3TNIA

Structure of cdk9/cyclin t f241l
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
297
Chain Sequence
SVECPFCDEVSKYEKLAKIGQEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 297
sequence length 319
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tniA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tniA01
1PMVA 4OGRA 4K2RA 4QMUA 3WZEA 2UZDA 3Q5ZA 3OF0A 4WOVA 4TPTA 4EH4A 4U45A 2Z7QA 3HUCA 4D2RA 5M55A 2XYUA 4FIGA 5KBQA 3EN5A 1PF8A 2AYPA 4EH7A 5AAEA 4TYIA 2XKCA 3V01A 2PZIA 4D9UA 1R1WA 4C4JA 4RIYB 4UYAA 4AOIA 5E8YA 1CDKA 4EBVA 4DE4A 3VRYA 4JOAA 4NUSA 3TACA 3C5UA 2QC6A 4ZMEA 2W5AA 3CKWA 3IGGA 1J1CA 4LGGA 4LL0A 4DINA 4ENXA 4G34A 5BNJA 4RC4A 4DG3E 5HORA 4MWHA 3MPMA 1VYZA 2ZDTA 2WQEA 4U3YA 4E6CA 5IPJA 4FKUA 1SNUA 5D41A 4O82A 3QTWA 4YPSA 3Q5IA 1Q4LA 1ERKA 4FTJA 4CRLA 2O64A 2XF0A 3PVBA 4EWHA 2QKWB 3NS9A 4RC3A 4L43A 4XP0A 1GZOA 4XS2A 4IC7A 5DH3A 4LOQA 5AUUA 4RJ8A 1BLXA 4QD6A 4Q5EA 2GDOA 3KQ7A 3ZBXA 4C58A 4DTBA 3QQUA 2X2KA 4OBQA 2HY81 4APPA 1Y91A 2FH9A 4RGJA 3UVPA 2XM9A 4BBFA 4FNWA 5AV2A 4CLJA 4D2SA 3OXTA 4KABA 3ZXTA 3LQ3A 2W1CA 2WELA 4D5HA 1H08A 1XQZA 1UNGA 3CCNA 3A7FA 2GHLA 3F7ZA 3DS6A 1BUHA 3PXYA 4FI1A 4K9YA 3RNIA 3ROCA 4FA2A 4UV0A 5CASA 4YZCA 3MH0A 3HV3A 4TW9A 3A61A 3W33A 2VD5A 3BU5A 3O50A 4AGUA 2WOUA 5I5ZA 3FMHA 2E9PA 4PY1A 2J0JA 1U54A 3IKAA 5ETFA 3VN9A 4BBMA 4BIEA 3GU7A 4ZJJA 3RGFA 5HTBA 3ZONA 1ATPE 4WUAA 1F5QA 4N6ZA 2EUFB 4Y73A 2QO2A 5CNOA 3OBGA 3ZHPC 3CJFA 2J5EA 4C02A 3HECA 2WQMA 4AS0A 2HWOA 2C69A 3CTJA 4O96A 5KCVA 4ZTQA 1YHWA 1Q62A 3ZDIA 2OJGA 2R7BA 2UZUE 3PE2A 4H1MA 4NYEA 4K11A 3KCKA 2ESMA 4UXQA 4FIJA 4V01A 4EUTA 2IZUA 4BI0A 1H25A 3A4PA 3LLTA 3DAJA 4MF1A 3UODA 2JFMA 4DC2A 3P1AA 4QNAA 5TT7A 3QQGA 4F64A 3FWQA 5H8BA 3Q4UA 4FTMA 3DFAA 3TNHA 3QUDA 3QA0A 1H26A 2XK7A 4N57A 4FSUA 