3TNIA

Structure of cdk9/cyclin t f241l
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
297
Chain Sequence
SVECPFCDEVSKYEKLAKIGQEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Cyclin-dependent kinase 9
total genus 82
structure length 297
sequence length 319
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tniA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tniA01
3QQKA 4IVDA 4BI2A 2OXYA 3TNPC 2YACA 3Q6UA 4QP3A 3Q2JA 4CZTA 3BPRA 5D1JA 3HGKA 4DGOA 5CEOA 4D4RA 2XNNA 4FV6A 3JYAA 4FT7A 2A1AB 2PSQA 3JY9A 4YSJA 3FEGA 1QPCA 4ZSAA 2PMIA 5EDQA 2XP2A 3NNWA 1Q3WA 1VEBA 2ITYA 3CKXA 3PIZA 4DEGA 5ETAA 4MAOA 3KL8A 1H28A 2QKRA 2ITOA 5AAFA 2UZOA 4AX8A 4Y8DA 4CFWA 1V0OA 2OIQA 4AZWA 3ZMMA 3ZLXA 3QTRA 4FNXA 4JDHA 4RVLA 4C4FA 4E6CA 5J7HA 2VO6A 5LCJA 4J95A 4W4XA 4MWHA 4F7LA 5IH5A 3ZBXA 5GJFA 1QPDA 4ZMFA 1L3RE 4FOCA 5CI6A 5EM8A 5A4TA 2OI4X 2CKQA 1A9UA 3OOGA 4GCJA 4C7TA 3PVGA 4DINA 3Q32A 1P14A 2GQRA 2R3IA 4LL5A 3CXWA 2J9MA 3MIYA 3ZUUA 1J7UA 4UYNA 4UMUA 4MWIA 1UV5A 3TKHA 4GT3A 3S1HA 3DDPA 3TUCA 2Y6OA 3PXQA 3BCEA 3DJ6A 4HOKA 2JDTA 3NX8A 3R7GA 5A4LA 3TIZA 5IG1A 3Q60A 3S95A 2CNVA 5M06A 3D14A 4PWNA 3V5TA 2HY81 4NFNA 1BKXA 4JBQA 1H08A 5F20A 5J5SA 5HO8A 5EQEA 1GIIA 3HP5A 3MPMA 3ET7A 3NIEA 3WE4A 2CJMA 2J5EA 3ORIA 4FE2A 3MB6A 3KMMA 3HMNA 3R04A 3EFKA 4ALWA 2BILB 5JT2A 3A8WA 3DXPA 5J8IA 2HIWA 4I21A 4O6LA 4MNEA 3UO4A 4TNBA 3VO3A 3FZRA 3MH2A 3EQDA 3HUCA 5HU9A 3LJ1A 3BWFA 4BB4A 2G2FA 1UWHA 4DEBA 3OROA 5GNKA 3QXPA 5FP6A 1ZY5A 3NAYA 4FK3A 4H39A 1OL6A 4QMSA 4PDYA 5DRDA 3ORMA 2VTTA 5E8UA 4BDGA 5AR2A 4TWPA 3LXLA 2C5YA 1UNHA 2YJSA 5KUPA 5HVJA 2HZNA 2JFLA 3SDJA 4ANSA 1YDSE 3QTWA 4F0FA 4NIFA 5CF8A 5AR4A 1G3NA 2RFDA 2ZDTA 5DN3A 4YZCA 1WBVA 5J1VA 5I3OA 4MX9A 3RPRA 2PVKA 5C9CA 4HGLA 5JZJA 2VWVA 1TVOA 1YXSA 4GYGA 2W4KA 4JLCA 5DR2A 4ZTSA 4MQ2A 4HYIA 5HLWA 3I60A 4RJ4A 1T46A 1ZYSA 1IEPA 4KKGA 2X7FA 4RC4A 5HG8A 3RNYA 4AGCA 4XG8A 3E92A 2QKWB 2J0JA 3BGZA 4IB3A 1H27A 2XM8A 2EB2A 2W1GA 3QA0A 4FKQA 4B8LA 3OCGA 4D9TA 3FMNA 4IB1A 4UMPA 5M4FA 1DAYA 3EQPA 3HP2A 4MD8E 4LI5A 4O96A 3ZBFA 3QGWA 5IEXA 4NYEA 5DR6A 3PXYA 4D5KA 5CAPA 3Q04A 4RVKA 2IW9A 2WMXA 3GNIB 4K0YA 4ZK5A 2BR1A 3KMUA 2OJ9A 5ETFA 4V0GA 3MTFA 2XH5A 5BUIA 2HY0A 1FBNA 2BDJA 1Q8ZA 3C4ZA 3BYSA 4ASXA 5DEYA 4XYFA 4YJVA 1XQZA 4ANBA 3VS6A 3NWWA 3WE8A 1NT2A 2OICA 3T8OA 2HW7A 3ZRMA 5IMEA 2JEDA 3GCUA 3D94A 1VJYA 5T68A 4QYGA 3PWDA 3S0OA 3P7BA 1JVPP 1XH6A 5A54A 4U9AA 3V5WA 4TW9A 2GCDA 4Z7HA 2I0EA 3QLFA 2UVXA 4H1JA 3T9IA 3PIXA 5C1QB 3IG7A 3NCZA 2NPQA 3LFBA 3P79A 3IOKA 4PQNA 4BCKA 4MXZA 4I6QA 3SG9A 3E7VA 5AEPA 1PXIA 3AC3A 4U41A 4EOOA 4BWPA 2ZVAA 2IZTA 3PG3A 3BEAA 5CY3A 5IU2A 1MQBA 1ZOGA 2GQSA 2R5TA 2G2HA 2XIZA 1O6KA 4AFEA 4U79A 3ZCLA 2R7IA 4PP7A 3SXSA 5ANGA 5LVOA 3VS1A 3PSBA 3BYVA 5FM2A 1W84A 3FPQA 2Q0BA 2PHKA 4XG6A 4M7IA 3PE1A 4FTAA 3JVRA 5KO1A 3QTSA 4FV2A 2WD1A 3D5WA 3GGFA 4RWKA 3O23A 4XV1A 5G1XA 4YNOA 3GU4A 4CLIA 3F3VA 5K0XA 1VYWA 4G9RA 4GK2A 4EBVA 5IA4A 3QQJA 2BKZA 4JX3A 2F7EE 4FIGA 2XCKA 4QO9A 3FHRA 5K3YA 3FZSA 4JG7A 5KZIA 2X2MA 5A3XA 1M2RA 2WZJA 4S2ZA 2W1CA 4A9TA 5CZIA 4HNIA 2E9UA 4IXPA 3NDMA 2ZV9A 3QTIA 4BN1A 5GINE 3B8RA 2I0VA 1PXLA 2JDSA 2R7BA 4GL9A 2BTSA 2VTNA 3OCSA 1G8SA 2AYPA 3HEGA 3IDPA 3KKVA 1XH5A 5F95A 4ZTHA 3IO7A 5DOSA 2PVJA 5I9WA 3QHWA 4QQJA 4DEIA 4EQCA 5LWNA 3E93A 2YN8A 5HLNA 4AA0A 4FTUA 3VUKA 4EK3A 3TEIA 3QZGA 2G9XA 1ZOEA 1JKSA 2B1PA 4KABA 3DBQA 3ZSIA 4DGGA 3A7GA 3QTZA 4Y85A 3BHUA 3COMA 3HYHA 3OVVA 2C4GA 3PA3A 1OKYA 4LV8A 2B9JA 3ZEPA 2BRGA 3IW6A 1NXKA 3E5AA 4R3PA 3MJ1A 5L2SA 2UW4A 2HCKA 2YDKA 3KXGA 3N51A 3NNVA 3PVBA 4FT3A 4FSZA 5DPVA 1PHKA 5HE1A 5E9EA 5AAGA 3FXXA 1YWNA 4IANA 3DKCA 4X3FA 2X7GA 3EWHA 2O5KA 3U6JA 3BWJA 3IK3A 3LCSA 1M17A 4IZ5A 4Z3VA 4CYIA 1W8CA 1OIUA 1WMKA 1YI6A 3DAJA 4Z9LA 4CXAA 3MH1A 4B0GA 3ZS5A 3FMLA 3UYSA 4XG4A 3BGPA 3DZQA 5IQEA 2G01A 2ITTA 4YZ9A 3UO5A 1IAHA 4XOZA 4UZHA 2RGPA 4D2RA 3COHA 5ANDA 2C3JA 4FKGA 2HZ4A 4LGDA 3DA6A 3V04A 2ITQA 5ANEA 5B7VA 3C0IA 3KEXA 2HZ0A 3KXHA 1HOWA 4K2RA 4FG8A 1E1XA 4MXOA 4K8AA 3KK9A 4FI1A 5A4EA 5C8KA 3L9PA 4J99A 4GG7A 1UU7A 4FKRA 4OTHA 4W4YA 4E73A 2R9SA 5LXMA 2PE1A 4AE6A 2BVAA 4L67A 4AZTA 5GJGA 3O17A 1B39A 3VS7A 2YIRA 3QCYA 3DKGA 3PPKA 4A9UA 3NUNA 3QZFA 1U4DA 3R7EA 3W10A 5L2TA 3EKNA 5DYJA 2BKKA 3LFNA 3A99A 4FUXA 4LGGA 2W5BA 5EHYA 5AIKA 3LMIA 4FEUA 3A61A 3C5UA 2VO7A 2R3FA 5ETCA 1FVVA 4DFUA 3OY3A 4BDFA 3BU6A 4O21A 4O7NA 5AM6A 4M0ZA 2YA9A 2WO6A 5AR8A 3R8VA 3UVQA 3MDYA 1MQ4A 3G6HA 4QTBA 4AN9A 1XH8A 5E7RA 4ZSJA 3IPHA 4I41A 4D2PA 2EB3A 2VWUA 3UP2A 4QNAA 4NU1A 3R9HA 3TM0A 2JDRA 3HA6A 3EN7A 1O6LA 2C3KA 2YIXA 4MQ1A 4MXYA 5HO6A 1IG1A 2XK6A 1NA7A 4BY9E 2CGUA 1AD5A 2QNJA 3C0GA 3DQWA 3RK9A 5CASA 5CI7A 2IZUA 3RBWA 4EC9A 4ZZNA 1V0BA 3PUPA 2GHMA 3HUBA 4ITJA 2B9IA 5FBNC 2H34A 5M4UA 3AG9A 4PTEA 4P90A 2P55A 3KGAA 3QU0A 2RFNA 4X2NA 2BZJA 4JG6A 5EQPA 2WQMA 2QOIA 2RFSA 4KAOA 4K6ZA 4RWIA 4S32A 4BCNA 5C8MA 4CFFA 2CCHA 5C4LA 5HG9A 3CJFA 3OBGA 4I6HA 2YABA 2HW6A 3LQ3A 3NNXA 4I20A 2ITWA 1GY3A 2OXXA 4PUZA 5CAVA 3ZO4A 2ERKA 4ENXA 4BYJA 2W4JA 4AG8A 5KMKA 4YJNA 4D58A 2C6MA 