A 4FT0A 3R7IA 3ODYX 3ZFMA 3ELJA 4OTPA 5CEKA 4ZOGA 4CG9A 3OT3A 5HVJA 4N70A 2IW9A 2V55A 3OW3A 3R63A 2J5EA 2VO3A 2F4JA 2WD1A 3AD4A 3PJ3A 4PL4A 2EB2A 2ZDTA 2QKWB 4YHFA 3W33A 3P7AA 4O0SA 4QQTA 1MQ4A 3ITZA 5IG1A 4GKHA 3KC3A 5E90A 4ZS0A 2VTHA 4XOYA 1OKYA 5KBRA 5L6PA 2GHMA 3PTGA 2AYPA 3Q5ZA 4GEOA 2RG6A 5M09A 1TKIA 3Q9XA 4KBKA 4ZMFA 3FMEA 4QTCA 4YZ9A 3PXZA 3S3IA 2VTIA 5JZNA 4O7WA 3G51A 2ZB1A 4BDEA 1WBPA 3VO3A 4BRXA 2WXVA 4UBAA 5AX9A 1I09A 2YM3A 1IR3A 1DAWA 2PVNA 3DKOA 4QMPA 4BCNA 2ETKA 3UZRA 3OEZA 4ANBA 3KY2A 5AAFA 2GQGA 4R3RA 4QMOA 3AD6A 3HZTA 1URWA 4C36A 3EQGA 3R2YA 4RJ6A 2VO7A 5H8BA 2UZVA 4AGCA 2V0DA 3EHAA 4G3CA 2PZRA 4L01A 4FL2A 3K5VA 1FMKA 2BRGA 4M0YA 4BI1A 2FH9A 1WBTA 4CXAA 3EN7A 4RWIA 4UX9A 5HX8A 1BL6A 2XK9A 2C68A 2X9FA 3GC0A 4FTRA 4KIKA 4RIWA 4TT7A 3U9CA 3VS7A 5T6KA 1OIRA 4K18A 4NJ3A 2C4GA 2ITQA 3HUBA 1WFCA 4E1ZA 4Z9LA 2UZWE 4I5HA 4QTAA 2YERA 3QQGA 3SDJA 3UGCA 2QHMA 1H24A 3QYZA 4QNYA 5GIOE 2WIPA 3DCVA 3F3TA 4NWMA 5CEIA 2Z7SA 5CX9A 4QP9A 4QP6A 3Q9WA 1M14A 2EVAA 2RFSA 1TQPA 4FTKA 4ZTNA 2GCDA 3PXKA 4LL0A 1UKHA 3VBTA 4BDBA 3S2PA 2PZIA 5EOBA 4C3RA 3F3VA 4DTAA 3F88A 5CXHA 2VWBA 5C9CA 3F6XA 2YJRA 3GQIA 5AV3A 1AD5A 4BHZA 1H07A 2B9FA 2OJFE 3C5IA 5EW3A 3V5LA 2JD5A 1QPEA 2IZUA 4IAIA 1VYWA 4K77A 2QHNA 4OR5A 3SXRA 5CEQA 2VNYA 3S0OA 3QUEA 2W96B 3KK9A 4NM7A 5DI1A 3S4QA 3H9FA 4X3FA 4DG2E 2VWVA 3NW6A 5CEOA 3BCEA 5EDPA 3LCDA 4WUNA 4LUDA 2XK7A 4EK3A 3BYSA 2GFCA 4JR3A 4O1OA 3KULB 4WOVA 5LWMA 5FRIA 3AXWA 3K5UA 5BVFA 4YP8A 3A7HA 4IHPA 3FPQA 3R73A 3KRLA 2ZVAA 5HBJA 3ORMA 2A1AB 2UW4A 4IACA 4AFJA 3QQUA 2WZJA 2XK8A 3KFAA 5A3XA 3O17A 4C0TA 5F4NA 3DBFA 4U3YA 4FZDB 5IQBA 3PRFA 5E1SA 4ZP5A 4BGGA 2G2IA 5GZAA 2CCIA 2YDIA 4FKUA 2X8DA 4W4YA 1OIQA 3VS6A 4OBPA 4RJ8A 3EYGA 3ZBFA 4DTKA 2BAJA 3TV6A 4E4MA 5C8MA 2I6LA 1PMEA 4DITA 4CD0A 1PXOA 4U45A 3I7CA 3OS3A 4MD9E 2B1PA 3PP1A 4RPVA 1M7QA 4ENYA 3KK8A 4YZDA 3T9IA 4IBMA 3IGGA 5M08A 3ANRA 2RKUA 5K3YA 4PL5A 4RWLA 4M15A 4BDDA 4OAVB 4YJRA 3EQDA 4HVGA 4AGUA 3OBJA 4II5A 4AXAA 3PDTA 3LXLA 1Q8UA 4MQ2A 3UVQA 4KS7A 4NKAA 4O2ZA 5AP2A 3AMAA 2YFXA 2A19B 4JRVA 5D7VA 3W2SA 1KOBA 4FGRA 4QMZA 3EZVA 4GK3A 4XEYA 4ZSJA 3D5WA 4FTJA 3IW7A 3TUDA 3VBYA 3TL8A 4FG9A 5FG8A 3OWKA 4MX9A 4D4YA 3NUPA 2ZOQA 1A06A 4FNZA 3N4VA 2JIIA 5E8XA 2AUHA 3A8WA 1FOTA 2HWOA 5DR2A 5EG3A 3RPRA 4P5QA 5GJGA 5HNGA 3AGMA 4A9TA 4D4SA 3E5AA 4FC0A 3WYXA 4EQUA 1NVRA 1YXUA 3BZ3A 4FTCA 4FTOA 4HVSA 4FEXA 5GZ9A 4AOTA 3UO5A 5C8KA 1WBVA 2C5XA 1FGIA 3FMKA 4IIRA 5TF9A 4I93A 1YRPA 3AQVA 4I41A 3QUDA 1WBOA 4NU1A 3Q2JA 1RE8A 3LCOA 4MBLA 5I5ZA 5BYYA 4D55A 4F4PA 1IEPA 3ZRKA 3FMMA 2JLDA 1GJOA 3UBDA 4B8LA 3BU3A 3UYSA 3TM0A 3IONA 3R83A 4ANMA 3R01A 3WZDA 3AT3A 3UPZA 3CS9A 4RX5A 3HKOA 5HG7A 3JXWA 4HOKA 4UALA 2EXEA 5GZ8A 3CTJA 4IE9A 2G9XA 4QQJA 5A46A 1XH7A 5AP3A 2R3NA 4OBOA 3SG8A 5J1VA 4F9YA 3ROYA 4D0XA 2PU8A 1GZNA 3JYAA 3QRIA 3LOKA 4OT5A 4UYNA 2OXYA 3QHWA 1M7NA 5HIBA 3WARA 3VUGA 3A99A 3ZUVA 1OL7A 3QZFA 2PYWA 4KWPA 4QD6A 3LLAA 2WOTA 5ANGA 4CFWA 2OZAB 3ZM9A 1REJA 1ZY4A 3DKGA 1NXKA 5FLFA 5EW8A 4AZWA 2C5OA 2YLEA 4TY1A 4R5YA 1ZLTA 4BKYA 1GOLA 4DFZE 4E7WA 5I9YA 5M07A 4F7SA 3OMVA 3MH2A 2G1TA 3MVJA 4TZRA 3SHEA 1H28A 3WZKA 2PK9A 4NFMA 5L8LA 3ZMMA 3NCZA 2W06A 1H01A 5KCVA 4QMTA 3OG7A 2BTRA 2W7XA 5HIEA 2QNJA 5A4EA 1CDKA 2BMCA 3FLYA 4Y72A 4ZK5A 1Q97A 3A7FA 2GNFA 2CPKE 3QZHA 1UWHA 4KKEA 1XH8A 5HX6A 2VO6A 4RC2A 5H8GA 4DH1A 2YITA 3KMWA 3R9NA 1VYZA 2E2BA 3VS4A 4GH2A 1H26A 2R7IA 1ZARA 4QP7A 1ZYSA 3MJ2A 4XG7A 3ZZEA 5C1QB 3TJCA 3C4EA 3TDVA 4U5JA 2F57A 4WT6A 2FO0A 3DTWA 4GJ2A 3PWYA 4O0WA 1Q5KA 2O63A 4AT5A 5BVDA 4C8BA 4JIAA 3M2WA 