5FDXA 3RCDA 5KMMA 5L3AA 4KKHA 3SW7A 5EHOA 1ZAOA 3WF6A 5E8SA 4F9AA 4D9TA 4V0GA 2A2AA 5HE1A 3OMVA 3KVXA 3CTHA 3FC2A 1J91A 4R3RA 4QMSA 2ZVAA 4PUZA 5CF6A 3A7JA 4BRXA 4D1ZA 4FV4A 4E8AA 2OXXA 4EK3A 3F2RA 3CGFA 4Q9ZA 1MRYA 4CKRA 1YRPA 2YABA 3D9VA 3FZOA 4ACCA 3FL4A 3UNKA 4D2VA 3OCTA 2H96A 2WQOA 3CY2A 3F82A 3WE8A 4RIWA 2XJ2A 4I6HA 4ZEGA 4CV8A 4IAYA 4AT3A 4FEVA 3QLGA 4J99A 2HELA 4MX9A 2XCKA 3QD2B 3LVPA 3RWPA 3RMFA 5CT0A 5F95A 5CU6A 3S4QA 4HCVA 2PSQA 3HAMA 4MBLA 4K8AA 4AG8A 2B9JA 4O0WA 2KTYA 2VWBA 5L2IA 4TY1A 1OPJA 3A7IA 3Q9ZA 3QYZA 4KD1A 5CQWA 4IFGA 2OG8A 5LVMA 3G9NA 5KBRA 4TZRA 4BCJA 2EVAA 1R0EA 4JG8A 2IZSA 4WO5A 2Y6OA 3BCEA 3G0EA 4AX8A 4G6OA 4IAZA 3VUHA 3SXRA 3E8CA 4FL2A 3WF9A 3I5ZA 2BFXA 4GH2A 2QO9A 4FTTA 4BKZA 1JAMA 4C2WA 3FYKX 4BZNA 3VS7A 3BLRA 2PVFA 2HZ0A 3N4VA 4TYHB 4ZTNA 3RK7A 4S32A 2UW6A 3DBFA 2W1DA 4Y8DA 4DH1A 2YJSA 3RHKA 4RVMA 1OKVA 4RC2A 2WHBA 4RX9A 4RA5A 4RWLA 3BYSA 5IH5A 2G2HA 4I0RA 4RT7A 3D2IA 3FUPA 5GZ9A 2BTSA 2GNLA 2PU8A 3QRUA 2ZM1A 5G6VA 2YM5A 4YTFA 4JDIA 3RJCA 2PPQA 3D5WA 4MEDA 4C57A 3EIDA 4FV2A 2A0CX 3ZO1A 3OCSA 2XVDA 4BFMA 3DZOA 1YWRA 3MFTA 5BQ0A 5K4IA 1PXPA 1V0OA 4U42A 2JLDA 4Q5HA 3U87A 4Y46A 2P3GX 5CS6A 3ORNA 3DDPA 5DT3A 5EHLA 4AA0A 2YIQA 3GQLA 5JFSA 5FGKA 5HU3A 5EHYA 3CPCA 5L8KA 2VGOA 5DMZA 4LV8A 5DHJA 3LCOA 3OG7A 4FV1A 3T3UA 3SOAA 2X2MA 2Z2WA 3PA3A 1GZKA 4X2FA 4C0TA 4FSTA 4M7IA 3H30A 3TZ9A 3E88A 3RK5A 1APME 3RAKA 3L9NA 3QL8A 2QLUA 3N51A 1O9UA 3TZ7A 4NKSA 4O86A 4O2PA 3V8TA 2RFSA 4IBMA 2J7TA 4O7WA 1PXMA 2QHMA 4FV9A 5LVPA 4YLKA 5A4CA 3GC8A 3ZEPA 4FF8A 2HENA 3SG9A 5BX0A 2WTCA 4IVBA 5EW3A 4OTHA 3KC3A 4C4FA 1DI8A 2R3MA 4F65A 3CQWA 4XJ0A 3BIZA 2C4GA 4X6RA 1OITA 2RSVA 3TWJA 2HCKA 3OWPA 4MBJA 4NH1A 4R5YA 4CG9A 4Y5HA 2WTVA 4D5KA 3ZSHA 5A6NA 5JFXA 5L8LA 4TYJA 5CNNA 5EM7A 4RPVA 1OL7A 