5KCVA 3BE2A 5CXZA 4C3PA 2PPQA 3GC7A 3ID6C 4LUEA 4G2FA 3L8VA 1S9IA 3PTGA 4DLIA 3DNDA 3HMMA 4WRSA 4ZTRA 4W8EA 2BFYA 3O7LB 3PJ3A 4PNIA 4FSRA 3UO6A 2O65A 4TYHA 2OSCA 4OTPA 3LQ8A 3R7VA 4ASEA 2PE0A 3RZBA 3CD3A 3K2LA 5G6VA 2WQBA 5HKMA 5L2IA 3MA6A 5HG7A 1JKKA 3FHIA 3GXLA 2FB8A 3QQHA 3PWYA 3A4OX 3MH3A 4FIFA 4CZYB 4EH8A 2XKCA 4II5A 3RNIA 5I9ZA 4KBAA 4UEUA 4CKIA 4IX3A 3I79A 5AFVA 3GU7A 4KRDA 2KULA 2GNIA 3ACJA 4Q2AA 4UV0A 4QMTA 4XRJA 4FTCA 4QYFA 5EFQA 4JDJA 3SX9A 5HIEA 4GU9A 4FSNA 2WTJA 2VTSA 4F64A 4L46A 5DIAA 3R7YA 3PDTA 1TQMA 3V5LA 3KB7A 5GZAA 1PY5A 2W1DA 3G9NA 2PVRA 3LXNA 4FKTA 3KVXA 2YERA 2XM9A 5AUYA 2HWPA 4K1BA 3HDMA 4IX4A 4LMUA 3DTWA 5CNNA 3D7TB 4O2PA 4O6EA 2OO8X 4MCVA 3S4QA 1YHWA 3H9RA 3UOLA 5IQAA 4D28A 4HCTA 2AC5A 3R0TA 4QPSA 3TIYA 1W98A 4EL9A 4E1ZA 3II5A 3EOCA 3GU8A 4FV5A 3TUDA 5I3RA 4NJDA 4PV0A 4QP7A 4C3FA 4BR3A 3MJ2A 3BBTB 4R1VA 5HVYA 5F1ZA 3LFEA 2W7XA 4ANQA 1BUHA 3VUMA 3UG1A 3A7FA 2VTIA 2F49A 2C6OA 2PZRA 2BAKA 2W96B 1UU8A 1ZWSA 3W16A 4CTCA 5DRBA 1YWVA 3L8XA 5HHWA 3T9TA 5KE0A 3NYXA 4YLKA 2C5XA 4ZEGA 4YSMA 3AD5A 3CP9A 4R3RA 3FI3A 3QQUA 4QMZA 4Y95A 4DTAA 4R6VA 1NVQA 4WRGA 2PVYA 4EHGA 3KMWA 1JSTA 3PJ8A 3HKOA 2DUVA 3WYYA 4HVSA 3U51A 3OWJA 4ZJJA 1A48A 3F2RA 3NEWA 3ORXA 2IVUA 4FYNA 4X2JA 2FVDA 4J8NA 2XK7A 2XUUA 1M2PA 3ZO1A 2V0DA 1GZ8A 5KNJA 3BZ3A 2DWBA 3KRWA 4WUNA 2OKRA 3AC5A 3A8XA 4RIYB 4BDCA 5BMSA 5CEPA 4IACA 2YZLA 3ZYAA 2GQGA 1UA2A 3MFUA 3PSCA 2IWIA 2IO6A 3GCQA 3IDCA 4C38A 4X2KA 2Y4IB 3ACKA 5A6NA 4F7NA 2RG6A 3BV2A 3OW3A 3R1YA 4RX7A 3AXWA 2YAAA 4CYJA 2YFXA 3FAAA 2R3MA 2R3OA 5IUHA 2VTHA 5IZFA 4RQVA 3TKIA 1E1VA 1KE7A 1CKJA 2WMQA 3QUEA 4BDBA 5BQ0A 3VAPA 3SVVA 4G5JA 4HZSA 4QT1A 4CVAA 2ZJWA 3W2SA 4E7WA 3RM6A 2PWLA 4IC7A 3W33A 4BZDA 4ERKA 4G3CA 5JFVA 1XKKA 3UNKA 3CTJA 4USFA 2J5FA 2VWYA 4BFMA 5HO7A 3A7JA 3CY3A 2OW3A 4FL3A 3R1SA 5CAUA 2PUNA 1BYGA 2W1IA 2Y9QA 3QRUA 4APCA 2XYUA 4JL9A 4W8DA 1XJDA 5C8NA 2UV2A 4GU6A 4ZSGA 3NUSA 5IEYA 4Q9ZA 5KBRA 3FI8A 4F1OA 4ACHA 3DBCA 5CALA 2BMCA 4WSYA 4L3JA 3O7LD 3O51A 2J90A 3KULB 1Q5KA 3DFAA 4OBOA 4UWYA 4FZFB 5IQFA 3MIAA 4YLLA 4TL0A 4FODA 4RX9A 4U40A 4WSQA 3QQFA 3NR9A 3Q9ZA 1Y8GA 4JDKA 5BNJA 5CZHA 5CSPA 4BICA 3EN5A 4LOOA 2OIDA 5D7AA 4BF2A 4ZLZA 2P33A 3EZRA 1ZXEA 2VX0A 1R0PA 2FA2A 2XKEA 4M8TA 4YJQA 3RWPA 4RA5A 1PXOA 3BE9A 2XJ1A 4NK9A 4FV0A 4FIHA 4MBIA 4RBLA 3PPZA 5AX9A 3S00A 3V8SA 1QPJA 4J53A 3FQHA 2GMXA 1ZYJA 2R3LA 2OZOA 2YM5A 3EQHA 2O8YA 3VHEA 3E8DA 2Z2WA 3AC4A 3H10A 5ANKA 4BYIA 4JBVA 3KY2A 3I6WA 3F66A 4XLVA 4CNHA 4QMNA 1H8FA 4PRJA 5HI2A 1H00A 3VHKA 2BAJA 3ORKA 4NSTA 2ZM4A 3KVWA 3QX4A 5DGZA 4BDDA 5C01A 3QKLA 3UG2A 3VF9A 5HBJA 4C34A 4EK4A 1ZOHA 5KX8A 4CCBA 3FUPA 3DXNA 3DLZA 3O71A 3EYHA 1PMUA 5CVGA 4AZSA 1KSWA 3RJCA 3LFCA 3RPVA 2XIRA 3K3IA 5JMSA 5HTCA 2Z60A 4A4OA 2UZNA 2V5QA 4L52A 3PE2A 4ASZA 3D0EA 5FGKA 1H1QA 2O2UA 4BTFA 2ZV2A 5AP2A 3JUHA 4F1MA 4L3PA 4O0YA 5DT3A 3BLHA 3UVRA 4EH2A 1PXMA 3QD3A 1LR4A 3VRYA 3W2CA 5HD4A 1GAGA 2CGXA 2XNMA 1X8BA 1RQQA 2BZIB 4Y5QA 5HEZA 3JR1A 3KC3A 2WQEA 3QKMA 1IR3A 2HOGA 3UPXA 2BALA 1ZY4A 2YCSA 3H0ZA 4IC8A 4WD5A 3RK5A 4XUFA 1FPUA 3HZTA 4BC6A 3AMYA 5AMNA 2R64A 3A7IA 3CQUA 4EZ5A 3L9LA 4AOIA 2CKOA 3PFQA 2OF2A 2XK3A 4G3GA 3KN6A 3THBA 3UBDA 4IADA 3RM7A 2XK9A 3PVWA 3GP0A 4XV2A 4HGTA 2CNUA 4ZJIA 1A06A 4XV9A 4CFNA 5T6KA 1ZYCA 3GQLA 3UDBA 2C0OA 2ITPA 3OXZA 4FKVA 1CDKA 4FVPA 4KKEA 3F3TA 5HCXA 2HK5A 3HA8A 3R7OA 3HV6A 4FTNA 4ASDA 5DE2A 2QOOA 4BCOA 5FTOA 4DFYA 2OFVA 3JXWA 3UC3A 3C1XA 3DU8A 4L3LA 4DHFA 3QTXA 4BHNA 2C47A 5EYCA 4DBNA 2ONLC 4GJ2A 1V1KA 2VWBA 4KIKA 4YO6A 4PL5A 5LOHA 4OAVB 1WBPA 3PY1A 3BU5A 4U3ZA 2YAKA 3RTPA 2YCFA 4HYSA 4QMYA 1Y8YA 2P0CA 4I94A 2X8IA 4UB7A 5E1EA 3VS3A 5JFWA 4KRCA 2QOQA 3ANRA 3UP7A 1NVRA 2BFXA 4PDPA 5H8EA 4BWKA 4MKCA 3I5ZA 1KOAA 1JNKA 2ITXA 3FC1X 3G5DA 4JJRA 2UW6A 1OMWA 4NWMA 3LM5A 5EKOA 5DG5A 4O0TA 5BMMA 4RWJA 4DGMA 2XYNA 1YXVA 3ZU7A 4EWQA 2WTKB 4ARKA 3LOKA 3QF9A 4U6RA 5IEVA 4ZTNA 3FMDA 2GS7A 2R3KA 1SM2A 5HICA 5BYLA 3ZHPC 1WBOA 2OH0E 1YVJA 3MYGA 5KHXA 4MXAA 4OTQA 4GMYA 3DKOA 5ACBC 3SXFA 4BDAA 3TTJA 4DGNA 5IQDA 2QOBA 4DF3A 4ENYA 3PLAE 3RAWA 5JQ8A 4GFMA 1Q61A 3DJ7A 1K9AA 1ZMWA 1Q3DA 4FV8A 2J0KA 4JRVA 3JY0A 3UE4A 2CKEA 3C9WA 4QMMA 3ZLSA 3IW5A 2QCSA 2YM3A 3QQLA 4KBKA 3MS9A 4QD6A 4EYJA 3OF0A 2IZSA 4NKSA 5HCZA 3UOKA 4C2WA 3LLAA 3V6SA 2PVFA 1ZZ2A 2EUFB 3IW7A 5J5TA 3FBVA 5M53A 3P9JA 4NH1A 3NRMA 2PZPA 5L2WA 4ZLOA 3LCOA 2P2HA 4KWPA 3U6HA 4MH7A 4PX6A 5M09A 3HDNA 4CRLA 3ZRLA 3ENMA 4KNBA 2WMAA 4I24A 2OWBA 4JRNA 4LV5A 3DQXA 4AFJA 3HRCA 5FM3A 4XEYA 4WG5A 4U42A 4KIQA 5CLPA 1ZARA 4K11A 4P4CA 5DH3A 5H8GA 5K0KA 1CKIA 2ONLA 3ORLA 5HIDA 3R7IA 1ATPE 4Q9SA 4XBRA 3ZONA 2X6EA 4BCHA 3DKFA 3LIJA 4EONA 4BBEA 5AV4A 2C6DA 4Y83A 2XNPA 4S33A 3TDVA 4IAKA 4F9YA 2XBJA 2GNFA 3KFAA 1Y91A 3HMPA 4YZNA 2OXDA 3I1AA 4PNKA 2IG7A 4GVAA 1UKIA 4V01A 2XMYA 2FSMX 3KF4A 4USDA 5FTGA 4AZEA 4ZY5A 4G3EA 1H0VA 2YZAA 3FZTA 2EU9A 3AD6A 1ZRZA 2I6LA 5LVLA 3DBDA 4F4PA 1PRYA 3D2KA 4PPBA 4J8MA 1OL7A 4ZIMA 3FKLA 5H8BA 3F3WA 3G33A 2Q83A 3QGYA 3WZEA 2V7OA 2YIYA 1PF8A 2E9PA 4WKQA 5DHJA 3C50A 1P2AA 2W1ZA 3EYGA 