1G8AA 3HMPA 4PUZA 5DEYA 3RGFA 3KKVA 3D5VA 3FYKX 4KINA 3UNKA 2XKFA 4QRCA 5M56A 5A9UA 2Z60A 3U87A 3TNIA 3A4OX 3A60A 4PDPA 4A06A 4ZIMA 4D1ZA 3VHKA 1JSTA 2UZBA 2V7AA 3OF0A 4MF1A 4D2VA 3LFDA 3A7JA 2O65A 2J0IA 4MAOA 2C5VA 1A48A 1XHAA 2RIOA 4NM0A 2JKKA 5LARA 2GS2A 5DR9A 2UW7A 4J8NA 5IQDA 3PIZA 5GJDA 4C37A 4WG4A 1U5RA 4HYUA 3PY1A 1HOWA 5CENA 4BCJA 1WVYA 4FKTA 2F7ZE 2HENA 4FTAA 2PMLX 3DNDA 5E1EA 4E4NA 3QGWA 3ET7A 3HGKA 3CKXA 4DC2A 3IW8A 3LAUA 4FUXA 4OTFA 4CZTA 3UG2A 2O64A 3Q4CA 2F49A 4RJ4A 3SVVA 4RZVA 4KRCA 2R9SA 4DEIA 3DQWA 1ZRZA 4G5PA 3LFAA 4LI5A 3VJOA 1BMKA 5CSWA 5L2IA 4AE9A 3R9HA 2QO7A 2YCRA 3C13A 4NZWB 4O1PA 4AN9A 2BROA 1KOAA 3BQRA 4NCTC 3GEQA 4BCFA 4YZMA 3COMA 3NR9A 3HV4A 4HCUA 4TL0A 3OBGA 3SLSA 1UWJA 4TPTA 1QPCA 5JK3A 4EOOA 2X7OA 4DGNA 4JBOA 4F63A 2X81A 3FMLA 5K0KA 3RAKA 4KIOA 2YIQA 2ZV8A 3MDYA 4ACCA 2JEDA 5HBEA 5LVLA 2XP2A 3UQFA 4U3ZA 4GG5A 5C27A 4ITJA 2OU7A 5DWRA 3AMBA 1WBNA 3F69A 4IAAA 4NTTA 4X6QC 4CFNA 1UV5A 2PUNA 3KXZA 4NW6A 3NUNA 2XNGA 4I6QA 4DGGA 4JRNA 1FPUA 5HE2A 3PJ8A 4DBNA 4D1XA 2P55A 3QKLA 4NFNA 3QRUA 1DAYA 2FSLX 4IH8A 3QAME 2GNJA 5L8JA 3VHEA 4EH9A 4QQ5A 1H0VA 3NUAA 5K4IA 2CKEA 2Z7RA 4M8TA 4I1ZA 4LOOA 3UODA 2GS7A 4D9TA 4DFUA 4A9SA 4WRSA 2DQ7X 2XZSA 1H0WA 2RGPA 5ETIA 4YSJA 2VWUA 4M67A 3IPHA 3L1SA 3AC4A 3FLSA 4UWBA 3RCDA 1M2PA 5A4LA 2GQRA 5M4UA 4L42A 4CLIA 5F95A 1ZOHA 4F6UA 5IISA 3VUHA 4PMSA 3VBXA 2XK4A 2FA2A 4EHVA 4FUYA 3ANQA 4MWIA 2B7AA 4KD1A 3TZ8A 2YZLA 5KMIA 2OXXA 4ZAUA 3NW7A 4L7SA 4C57A 3H4JA 2JIVA 4O82A 4A4LA 5KNJA 4XP2A 2GSFA 3D94A 3E62A 4P7EA 3PSCA 3KREA 2GHGA 2XA4A 4M13A 3ORIA 3Q32A 2Y4IB 4GMYA 1PJKA 2WU7A 3MIAA 4GK4A 1H08A 3CY2A 3T9TA 2BDJA 2PMIA 2H34A 2W17A 4KNBA 3I81A 5LMAA 3P0MA 4OTHA 5K9IA 3C0GA 4AGWA 1P2AA 3R2BA 4YHTA 5AP1A 1ZYCA 2JFLA 4EOSA 2YIRA 4F9CA 3UQCA 1O6LA 4TYGA 3TV4A 3FL5A 3BWFA 4LFIA 4R3CA 4DT9A 3O7LB 5KKRB 3NPCA 5IKWA 3WE8A 4YMJA 1H1QA 3OTVA 4YZCA 3BELA 2JFMA 2WTKC 4XUFA 1GIIA 2VZ6A 4JQ8A 3Q4TA 4RIOA 5BVKA 3TWJA 1IASA 4Y95A 4QTEA 4ACHA 4XOZA 2YWVA 1FGKA 2QR8A 4M12A 4BY9E 2CDZA 3WF9A 3KRWA 4PMPA 5HTCA 3BGQA 4GCJA 4JQ7A 2R5TA 2BHHA 2YHVA 4KABA 1J1BA 4ZTSA 3R7YA 5HQ0A 3HRCA 4KKHA 4GG7A 4R1VA 5HLNA 5TOZA 3O8PA 4I4FA 2ONLA 3EKKA 2OBJA 5CVFA 5EDRA 4I4EA 3DXNA 5EDQA 5FEEA 4BCOA 4CQEA 3FI8A 2YAAA 1R39A 1XH4A 3VN9A 1LPUA 3WE4A 4JVGA 1UVRA 1YHSA 3HA8A 4EOIA 3VRZA 5GHVA 2XUUA 4CTCA 3TDWA 2HCKA 1WCCA 2PTKA 4ZSLA 3QL8A 2I0HA 4IX5A 4ERWA 4X3FC 4APPA 1Y8GA 4BF2A 4DGOA 1Z9XA 4AP7A 3PG3A 5E4HA 4MQ1A 4N6YA 5IH4A 5AAGA 4BBMA 5JGAA 3JUHA 4IVAA 2W1HA 4YUQA 4J96A 3GI3A 2ZJWA 3TI1A 2VD5A 4TWOA 3TACA 4BIEA 4L6QA 3QQKA 2REIA 4AW0A 3HL7A 2VTJA 2PUUA 2EU9A 3UTOA 1F5QA 3E8EA 4FKLA 3OFMA 5CSPA 2C5NA 5HLPA 4TNDA 3LXNA 4DCAA 2BKZA 1ZOGA 4LRJA 4G31A 4GYGA 2OJ9A 3OXZA 4NM5A 4EQMA 2WU6A 4DGLC 3EFJA 3QTRA 3R8LA 4F08A 5AUWA 1O6YA 3RK7A 3P9JA 5AUTA 3AC1A 2WHBA 4EHEA 3JY0A 4CFXA 3EN5A 4FNWA 3FY2A 4NM3A 3ZDIA 3C0IA 2OK1A 2JDTA 3DZOA 1R78A 2FSTX 3ZONA 4U97A 3FXXA 3HDNA 3UNZA 2R3QA 4FZAB 4JNWA 5A4TA 2YABA 2E9NA 2OKRA 5IA2A 5HTBA 2ZM1A 3VUTA 4FKJA 2G2HA 4TW9A 4CKIA 2B9IA 5CU3A 3ATSA 4MH7A 1ZMVA 4X6RA 3WZEA 4CSVA 2YN8A 3R9RA 4X2NA 2R3PA 3RPOA 3ORXA 5AV2A 5C03A 1ZOEA 4JAIA 5M53A 3F2AA 5KMKA 4IWPA 3NUSA 4GU9A 4AZSA 1Q99A 5EM5A 4QQCA 3RI1A 1NVSA 4YJUA 4IB0A 4N4SA 4AA5A 4CMUA 4E5AX 4XJ0A 2VO0A 3HV6A 3IDPA 2XEYA 3LCSA 2WQNA 1U5QA 3ORNA 1QL6A 3OY1A 1J91A 2WTJA 4C33A 1NY3A 4FTQA 5KZIA 4NIFB 4M3QA 3HUCA 3PLAE 4RX8A 4YTIA 1UU8A 4BC6A 3FHRA 4Y73A 2R3HA 3BE2A 3DJ7A 4RQVA 3GOPA 2QOCA 3EJ1A 4IC8A 1APME 1A9UA 2QO2A 1M52A 4BGHA 5AA9A 2QG5A 2PVFA 3QC9A 4GKIA 4IWDA 