4UMRA 3E8EA 4PPCA 4LMNA 4CQGA 2ZV2A 1OUYA 3ODZX 4IIRA 4C4EA 3QWKA 4F70A 1MRVA 4MD9E 4ZK5A 3DGKA 3FPQA 4IACA 3MWUA 5KKRC 4OT5A 4QMXA 2WZJA 5CU0A 3S1HA 4ZZOA 5EQEA 1WBNA 3D7TB 5KZ0A 4EK5A 2PVLA 4AW1A 2I0HA 5EYKA 1YDRE 2PMNX 5DNRA 1E1VA 3BQCA 4GS6A 5DR6A 5DRBA 1KV2A 4GUBA 4UWBA 3LXPA 3DBQA 4JX7A 3UIBA 5HO8A 5IA0A 5J9YA 3KXHA 1LEWA 4FV6A 1Q97A 4WUNA 5ETIA 4BVUA 5IQGA 4QYGA 4J71A 5EDRA 3KRJA 2ITXA 4DBNA 2Y7JA 5CU2A 5EFQA 3ZUVA 4HPUE 3BGPA 2DS1A 1M2RA 2ERKA 3F5XA 3QX2A 5A3XA 4GT5A 1Y57A 4MD8E 2P55A 3BHYA 2IVVA 3NVKI 2XB7A 4UN0C 4YZDA 5J95A 4FEXA 3OC1A 4TKSA 3MVJA 2WXVA 3HAVA 5HTCA 2CCIA 4OTIA 5AM6A 3JPVA 4O7NA 4ANMA 2B52A 2CPKE 3F88A 2UVZA 2C6EA 5M44A 3CJGA 5HCYA 3T9TA 3F9NA 4I1ZA 4NW6A 5C27A 3FI2A 4FEQA 5AV1A 4AT4A 1OL1A 1Q41A 5DA3A 1V0BA 4GKIA 1TQMA 4QQ5A 4A4LA 4Z16A 5EW9A 2X7GA 4GU9A 3RM6A 3ZC5A 4ACHA 3D5XA 4LI5A 3UVRA 1MRUA 3FZRA 4XH6A 4TYHA 1JOWB 1H0WA 4FSMA 4NSTA 3WILA 2OF4A 4BDDA 3MTLA 3N4UA 4OT6A 2W5BA 2BRNA 3QD0A 3R04A 4PTEA 2FSLX 3QTIA 4CYJA 3VS5A 5AUTA 5IA5A 4FTRA 4IEBA 3TZMA 4ACGA 3OBJA 4E20A 5IQAA 3P7CA 3UNZA 4CVAA 5LMBA 1KOAA 4JQEA 4WRSA 4F6SA 4LGHA 4YTCA 4NTTA 2PZYA 2YCRA 3LFCA 3DBEA 4HYUA 4WNMA 1IA8A 3UMWA 1IRKA 3UZRA 1CKIA 3WIKA 3GU6A 3LMGA 1IR3A 2XIRA 2XBAA 4I41A 1R39A 2VWUA 4LGDA 2CKOA 2QONA 4BB4A 4F9CA 4M14A 4CYIA 1GOLA 3KXMA 1JBPE 4HGTA 4FZ6A 4UWCA 3QTZA 1P5EA 2B54A 3HX4A 4NTSA 4BKJA 5KO1A 4GFGA 3H10A 4F1OA 3VBWA 4BHZA 4EH8A 2ERZE 3V8SA 2C3KA 4XBRA 1DM2A 5CI6A 4XV3A 3CGOA 1ZOHA 4C34A 3FPMA 4DLIA 4AW2A 4ZTMA 4YJVA 3VUMA 3S2PA 4E93A 2QOQA 4EOSA 4OAUC 4G3DA 3RAIA 2JDRA 1AGWA 4S31A 4RJ6A 5LXMA 2YM4A 1J3HA 5IU2A 3BYUA 3HMPA 3TZ8A 3B8QA 4YJPA 2ZV7A 4M66A 5J1VA 4FKJA 2QURA 3O2MA 2SRCA 3F7WA 4MXAA 3JVSA 4CZUA 5BVEA 3OTUA 3TEIA 4C2VA 2BZHB 5FTGA 4U40A 5DI1A 5G1XA 3QTRA 3E63A 2J4ZA 1YXVA 