3CD8A 2WMTA 4QP8A 5AJQA 2YDJA 4EOPA 4B9DA 3Q3BA 3FMHA 3UIBA 1SYKA 2X0GA 3DOGA 3RVGA 3DCVA 1XR1A 3R21A 2VX1A 3ETAA 2HZIA 5T3QA 4PP9A 5HX8A 4X3FC 3PYYA 1KE5A 4B99A 1FMKA 4DEAA 2BDFA 3ELJA 4RFMA 4HJOA 2V22A 1CMKE 5A14A 4ID7A 4PDOA 4RZVA 4QRCA 4IDTA 3R30A 4EH7A 4EH5A 4FSMA 3QRIA 5GIPE 3H3CA 2WOTA 3K5UA 3PJCA 4FNYA 5KMLA 2C6EA 2CCIA 3FZ1A 4G6OA 4XHKB 5A4CA 2WTKC 1OPKA 4AWIA 4M12A 3QL8A 5EOBA 1H1PA 5I0BA 1XH4A 3TDWA 3HLLA 4EI4A 2RIOA 3G6GA 5HORA 4YBKA 2ETMA 2W5HA 3FI4A 4CEGA 5BVOA 4TKSA 1WFCA 1JOWB 4RSSA 1H25A 2B53A 4FT9A 3VW6A 5LMBA 3OBJA 1YRPA 3HV4A 3FXWA 4I6FA 3F5UA 3RPOA 3WF7A 5EW9A 1MRVA 1XO2B 3DK7A 3RPYA 4EK8A 4U0IA 4O7VA 2I0HA 4UX9A 5AP0A 5ANIA 2XIKA 3KF7A 2HXQA 2FSLX 2UUEA 2ZB0A 4PMSA 4DFBA 4U80A 3SW4A 2BDWA 3I0OA 4YTCA 4EH4A 3NYVA 3P0MA 3UJGA 2C6IA 5ANJA 4QP9A 4JQEA 4TXCA 5JN2A 4AN3A 2Q0NA 2P3GX 2B7AA 1WVWA 1VYZA 2XNOA 3VS5A 3HNGA 2I40A 5LCKA 3V6RA 4B4LA 4FGRA 4NM7A 1Z9XA 4C4JA 3TT0A 3NW7A 2QQ7A 3PRIA 4DGLC 4LRKA 5M57A 1K3AA 2VWWA 5H2UA 4EOSA 4WOVA 4IX6A 3UMXA 2QOHA 2ZM1A 4RA4A 3UZTA 5AA8A 4XS2A 3EL8A 2IVSA 2ETRA 3LHJA 3R83A 5C26A 4AW1A 2C1AA 4EEVA 2E9VA 3MTLA 4RJ3A 4G34A 3F61A 4E4LA 2QOFA 5DFPA 5DMZA 5KMMA 2VAGA 1XH7A 4O0XA 4O83A 2WMBA 4OBPA 1ERKA 1TKIA 4RC3A 1RW8A 1WBSA 4U3YA 2X4FA 2Y0AA 5FXRA 4ACCA 4YMJA 1VZOA 1Y6BA 4EJNA 4ZLYA 3CSVA 5FEDA 1KOBA 3PXKA 4R7BA 4V0GB 3UNJA 1U54B 3C0HA 5EQYA 2GU8A 4AAAA 3ORPA 4RVMA 2J0MB 5AV3A 4AUAA 3E88A 4NFMA 4DEDA 4DA5A 2REIA 3G0FA 4R3CA 4QMQA 5HE3A 4KUJA 5BVFA 3HVCA 3M42A 5E1SA 4QMOA 3CBLA 5D12A 2VNWA 5B2LA 4RLKA 2W9ZB 4X0MA 4WHZA 3KQ7A 4TY1A 3QA8A 4ZJVA 4FTRA 3VUDA 3QCQA 2CGVA 4KIPA 2RFEA 1OGUA 3OMVA 4RJ7A 2B0QA 5DBXA 4BCMA 3QUPA 4HVHA 4FGBA 2X4ZA 3O8UA 4IE9A 3TZ8A 2IPXA 2W05A 4I5CA 3TWJA 2CN8A 3F7ZA 4BCPA 4RIXA 5CQWA 5EYDA 3CPBA 4UMQA 3NUXA 5K5NA 2QO9A 4MF0A 3EJ1A 3GC0A 4O0UA 5EM7A 1OBDA 2NP8A 3CR0A 3A60A 3ITZA 5TE0A 4BI0A 3QCSA 3VRZA 4RG0A 4RX8A 4JIAA 3IECA 4BKYA 2QR7A 2WOUA 4XG2A 3RI1A 1UNGA 3R63A 3BHTA 4E5AX 2UVZA 2QHNA 5GHVA 4H3QA 3L9MA 4G16A 4HYHA 4PMTA 3FZOA 5HIBA 3ZSGA 3FY2A 4PPAA 4G3FA 4HPUE 4TYEA 1I09A 3F3UA 2VTMA 3A4PA 1YXUA 2PULA 3VS4A 3ZDUA 5I9UA 4BDJA 3ALOA 2PE2A 3QCXA 4UN0C 2VUWA 3ENHA 4PL4A 1PMEA 1YDTE 3QAME 3TKUA 4ZS4A 2WMUA 3I7CA 5HLPA 3TNHA 3LMGA 4EYMA 5KBQA 2X39A 4NJ3A 3KXXA 3SD0A 4DCAA 4P5QA 5J7BA 3VBYA 4LGHA 5AP6A 1OIRA 4J7BA 4NKAA 1M52A 3UPZA 1ZMVA 3EN6A 3W1FA 3ZXZA 3EFLA 3DGKA 3T3VA 3DAEA 4QYHA 2JITA 4YHJA 3K54A 3COIA 3QXOA 4HNFA 2X8DA 4O2ZA 4ZSEA 1WVYA 3ROYA 4RIXB 3BYOA 3I7BA 3LLTA 3MESA 4GW8A 2C30A 2UZDA 5EH0A 3R8PA 3OUNB 1PMNA 4JG8A 4U45A 4NZWB 4U44A 1LP4A 4TYIA 1YDRE 3HMOA 4GEOA 2B9HA 2OK1A 5FEQA 3QYWA 4M3QA 2WMRA 3H9FA 4L42A 5BYYA 1PXKA 1PJKA 1FVTA 2C1BA 2IN6A 4FZDB 4YTHA 2XKFA 5AV1A 3IW8A 5B0XA 2B52A 5FDPA 3UOJA 2JBPA 2C3LA 4UBAA 1URWA 4BKJA 4XG9A 3SKCA 4IDVA 3QKKA 3DXQA 4D1SA 3ZZWA 5DWRA 3F5PA 1OUKA 5DVRA 3U87A 4LOPA 5HBHA 4U5JA 3BHYA 1FGKA 2R0IA 3GU6A 4CTBA 4DTBA 2ZB1A 2YM4A 3FE3A 3DNEA 4L6QA 4BCJA 3WOWA 4ZAUA 4AW2A 4CMOA 4CMUA 4QMLA 3Q9WA 4PF4A 4CSVA 3D7ZA 3GEQA 4FKIA 3QWJA 2X7OA 3D7TA 3SW7A 4MHAA 4NTTA 2WGJA 3HV3A 3RWQA 4E6AA 4RIWA 3HRBA 2VZ6A 5L2QA 2Z8CA 5FQDC 4F7JA 2FUMA 4K9YA 5IA1A 3R9DA 5L8LA 4A06A 2WEVA 3F82A 3B2TA 3WF5A 5J9LA 3PRFA 1YKRA 2YWVA 5AIRA 5EI2A 2JKQA 3VQHA 3QQGA 3FPMA 4MXXA 3R9NA 3WZJA 4FKWA 2YDIA 3L1SA 2BUJA 5EG3A 5AADA 3OCBA 2ITVA 1H01A 1W0XC 5HU3A 4JVGA 5B2MA 3LPBA 4WBBB 4KS7A 4ZS0A 5L6WL 2PTKA 5IISA 2VWXA 3DAKA 3VS0A 2XS0A 4U7ZA 2XBAA 3C4WA 4Y72A 3MN3A 2W99B 1MP8A 2AC3A 4DH8A 2WTCA 2O64A 4LRMA 2ETKA 4TWNA 5AP5A 3U55A 4IWQA 5FWKK 5FXSA 4FTLA 5DA3A 2H96A 2JIVA 2XIXA 3ZRKA 3OWKA 4YC3A 3WBLA 4FOBA 2OGVA 2VU3A 5AP1A 2X2KA 3PY0A 3E7OA 2QVSE 4DH7A 1SVHA 5E92A 4O7YA 1QCFA 2C68A 3O0GA 2FO0A 3QTUA 1P5EA 3LFSA 2Y4IC 2I0YA 2C5NA 4EUTA 2VTOA 1H24A 2C0TA 2EWAA 3P86A 4IM3A 4C3RA 5CF5A 4YGAA 2CSNA 3FZPA 3OTUA 3R2BA 4HGEA 1ZAOA 2QD9A 4R7HA 5AR3A 4HVIA 2ZV7A 4YNEA 3UVPA 3C51A 2UZUE 2IW6A 2Y8OA 3RKBA 4RFZA 3LCTA 5BVKA 3WILA 4EOMA 3UMWA 2JLDA 3GCSA 4HPTE 4TNDA 4BCQA 4EH6A 4DH3A 3FJQE 2QC6A 3ZM4A 4FZ7A 4O7TA 2OBJA 3ATSA 1K2PA 4IZYA 5IUGA 1W82A 3MWUA 5M07A 4UALA 2UW7A 1BL6A 4EQUA 3FLSA 2QLUA 1O9UA 4RJ5A 2PL0A 4DFNA 5FBOA 4DG2E 3EMGA 4F65A 4BDHA 4CKJA 4C62A 2R3NA 2Z7RA 2SRCA 4TZRA 4OTDA 4F9CA 3M1SA 2JKMA 2HWOA 1CKPA 4L7SA 4TT7A 3TCPA 4BVUA 3O50A 4O27B 3NVKI 5CSHA 4M13A 3L9NA 4XBUA 3RHXA 2WAJA 2GFSA 5AX3A 4FA2A 3TUBA 4FKPA 4FUYA 4H3PA 3E8EA 4TYJA 5E8SA 3NCGA 5AM7A 4BGQA 1BI8A 5DR9A 3MA3A 4O0SA 2R3JA 3QZHA 4P7EA 2W0JA 5HX6A 4OTWA 2X8EA 2YM8A 1XH9A 2CHLA 5AUTA 3E63A 4EHZA 4F9BA 1Q24A 4FF8A 4YJRA 4BDKA 2FGIA 3JPVA 3FI2A 3E87A 2XJ2A 4AGWA 4C0TA 1YXTA 2XVDA 3VW8A 3W32A 5BVWA 3MH0A 4YU2A 3FLZA 1F3MC 2PY3A 4QTEA 3FDNA 4O7LA 3BU3A 4EZ7A 4W4VA 5FTQA 2UZWE 2J4ZA 1R78A 5EI6A 3VUIA 4F0GA 5HNGA 3KU2A 5JZNA 3EKKA 5CQUA 3E3PA 1GZNA 3AGLA 3AQVA 3EL7A 5HQ0A 1ZLTA 2XF0A 3CY2A 2X2LA 3UTOA 4E26A 1I44A 4MTAA 3LQ5A 4GUEA 4LG4A 4YR8A 5M56A 1UWJA 5IDPA 2ACXA 3OW4A 3R8MA 5EKNA 3FLYA 1OL2A 2OJJA 3FMKA 4WNPA 3FMJA 5CVFA 3BV3A 2EVAA 3IOPA 2J2IB 4UWCA 1BLXA 4GS6A 