3FL4A 3MV5A 2A2AA 5E8SA 4TYJA 4BBFA 4IB3A 5AP5A 3ZXZA 4QO9A 4G1WA 4WUAA 1UNGA 4PTGA 5HTIA 4RC3A 4HYSA 3L8VA 3ZSGA 3EFWA 3R1SA 4ZEGA 3D5UA 5BYZA 1AQ1A 4AT3A 5BX0A 4XYFA 2FGIA 2NPQA 3RJCA 3V5PA 1OB3A 3E3PA 4HJOA 4DGMA 4S30A 2UW3A 4QYFA 4YJSA 2YCQA 1JVPP 1Y6AA 3PXRA 2EXMA 2VX3A 4JG6A 2GFSA 1MUOA 4PNIA 5CU6A 3RAHA 4EKLA 2CNVA 3NYOA 1XWSA 2ITXA 2O2UA 4WIHA 4DYMA 3OD6X 2RL5A 4KS8A 4BL1A 2UVXA 5CZIA 1U54A 3AD5A 4E4LA 3GCQA 4GT3A 4UEUA 2PVJA 3LM5A 3DPKA 5B2KA 4OT6A 4ZY6A 1BUHA 4G34A 3KXGA 5GNKA 4BCPA 4Z3VA 3GOKA 1NW1A 3QTQA 4JG7A 3A61A 5J5SA 4IX3A 4BCMA 4O7YA 2W1IA 4AG8A 2WQBA 3EWHA 4F9AA 3V01A 4QTDA 5J79A 5AA8A 3NYVA 4KA3A 1YDRE 4AAAA 3E8CA 4GFGA 4PDOA 4D2TA 2VAGA 3ZO1A 3LMHA 3GU8A 4GU6A 1ZWSA 2XRWA 1OIUA 1JPAA 2NRYA 5CT0A 3GQLA 3EQCA 3FC1X 3FPMA 3O96A 4EZ5A 3FSKA 1Q8TA 2PZPA 2UZOA 2P2IA 2PPQA 4K0YA 1Q8WA 3VBQA 5CAPA 1DM2A 3TKHA 5LVNA 2WKMA 1YQJA 4EK6A 4R78A 2BHEA 4YBKA 3V5TA 4X0MA 5HD7A 4F6WA 4YPDA 4PMTA 5DPVA 4N57A 1UU3A 4FV1A 1OL1A 3EL7A 4MXYA 4F0IA 3DK6A 3IO7A 4HCVA 2IN6A 4R7BA 4RWJA 4FVQA 5ANKA 5L2WA 4I94A 5TE0A 3OWJA 5T68A 5DLSA 2Y4PA 3THBA 5JFXA 4FV4A 3TNHA 4NT4A 2W1ZA 3VAPA 3CQWA 3F66A 5AIKA 5CWZA 2BRMA 2QO9A 4GRBA 4MYGA 1WBWA 4U8ZA 5LWNA 1W82A 2C30A 2BR1A 3AGLA 4R3PA 3IK3A 2Z8CA 3L8SA 4RIXB 3P1AA 5IEVA 4JDJA 2WB8A 4RLKA 1H1RA 3EFLA 2VTPA 4O91A 1OKWA 3DAKA 3MY5A 4ALVA 3GFEA 2OO8X 2WMWA 2CNUA 2CCHA 3VBVA 4E6AA 4IWQA 5K4JA 1WBSA 3R8ZA 3CXWA 2WTIA 3GFWA 4XG2A 2B9HA 3M1SA 3I5NA 4AE6A 4DH5A 4W4XA 4FBXA 4FK6A 5DFPA 1S9IA 1LUFA 4I5CA 3ZLYA 2X0GA 5K5XA 2J90A 3DJ6A 4IZ7A 5DR6A 3VJNA 1WMKA 1WVWA 5IA0A 5HCYA 3O7LD 2O8YA 5L6OA 4ALWA 3PVWA 4E26A 4WO5A 4FKQA 4OTDA 2W1EA 2AC3A 5M06A 4D5KA 2XNPA 3DGKA 4RC4A 4H1MA 5DIAA 2C6OA 3V5WA 4DH3A 4U6RA 5HU3A 3O2MA 3QCXA 4JBPA 4PPBA 5KMJA 2ESMA 3CD3A 1H27A 2BDFA 3O23A 4YLKA 2WMTA 1FINA 1ERKA 1TQIA 4GVAA 2JAVA 5L2QA 5FBNC 4KSPA 4O7SA 3OUKA 4YNEA 1YHVA 2Y7JA 3GCVA 3QXPA 3GP0A 1YI6A 4K9YA 4C62A 5JQ5A 2CLQA 1GIHA 3DNEA 4F70A 1PRYA 5EI8A 1B38A 4L52A 1RQQA 2HW7A 3P79A 4YO6A 4MCVA 4TWNA 2BILB 4E5BA 1HCLA 2SRCA 2HYYA 4GUEA 1Q24A 3M42A 4ASDA 3IW5A 5ANDA 3HX4A 2XF0A 3RTPA 4B0GA 4D2WA 3LM0A 3MW1A 3ZO3A 3RALA 4RFZA 4BN1A 2O5KA 5BUIA 1YXTA 4IWOA 5EM7A 2IO6A 3VWAA 3QALE 3O50A 2Q83A 4EYJA 3EFKA 3DT1A 4ANNA 4DFLA 4UXQA 4KAOA 4PP7A 3BYMA 3QTUA 4AOIA 4BB4A 5JN2A 3MJ1A 4OW8A 3KULA 4FT3A 2ITTA 4W9XA 4I0RA 4ZZNA 3CTQA 4LM5A 4IANA 4BWPA 3QTSA 1OITA 1MRUA 2UV2A 3DKFA 4AUAA 5CAUA 5IA3A 2F2CB 3R0TA 1XH5A 4FKRA 5IDPA 3ULIA 5LMKA 5LOHA 1YOLA 5ANEA 3KXXA 3V51A 4ASZA 3L8XA 3POOA 3FXZA 3VNTA 3DZQA 1TVOA 1HCKA 2QCSA 2I7QA 1OPJA 3OZ6A 2YM4A 2R3OA 5KMOA 3WZUA 4DH7A 4AF3A 4JT3A 2W4KA 3W32A 4FIEA 2PUPA 3RCJA 3TTJA 2IVSA 3BLRA 4XG9A 4K11A 4IZ5A 5AUYA 1M2QA 4FKPA 4ZMEA 3QA0A 3KXMA 2ITVA 4LOPA 3HLLA 4QP8A 2OIBA 4I0SA 3EKNA 3R9OA 3ZC5A 4A4XA 3LQ8A 3D2IA 3D5XA 3RBWA 3WF7A 5I0BA 2OWBA 2V62A 5I9ZA 4RLLA 4L67A 4A9YA 2VX1A 4JDHA 3ZU7A 4R1YA 1ZMUA 3QTZA 3TNPC 5AFVA 3ZLWA 2YIXA 4EK5A 3LFSA 4R8QA 5FWKK 1H1PA 4O22A 2W0JA 3BYOA 5JRQA 2PWLA 5A6OA 2CKOA 1QPJA 3E92A 3V04A 5I4NA 4XHKB 3WF6A 2J51A 4C4IA 4CZYB 2IZRA 5FGKA 2Y6MA 3FKLA 3O51A 3HVCA 2B53A 2J6MA 3UYTA 1SM2A 2G2FA 4M69B 3OW4A 3OEFX 4MXZA 3CJGA 2GQSA 2YZAA 1M2RA 4DLIA 2XVDA 3AC8A 3DA6A 5CNNA 4D2PA 4I22A 3ZEWA 4PL3A 2FSOX 3I0QA 5I9VA 1G5SA 4O21A 5I9XA 2I0YA 3FXWA 1CSNA 2XIRA 4WKQA 4EJ7A 2X2MA 2CHLA 5DNRA 2PL0A 3ZOSA 1K2PA 5JH6A 5L4QA 1OM1A 4P4CA 2C3LA 4MBIA 4YNOA 5AP0A 4RGJA 3QTIA 4FTIA 5CF8A 1YXVA 3D7TB 3DK7A 1GZKA 2B52A 4FT9A 5E8UA 5JFSA 3PZHA 5CSXA 3DDPA 4FTTA 3FI3A 4J99A 3PIYA 2IW8A 4LL5A 3PIXA 5KX8A 5J7BA 