2QQ7A 5E90A 4DAWA 3MB6A 4PWNA 4DG2E 5BUJA 1Z9XA 3OW3A 4X3JA 3F66A 2R3KA 3R2YA 3NUUA 5IUIA 1GNGA 1Y8GA 2HWPA 3D7TA 3PIZA 3PXQA 4TYEA 1JNKA 2VTQA 1H27A 3DZQA 3HA8A 3ZS5A 4B9DA 3FZTA 5IQDA 4L00A 3VULA 3F3UA 5HLNA 4AGDA 1FMOE 5AUWA 4JBQA 3VF9A 5HG9A 1A48A 5EW8A 1Q3DA 4U8ZA 3V04A 4C3FA 3BLQA 1XH7A 3VJNA 4E6QA 5EQYA 3E5AA 5FP5A 2E2BA 3HGKA 4EOKA 4QPSA 3D5UA 3I7CA 3S0OA 3V5PA 3W2OA 5GJGA 4HJOA 4X3FB 4FTOA 1H1PA 4DFNA 2PUNA 4FGBA 2YDJA 4MTAA 3ATSA 1FMKA 2GNHA 2AUHA 3QCSA 5CAUA 5LQFA 4HGLA 3WIGA 3TDWA 1B6CB 4PL5A 4DT9A 4QT1A 3FBVA 4M15A 4UYNA 3EMGA 1RJBA 4QTBA 3FY2A 1ZYSA 2XK8A 3AGMA 3ENHA 4JJRA 3TIYA 1T46A 1XJDA 4RG0A 5CVGA 5JGBA 4DYMA 3IO7A 4D2PA 3CIKA 4FKGA 4NEUA 3OWJA 2HZIA 2G2IA 1F0QA 1OM1A 4Q2AA 2ZMCA 4FSQA 4AGWA 4EKKA 3NNVA 2C0TA 2Y9QA 1XH8A 1PKDA 3SKCA 4CG8A 3PIYA 2QI8A 4WA9A 5JKGA 3ANQA 4HNFA 5CZHA 2JDSA 3G9LX 4JIKA 5GIPE 5AMNA 2IZTA 4JBPA 3W10A 3HRFA 2R3GA 3DTWA 4W9WA 4EOLA 4O7RA 4Y83A 3A4OX 4ONAA 2GCDA 3VQUA 2ZJWA 3IW7A 4W4VA 5KX8A 2R3IA 4YJSA 4EH6A 3PRIA 3L9LA 1CKPA 3TCPA 1Y6AA 3E3PA 4EKLA 3EQHA 5AX3A 1OZ1A 1PMNA 1IG1A 3EQFA 5CZIA 4I3ZA 4WHZA 3TV4A 4F7NA 2W4OA 3TIZA 5H8GA 4EOQA 3QGYA 4BWPA 5AUXA 1JKSA 5JQ8A 3C5IA 3R7GA 5IQCA 1J7IA 4HCUA 5JMSA 3LQ5A 3W2QA 2W1HA 3BV2A 3D4QA 1G3NA 3POZA 3GCPA 4O7SA 4DA5A 1UNLA 1OPKA 3EQGA 3UOHA 4U81A 3UG1A 4I6BA 4C7TA 4IFCA 3K5VA 4DBXA 4AUAA 1WBPA 1YHVA 3TN8A 4CFWA 1ZZ2A 3PA4A 4ZS4A 4N70A 2XRUA 3GQIA 4KSPA 3ZRLA 3AC3A 5GZ8A 5I9WA 3AD5A 5CAPA 4FNYA 2QHNA 3G0FA 3IW6A 4L53A 2VTIA 5C1QB 3QU0A 1PY5A 5B2MA 3BWFA 5AUZA 4F6UA 1TQIA 3KMMA 4AZTA 2UZBA 2R3FA 4YLLA 3R8MA 2QODA 3GGFA 3EYHA 4DFLA 4M0ZA 1W7HA 4ZP5A 4DH5A 2YERA 4O2ZA 3NYXA 4NWMA 4XV2A 5E8UA 2GMXA 3WF8A 3FZPA 5FG8A 4TXCA 3PXZA 2W7XA 3KFAA 4R6VA 4EZ5A 2BVAA 2BR1A 3K3JA 5HX8A 3VUGA 3LXNA 1GZNA 2HAKA 3BU3A 3CY3A 