3OTVA 3OY1A 3Q5IA 4YC8A 4ZTQA 2X9FA 3O96A 3W8LA 4MBLA 4M67A 3KRRA 2XNBA 3GCPA 2ZMDA 3MPTA 5TOZA 3UGCA 4F6UA 3WIKA 5JGAA 3N4TA 4F6WA 5LARA 3SOCA 3RZFA 1V0PA 3F5GA 4FK6A 4EHEA 4ZY4A 3EB0A 3QALE 4O38A 5EDPA 3CQEA 3PZHA 3SRVA 3DB8A 4IAYA 3BELA 4R77A 2FSOX 4O0VA 4S30A 3TNWA 3FL5A 5DI1A 4FT5A 4QTCA 4BTKA 1H1SA 2QU6A 2WIPA 1RJBA 1U54A 2XK8A 3QFVA 3QRTA 5IQGA 2FSTX 4J1RA 2H6DA 2QU5A 4OT6A 4IVAA 5HE0A 1APME 3P1AA 4QMXA 3B8QA 5FDXA 1WAKA 3DFCB 3MGYA 4I5HA 4O1OA 4USEA 3TXOA 2EXMA 5CU3A 1KUTA 2QOKA 3ERKA 4C4GA 3BHVA 4FNWA 2CLQA 3KRLA 4M84A 3M2WA 2J0LA 4ZTLA 3NGAA 4FICA 1J7LA 2OZAA 1YHSA 2R3HA 3CS9A 4MBJA 3UQFA 3FLWA 4N57A 3LJ2A 1M7NA 2ZV8A 4O7ZA 4ZTMA 1S9JA 4ORKA 2YITA 3OCTA 2E9OA 2ITUA 1IA9A 5FP5A 1DM2A 3OEFX 3KXZA 4RIYA 3QHRA 4E5BA 5ICPA 2E9NA 5CT7A 3VVHA 3GBZA 4CMTA 2QR8A 4GSBA 4L45A 4D2VA 4YJTA 4E8AA 3OC1A 3RPSA 3W2OA 1SNXA 4YPSA 3ZDIA 5L6OA 3CTHA 3OS3A 4OT5A 4F0IA 3QC9A 3BYUA 1J1CA 3EN4A 3D5XA 3ZH8A 3KCKA 3TNQB 2GNGA 3NUPA 5CEQA 5AUUA 4GKHA 4MEDA 5ETIA 4AW0A 4XP3A 1H1WA 4RC2A 3TNIA 4C8BA 2JFMA 4LOQA 3A2CA 3F6XA 3KRJA 1F5QA 1PKGA 3LFFA 4K77A 4C37A 1DI8A 2H8HA 4ANMA 4JAJA 3ODYX 4D55A 2YWPA 2PUPA 3PA5A 4IH8A 4BBFA 3AD4A 3R2YA 5D11A 3BRBA 1M2QA 3B2WA 3OT3A 3PXFA 3FYJX 5D10A 3F88A 4FTTA 1JQHA 4FX3A 3VBXA 5CEKA 4GT5A 2JKKA 2BRMA 2QO7A 3OHTA 5HG5A 3QUDA 4TRLA 3RHKA 2IJMA 3C13A 3ZUVA 2VTQA 1WBTA 3AC8A 4I4FA 4JS8A 2QO2A 4TYHB 5L4QA 4OAUC 5IQCA 2XRUA 4WO5A 4B6LA 4BWXA 2UVYA 3HV5A 3BHHA 3O8TA 5E8WA 4DBXA 2EXEA 3OXTA 4D9UA 4F9WA 2C3IB 3FWQA 3MI9A 3Q9XA 4ITIA 1OECA 1SZMA 2BRNA 3LZBA 3KK8A 3EN9A 4E6QA 3FC2A 1OB3A 3EZVA 2VWIA 3PPJA 4LQMA 5HGIA 4YURA 5AAEA 1Y57A 4JI9A 2NNWB 1JPAA 4IBMA 1Q97A 4UY9A 3CCNA 3V5PA 4EOLA 3PZEA 5M08A 4QMVA 4FEVA 4CQEA 4ZZOA 4D1XA 3OWLA 4Y46A 3WZUA 4X6QC 4BDEA 5JFXA 4M14A 3DTCA 3PJ1A 5HTIA 5M4IA 2C0IA 2WTIA 3EIDA 3OEZA 3R7UA 4HW7A 4M0YA 3TI1A 4YJSA 4DLJA 2VO0A 1BX6A 3MBLA 1XBAA 4TTHB 4FBXA 2IW8A 4AQCA 2OJIA 4I0SA 2Z02A 4O82A 1OM1A 4L7FA 1QL6A 4LYNA 3TV4A 5IF1A 3HAVA 4A9SA 1B6CB 4E93A 3MVMA 4D2SA 2I1MA 3VF8A 1JSVA 4R5YA 5AP3A 4DE4A 1YI4A 3SLSA 2XK4A 2V7AA 2W1HA 4N6ZA 2WMSA 2W06A 3LXKA 4MK0A 3E8CA 2GHLA 2PK9A 3LCDA 3F2AA 3VWAA 4GK4A 2Z7QA 3KULA 4G5PA 3I81A 4FKJA 4JNWA 4QQTA 3V5QA 3BGQA 3PG1A 4A4LA 5A46A 3N9XA 4HCVA 2CKPA 4EOKA 4V05A 4RLLA 4TPTA 4WT6A 4BCGA 1FQ1B 3DLSA 4FKOA 4GRBA 4TN6A 5KMJA 4JBOA 5I9XA 5HVKA 1GJOA 4S31A 4QP6A 4NM5A 3C4XA 4IB0A 3REPA 2O63A 1CM8A 1YOLA 3H4JA 4FIJA 2ITZA 4GIHA 2YLEA 1Q99A 4GV1A 2YLFA 3LFAA 4X7QA 4BZOA 4E4XA 5I4NA 3FY0A 3LCKA 2W5AA 3DV3A 3Q53A 2WFYA 4K33A 5CS6A 3NW5A 5BVEA 4I0RA 4A9YA 3Q9YA 5AP4A 5B2KA 1NW1A 1GZKA 4R78A 3E62A 3TG1A 3VULA 3WIGA 4DFXE 4NT4A 4CFXA 4C57A 2DYLA 3LAUA 2R3GA 4PMPA 2CGWA 4QYYA 5HNBA 4G3DA 2G2IA 3V3VA 4DTKA 2VGPA 4M66A 4RMZA 2ZM3A 1BL7A 4QMPA 2A0CX 2WTWA 3BIZA 3GU5A 4BIDA 2XA4A 1XBCA 3BLQA 5JK3A 2R3RA 4WBOA 4ZOGA 5JFSA 4N6YA 1OPJA 3R22A 3CJGA 2E2BA 5DLSA 1J7IA 2PMNX 4O84A 2JC6A 3BYMA 2WQNA 5HD7A 2BHHA 3VJNA 5A6OA 2RG5A 2W4OA 2PZYA 5KZ0A 3GOKA 3VQUA 2HYYA 4ONAA 2PVMA 4HVGA 3SA0A 3ZUTA 4DFLA 5ACKA 3R1QA 1SNUA 4AXAA 3ATTA 1BI7A 5JKGA 3UZRA 1FMOE 1T45A 2XNGA 3D2IA 5E8YA 2UW0A 3CQWA 3U4UA 4I5PA 1KE8A 3QTQA 3DJ5A 4RJ6A 1B38A 1Q8WA 4M69B 3ULZA 1HCLA 2C6KA 2PVLA 5J79A 3ZXTA 1TQPA 1OVEA 3BLRA 3NAXA 2OLCA 4RFYA 2JAVA 3FSFA 4H1MA 5K5XA 4JX7A 4DYMA 4EH9A 2RSVA 1WCCA 3Q52A 5JGDA 1ZZLA 1IASA 3Q6WA 4M68A 4RQKA 2J50A 1G5SA 4I6BA 2XIYA 4YZBA 3D83A 4NL0A 2QLQA 4WNMA 3UYTA 3OD6X 5AUVA 2YEXA 1FVRA 3RCJA 3IS5A 1GNGA 2VN9A 4DT8A 4HCUA 4R1YA 4RZWA 1ZYLA 3ULIA 4NEUA 4B7TA 5K9IA 4X3FB 3KN5A 4XRLA 3TACA 3VC4A 4FSTA 4FZAB 3FMEA 4RIOA 4OUCA 1YHVA 3W2RA 3BX5A 2BIKB 3U9CA 4YUQA 4FKUA 2VTAA 3ZO3A 2WB8A 4IX5A 2R0UA 5HZNA 1P4OA 3EQRA 3FMMA 4FC0A 4QMWA 4C2VA 3R73A 2DS1A 3PP1A 4NTSA 4KIKB 4I0TA 4IB5A 4BIEA 4CT2A 5IQBA 4UXLA 4Z16A 3UZPA 4FV7A 4C59A 1Z57A 3M11A 4FV9A 4AT3A 4PTCA 2XRWA 4D2TA 5C03A 1XWSA 3PXRA 4F99A 4DG0E 4D5HA 3ROCA 4O7SA 2GPHA 3MY0A 3D15A 2C6TA 2WNTA 3OT8A 3NMUF 5HOAA 5FXQA 1OKVA 2CN5A 3GUBA 4DC2A 2NRUA 4EOQA 5CAQA 1SVGA 2B9FA 3COKA 3MW1A 1GIHA 4G1WA 4AW5A 4WIHA 4BDIA 5CT0A 4M69A 3VBTA 3C7QA 4FEQA 3DPKA 4ANNA 1JKTA 1Y6AA 4XG7A 5DT4A 3LM0A 5L8JA 5TR6A 2B54A 3IKAA 4F08A 5CF6A 5BUEA 5LMKC 1KE9A 3BI6A 3CIKA 4IZ7A 1W7HA 3CLYA 4IWOA 1PYXA 2XCHA 5D7VA 5E8TA 5AUWA 2PUIA 4MD7E 3D4QA 4I1ZA 4YZMA 3FXZA 3S3IA 4AA5A 4DCEA 2OFUA 2J0IA 3CGFA 4ACGA 4EUUA 3R28A 5CSXA 3HRFA 4FTMA 4ZZMA 3AMAA 2WTVA 3WZDA 3MSSA 4C58A 4OR5A 4CLJA 4HYUA 4C4EA 4B8MA 4EK6A 1WZYA 1OL5A 2GS6A 1XBBA 1R1WA 2Z7SA 4CRSA 5BPYA 1JBPE 3I4BA 5LVMA 4WG3A 3L8SA 4EKKA 5CAOA 5CENA 3BQCA 3P7CA 3QX2A 4M97A 2X9EA 4XP0A 4KINA 4LFIA 4G6NA 5DEWA 5AP7A 4AP7A 4CG8A 3DBFA 5IH6A 5M51A 5BYZA 1J3HA 3LXPA 4YTFA 5K4IA 5KHWA 3F9NA 3QBNA 2G1TA 4IFCA 2J6MA 2XNEA 4XCUA 4AS0A 4KSQA 4AACA 4E5WA 4RX5A 2JDOA 1KWPA 4RPVA 1HCKA 3POOA 5KMOA 5IA2A 4YJUA 5TO8A 3QZIA 5I9YA 5F4NA 4EKLA 2GNHA 2AUHA 1OKWA 2BHEA 3VNTA 3G51A 3SRVB 1PKDA 2YIQA 2A19B 3F7WA 3ZOSA 3FYKX 3POZA 4AOTA 4G9CA 1RE8A 4ANOA 3AT2A 4N4SA 4QMUA 4ZY6A 3I5NA 2C69A 2P2IA 2R3QA 4O91A 2F7ZE 3OXIA 