3KN6A 2PSQA 4BFMA 2ONLC 4RFYA 1OPLA 2YIYA 5F9EA 4D2SA 3R21A 3BGPA 5CASA 1XQZA 2PHKA 5EM8A 4F9WA 2ITWA 4KIPA 2BAQA 3NYXA 3UC3A 3HMOA 2Y8OA 3UZPA 5HKMA 4HVHA 2ITPA 4XX9A 4JI9A 4QMWA 3SAYA 3TKUA 5JFWA 5CVGA 2YDKA 4FKIA 4C35A 2C3KA 5FXQA 3WIKA 2WMSA 3ODZX 5KMLA 2W5BA 5ETAA 1W83A 5ANOA 3V3VA 4HPUE 3Q5IA 3FHIA 1DI8A 4QNAA 5D11A 2J0JA 4WG5A 4BDKA 1IAHA 4TXCA 2B0QA 4OTRA 3EYHA 3CJFA 2BRHA 4ZTMA 4PDSA 3IW6A 5HCXA 1KE7A 2ITOA 4FV5A 2OFVA 2QOOA 4G16A 3MVLA 3DKCA 4O7VA 2RG5A 3VW8A 2OZAA 2IVVA 4AACA 3UIBA 4ORKA 3MI9A 4EH7A 2W1GA 4IDVA 3KQ7A 5HNBA 5AM7A 4JBQA 1CMKE 2BTSA 2YDJA 5E7RA 3KRXA 3TIZA 4JG8A 5IH5A 1W8CA 2QI8A 4PTCA 5A54A 5HGIA 4FSNA 4Y5QA 3SX9A 4BTJA 4UN0C 4O86A 3LFNA 4LUEA 5IUGA 3MH0A 4JOAA 4MXOA 5AR8A 4BICA 1MRYA 4FSQA 1Q8ZA 3ZUUA 2V5QA 5TO8A 3FZOA 3I79A 3QFVA 4A07A 2BIYA 4CFFA 3GVUA 3QD3A 5AX3A 3VUIA 3KF7A 4AQCA 5IEXA 2HZIA 3ORPA 2W4JA 2PULA 3VS0A 1SVEA 1P5EA 4EJNA 2HELA 2PMNX 3DQXA 3HV5A 4S31A 5J87A 2HY81 2XIXA 4XP0A 5E91A 3I1AA 4NW5A 3BPRA 4JQEA 3VF9A 5IQGA 4QOXA 4FF8A 1OI9A 4MEDA 5ANJA 2WOUA 2PE1A 2WMBA 3R8MA 4YLJA 4V01A 5CTPA 2C1AA 4F7JA 2VRXA 4X2JA 3LVPA 4IZAA 2JBOA 5AP7A 1JWHA 4QYEA 4BZOA 3MFTA 2CGWA 4DFBA 3FEGA 2HZ0A 4DTBA 2HWPA 5FQDC 3SW4A 5HO7A 2XMYA 2W05A 3GGFA 3BBWA 3KEXA 3LFQA 4DFYA 5DT3A 4RJ7A 4IEBA 4FSTA 4KBCA 4WNMA 4BWXA 2HAKA 1GY3A 5ITAA 4E6QA 3QTWA 4V0GB 5KE0A 5C8NA 5KZ0A 4S32A 1CKPA 1OUKA 2QOFA 2VWYA 3LW0A 2HK5A 3PPZA 3LCTA 5DEWA 5ACKA 3ATTA 1ZY5A 3IS5A 4C4GA 3NDMA 4MNFA 4KIQA 4C2WA 4YSMA 4U9AA 3RZBA 2ZV2A 5LMBA 4FZ6A 3DDQA 5E92A 2QOQA 3LE6A 2CN5A 4LGGA 2NRUA 3UNJA 4HNIA 1OECA 2BIKB 2YISA 1BLXA 3QWJA 4FI1A 3ZDUA 4RT7A 4C4JA 2J50A 1PYXA 4YBJA 2XM8A 2JIUA 4BCGA 2PVMA 2XIKA 4ZSGA 3CR0A 3C9WA 5FM3A 4BYJA 3ERKA 2XCKA 3PXQA 2C47A 3LFEA 4PF4A 2GNGA 4RIYA 3HMMA 5HD4A 2GHLA 2PUIA 5GINE 3GBZA 3Q4ZA 5HG9A 4ENXA 5LJJA 4JAJA 1EH4A 2OZOA 2UW6A 3ZH8A 2VX0A 3NUYA 3ETAA 5EYCA 5FEDA 1B39A 2Z7QA 4H3BA 4O38A 4YJNA 3SV0A 4AW5A 4EH6A 2QG7A 4IM2A 3FUPA 2X9EA 2GNIA 3KGAA 3MS9A 3FAAA 3MTFA 2Y6OA 4E20A 2PVLA 3ZRLA 4EL9A 3OVVA 1L3RE 1YKRA 2GMXA 3RVGA 4ZTQA 3H30A 1T46A 1PHKA 4QMLA 3MBLA 3N4TA 3TXOA 3UP7A 2C3IB 5M55A 3DOGA 4UMQA 1P4OA 3MTLA 4XS2A 3WF5A 3G6GA 3EQFA 4F1MA 4FTNA 5HI2A 4FK3A 5EYKA 3MA6A 1XJDA 1YW2A 3UIMA 4BBEA 4BCIA 3O8TA 2J0MB 3LZBA 4GS6A 1QMZA 5AP4A 4C59A 5ETFA 2XIZA 4E3CA 2P3GX 2R7BA 4NH1A 3TIYA 4BZDA 5LXMA 4BTKA 4PRJA 3ZO2A 1JLUE 2NNWB 2BAKA 4U81A 5AR7A 5G1XA 3FZPA 3HV3A 5CYIA 4YJVA 3UC4A 4IFCA 4ZLYA 2IG7A 5CVHA 5AR3A 2WELA 4AX8A 2R3IA 3HV7A 4L45A 5F94A 1FVRA 4WG3A 2VWXA 3P7BA 4LRMA 3OCBA 1Y57A 2WAJA 4QMYA 2UZUE 4G17A 4ZTHA 3WZJA 3SA0A 4LGHA 4B8MA 2CGUA 1IRKA 4BYIA 3AMYA 4WNOA 3GT8A 4BTMA 3E64A 1Q3DA 3C50A 3HAVA 3R6XA 3TZMA 2FB8A 4OLIA 1KWPA 4XG6A 2WPAA 2XH5A 2BVAA 4YJPA 2DUVA 2XYUA 4BI2A 4BKZA 4D4RA 4I20A 4APCA 3BIZA 3B2TA 1YXSA 2C6MA 3U8WA 2PVKA 4WD5A 3W2RA 1KE5A 2JDRA 2OJJA 1UNLA 2OI4X 3IECA 4NK9A 4Y46A 5HEZA 4DEEA 4WBBB 4F1OA 5BYLA 3QUPA 3QBNA 5AR5A 2OH0E 2UW0A 5CQUA 2NP8A 3L9LA 3EL8A 4LV8A 2BRBA 4RWKA 3FYJX 2C6EA 4XCUA 3UMXA 4FIJA 3G15A 4X7QA 2QU6A 3PJ2A 4FSUA 3MVHA 4AA0A 1Q61A 2UW8A 3BHUA 4RX9A 2BZKB 2BZIB 4EOQA 5IF1A 3VS1A 4Y5HA 3RHXA 3U54A 3NIEA 2C69A 4O2PA 4Z55A 3JPVA 5CAVA 3QQJA 1OGUA 2A0CX 3C51A 2XBAA 1F0QA 1KE6A 3QKKA 4IAYA 3TEIA 5ICPA 3Q6WA 2W1CA 4DG0E 3ZTXA 3DJ5A 3S00A 1Q62A 3GU5A 5EHLA 2ERKA 3MPMA 4A9RA 2DS1A 3ZC6A 5FXSA 4EWHA 3SC1A 3R7GA 4G3DA 3QLFA 3C4FA 4YR8A 2BRNA 3SQQA 5AADA 4PY1A 3BKBA 3OC1A 5A6NA 1ZXEA 3DK3A 3DBDA 5JGBA 4DFXE 3G9NA 4EOKA 4RA5A 3UG1A 5FDPA 4KUJA 3FKNA 4RQKA 4ITHA 3RWPA 3TZ7A 3MESA 2C6LA 3NMUF 1U46A 