1WFCA 2UW4A 2WGJA 4IM2A 4LRJA 3P9JA 5EYDA 2WMRA 1ZY5A 3KA0A 2VV9A 3QD3A 4TTHB 3VBQA 4IM3A 3PWYA 4AU8A 5AADA 2WMBA 1BL7A 2PMIA 4XMOA 4HGSA 2LAVA 3DQXA 3B2WA 2V7AA 4DH8A 3AC5A 3RPRA 5HCZA 1U59A 3KMWA 4YBJA 5FUTA 4PL4A 4UB7A 4X2NA 1WBOA 3R7OA 4I4FA 4G3GA 4O0UA 4WT6A 3UTOA 5L4QA 4K0YA 2DQ7X 2W4JA 4BCQA 2X9FA 3ODYX 2RIOA 4R7IA 3LHJA 1O6KA 4IZYA 5KHWA 4H58A 4ZLZA 5M56A 4MH7A 5TR6A 5K5NA 3NIZA 4RZWA 4MYGA 3RPVA 4O83A 3HA6A 3QYWA 4FX3A 4N0SA 4XX9A 4YGAA 4YU2A 2ITPA 1OIYA 3L8PA 4I22A 4FTCA 3QCYA 4GYGA 3FKOA 3ORKA 3WF7A 1XKKA 1BMKA 3HYHA 3KL8A 3UJGA 4B99A 3WARA 3QA8A 4D58A 3EQRA 3FXXA 4L3LA 5AUVA 5HNBA 3O96A 3O7LB 3R71A 1P4OA 3KN5A 4AFJA 5IUGA 2ZB0A 4LUEA 3UPXA 3KXXA 3RAWA 4LOPA 4RX8A 4O0RA 4BDEA 2C1BA 3RALA 2R0UA 3UPZA 3EFJA 3EFWA 4BDFA 2IG7A 4XEYA 2E9UA 5AP6A 3BYOA 4WG4A 5CWZA 3K5UA 4F6WA 4QMWA 3E87A 4LM5A 5IH6A 5JQ5A 4LRMA 3EL7A 3GVUA 5AR4A 4J8NA 2GS6A 3QTQA 3R0TA 3R22A 1WBTA 5KZIA 3H9RA 4FKSA 3V5WA 4D2TA 5AA8A 5LMKA 4R7BA 3O71A 1FPUA 2GHGA 3DB8A 4V04A 3HRCA 4G17A 1QPCA 4EJ7A 2YIYA 4FT9A 4V0GB 5B2KA 5JZNA 4AN2A 3DK3A 5IISA 4P5ZA 4FSNA 3UBDA 5JGDA 3LPBA 4DGMA 3QTXA 2VN9A 4NW5A 4NM0A 1TVOA 3PLAE 1JLUE 4DTAA 2CNVA 5LJJA 4FV3A 1M7NA 2X0GA 3V5LA 4ALWA 3PTGA 3CLYA 1YXXA 1UU9A 3VO3A 3SGCA 5E8XA 2GFCA 4E4NA 2QNJA 3ZFMA 1DS5A 2UZLA 4KA3A 3KK8A 5E8VA 4CV9A 5HZNA 1UA2A 2PMLX 2O2UA 1RDQE 4YTIA 3QCQA 3FMDA 5TF9A 3KRRA 2OF2A 2OIDA 2QD9A 3RKBA 3KGAA 3NDMA 4BGHA 1M2QA 2FA2A 5E9EA 3MPAA 4XG8A 4MF0A 3ORIA 2QOKA 1ZYDA 3BHTA 5FBOA 2IW8A 3RI1A 3Q2JA 2BAKA 3BI6A 3H3CA 4IWDA 3F69A 4PMMA 5EG3A 3PVGA 4H39A 3UP7A 2YHVA 3FSFA 2CGXA 1IA9A 2J0IA 5BMMA 4YURA 2QOCA 1V0PA 3DPKA 3F6XA 3MJ1A 4U7ZA 4ITJA 4XUFA 3DDQA 4XV9A 3C0GA 4YZNA 5FDPA 3JR1A 2WKMA 5GJFA 3UYSA 1Q8TA 1H07A 3NRMA 4KS8A 2G01A 1YQJA 1ZMVA 2CLQA 1YDTE 2G2FA 3NSZA 4R5SA 