3VBWA 3P23A 3R01A 2JKOA 2F57A 4OBQA 4FMQA 3AGMA 3P78A 5LQFA 3N4VA 4WG4A 4UMRA 4L01A 3NS9A 2BAQA 3GB2A 5AUXA 4UWBA 1E9HA 2R3PA 3RAHA 3D5VA 4FZ6A 3SG8A 5IDNA 4D2WA 3AMBA 2WEIA 1U5QA 4KKHA 4F70A 1Q8TA 1FGIA 1PXPA 2WU6A 5BX0A 3UODA 1LPUA 5E4HA 4PL3A 5EDRA 2QG5A 4HVDA 4NUSA 4X2FA 4XOYA 3TV7A 3CGOA 3MV5A 3AT3A 1MRUA 4J71A 4KA3A 3UQCA 1W83A 1UKHA 3TV6A 5EOLA 4F09A 2PZ5A 2QURA 3AC1A 4YLJA 5D9HA 4ALVA 2GHGA 4QYEA 2ZMCA 1OBGA 3R8UA 2W17A 2XB7A 2JGZA 2GSFA 2IVTA 3D9VA 4WA9A 3V5JA 4IFGA 4FR4A 3ZLYA 3NYOA 2XKDA 3HMIA 4H36A 4IQ6A 2V55A 3LJ0A 3NW6A 4PPCA 1R3CA 3W8QA 5M55A 4FYOA 4QQCA 4X21A 4TYGA 1JLUE 4DH1A 2WTDA 3VS2A 5AV0A 2WQOA 2OU7A 4W9WA 3VJOA 4GFGA 3UIUA 5LWMA 4JDIA 2BZKB 5J9ZA 5C4KA 4IZAA 3MY1A 4WUAA 2BCJA 2J7TA 2OG8A 3LFDA 3QWKA 4H3BA 3BKBA 3EQIA 3QD4A 2PU8A 1P4FA 3RGFA 1SMHA 1KV1A 4FKLA 3VBVA 3U8WA 4BIBA 5EK7A 3H0YA 4IM0A 5D41A 3AT4A 1QMZA 4RRVA 2Y4PA 2JDVA 5LMAA 1UNLA 2B55A 2UZVA 1M14A 2PUUA 1J91A 4CKRA 1R0EA 1LUFA 3OG7A 2F2CB 2W9FB 4L68A 3QRKA 5JSMA 2JIUA 3T3UA 4GVJA 2Z7LA 1RDQE 3SV0A 3VUHA 1Q8UA 5CANA 4FIEA 2A27A 1GZOA 3GENA 4Z7GA 4N70A 2HAKA 4JOAA 4O22A 4RVTA 1L8TA 2HELA 5C27A 3G90X 5K4JA 5KMIA 3MVJA 3HAMA 4GFOA 2OIBA 4IMYA 2BIYA 1ZMUA 4IAIA 3TN8A 4EOJA 2LGCA 4YP8A 3EFWA 5IQHA 4A7CA 3NIZA 4J98A 2KTYA 2JBOA 4C36A 4L44A 2C5OA 3GOPA 4IWPA 5AR5A 4CV9A 4FVRA 5CU0A 4GK3A 3DK6A 3HV7A 3CPCA 3P08A 1F0QA 3V51A 3FLNC 4IW0A 4NCTC 2WXVA 5BVNA 1GIJA 1JWHA 3OP5A 4MD9E 4BGHA 4YBJA 5A4QA 4C02A 2W1FA 3OFMA 4Q5HA 4XP2A 3W18A 2BPMA 1Q8YA 5I5ZA 2VGOA 3V8TA 5IQIA 3R9OA 4KD1A 4D1ZA 1EH4A 4MF1A 2VNYA 2BTRA 3PLSA 4BTMA 4ACDA 5HTBA 2OZAB 3WARA 1REKA 5CF4A 3IQ7A 4XX9A 3O8PA 2C6LA 3W55A 4I5MA 1KV2A 3WF8A 4XH6A 4CZUA 4F63A 4Y73A 4U8ZA 5E8XA 4OTRA 3Q96A 3MFSA 4I92A 5IPJA 1JAMA 1U59A 4L00A 3KREA 3TJCA 5JRQA 5CXHA 4O7WA 4JR7A 3VUGA 3KXMA 3TZMA 5LMKA 2JAMA 2R4BA 4G17A 3U54A 3R8ZA 2GDOA 3DBEA 1KE6A 2RL5A 3DDQA 2YM7A 4GJ3A 4IJ9A 4JBPA 5EHLA 5EHOA 1JKLA 2H9VA 3ANQA 3RCDA 3W2PA 1U5RA 3U4WA 5BUJA 5HNIX 4APPA 1OITA 2VV9A 4IIRA 3RAKA 3NUAA 2O3PA 3ZTXA 4AGDA 2XEYA 2QHMA 1IA8A 4H58A 3OZ6A 3FV8A 3VIDA 3FKOA 4OTIA 3GC8A 5DT0A 4CFMA 4D0XA 4XMOA 4YC6A 2YM6A 4DEHA 3WF6A 3ZZEA 2WKMA 5EYMA 2PMLX 2HXLA 4DAWA 4X2GA 4D4VA 4PDSA 4QTAA 3CEKA 5AUZA 4KB8A 1H26A 3WF9A 5IA3A 5ITAA 5CU2A 1UVRA 1VR2A 3ORNA 2NRYA 1WVXA 4GG5A 4MXCA 5CEIA 3ZEWA 4JQ8A 4RJ8A 5IA5A 1YOMA 2OJGA 2GTMA 3V8WA 4I22A 4CD0A 3Q4TA 4BBMA 3TJDA 4IAFA 4R5SA 2OJFE 4QP1A 4V04A 5E90A 4AF3A 5CU4A 3K3JA 1R39A 2X1NA 4YHFA 4O81A 3PJ2A 4PMMA 3SAYA 3DS6A 4DH5A 1H0WA 4E20A 3QLGA 4EK5A 1H07A 5AWMA 2QOCA 3C4CA 3EFJA 4FKSA 5HBEA 2CMWA 2F9GA 5H9BA 5IH4A 4IJPA 4BGGA 1OIYA 3EQCA 4JQ7A 3RMFA 2F7XE 3ODZX 4LM5A 4FTQA 3AC2A 4AOJA 4LMNA 1IRKA 1OPLA 1H4LA 1UU9A 3TZ9A 2VO3A 4F1TA 4EBWA 3PIYA 4LL0A 5CU6A 4C35A 2UW5A 3D5UA 2GFCA 2BRHA 3R02A 4N0SA 4EH3A 4JAIA 4FEWA 4IAZA 2GS2A 2WU7A 3SGCA 4RWLA 1OIQA 3W2QA 4E4MA 5M44A 5TKDA 3FQEA 3RINA 1Z5MA 2WMVA 4CT1A 4G31A 2PVNA 1WBWA 4HZRA 4IHPA 4NM0A 5E8VA 4FL2A 4AT4A 4F7SA 3UIMA 5L3AA 5JEBA 3U9NA 2PMOX 4U81A 5IMXA 2WHBA 3MVHA 2ZYBA 5LJJA 4OLIA 5EM5A 5IA0A 2WIHA 4Y5HA 2EXCX 4KS8A 5F94A 4C61A 1MRYA 5TT7A 2PYWA 1Q41A 5LVNA 5KKRB 3FSKA 3LKMA 3EQGA 4FTOA 4CFVA 3NZ0A 3HL7A 3ORZA 4PY1A 5IKWA 5L8KA 2XEZA 2ITNA 4K18A 4O86A 3NLBA 4NW5A 3DK3A 3G0EA 2VRXA 4D4SA 5EYKA 2Y7JA 4YPDA 3F5XA 2Y6MA 4FSYA 3KRXA 2YHVA 4EHVA 3K5VA 5CYIA 3VBQA 3P7AA 4QP2A 4DG3E 2F4JA 4FV1A 4HGSA 4FL1A 2A4LA 2ZAZA 3OUKA 4GIIA 4W4WA 4L43A 4UXQA 5FRIA 4F9AA 1J1BA 1NY3A 1Q62A 1OL1A 3IW4A 4AN2A 2DQ7X 4C33A 4EJ7A 3P4KA 1AQ1A 3L8PA 4AGUA 3EQFA 2JIIA 5FEEA 3UIXA 5F9EA 4FT0A 4JIKA 1U46A 4BL1A 4FTJA 3JVSA 4NCTA 1AGWA 4FG7A 4ZSLA 3UOHA 3MB7A 2WMWA 3JS2A 1ZYDA 2WELA 4KBCA 4L8MA 3R1NA 4XNEA 1STCE 5FD2A 3TL8A 3RK7A 3ZC5A 3KXNA 4OTFA 2V62A 5FLFA 1O6YA 3Q4UA 4YJPA 5CWZA 2XJ0A 4LUDA 4XG3A 4MYGA 3RALA 1CTPE 3LFQA 3LMHA 4OTGA 5ANOA 3SQQA 4CFUA 4XLIA 1YWRA 5CSVA 2BZHB 4YZDA 5H3QA 3R9RA 2IZRA 4ALUA 3HECA 3NYNA 3FQSA 5AR7A 1URCA 3C4FA 3IDBA 5EI8A 4DN5A 4YO4A 4DFZE 4FTKA 4FIIA 2UZLA 3GVUA 5FUTA 2B4SB 1REJA 3F69A 2A2AA 2QONA 3DT1A 3IGGA 3PY3A 4YTIA 4DEEA 4X6RA 2GNJA 1LEWA 3EHAA 2LAVA 3PVUA 4FSUA 4TWCA 5CVHA 1YOJA 3U6IA 3NSZA 5JGBA 3NNUA 3PP0A 4XJ0A 3SOAA 3QC4A 2GTNA 4NM3A 4BKZA 2QG7A 3DB6A 1PYEA 4U97A 4AA4A 2BRBA 4AE9A 4O0RA 4CV8A 3CKWA 3A62A 1OUYA 2ESMA 3GFEA 4RIWB 3MPAA 2FH9A 3CTQA 3KA0A 2YCQA 4FG9A 4RGJA 3OOMA 3BEGA 5J1WA 1CSNA 2YJRA 3I6UA 4FEXA 3LW0A 1DAWA 3QRJA 4Z55A 3PA4A 1QPEA 3IONA 1PXJA 5DNRA 4O0WA 5E91A 4S34A 1FINA 1SVEA 2VTRA 5HE2A 4ZP5A 2C5VA 3GCVA 2CPKE 3IGOA 5EW3A 2WPAA 4AZVA 4BCIA 4ERWA 2XZSA 4MVFA 2PVHA 4P2KA 4X3JA 5AA9A 4TWOA 4JXFA 4PTGA 2R2PA 4QQ5A 5CX9A 3ZLWA 4GYIA 2ZDUA 2RKUA 4ZMEA 4UYAA 5GZ9A 3CC6A 3AOXA 3SHEA 3PXZA 3G15A 4IWDA 4J97A 4BRXA 2O0UA 2P4IA 4O1PA 3DZOA 5EM6A 1YI3A 2OH4A 2PZIA 3F2NA 3LE6A 3VN9A 3LVPA 4U43A 3ORTA 3GQIA 4FTIA 4FV3A 2VTPA 3WYXA 5CEMA 2JD5A 3E8NA 5GZ8A 4DITA 3G9LX 4EQMA 5KKRC 5CTPA 1PMVA 3Q4ZA 4I3ZA 3GI3A 3A7HA 3QYZA 3UC4A 3ZSHA 4IEBA 2ZOQA 3FLQA 2GNLA 4J96A 4QNYA 4CQGA 3MFTA 2UW8A 4E6DA 4AU8A 4AZFA 1G8AA 