3UO4A 3PVUA 4CG8A 3FJQE 4OUCA 4HCTA 3BV2A 2W9FB 2X4ZA 3OP5A 4BHNA 5AEPA 5IA1A 3QF9A 3BQCA 3CTHA 4YZBA 2QOKA 2EUFB 5C01A 4ASXA 4KSQA 3SXFA 3C4ZA 2R0IA 4J97A 4X2FA 4IX4A 2LGCA 2OXDA 3QHRA 4YJTA 5ANIA 4XBUA 2WQMA 5IZFA 5HVKA 2B54A 2KULA 3Q6UA 3EQPA 4Q2AA 3W8QA 2BDWA 4NEUA 3GCSA 3U4WA 3UOKA 2RF9A 4C2VA 3F2RA 5LMKC 3QX4A 4E6DA 4XMOA 4FZFB 1L8TA 5IEYA 1YHWA 3RM6A 4RVKA 4IJ9A 4AU8A 3W2OA 4GV1A 2VTMA 5FBOA 2H8HA 5HG8A 2VWIA 4J71A 4ITIA 4BVUA 4PTEA 2C3JA 3MPTA 4XNEA 5JQ8A 4JBVA 1OIYA 5HNIX 4O81A 3LIJA 3H9OA 5JRSA 2YA9A 3FBVA 4M66A 3DV3A 3ENHA 2YCFA 4I23A 4LGDA 3BWJA 4MNEB 5HO8A 4BDGA 4MD8E 1GNGA
chains in the Genus database with same CATH superfamily
5J9LA 5TKDA 4CYIA 4DEHA 3FQSA 3Q04A 2PE0A 4F65A 5AR4A 3EN6A 1H25A 1V0PA 3FLZA 4PNKA 3BHHA 3KCFA 3CE3A 2C5YA 4XG8A 3R1YA 4LG4A 5HG5A 4FVPA 3S1HA 5CAOA 1WAKA 3NGAA 4QMMA 3LJ0A 4L44A 4FZ7A 4ERKA 4OBQA 3PE1A 5C4LA 1JOWB 2HZ4A 3B2WA 3CBLA 1JAMA 4Q5EA 2YEXA 3DAEA 4ANQA 2X4FA 1XR1A 3KA0A 4H3QA 4ZJVA 4TRLA 1UU7A 2WTDA 4KRDA 3GB2A 3VC4A 4FIFA 2C0IA 3W0SA 1IG1A 3PJCA 4NIFA 4TYEA 2WEVA 3PUFC 1SMHA 2VN9A 3VRYA 1G8JA 2WGJA 4C38A 5CI6A 4DEGA 5FP5A 2VWWA 2XB7A 5M51A 2A27A 4EORA 3FY0A 3V8TA 4R7IA 4B7TA 1OUYA 2X2LA 3Q4UA 2C1BA 3OTUA 2BUJA 3MN3A 5IA4A 5AUUA 2XBJA 2I0VA 5A4CA 2VTRA 2NYAA 3NZ0A 4ZY4A 3PA4A 1GAGA 4RA4A 2RFEA 3CCNA 4BGQA 1OZ1A 2C6TA 2YJSA 3G6HA 3W2QA 4Z7GA 4RVLA 1CM8A 3H3CA 3K54A 5JSMA 4K2RA 2HY0A 4FR4A 5DMZA 4AN2A 2G01A 4IVBA 2GS6A 1CKJA 3NW5A 4O4DA 4EK8A 5G6VA 4DEDA 4EHGA 4EYMA 3KIOC 2PVRA 4HYIA 4UZDA 5L2TA 4MBJA 4ID7A 4G6LA 3W55A 3P5JC 4QYHA 5CXZA 2B9JA 3D2KA 4FODA 5DRBA 4FEVA 3CIKA 4FG7A 4GW8A 1VEBA 4XRLA 4BDJA 3QU0A 4JDKA 4E4XA 1OPKA 5KHXA 4O7TA 3G2FA 5C4KA 3ALOA 2R3JA 2UZEA 3I60A 4FEUA 4Q9SA 3SW7A 3II5A 2CKQA 3JR1A 4FIGA 5AUVA 1UU9A 4O83A 2J5FA 4I5PA 3COIA 4CFMA 4EI4A 5DT4A 5AUZA 2QODA 4I92A 3UDBA 2PE2A 3W2PA 3NAXA 4J95A 3U55A 3CPCA 3I4BA 4F0GA 1W0XC 4BTFA 2B55A 2JDVA 1STCE 3AG9A 3DU8A 3UO6A 3QD4A 4FTLA 4YZNA 4F6SA 3FZTA 3VQUA 3SOCA 3QD0A 3MVMA 3V6SA 3JVSA 4FT5A 4R5SA 2HXLA 4HZSA 3V5JA 3G0FA 1B6CB 4F7NA 5BMSA 4GL9A 4J98A 2Z2WA 2XRUA 4H39A 1PMNA 5IMXA 3JS2A 5B0XA 1KE9A 1E9HA 5DT0A 3EQHA 5CANA 3L9MA 4L3LA 1K3AA 2XIYA 4GUBA 2WFYA 2BKKA 2E9VA 4IVDA 3QXOA 3QD2B 2QONA 3AC2A 4E73A 3R1QA 2WMVA 3BYVA 4ZJJA 5KMMA 5EI2A 5ACBC 3RP9A 4J1RA 5J95A 3ROCA 3VBWA 5HLWA 3PSDA 1YI3A 3OT8A 3GC9A 3PPKA 5HE0A 4UB7A 4WSQA 4C34A 5KHWA 2XALA 3FWQA 3BL9A 3KB7A 4D58A 4IMYA 3CY3A 3L9NA 3RM7A 2RSVA 4RIXA 1V0OA 4CCBA 1E1VA 3GUBA 5HE3A 4A4OA 2YAKA 2W99B 5L2SA 4BIBA 4FV3A 2R3MA 3NVMB 4FE2A 4G3EA 3RAWA 3U4UA 3OOMA 2H6DA 1PYEA 1Y91A 3B8RA 4D1SA 2YM8A 4TYHB 2E9OA 2XEZA 2XNEA 5BNJA 4EH3A 2GPHA 3LMIA 3UDZA 1YVJA 1J1CA 1YWNA 3LHJA 3NVKI 4R77A 1U54B 4BCQA 1LEZA 5D10A 3REPA 4O7LA 3UOLA 3O71A 4GK2A 3DBQA 3K2LA 5DHJA 3NIZA 3W0NA 1PXJA 3IKAA 2F2UA 4C3FA 4QP4A 4W9WA 4ARKA 2OH4A 4J53A 5JT2A 5L3AA 3IOPA 3ZLSA 4ZS4A 2ZDUA 4CV9A 4GIHA 4M97A 2P4IA 3EIDA 3HP2A 4M14A 3SRVB 4UWCA 4RJ3A 3ORTA 1KSWA 4WNKA 3LQ5A 3W16A 3W2CA 4EOJA 2OF2A 2HXQA 2OF4A 3TTIA 4CRSA 2B4SB 1RDQE 5CSVA 2BCJA 2XK6A 3BEGA 4EH4A 4CFVA 3PZEA 2XJ2A 3NLBA 3SD0A 4FNYA 2ZYBA 2X8IA 3SG9A 2W1DA 4NUSA 4DT8A 1Y8YA 2HIWA 4XG4A 4CMOA 2VV9A 5KBQA 3PPJA 3HP5A 4H3PA 3BE9A 4G3FA 1OL6A 4AXCA 2OICA 2W4OA 5CT7A 4BR3A 4DA5A 1S9JA 1KE8A 4RVMA 4XRJA 4XV1A 4AZFA 4HVIA 5FXRA 4I5MA 1ATPE 4O0VA 4XV9A 3FLQA 4Q9ZA 3QLGA 3BL7A 3GXLA 1YI4A 4PPCA 5JKGA 4FIIA 3BYUA 3COKA 4BDIA 4FTMA 4QMUA 3HA6A 3WILA 5CEPA 2XM9A 3R8UA 4C4FA 5B2MA 3DXPA 4CKRA 4M0ZA 5H2UA 4E93A 4FICA 1OBGA 4O96A 4O7ZA 3BX5A 1SNUA 1WZYA 3QWKA 2BZJA 3ZYAA 