2RF9A 2VTAA 3NR9A 3FMNA 4RJ7A 2ITOA 2VZ6A 5AP7A 3LJ2A 4A9UA 3EJ1A 1OKZA 3GBZA 5LCKA 4TWNA 2R3HA 4FVRA 4EQMA 1H28A 2E9OA 5L2TA 3ANRA 4NKAA 5KMOA 4ARKA 4U6RA 4I5PA 5BYZA 3OHTA 3ZLYA 1OL2A 3P86A 4M13A 3MGYA 4ZSEA 5CEMA 2J0LA 3OTVA 4FIEA 2XH5A 3QUEA 3OY3A 4EBWA 1KE5A 4PQNA 4U80A 4F4PA 3MH2A 2P2IA 3I5NA 2C5XA 4HVHA 3UC4A 2GFSA 2XYNA 3B8RA 5CEOA 1ZLTA 2YCFA 2J0KA 3DLZA 2YZLA 4TWCA 4QMPA 4XLIA 4EYMA 5DR2A 1UKIA 1EH4A 2BFYA 3IS5A 4FTNA 3AD4A 2ZV9A 4FG8A 3MSSA 2CGWA 5I9YA 3NGAA 5BVWA 1CM8A 3W18A 2OLCA 1K3AA 4IH8A 2ZOQA 4PV0A 1OBDA 4UMQA 4HVSA 2IW6A 3EQCA 1QL6A 4R8QA 4X3FC 4MXXA 1FVVA 4IW0A 5IMEA 4BCOA 5IKWA 1U46A 4IWPA 4RJ4A 4XYFA 4CT2A 4TNDA 5HLWA 3IDPA 2W1ZA 4YP8A 4L01A 3IW4A 2OZAA 4JDHA 1BI8A 3NW5A 5DRDA 4ACDA 2ITWA 3E8DA 3IK3A 4F99A 2VTSA 4GRBA 3RK9A 3FLWA 4FT5A 1OIQA 3IOPA 3BLHA 2XRWA 4FKLA 2R3JA 3C4ZA 4BDAA 3R63A 4S34A 5KMIA 4YNOA 3G51A 2ETKA 4EOMA 4BKYA 4PL3A 2R3RA 5L6WL 3EYGA 2P33A 5AEPA 4FKRA 1H1SA 3FQSA 1GIJA 1QCFA 1YHSA 2WMTA 2HXQA 1FQ1B 3CEKA 1OL6A 2A27A 2JBOA 3QBNA 4L44A 3PVUA 4XG3A 1QPEA 3QZIA 4FZAB 3R7UA 4D0XA 3O7LD 4ZTHA 3VC4A 2ITVA 4HZRA 5HE2A 1NW1A 4GK4A 3Q4CA 4OTGA 4CMUA 1PJKA 1HOWA 4WD5A 4F7SA 4OTFA 2OICA 3V6RA 3NX8A 1WZYA 4EOPA 2PYWA 2NRUA 2R3LA 2ZDUA 4ANQA 2NPQA 5J9ZA 3V5JA 1B38A 1MQ4A 1O6YA 1W8CA 4V05A 4XG6A 5ICPA 3BHUA 5DEYA 4ZZNA 2UW9A 3C50A 4GIIA 1KE9A 4O22A 5AFVA 4HYHA 3ORTA 4U9AA 5CSVA 2X2LA 2VWWA 3AC1A 3PA5A 1BI7A 3RINA 4H3QA 5BMSA 1TKIA 2Q83A 4KINA 3TUDA 2Z60A 3V6SA 1OECA 4F0FA 1SVGA 3E7VA 5HNGA 3ULZA 3SRVA 5L6OA 3FZSA 2VO3A 4B4LA 2PE1A 1E9HA 3P23A 2I1MA 2FVDA 5AR3A 4U79A 4IDTA 5AAGA 3TXOA 4KSQA 2P4IA 1YXSA 2Y8OA 5AR8A 4DFUA 4HOKA 3WF5A 1XWSA 3ZBFA 3LCKA 3GUBA 3P5KA 4PDYA 5HIBA 1XHAA 3NAXA 5FTOA 4O6LA 3VF8A 3ALOA 2V22A 3DCVA 4IQ6A 4RQVA 4S2ZA 1I09A 4FOCA 3R9HA 3WOWA 