2F2UA 4GUBA 4QTDA 1H1RA 1Q4LA 3V01A 3FL4A 3MFRA 4IVBA 2VD5A 3C4EA 3BQRA 4ITHA 3R6XA 1PW2A 1DS5A 4D0WA 2UZBA 3I0QA 4QP4A 5J9YA 2UW3A 2BROA 2HENA 4W9XA 3H9OA 3ZFYA 5J95A 5JQ5A 3Q5ZA 4DT9A 4GH2A 3G2FA 5GIOE 4NW6A 5HESA 1M7QA 5FG8A 5TF9A 2I7QA 2UZTA 3R00A 4FVQA 1TQIA 4M15A 4BI1A 3ZFMA 3ZO2A 3GT8A 1ND4A 4JT3A 1FOTA 5M4CA 1MUOA 3SC1A 1PXNA 4BZNA 3Q2MA 4ANLA 4I23A 2RF9A 3F3ZA 2CLXA 2G15A 1GOLA 3TZ7A 4E4NA 4EWHA 4GT4A 2OF4A 3EQBA 3QD2B 3UQGA 4C4HA 4QPAA 3R8LA 3NUUA 4WNKA 1YXXA 5EW8A 2YIWA 3ALNA 3UNZA 2NO3A 4P5ZA 1OZ1A 4QPMA 4I4EA 3NUYA 3Q4CA 3E3BX 3EH9A 1WBNA 4R8QA 1IAJA 4NIFB 3ZC6A 4J52A 3N4UA 5JH6A 4FV4A 3C5IA 4F6SA 3NVMB 2QOLA 1UU3A 4EC8A 4EZ3A 3OWPA 4XV3A 5CSWA 3MVLA 3KCFA 4KSPA 2QI8A 4UZDA 2IVVA 3P5KA 5AV2A 4O7RA 4A4XA 1NVSA 5A9UA 2FYSA 3FKNA 4IAAA 4FSQA 4CG9A 4CCUA 5LVPA 4H05A 4ZXTA 3PSDA 2ERZE 3DY7A 3QD0A 4JR3A 5KMNA 5E8ZA 4E3CA 4L53A 2VTJA 3VUTA 5JRSA 4MNEB 5I9VA 4G6LA 1OKZA 2W1EA 4IM2A 1JSUA 5HCYA 5BVDA 2CNQA 1YQJA 2UZEA 4OGRA 5GJDA 3E64A 4FNZA 2UW9A 2VWZA 4FSWA 4BCFA 2YCRA 3WI6A 3H30A 4LRJA 4I93A 3BBWA 3S2PA 1YW2A 2VX3A 3GFWA 5IUIA 4MNFA 4EOIA 4KIOA 3RP9A 2CDZA 3WZKA 2X6DA 4WNOA 4Q5EA 5CNOA 3CE3A 5J87A 3SXRA 4C4IA 4IVCA 1XHAA 4GKIA 4UMTA 4QOXA 1DI9A 3HX4A 4R7IA 3RAIA 4A9RA 4YJOA 4BHZA 4ACMA 2J51A 4BTJA 1OI9A 3ZM9A 3R71A 3ZFXA 2X81A 1BMKA 2YISA 3TTIA 3NPCA 4L9IA 4RT7A 4AT5A 4YHTA 3MY5A 3GC9A 4CGAA 4D4YA 4EORA 2QODA 3O2MA 1LEZA 4OW8A 2VTLA 4A07A 5L6PA
chains in the Genus database with same CATH superfamily
3QQKA 4IVDA 4BI2A 2OXYA 3TNPC 2YACA 3Q6UA 4QP3A 3Q2JA 4CZTA 3BPRA 5D1JA 3HGKA 4DGOA 5CEOA 4D4RA 2XNNA 2ZFYA 4FV6A 3JYAA 4FT7A 2A1AB 2PSQA 3JY9A 4YSJA 3FEGA 1QPCA 4ZSAA 2PMIA 5EDQA 2XP2A 3NNWA 1Q3WA 1VEBA 2ITYA 3CKXA 3PIZA 4DEGA 3VONA 5ETAA 4MAOA 3KL8A 1H28A 2QKRA 2ITOA 5AAFA 2UZOA 4AX8A 4Y8DA 4CFWA 1V0OA 2OIQA 4AZWA 3ZMMA 3ZLXA 3QTRA 4FNXA 4JDHA 4RVLA 4C4FA 4E6CA 5J7HA 2VO6A 5LCJA 4J95A 4W4XA 4MWHA 4F7LA 5IH5A 3ZBXA 5GJFA 1QPDA 4ZMFA 1L3RE 4FOCA 5CI6A 5EM8A 5A4TA 2OI4X 2CKQA 1A9UA 3OOGA 4GCJA 4C7TA 3PVGA 4DINA 3W0PA 3Q32A 1P14A 2GQRA 2R3IA 4LL5A 3CXWA 2J9MA 3MIYA 3ZUUA 4FRFA 1J7UA 4UYNA 4UMUA 4MWIA 1UV5A 3TKHA 4GT3A 3S1HA 3DDPA 3TUCA 2Y6OA 3PXQA 3BCEA 3DJ6A 4HOKA 2JDTA 3NX8A 3R7GA 5A4LA 3TIZA 5IG1A 3Q60A 3S95A 2CNVA 5M06A 3D14A 4PWNA 3V5TA 2HY81 4NFNA 1BKXA 4JBQA 1H08A 5F20A 5J5SA 5HO8A 5EQEA 1GIIA 3HP5A 3MPMA 3ET7A 3NIEA 3WE4A 2CJMA 2J5EA 3ORIA 4FE2A 3MB6A 3KMMA 3HMNA 3R04A 3EFKA 4ALWA 2BILB 5JT2A 3A8WA 3DXPA 5J8IA 2HIWA 4I21A 4O6LA 4MNEA 3UO4A 4TNBA 3VO3A 3FZRA 3MH2A 3EQDA 3HUCA 5HU9A 3LJ1A 3BWFA 4BB4A 2G2FA 1UWHA 4DEBA 3OROA 5GNKA 3QXPA 5FP6A 1ZY5A 3NAYA 4FK3A 4H39A 1OL6A 4QMSA 4PDYA 5DRDA 3P5JC 3ORMA 2VTTA 5E8UA 4BDGA 5AR2A 4TWPA 3LXLA 2C5YA 1UNHA 2YJSA 5KUPA 5HVJA 2HZNA 2JFLA 3SDJA 4ANSA 1YDSE 3QTWA 4F0FA 4NIFA 5CF8A 5AR4A 1G3NA 2RFDA 2ZDTA 5DN3A 4YZCA 1WBVA 5J1VA 5I3OA 4MX9A 3RPRA 2PVKA 5C9CA 4HGLA 5JZJA 2VWVA 1TVOA 1YXSA 4GYGA 2W4KA 4JLCA 5DR2A 4ZTSA 4MQ2A 4HYIA 5HLWA 3I60A 4RJ4A 1T46A 1ZYSA 1IEPA 4KKGA 2X7FA 4RC4A 5HG8A 3RNYA 4AGCA 4XG8A 3E92A 2QKWB 2J0JA 3BGZA 4IB3A 1H27A 2XM8A 2EB2A 2W1GA 3QA0A 4FKQA 4B8LA 3OCGA 4D9TA 3FMNA 4IB1A 4UMPA 5M4FA 1DAYA 3EQPA 3HP2A 4MD8E 4LI5A 4O96A 3ZBFA 3QGWA 5IEXA 4NYEA 5DR6A 3PXYA 4D5KA 5CAPA 3Q04A 4RVKA 2IW9A 2WMXA 3GNIB 4K0YA 4ZK5A 2BR1A 3KMUA 2OJ9A 5ETFA 4V0GA 3MTFA 2XH5A 5BUIA 2HY0A 1FBNA 2BDJA 1Q8ZA 3C4ZA 3BYSA 4ASXA 5DEYA 4XYFA 4YJVA 1XQZA 4ANBA 3VS6A 3NWWA 3WE8A 1NT2A 2OICA 3T8OA 2HW7A 3ZRMA 5IMEA 2JEDA 3GCUA 3D94A 1VJYA 5T68A 4QYGA 3PWDA 3S0OA 3P7BA 1JVPP 1XH6A 5A54A 3ML1A 4U9AA 3V5WA 4TW9A 2GCDA 4Z7HA 2I0EA 3QLFA 2UVXA 4H1JA 3T9IA 3PIXA 5C1QB 3IG7A 3NCZA 2NPQA 3LFBA 3P79A 3IOKA 4PQNA 4BCKA 4MXZA 4I6QA 3SG9A 3E7VA 5AEPA 1PXIA 3AC3A 4U41A 4EOOA 4BWPA 2ZVAA 2IZTA 3PG3A 3BEAA 5CY3A 5IU2A 1MQBA 1ZOGA 2GQSA 2R5TA 2G2HA 2XIZA 1O6KA 4AFEA 4U79A 3ZCLA 2R7IA 4PP7A 3SXSA 5ANGA 5LVOA 3VS1A 3PSBA 3BYVA 5FM2A 1W84A 3FPQA 2Q0BA 2PHKA 4XG6A 4M7IA 3PE1A 4FTAA 3JVRA 5KO1A 3QTSA 4FV2A 2WD1A 3D5WA 3GGFA 4RWKA 3O23A 4XV1A 5G1XA 4YNOA 3GU4A 4CLIA 3F3VA 5K0XA 1VYWA 4G9RA 4GK2A 4EBVA 5IA4A 3QQJA 2BKZA 4JX3A 2F7EE 4FIGA 2XCKA 4QO9A 3FHRA 5K3YA 3FZSA 4JG7A 5KZIA 2X2MA 5A3XA 1M2RA 2WZJA 4S2ZA 2W1CA 1TZDA 4A9TA 5CZIA 4HNIA 2E9UA 4IXPA 3NDMA 2ZV9A 3QTIA 4BN1A 5GINE 3B8RA 2I0VA 1PXLA 2JDSA 2R7BA 4GL9A 2BTSA 2VTNA 3OCSA 1G8SA 2AYPA 3HEGA 3IDPA 3KKVA 1XH5A 5F95A 4ZTHA 3IO7A 5DOSA 2PVJA 5I9WA 3QHWA 4QQJA 4DEIA 4EQCA 5LWNA 3E93A 2YN8A 5HLNA 4AA0A 4FTUA 3VUKA 4EK3A 3TEIA 3QZGA 2G9XA 1ZOEA 1JKSA 2B1PA 4KABA 3DBQA 3ZSIA 1VLRA 4DGGA 3A7GA 3QTZA 4Y85A 3BHUA 3COMA 3HYHA 3OVVA 2C4GA 3PA3A 1OKYA 4LV8A 2B9JA 3ZEPA 2BRGA 3IW6A 1NXKA 3E5AA 4R3PA 3MJ1A 5L2SA 2UW4A 2HCKA 2YDKA 3KXGA 3N51A 3NNVA 3PVBA 4FT3A 4FSZA 5DPVA 1PHKA 5HE1A 5E9EA 5AAGA 3FXXA 1YWNA 4IANA 3DKCA 4X3FA 2X7GA 3EWHA 2O5KA 3U6JA 3BWJA 3IK3A 3LCSA 1M17A 4IZ5A 4Z3VA 4CYIA 1W8CA 3PUFC 1OIUA 1WMKA 1YI6A 3DAJA 4Z9LA 4CXAA 3MH1A 4B0GA 3ZS5A 3FMLA 3UYSA 4XG4A 3BGPA 3DZQA 5IQEA 2G01A 2ITTA 4YZ9A 3UO5A 1IAHA 4XOZA 4UZHA 2RGPA 4D2RA 3COHA 5ANDA 