3AOXA 3NNXA 1OL2A 4AS0A 4CCUA 4YO4A 5GJFA 1NVQA 3UZTA 4N6ZA 4CKJA 3PA5A 4CLJA 1YWVA 4AOJA 4DHJA 2VTOA 5D41A 4IB1A 4KKGA 4OTGA 3VQHA 2ETMA 1XO2B 4NKSA 5LVMA 3R00A 4F1TA 2H9VA 4EC8A 2ITNA 5M44A 2LAVA 4CGAA 1ZYDA 2DYLA 5FDXA 3D15A 3JY9A 4AZEA 3O8UA 3PXYA 2XKCA 1PF8A 4QP3A 2UZLA 4XLVA 3LLTA 4LDTA 4ANSA 5JMSA 4CRLA 3HEGA 4OAUC 1JQHA 5K0XA 3LXPA 2ZAZA 4Q5HA 3CEKA 1PXMA 2QURA 2UW9A 3N51A 3BGZA 4IAZA 3OWPA 4L3PA 4L53A 3SKCA 2VNWA 2AEGA 5HOAA 5LCJA 5CF4A 4BKJA 5ETCA 3F61A 1ZAOA 4IX6A 4X2KA 3LFFA 4FEQA 5DN3A 5HE1A 3UOHA 4FA2A 5M4IA 2J7TA 1LP4A 5HESA 2Y9QA 4EBVA 3RPVA 2PY3A 2F7EE 3WI6A 1H00A 1Z5MA 3CQEA 4FKWA 2JDSA 3GENA 5FM2A 4G6OA 4DF3A 3GNIB 5CNOA 4AW2A 1FBNA 3GU4A 5L8KA 4G9RA 2QKRA 3IDBA 3U6JA 3EN9A 4X3JA 3UP2A 4Z16A 1KV1A 4FV9A 4NL0A 4QPAA 3NUUA 4TN6A 4ANLA 1XBAA 5E8VA 4K33A 1V0BA 2EB3A 2VWZA 3I6WA 1H4LA 2JBPA 2YWPA 3D14A 4K6ZA 4EKKA 3N9XA 4KIKB 2Y4IC 4RIWB 3ZXTA 3EQRA 4EOMA 5BPYA 5LVOA 1PXIA 3MSSA 5LVPA 3MB7A 3IQ7A 3W0PA 5HORA 5AR2A 3QCQA 5CF6A 2WTKB 1JKSA 4M69A 5HHWA 4O0XA 2E9PA 4LYNA 2XYNA 2XK3A 3CC6A 3TUBA 1RJBA 3BRBA 5EYDA 3KRRA 4BDHA 5M57A 2VUWA 3E7OA 3PUPA 1OVEA 2QOBA 5DGZA 5CI7A 5I9UA 3NRMA 2XNBA 2WMXA 4GYIA 2QR7A 2X2KA 3G0EA 3ACKA 3CKWA 4B4LA 4DN5A 5KKRC 4EOPA 2XNNA 4BDAA 4QP1A 5DVRA 3UMWA 3NEWA 2HW6A 3BLHA 3CGFA 4HZRA 4USEA 2AC5A 3ENMA 1KV2A 5I3RA 2R64A 2WIHA 4MD7E 5DYJA 3UPXA 3ZEPA 1I44A 4LMUA 4WA9A 4UMTA 2XCHA 4EHZA 2OGVA 3D7TA 3QRTA 4PMMA 2IZTA 3HMIA 3RPSA 2GTNA 1BI7A 3DTCA 3PVBA 2JAMA 4DEBA 5HBHA 5F20A 4ZZOA 5C26A 2QOLA 3DLSA 4XBRA 2ZM4A 3AT4A 4O84A 2QC6A 3F5GA 4RBLA 4X3FB 4PX6A 4U43A 2OG8A 2AQXA 2IVTA 4FT7A 1H1WA 4O0YA 4OTQA 5D12A 5E8WA 4ZTLA 4EH5A 4CVAA 4IQ6A 2C6KA 5IH6A 3I0OA 4V05A 2JKQA 3PY0A 3AKJA 3NX8A 2ZB0A 2FYSA 2YIWA 4J7BA 3ZM4A 2OIQA 4X21A 3HRBA 3L8PA 4U41A 4B9DA 5TR6A 1FQ1B 4L7FA 2WMAA 4FSZA 5AMNA 4DCEA 5LQFA 2R3LA 3R22A 4JIKA 1UA2A 3KCKA 4GT4A 3OOGA 2FSMX 2P33A 3GU6A 1YOMA 4IAKA 4LQMA 3RMFA 4GT5A 5EW9A 3BHTA 4YURA 4PDYA 2VTNA 2H96A 4QMNA 2C0OA 4CTBA 3QTXA 5IQHA 1UKIA 3NUXA 3BHVA 3P78A 4HPTE 4BDFA 3TUCA 1ZZLA 3FSFA 4FSWA 1MP8A 3LMGA 5K5NA 4E6CA 4BIDA 2OJGA 2A4LA 1U59A 4FV0A 2PZ5A 4QT1A 4M7IA 3ZO4A 4I6LA 1CKIA 4W4VA 5BVNA 1SYKA 4UMPA 2EXCX 2OSCA 3KXHA 1JSVA 3LKMA 1YOJA 3ZSIA 4JL9A 4R7HA 3NNVA 3PWDA 3W18A 3A7IA 3F7ZA 4UV0A 5AWMA 2QLUA 4ZTRA 2J4ZA 2X7GA 4IC7A 5IUIA 3QQHA 1LEWA 3CQUA 4AZTA 4EQCA 2JKOA 5D9HA 5IQCA 1OBDA 3MH3A 4TWCA 4O7NA 4ACDA 3G90X 3QQFA 4U79A 4WNPA 5HZNA 2Y0AA 4R6VA 3KRJA 4L3JA 4XV2A 3F3UA 2W5HA 2UVYA 3DB8A 4A7CA 4UZHA 4C4HA 1KUTA 4AGDA 3UOJA 1W84A 1Q4LA 2OIDA 4RJ5A 4QDVA 4H58A 3D83A 3O0GA 4JS8A 4ASEA 4UMUA 3RHKA 5BUJA 1ZMWA 3H0YA 2XJ0A 4IDTA 3WYYA 3I5ZA 4IADA 2VU3A 4GIIA 3TJDA 4I3ZA 5IA5A 4I21A 2ZFYA 4B99A 5AV0A 4CFUA 4EK4A 4QYYA 1IA9A 4FKOA 4ZSEA 5FEQA 3CD8A 3LQ3A 4EOLA 2IEWA 3ORLA 4IFGA 2VTAA 3DB6A 4RVTA 3ZCLA 5IQAA 5L6WL 4C3PA 3HMNA 1GZ8A 4RMZA 1VJYA 4L9IA 2WO6A 1U4DA 3D7ZA 3HNGA 4V0GA 5AV4A 4YJOA 1IAJA 3Q52A 1IA8A 2IW6A 3TCPA 4FV7A 1PKGA 4V04A 3ZRMA 5JEBA 4USDA 5KMNA 3NYNA 4I24A 5CU2A 3FLNC 1G3NA 2ITUA 3FQHA 4F64A 3RINA 4S33A 4ONAA 4EZ3A 3BEAA 4K8AA 4F99A 4DINA 2OFUA 3DXQA 3H10A 3SXSA 3DY7A 2JGZA 4PWNA 3I6UA 2UZDA 3A2CA 3NSZA 1ND4A 2UW5A 2QU5A 1XH9A 3MH1A 2O3PA 4FG8A 4QMXA 5E8TA 5H8EA 3PLSA 4A9UA 4EUTA 3E63A 3LPBA 4AFEA 1ST4A 1JKKA 1PXLA 2J0KA 2OLCA 2ACXA 2P0CA 2X6DA 4FIHA 2J2IB 3IOKA 3R8PA 3GCPA 3AT2A 3Q2MA 4OGRA 3RKBA 4EUUA 2XAOA 3PFQA 4FGBA 4FNXA 3VUKA 3AKKA 4XLIA 3HYHA 1W7HA 3C4WA 4MKCA 2EWAA 3NNUA 3UVPA 2C6IA 3FLWA 3DBCA 3G5DA 2ZV9A 1P4FA 2X1NA 3ZSHA 4FX3A 1H1SA 3L9PA 4U42A 2CJMA 4YTHA 4MHAA 4D9UA 