5LCJA 1IAHA 4BCNA 2R3NA 3P78A 4GV1A 3E93A 3FLZA 3PXRA 1GIIA 3FLSA 3BEGA 4CFFA 4FMQA 2RGPA 3JYAA 2PY3A 5CU4A 4JBOA 3TDVA 2C68A 3SHEA 3U9CA 4I4EA 2XJ1A 5JT2A 2NRYA 4JAJA 2X8DA 2FB8A 3PPJA 3W2CA 2VWZA 2C3LA 2QOFA 4QTCA 1M2PA 3DNEA 4A9RA 4WKQA 2WU7A 2BKKA 3VBXA 4O7VA 2W05A 2AC3A 2I6LA 4DGGA 4UMUA 4Y95A 3R1NA 3NIEA 3PSDA 4RBLA 4PP9A 2BDFA 3TM0A 4KUJA 4KNBA 5I9XA 4L9IA 3LFNA 3ZRMA 3AXWA 2PVHA 4RSSA 4K33A 5E8TA 4XV1A 3PRFA 2OU7A 2XNGA 4LYNA 5FEQA 4KAOA 2PVNA 2CSNA 2R5TA 3Q96A 4EOJA 4FUYA 2R64A 4FIFA 5DLSA 2C3IB 4FUXA 5C4LA 3SXSA 3PPKA 4XG4A 4TN6A 4AT5A 3KY2A 4QMYA 2JKOA 5CI7A 2OBJA 5EI2A 2B7AA 3R73A 4J98A 3C4WA 1QPDA 2YFXA 2VTRA 3EN6A 4AZSA 4C3RA 2A1AB 1VEBA 1IEPA 1YXTA 2BIYA 1XH9A 4PDSA 5DEWA 4EH2A 3MY1A 3SG8A 4X21A 2BRHA 2GNJA 1J7UA 2B9FA 4FC0A 1ZYJA 3OFMA 2ACXA 1NXKA 3D7ZA 3TV6A 1HCLA 4BWKA 1UWHA 4TL0A 1XBCA 2QU6A 1YI6A 2UW3A 3QZFA 5A4TA 3QTUA 4UWYA 3W1FA 3CTQA 3REPA 3TJDA 4XRLA 4BDBA 3H4JA 3TL8A 3MIYA 4H05A 1BYGA 1H0VA 2WMQA 3GB2A 3OY1A 3QWJA 4HW7A 3EFLA 2PZRA 3L1SA 3TJCA 4B0GA 3DU8A 3CD8A 3NUXA 2YIWA 3F61A 3HV7A 5EKOA 1FVRA 1H24A 5A4LA 1ZXEA 3AGLA 4G2FA 5HG5A 1H1QA 1YOMA 2OWBA 2BIKB 3EKKA 4D4SA 2QOHA 4DT8A 3CQUA 2OH0E 5J8IA 1W84A 1JKTA 2W1IA 4WBBB 2XKDA 3AQVA 5HD7A 2UZEA 5JRSA 2CDZA 5HLPA 4DTKA 4EWQA 1BX6A 4I5CA 3DFCB 3C51A 5AP1A 5TOZA 4U3ZA 5AV0A 4E3CA 3OUNB 5JGAA 2BMCA 2WMWA 4IB5A 4PMTA 4QTEA 4IWOA 4D4RA 5IA3A 3G6GA 5M51A 2YZAA 4YHFA 5ANJA 2OK1A 3LIJA 3TNQB 3NEWA 1ZMWA 2I40A 4RVLA 4BZOA 4MD7E 3GCSA 2BZIB 3E92A 4KKEA 2XNBA 2R2PA 4UX9A 4BIBA 1K9AA 2CKQA 3NZ0A 2OIQA 5CTPA 4FGRA 3RNYA 4EUUA 4RJ3A 1GIHA 1KE6A 5D9HA 4CT1A 4O0YA 4OW8A 3LM0A 3BYVA 4JQ8A 2YACA 5CVHA 4ASXA 2B9HA 4O1PA 4XG7A 4EK4A 4KRDA 4FZFB 5CX9A 5FXSA 3I7BA 3R9OA 3FI8A 4KKGA 3BRBA 2Z7LA 4USDA 5BPYA 1WAKA 1CMKE 4E73A 5HO6A 2CNUA 4TWPA 