2C3JA 4FKGA 2HZ4A 4LGDA 3BL9A 3DA6A 3V04A 2ITQA 5ANEA 5B7VA 3C0IA 3KEXA 2HZ0A 3KXHA 1HOWA 4K2RA 4FG8A 1E1XA 4MUQA 4MXOA 4K8AA 3KK9A 4FI1A 5A4EA 5C8KA 3L9PA 4J99A 4GG7A 1UU7A 4FKRA 4OTHA 4W4YA 4E73A 2R9SA 5LXMA 2PE1A 4AE6A 2BVAA 4DDIA 4L67A 4AZTA 5GJGA 3O17A 1B39A 3VS7A 2YIRA 3QCYA 3DKGA 3PPKA 4A9UA 3NUNA 3QZFA 1U4DA 3R7EA 3W10A 5L2TA 3EKNA 5DYJA 2BKKA 3LFNA 3A99A 4FUXA 4LGGA 2W5BA 5EHYA 5AIKA 3LMIA 4FEUA 3A61A 3C5UA 2VO7A 3W0RA 2R3FA 5ETCA 1FVVA 4DFUA 3OY3A 4BDFA 3BU6A 4O21A 4O7NA 5AM6A 4M0ZA 2YA9A 2WO6A 5AR8A 3R8VA 3UVQA 3MDYA 1MQ4A 3G6HA 4QTBA 4AN9A 1XH8A 5E7RA 4ZSJA 3IPHA 4I41A 4D2PA 2EB3A 2VWUA 3UP2A 4QNAA 4NU1A 3R9HA 3TM0A 2JDRA 3HA6A 4AQKA 3EN7A 1O6LA 2C3KA 2YIXA 4MQ1A 4MXYA 5HO6A 1IG1A 2XK6A 1NA7A 4BY9E 2CGUA 1AD5A 2QNJA 3C0GA 3DQWA 3RK9A 5CASA 5CI7A 2IZUA 3RBWA 4EC9A 4ZZNA 1V0BA 3PUPA 2GHMA 3HUBA 4ITJA 2B9IA 5FBNC 2H34A 5M4UA 3AG9A 4PTEA 4P90A 2P55A 3KGAA 3QU0A 2RFNA 4X2NA 2BZJA 4JG6A 5EQPA 2WQMA 2QOIA 2RFSA 4KAOA 4K6ZA 4RWIA 4S32A 4BCNA 5C8MA 4CFFA 2CCHA 5C4LA 5HG9A 3CJFA 3OBGA 4I6HA 2YABA 2HW6A 3LQ3A 3NNXA 4I20A 2ITWA 1GY3A 2OXXA 4PUZA 5CAVA 3ZO4A 2ERKA 4ENXA 4BYJA 2W4JA 4AG8A 5KMKA 4YJNA 4D58A 2C6MA 5KCVA 3BE2A 5CXZA 4C3PA 2PPQA 3GC7A 3ID6C 4LUEA 4G2FA 3L8VA 1S9IA 3PTGA 4DLIA 3DNDA 3HMMA 4WRSA 1W2DA 4ZTRA 4W8EA 2BFYA 3O7LB 3PJ3A 4PNIA 4FSRA 3UO6A 2O65A 4TYHA 2OSCA 4OTPA 3LQ8A 3R7VA 4ASEA 2PE0A 3RZBA 3CD3A 3K2LA 5G6VA 2WQBA 5HKMA 5L2IA 3MA6A 5HG7A 1JKKA 3FHIA 3GXLA 2FB8A 3QQHA 3PWYA 3A4OX 3MH3A 4FIFA 4CZYB 4EH8A 2XKCA 4II5A 3RNIA 5I9ZA 4KBAA 4UEUA 4CKIA 4IX3A 3I79A 5AFVA 3GU7A 4KRDA 2KULA 2GNIA 3ACJA 4Q2AA 4UV0A 4QMTA 4XRJA 4FTCA 4QYFA 5EFQA 4JDJA 3SX9A 5HIEA 4GU9A 4FSNA 2WTJA 2VTSA 4F64A 4L46A 5DIAA 3R7YA 3PDTA 1TQMA 3V5LA 3KB7A 5GZAA 1PY5A 2W1DA 3G9NA 2PVRA 3LXNA 4FKTA 3KVXA 2YERA 2XM9A 5AUYA 2HWPA 4K1BA 3HDMA 4IX4A 4LMUA 3DTWA 5CNNA 3D7TB 4O2PA 4O6EA 2OO8X 4MCVA 3S4QA 1YHWA 3H9RA 3UOLA 5IQAA 4D28A 4HCTA 2AC5A 3R0TA 4QPSA 3TIYA 1W98A 4EL9A 4E1ZA 3II5A 3EOCA 3GU8A 4FV5A 3TUDA 5I3RA 4NJDA 3UDZA 4PV0A 4QP7A 4C3FA 4BR3A 3MJ2A 3BBTB 4R1VA 5HVYA 4BJJA 5F1ZA 3LFEA 2W7XA 4ANQA 1BUHA 3VUMA 3UG1A 3A7FA 2VTIA 2F49A 2C6OA 2PZRA 2BAKA 2W96B 1UU8A 1ZWSA 3W16A 4CTCA 5DRBA 1YWVA 3L8XA 5HHWA 3T9TA 5KE0A 3NYXA 4YLKA 2C5XA 4ZEGA 4YSMA 3AD5A 3CP9A 4R3RA 3FI3A 3QQUA 4QMZA 4Y95A 4DTAA 4R6VA 1NVQA 4WRGA 2PVYA 4EHGA 3KMWA 1JSTA 3PJ8A 3HKOA 2DUVA 3WYYA 4HVSA 3U51A 3OWJA 4ZJJA 1A48A 3F2RA 3NEWA 3ORXA 2IVUA 4FYNA 4X2JA 2FVDA 4J8NA 2XK7A 2XUUA 1M2PA 3ZO1A 2V0DA 1GZ8A 5KNJA 3BZ3A 2DWBA 3KRWA 4WUNA 2OKRA 3AC5A 3A8XA 4RIYB 4BDCA 5BMSA 5CEPA 4IACA 2YZLA 3ZYAA 2GQGA 1UA2A 3MFUA 3PSCA 2IWIA 2IO6A 3GCQA 3IDCA 4C38A 4X2KA 2Y4IB 3ACKA 5A6NA 4F7NA 2RG6A 3BV2A 3OW3A 3R1YA 4RX7A 3AXWA 2YAAA 4CYJA 2YFXA 3FAAA 2R3MA 2R3OA 5IUHA 1ST4A 2VTHA 5IZFA 4RQVA 3TKIA 1E1VA 1KE7A 1CKJA 2WMQA 3QUEA 4BDBA 5BQ0A 3VAPA 3SVVA 4G5JA 4HZSA 4QT1A 4CVAA 2ZJWA 3W2SA 4E7WA 3RM6A 4LV7A 2PWLA 4IC7A 3W33A 4BZDA 4ERKA 4G3CA 1W2CA 5JFVA 1XKKA 3UNKA 3CTJA 4USFA 2J5FA 2VWYA 4BFMA 5HO7A 3A7JA 3CY3A 2OW3A 4FL3A 3R1SA 5CAUA 2PUNA 1BYGA 2W1IA 2Y9QA 3QRUA 4APCA 2XYUA 4JL9A 4W8DA 1XJDA 5C8NA 2AEGA 2UV2A 4GU6A 4ZSGA 3NUSA 5IEYA 4Q9ZA 5KBRA 3FI8A 4F1OA 4ACHA 3DBCA 5CALA 2BMCA 4WSYA 4L3JA 3O7LD 3O51A 2J90A 3KULB 1Q5KA 3DFAA 4OBOA 4UWYA 4FZFB 5IQFA 3MIAA 4YLLA 4TL0A 4FODA 4RX9A 4U40A 4WSQA 3QQFA 3NR9A 3Q9ZA 1Y8GA 4JDKA 5BNJA 5CZHA 5CSPA 4BICA 3EN5A 4LOOA 2OIDA 5D7AA 4BF2A 4ZLZA 2P33A 3EZRA 1ZXEA 2VX0A 1R0PA 2FA2A 2XKEA 4M8TA 4YJQA 3RWPA 4RA5A 1PXOA 3BE9A 2XJ1A 4NK9A 4FV0A 4FIHA 4MBIA 4RBLA 3PPZA 5AX9A 3S00A 3V8SA 1QPJA 4J53A 3FQHA 2GMXA 1ZYJA 2R3LA 2OZOA 2YM5A 3EQHA 2O8YA 3VHEA 3E8DA 2Z2WA 3AC4A 3H10A 5ANKA 4BYIA 4JBVA 3KY2A 3I6WA 3F66A 4XLVA 4CNHA 4QMNA 1H8FA 4PRJA 5HI2A 1H00A 3VHKA 2BAJA 3ORKA 4NSTA 2ZM4A 3KVWA 3QX4A 5DGZA 4BDDA 5C01A 3QKLA 3UG2A 3VF9A 5HBJA 4C34A 4EK4A 1ZOHA 5KX8A 4CCBA 3FUPA 3DXNA 3DLZA 3O71A 3EYHA 1PMUA 5CVGA 4AZSA 1KSWA 3RJCA 3LFCA 3RPVA 2XIRA 3K3IA 5JMSA 5HTCA 2Z60A 4A4OA 2UZNA 2V5QA 4L52A 3PE2A 4ASZA 3D0EA 5FGKA 1H1QA 2O2UA 4BTFA 2ZV2A 5AP2A 3JUHA 4F1MA 4L3PA 4O0YA 5DT3A 3BLHA 3UVRA 4EH2A 1PXMA 3QD3A 1LR4A 3VRYA 3W2CA 5HD4A 1GAGA 2CGXA 2XNMA 1X8BA 1RQQA 2BZIB 4Y5QA 5HEZA 3JR1A 3KC3A 2WQEA 3QKMA 1IR3A 2HOGA 3UPXA 2BALA 1ZY4A 2YCSA 3H0ZA 3W0SA 4IC8A 4WD5A 3RK5A 4XUFA 1FPUA 3HZTA 4BC6A 3AMYA 5AMNA 2R64A 3A7IA 3CQUA 4EZ5A 3L9LA 4AOIA 2CKOA 3PFQA 2OF2A 2XK3A 4G3GA 3KN6A 3THBA 3UBDA 4IADA 1OGYA 3RM7A 2XK9A 3PVWA 3GP0A 4XV2A 3NFFB 4HGTA 2CNUA 4ZJIA 1A06A 4XV9A 4CFNA 5T6KA 1ZYCA 3GQLA 3UDBA 2C0OA 2ITPA 3OXZA 4FKVA 1CDKA 4FVPA 4KKEA 3F3TA 5HCXA 2HK5A 3HA8A 3R7OA 3HV6A 4FTNA 4ASDA 5DE2A 2QOOA 4BCOA 5FTOA 4DFYA 2OFVA 3JXWA 3UC3A 3C1XA 3DU8A 4L3LA 4DHFA 3QTXA 4BHNA 2C47A 5EYCA 4DBNA 2ONLC 4GJ2A 1V1KA 2VWBA 4KIKA 4YO6A 4PL5A 5LOHA 4OAVB 1WBPA 3PY1A 3BU5A 4U3ZA 2YAKA 3RTPA 2YCFA 4HYSA 4QMYA 1Y8YA 2P0CA 4I94A 2X8IA 4UB7A 5E1EA 3VS3A 5JFWA 4KRCA 2QOQA 3ANRA 3UP7A 1NVRA 2BFXA 4PDPA 5H8EA 4BWKA 4MKCA 3I5ZA 1KOAA 1JNKA 2ITXA 3FC1X 3G5DA 4JJRA 2UW6A 1OMWA 4NWMA 3LM5A 