3BHYA 4YTCA 5GIPE 3OWLA 4FOCA 3POZA 3KVXA 3HDMA 4JR7A 2FUMA 3OCGA 3FI2A 2X7FA 3F9NA 3P08A 3CPBA 5AP6A 3RK9A 3H0ZA 2C6DA 2C0TA 1XBCA 4JJRA 4RFMA 3TT0A 4O6LA 4TKSA 1QPDA 5CAQA 3F3ZA 1REKA 3F3WA 2VGPA 5IU2A 3N4UA 3KVWA 3V8SA 4NYEA 3MYGA 5FTQA 2GU8A 1PW2A 4Y83A 2PZYA 5EQEA 1YWRA 5CQWA 1XBBA 2UVZA 4NSTA 4YC8A 4ACGA 4WHZA 1PY5A 2XNMA 5JGDA 1SVHA 4IJPA 4EC9A 2QOIA 3CLYA 5EQYA 2WTVA 2GTMA 4O6EA 5EYMA 1QCFA 5EI6A 3D4QA 4CNHA 3OY3A 1JSUA 4FKSA 4DE4A 5T3QA 3A8XA 3O5AA 4AT4A 3MY1A 3QC4A 3HAMA 3TMOA 1OKZA 3F82A 4RX7A 3Q9YA 1YDTE 3DLZA 4J52A 3TV7A 4YTFA 4FV6A 4L8MA 3QKMA 3IG7A 3FZ1A 2XJ1A 3AC3A 4YC3A 3TNQB 4OTIA 3ZBXA 4EH2A 3C1XA 3F5UA 3MWUA 3A4PA 4BWKA 3CSVA 3BI6A 4QMQA 2HOGA 3EMGA 4FL1A 5IQFA 5FTGA 2GNHA 2YACA 2YLFA 4F7LA 4Z7HA 3A7GA 3P7CA 2ITYA 4M68A 3OHTA 3T3VA 4O27B 5BQ0A 4RIYB 2X6EA 3JVRA 3LJ1A 3QA8A 3GU7A 3P4KA 4MWHA 4UWYA 2F9GA 3E93A 4D28A 4DG3E 4E5WA 2CGVA 3MFSA 3R02A 3E3BX 2W9ZB 4JX3A 3Q53A 2CKPA 2GDOA 3E8NA 5J9YA 3K3IA 3QCSA 2ZMDA 3B8QA 1CTPE 4MTAA 3SGCA 4IAFA 4DAWA 1M17A 3C4CA 4MXAA 3Q3BA 4J8MA 4GJ3A 3MIYA 4IZYA 4OTWA 3FQEA 3F5PA 5D1JA 3U51A 5EKNA 1SZMA 2DWBA 5J8IA 3MFUA 4I0TA 1DI9A 3QQLA 2R4BA 5HO6A 2OW3A 2PVYA 5F1ZA 4HGTA 5HCZA 4CYJA 3DBEA 4L00A 5AJQA 4HVDA 4JX7A 1YDSE 4JXFA 3ZHPC 2ITZA 4G6NA 1R0EA 4BCKA 5BVEA 3VF8A 1ZYJA 4YC6A 5A14A 4FTUA 5DA3A 3OUNB 4EZ7A 2YM7A 5CEMA 3WBLA 5J1WA 1BI8A 2G15A 3AC5A 1V1KA 4BDCA 4CMTA 3VULA 5I9WA 4PQNA 3WOWA 4FMQA 2I40A 1J7UA 5DH3A 4WSYA 5DE2A 2VGOA 3ACJA 4EONA 3BU6A 3E8DA 3KMMA 4UXLA 3ULZA 4ANOA 5CZHA 1W98A 2IJMA 3ZZWA 3KXNA 3R04A 1BX6A 2V7OA 4IXPA 3TNWA 3CP9A 4AW1A 4DH8A 4N0SA 1VR2A 1Q41A 5CALA 4IB5A 1F3MC 3LCKA 5BMMA 3BLQA 4X2GA 4ZJIA 5DRDA 3ZUTA 4XP3A 4MK0A 2CNQA 3ZS5A 4ZLZA 4P90A 4ZZMA 2Z02A 3OROA 2P2HA 3PG1A 2YM6A 4FV2A 4F78A 5EHYA 4Y8DA 3KF4A 2XKEA 2VTLA 3IDCA 4PV0A 3LJ2A 4XV3A 3TG1A 3T3UA 4DHFA 3U6HA 4QPSA 3OCSA 2JC6A 4IW0A 4P5ZA 5IQIA 4LMNA 1JBPE 2BPMA 3QYWA 5LCKA 1SVGA 3QRKA 2BALA 4W4WA 4WRGA 5BVWA 5M4FA 4H05A 3PSBA 3T8OA 4G2FA 2KTYA 4IM3A 3R7EA 3NAYA 3QZIA 4MXCA 4FYNA 4ZY5A 2CGXA 1URCA 1O9UA 5DBXA 4FJVA 4YHJA 3R1NA 3FI4A 5H3QA 3R7UA 3F2NA 1PKDA 1E1XA 4AWIA 5H9BA 2R3GA 3FMNA 2ZMCA 4HGEA 2WQOA 4GSBA 4MNEA 4ZXTA 2PVHA 1PXNA 3QX2A 2JDOA 2UZTA 2VTQA 4PP9A 4FYOA 5D7AA 3PXFA 3H9RA 2ERZE 4KBAA 5EH0A 2WQEA 4AA4A 3HECA 3MFRA 3V6RA 3FMJA 1VZOA 4L68A 5FP6A 1FMOE 3U9NA 2CMWA 3BV3A 3FE3A 3NS9A 4UMRA 4C02A 4AN3A 5DG5A 3R71A 4XH6A 3TZ9A 5JZJA 3E7VA 5HIDA 1OL5A 4FSYA 5B2LA 2GNLA 4RG0A 5HICA 1YXXA 3LFCA 3Q96A 4U80A 5EK7A 1UNHA 3S95A 3VW6A 1R3CA 4ALUA 5M4CA 2ETRA 3VS3A 4C61A 4F0FA 2J0LA 1BKXA 3FZRA 4CQGA 3OXTA 3NFFB 3UE4A 4L43A 3KU2A 4U7ZA 4G5JA 2QOHA 3KN5A 1BL7A 2NO3A 4USFA 4DFNA 3U6IA 4YPSA 1Q8YA 2IVUA 2J9MA 5EFQA 2F7XE 3ZLXA 2W5AA 1DS5A 3PY3A 3MPAA 4O7RA 4CT2A 3LXKA 2CLXA 3VS2A 4W8EA 4TNBA 1OMWA 2I1MA 3RZFA 5CLPA 2QVSE 4O0TA 1OKVA 3D9VA 3VIDA 4BCHA 4HW7A 5CY3A 3KL8A 1PXPA 3RAIA 2R3RA 4FOBA 4QTBA 4QMVA 4YU2A 2E9UA 4LV5A 3MY0A 4ZSAA 3PVGA 3R9DA 1ZYLA 3OXIA 4DLJA 4PPAA 3NWWA 3PA3A 3G33A 4JLCA 4QP2A 5FD2A 4NJDA 1FVTA 4C7TA 3FMHA 2IWIA 5FTOA 3RWQA 1P14A 4QMSA 1MRVA 4D4VA 4RSSA 4EWQA 3I7BA 3DFCB 4I6FA 4YGAA 5IUHA 3UQGA 5EM6A 1T45A 4YJQA 4CT1A 3K3JA 1ZZ2A 2R3FA 4I6BA 4U0IA 5J7HA 5TT7A 5J5TA 1G8SA 1XKKA 4IM0A 1J3HA 3QRJA 5FUTA 3FZSA 5DOSA 3BU5A 2IF8A 2BZHB 3GCUA 1R1WA 4BZNA 5HVYA 1XH6A 2WMUA 3PRIA 5BVOA 3ID6C 3NCGA 3EQBA 3ZFYA 2X0OA 3VONA 2WNTA 3EB0A 4K1BA 3PYYA 3FDNA 5AUXA 5IMEA 2BFYA 4MXXA 5CU0A 3R8VA 4F09A 3FV8A 3ORZA 2IZSA 3G9LX 3DFAA 2YCSA 4GVJA 3UIUA 3VVHA 4AZVA 5EQPA 3FKOA 2YM5A 4EBWA 3R7OA 2OJIA 2JKMA 3MA3A 2QQ7A 