5EKOA 5DG5A 4O0TA 5BMMA 4RWJA 4DGMA 2XYNA 1YXVA 3ZU7A 4EWQA 2WTKB 4ARKA 3LOKA 3QF9A 4U6RA 5IEVA 4ZTNA 3FMDA 2GS7A 2R3KA 1SM2A 5HICA 5BYLA 3ZHPC 1WBOA 2OH0E 1YVJA 3MYGA 5KHXA 4MXAA 4OTQA 4GMYA 3DKOA 5ACBC 3SXFA 4BDAA 3TTJA 4DGNA 5IQDA 2QOBA 1XMMA 4DF3A 4ENYA 3PLAE 3RAWA 5JQ8A 4GFMA 1Q61A 3DJ7A 1K9AA 1ZMWA 1Q3DA 4FV8A 2J0KA 4JRVA 3JY0A 3UE4A 2CKEA 3C9WA 4QMMA 3ZLSA 3IW5A 2QCSA 2YM3A 3QQLA 4KBKA 3MS9A 4QD6A 4EYJA 3OF0A 2IZSA 4NKSA 5HCZA 3UOKA 4C2WA 3LLAA 3V6SA 2PVFA 1ZZ2A 2EUFB 3IW7A 5J5TA 3FBVA 5M53A 3W0MA 3P9JA 4NH1A 3NRMA 2PZPA 5L2WA 4ZLOA 3LCOA 2P2HA 4KWPA 3U6HA 4MH7A 4PX6A 5M09A 3HDNA 4CRLA 3ZRLA 3ENMA 4KNBA 2WMAA 4I24A 2OWBA 4JRNA 4LV5A 3DQXA 4AFJA 3HRCA 5FM3A 4XEYA 4WG5A 4U42A 4KIQA 5CLPA 1ZARA 4K11A 4P4CA 5DH3A 5H8GA 5K0KA 1CKIA 2ONLA 3ORLA 5HIDA 3R7IA 1ATPE 4Q9SA 4XBRA 5BV3A 3ZONA 2X6EA 4BCHA 3DKFA 3LIJA 4EONA 4BBEA 5AV4A 2C6DA 4Y83A 2XNPA 4S33A 3TDVA 4IAKA 4F9YA 2XBJA 2GNFA 3KFAA 1Y91A 3HMPA 4YZNA 2OXDA 3I1AA 4PNKA 2IG7A 4GVAA 1UKIA 4V01A 2XMYA 2FSMX 3KF4A 4USDA 5FTGA 4AZEA 4ZY5A 4G3EA 1H0VA 2YZAA 3FZTA 4AXEA 2EU9A 3AD6A 1ZRZA 2I6LA 5LVLA 3DBDA 4F4PA 1PRYA 3D2KA 4PPBA 4J8MA 1OL7A 4ZIMA 3FKLA 5H8BA 3F3WA 3G33A 2Q83A 3QGYA 3WZEA 2V7OA 2YIYA 1PF8A 3AKJA 2E9PA 4WKQA 5DHJA 3C50A 1P2AA 2W1ZA 3EYGA 3CD8A 2WMTA 4QP8A 5AJQA 2YDJA 4EOPA 4B9DA 3Q3BA 3FMHA 3UIBA 1SYKA 2X0GA 3DOGA 3RVGA 3BLAA 3DCVA 1XR1A 3R21A 2VX1A 3ETAA 2HZIA 5T3QA 4PP9A 5HX8A 4X3FC 3PYYA 1KE5A 4B99A 1FMKA 4DEAA 2BDFA 4BJJB 3ELJA 4RFMA 4HJOA 2V22A 1CMKE 5A14A 4ID7A 4PDOA 4RZVA 4QRCA 2XAOA 4IDTA 3R30A 4EH7A 4EH5A 4FSMA 3QRIA 2XANA 3H3CA 5GIPE 2WOTA 3K5UA 3PJCA 4FNYA 5KMLA 2C6EA 2CCIA 3FZ1A 4G6OA 4XHKB 5A4CA 2WTKC 1OPKA 4AWIA 4M12A 3QL8A 5EOBA 1H1PA 5I0BA 1XH4A 3TDWA 3HLLA 4EI4A 2RIOA 3G6GA 5HORA 4YBKA 2ETMA 2W5HA 3FI4A 4CEGA 5BVOA 4TKSA 1WFCA 1XMLA 1JOWB 4RSSA 1H25A 2B53A 4FT9A 3VW6A 5LMBA 3OBJA 1YRPA 3HV4A 3FXWA 4I6FA 3F5UA 3RPOA 3WF7A 5EW9A 1MRVA 1XO2B 3DK7A 3RPYA 4EK8A 4U0IA 4O7VA 2I0HA 4UX9A 5AP0A 5ANIA 2XIKA 3KF7A 2HXQA 2FSLX 2UUEA 2ZB0A 4PMSA 4DFBA 4U80A 3SW4A 2BDWA 3I0OA 4YTCA 4EH4A 3NYVA 3P0MA 3UJGA 2C6IA 5ANJA 4QP9A 4JQEA 4TXCA 5JN2A 4AN3A 4AAYA 2Q0NA 2P3GX 2B7AA 1WVWA 1VYZA 2XNOA 3VS5A 3HNGA 2I40A 5LCKA 3V6RA 4B4LA 4FGRA 4NM7A 1Z9XA 4C4JA 3TT0A 3NW7A 2QQ7A 3PRIA 4DGLC 4LRKA 5M57A 1K3AA 2VWWA 5H2UA 4EOSA 4WOVA 4IX6A 3UMXA 2QOHA 2ZM1A 4RA4A 3UZTA 5AA8A 4XS2A 3EL8A 2IVSA 2ETRA 3LHJA 3R83A 5C26A 4AW1A 5CEKA 2C1AA 4EEVA 2E9VA 3MTLA 4RJ3A 4G34A 3F61A 4E4LA 2QOFA 5DFPA 5DMZA 5KMMA 2VAGA 1XH7A 4O0XA 4O83A 2WMBA 4OBPA 1ERKA 1TKIA 4RC3A 1RW8A 1WBSA 4U3YA 2X4FA 2Y0AA 5FXRA 4ACCA 4YMJA 1VZOA 1Y6BA 4EJNA 4ZLYA 3CSVA 5FEDA 1KOBA 3PXKA 4R7BA 4V0GB 3UNJA 1U54B 3C0HA 5EQYA 2GU8A 4AAAA 3ORPA 4RVMA 2J0MB 4O4CA 5AV3A 4AUAA 3E88A 4NFMA 4DEDA 4DA5A 2REIA 3G0FA 4R3CA 4QMQA 5HE3A 4KUJA 5BVFA 3HVCA 3M42A 5E1SA 4QMOA 3CBLA 5D12A 2VNWA 5B2LA 4RLKA 2W9ZB 4X0MA 4WHZA 3W0QA 3KQ7A 4TY1A 3QA8A 4O4BB 4ZJVA 4FTRA 3VUDA 3QCQA 2CGVA 4KIPA 2RFEA 1OGUA 3OMVA 4RJ7A 2B0QA 5DBXA 4BCMA 3QUPA 4HVHA 4FGBA 2X4ZA 3O8UA 4IE9A 3TZ8A 2IPXA 2W05A 4I5CA 3TWJA 2CN8A 3F7ZA 4BCPA 4RIXA 5CQWA 5EYDA 3CPBA 4UMQA 4DDGA 3NUXA 5K5NA 4DHJA 2QO9A 4MF0A 3EJ1A 3GC0A 4O0UA 5EM7A 1OBDA 2NP8A 3CR0A 3A60A 3ITZA 5TE0A 4BI0A 3QCSA 3VRZA 4RG0A 3UDSA 4RX8A 4JIAA 3IECA 4BKYA 2QR7A 2WOUA 4XG2A 3RI1A 1UNGA 3R63A 3BHTA 4E5AX 2UVZA 2QHNA 5GHVA 4H3QA 3L9MA 4G16A 4HYHA 4PMTA 3FZOA 5HIBA 3ZSGA 3FY2A 4PPAA 4G3FA 4HPUE 4O4DA 4TYEA 1I09A 3F3UA 2VTMA 3A4PA 1YXUA 2PULA 3VS4A 3ZDUA 5I9UA 4BDJA 3O5AA 3ALOA 2PE2A 3QCXA 4UN0C 2VUWA 3ENHA 4PL4A 1PMEA 1YDTE 3QAME 3TKUA 4ZS4A 2WMUA 3I7CA 5HLPA 3TNHA 3LMGA 4EYMA 5KBQA 2X39A 4NJ3A 3KXXA 3SD0A 4DCAA 4P5QA 5J7BA 3VBYA 4LGHA 5AP6A 1OIRA 4J7BA 4NKAA 1M52A 3UPZA 1ZMVA 3EN6A 3W1FA 3ZXZA 3EFLA 3DGKA 3T3VA 3DAEA 4QYHA 2JITA 4YHJA 3K54A 3COIA 3QXOA 4HNFA 2X8DA 4O2ZA 4ZSEA 1WVYA 3ROYA 4RIXB 3BYOA 3I7BA 3LLTA 3MESA 4GW8A 2C30A 2UZDA 5EH0A 3R8PA 3OUNB 1PMNA 4JG8A 4U45A 4NZWB 4U44A 1LP4A 4TYIA 1YDRE 3HMOA 4GEOA 2B9HA 2OK1A 5FEQA 3QYWA 4M3QA 2WMRA 3H9FA 4L42A 5BYYA 1PXKA 1PJKA 1FVTA 2C1BA 2IN6A 4FZDB 4YTHA 3AKKA 2XKFA 5AV1A 3IW8A 5B0XA 2B52A 5FDPA 3UOJA 2JBPA 2C3LA 4UBAA 1URWA 4BKJA 4XG9A 3SKCA 4IDVA 3QKKA 3DXQA 4D1SA 3ZZWA 5DWRA 3F5PA 1OUKA 5DVRA 3U87A 4LOPA 5HBHA 4U5JA 3BHYA 1FGKA 2R0IA 3GU6A 4CTBA 4DTBA 2ZB1A 2YM4A 3FE3A 3DNEA 1TFFA 4L6QA 4BCJA 3WOWA 4ZAUA 4AW2A 4CMOA 4CMUA 4QMLA 3Q9WA 4PF4A 4CSVA 3D7ZA 3GEQA 4FKIA 3QWJA 2X7OA 3D7TA 3SW7A 4MHAA 4NTTA 2WGJA 3HV3A 3RWQA 4E6AA 4RIWA 3HRBA 2VZ6A 5L2QA 2Z8CA 5FQDC 4F7JA 2FUMA 4K9YA 5IA1A 3R9DA 5L8LA 4A06A 2WEVA 3F82A 3B2TA 3WF5A 5J9LA 3PRFA 1YKRA 2YWVA 5AIRA 5EI2A 2JKQA 3VQHA 3QQGA 3FPMA 4MXXA 3R9NA 3WZJA 4FKWA 2YDIA 3L1SA 2BUJA 5EG3A 5AADA 3OCBA 2ITVA 1H01A 1W0XC 5HU3A 4JVGA 5B2MA 3LPBA 4WBBB 4KS7A 4ZS0A 5L6WL 2PTKA 5IISA 2VWXA 3DAKA 3VS0A 2XS0A 4U7ZA 2XBAA 3C4WA 4Y72A 3MN3A 2W99B 1MP8A 2AC3A 4DH8A 2WTCA 2O64A 4LRMA 2ETKA 4TWNA 5AP5A 3U55A 4IWQA 5FWKK 5FXSA 4FTLA 5DA3A 2H96A 2JIVA 2XIXA 3ZRKA 3OWKA 4YC3A 3WBLA 4FOBA 2OGVA 2VU3A 5AP1A 2X2KA 3PY0A