4M84A 4LRKA 5KO1A 3PP0A 3P5KA 4FSMA 2R3KA 5IPJA 5AIRA 1J7IA 3COHA 5IQEA 3KMUA 1PXKA 5EKOA 5HU9A 2XARA 3DS6A 3NNWA 2R2PA 3EOCA 3A62A 3IW4A 4TWPA 4TYIA 4BI0A 4EEVA 3VS5A 4G3GA 3C5UA 4U44A 4ACMA 4C58A 3EN4A 4CV8A 3LFBA 3V5QA 2XS0A 2ZM3A 3FC2A 3MB6A 3W8LA 1Z57A 5AAEA 1NT2A 3VUMA 4WBOA 4C4EA 3P23A 4HGLA 1J7LA 1LR4A 4W8DA 5B7VA 1TQMA 5E9EA 4H1JA 4QYGA 3UVRA 2WTCA 4RZWA 3BBTB 3VUDA 4EH8A 4KB8A 2RFDA 2CN8A 3RK5A 1O6KA 4DBXA 5A4QA 4UY9A 5E8ZA 2W1FA 2R0UA 2QD9A 3C7QA 2Q0NA 4QPMA 4FL3A 4FVRA 5CS6A 3SOAA 4CZUA 5BUEA 4TYHA 3ZFXA 3Q60A 2I0EA 1WVXA 5I3OA 4FKVA 3V8WA 3QGYA 2X39A 4H36A 1Q3WA 5KUPA 2VTSA 3D0EA 2ZV7A 3TKIA 4NTSA 5CU4A 1K9AA 1XMMA 4G9CA 5CF5A 4UYAA 1R0PA 3EH9A 2UUEA 4GFMA 4HGSA 1GZOA 1BYGA 2Q0BA 3SRVA 3EQIA 4FEWA 1NA7A 4P2KA 1RW8A 4FKGA 2WEIA 1JKTA 5IDNA 5EHOA 4HNFA 2XNOA 1SNXA 2FVDA 4MF0A 4S2ZA 3UJGA 3P86A 2O0UA 3FMDA 3IGOA 5CSHA 2CSNA 3GC8A 3W1FA 4FSRA 3TYKA 3M11A 4HYHA 1FVVA 4YLLA 1Y6BA 4O4CA 4O4EA 4S34A 2WMRA 3Q9ZA 1PMUA 4E8AA 4Y85A 3R28A 4NCTA 1X8BA 3R30A 3QCYA 3ALNA 4TTHB 1AGWA 4JDIA 5E8YA 3RPYA 3DAJA 3F5XA 1H8FA 3PJ1A 3ORKA 1MQBA 5JFVA 2XKDA 5EOLA 3RNIA 3WF8A 4U40A 4DEAA 2X0QA 2X8EA 4B6LA 3C4XA 3WIGA 4ZLOA 4D0WA 5AV1A 4D2RA 3EZRA 4CEGA 2RFNA 2IPXA 2WTWA 2QLQA 2JITA 4FV8A 4GFOA 1PMVA 2PMOX 3E88A 3GC7A 4IVCA 4MVFA 3RNYA 3UIXA 1JKLA 5BV3A 3C0HA 3TN8A 1GIJA 4O0RA 3F7WA 3E87A 5AM6A 2UZNA 5J9ZA 2BFXA 2Z7LA 3PE2A 3W10A 4D5HA 4F9BA 1JNKA 3R7VA 4AXEA 3QZGA 3HRFA 3OCTA 4L46A 2V22A 2WMQA 4RRVA 3MGYA 4O0UA 3CGOA 4LOQA 2HZNA 2VTTA 4I6HA 4XG3A 4FT0A 3R7IA 3ODYX 3ZFMA 3ELJA 4OTPA 5CEKA 4ZOGA 4CG9A 3OT3A 5HVJA 4N70A 2IW9A 2V55A 3OW3A 3R63A 2J5EA 2VO3A 4BJJB 2F4JA 2WD1A 3AD4A 3PJ3A 4PL4A 4DDIA 2EB2A 2ZDTA 2QKWB 4YHFA 3W33A 3P7AA 4O0SA 4QQTA 1MQ4A 3ITZA 5IG1A 4GKHA 3KC3A 5E90A 4ZS0A 2VTHA 4XOYA 1OKYA 5KBRA 5L6PA 2GHMA 3PTGA 2AYPA 3Q5ZA 4BJJA 4GEOA 2RG6A 5M09A 1TKIA 3Q9XA 4KBKA 4ZMFA 3FMEA 4QTCA 2XAMA 4YZ9A 3PXZA 3S3IA 2VTIA 5JZNA 4O7WA 3G51A 2ZB1A 4BDEA 1WBPA 3VO3A 4BRXA 2WXVA 4UBAA 5AX9A 1I09A 2YM3A 1IR3A 1DAWA 2PVNA 3DKOA 4QMPA 4BCNA 2ETKA 3UZRA 3OEZA 4ANBA 3KY2A 5AAFA 2GQGA 4R3RA 4QMOA 3AD6A 3HZTA 1URWA 4C36A 3EQGA 3R2YA 4RJ6A 2VO7A 5H8BA 2UZVA 4AGCA 2V0DA 3EHAA 4G3CA 2PZRA 4L01A 4FL2A 3K5VA 1FMKA 2BRGA 4M0YA 4BI1A 2FH9A 1WBTA 4CXAA 3EN7A 4RWIA 4UX9A 5HX8A 1BL6A 2XK9A 2C68A 2X9FA 3GC0A 4FTRA 4KIKA 4RIWA 4TT7A 3U9CA 3VS7A 5T6KA 1OIRA 4K18A 4NJ3A 2C4GA 2ITQA 3HUBA 1WFCA 4E1ZA 4Z9LA 2UZWE 4I5HA 4QTAA 2YERA 3QQGA 3SDJA 3UGCA 2QHMA 1H24A 3QYZA 4QNYA 5GIOE 2WIPA 3DCVA 3F3TA 4NWMA 5CEIA 2Z7SA 5CX9A 4QP9A 4QP6A 3Q9WA 1M14A 2EVAA 2RFSA 1TQPA 4FTKA 4ZTNA 2GCDA 3PXKA 4LL0A 1UKHA 3VBTA 4BDBA 3S2PA 2PZIA 5EOBA 4C3RA 3F3VA 4DTAA 3F88A 5CXHA 2VWBA 5C9CA 3F6XA 2YJRA 3GQIA 5AV3A 1AD5A 4BHZA 1H07A 2B9FA 2OJFE 3C5IA 5EW3A 3V5LA 2JD5A 1QPEA 2IZUA 4IAIA 1VYWA 4K77A 2QHNA 4OR5A 3SXRA 5CEQA 2VNYA 3S0OA 3QUEA 2W96B 3KK9A 4NM7A 5DI1A 3S4QA 3H9FA 4X3FA 4DG2E 2VWVA 3NW6A 5CEOA 3BCEA 5EDPA 3LCDA 4WUNA 4DHIB 4LUDA 2XK7A 4EK3A 3BYSA 2GFCA 4JR3A 4O1OA 3KULB 4WOVA 5LWMA 5FRIA 3AXWA 3K5UA 5BVFA 4YP8A 3A7HA 4IHPA 3FPQA 3R73A 3KRLA 2ZVAA 5HBJA 3ORMA 2A1AB 2UW4A 4IACA 4AFJA 3QQUA 2WZJA 2XK8A 3KFAA 5A3XA 3O17A 4C0TA 5F4NA 3DBFA 4U3YA 4FZDB 5IQBA 3PRFA 5E1SA 4ZP5A 4BGGA 2G2IA 5GZAA 2CCIA 2YDIA 4FKUA 2X8DA 4W4YA 1OIQA 3VS6A 4OBPA 4RJ8A 3EYGA 3ZBFA 4DTKA 2BAJA 3TV6A 4E4MA 5C8MA 3PFYA 2I6LA 1PMEA 4DITA 4CD0A 1PXOA 4U45A 3I7CA 3OS3A 4MD9E 2B1PA 3PP1A 4RPVA 1M7QA 4ENYA 1VLRA 3KK8A 4YZDA 3T9IA 4IBMA 3IGGA 5M08A 3ANRA 2RKUA 5K3YA 4PL5A 4RWLA 4M15A 4BDDA 4OAVB 4YJRA 3EQDA 4HVGA 4AGUA 3OBJA 4II5A