4ZTLA 3OCGA 4M84A 4NFMA 4K18A 3BEAA 4DGOA 4P5QA 2QOIA 2C47A 2YLEA 2BUJA 4FYNA 4FYOA 2CGUA 5F4NA 3UQGA 3ZDUA 4RVTA 2QR8A 3EN4A 3HV6A 4DH3A 2O5KA 3OCBA 3O23A 4O38A 3WYYA 4R77A 4I0TA 2GNGA 2YLFA 3ZZWA 3FEGA 4EZ7A 3F2NA 3H0ZA 4FV5A 4IC8A 1GAGA 3C0HA 4XG9A 2HIWA 3IQ7A 4CNHA 2C6KA 3KRWA 4I93A 5I3RA 3BYMA 5A46A 4CGAA 3GENA 3FMLA 1FVTA 3O8PA 3NMUF 5K4JA 3KXZA 4IDVA 4NM3A 1W98A 2OFUA 2R7IA 2Z7RA 3SOCA 4AW5A 4NU1A 2FGIA 4IAKA 3FZ1A 4ERWA 3PY1A 2GQGA 2OGVA 5DGZA 3PJ1A 5CAVA 4CCBA 2V7OA 4FTAA 3FXWA 3GXLA 4FTKA 3R30A 4I21A 1Z57A 4YSMA 5FM3A 5IQHA 3GFEA 2F2CB 3FHIA 3I81A 4E1ZA 3UIXA 5HVKA 3RCJA 2UW8A 2C0OA 3O17A 4ANNA 3UO5A 5EK7A 1H01A 2C3JA 5DE2A 2CCHA 4EQCA 4X2JA 2UW7A 5LVNA 4D4YA 4FIHA 5BVDA 3V5QA 4G9RA 3MDYA 3WZJA 3R9RA 3UG2A 2DUVA 4O0TA 3ZYAA 4E5BA 2PUUA 5CENA 3Q60A 1CTPE 2KULA 5B2LA 1A06A 4H36A 4IADA 5TKDA 3I79A 4DHFA 3KCFA 2YM3A 5AR2A 3KXNA 5T3QA 3VAPA 3VHKA 2XEZA 3UQFA 2IN6A 1G8AA 2Y4PA 3F5UA 3LFDA 4HYIA 3H9FA 3OXIA 4F63A 5F94A 1R0PA 3AT3A 3UO4A 2BZKB 3BPRA 1R3CA 4ASEA 3HRBA 1PXKA 1WMKA 4I5HA 3EWHA 4E5WA 4YTHA 4H3PA 4FKWA 5BVOA 4DEEA 2G1TA 3QXOA 4FODA 3RZFA 4BDCA 3W8LA 4JVGA 4BICA 3QAME 4RLKA 5FBNC 3U54A 4BY9E 3VW6A 5HVYA 1WBSA 4O81A 3NWWA 2CN8A 3NUAA 4DEBA 3IG7A 2GTNA 4PTGA 4UALA 4K77A 1FGKA 4YPDA 2J0MB 2WU6A 4U5JA 2E9VA 2UZVA 3ORMA 2C5YA 4E6DA 2CGVA 4USFA 4FTLA 3DBCA 3LFBA 3PXFA 2X4ZA 5C01A 2VWVA 3R9DA 5BVFA 4WRGA 4AE6A 3W2RA 4AXAA 4WSQA 4ZJVA 2QU5A 2XNEA 4LG4A 5AAFA 5CF8A 4U41A 4ZZMA 4IHPA 4DN5A 4PNKA 2W0JA 2BDJA 3NYOA 3F3VA 1JSVA 3G33A 3PY0A 3R1QA 2X8IA 3MIAA 4IVCA 3POOA 4EZ3A 4D2WA 3PSCA 4E4MA 3ACJA 1DI9A 2RKUA 3K3IA 3P7AA 5FM2A 3DXPA 3Q4ZA 4S30A 5LOHA 3U55A 4JRVA 4FKIA 5HGIA 4UEUA 4QQTA 3MV5A 3RP9A 3RVGA 1KSWA 3TV7A 4CMOA 5TE0A 1JKLA 2F4JA 3EZRA 4BL1A 1J1BA 4IAIA 5ANOA 3UVQA 4EEVA 3TKHA 2PUIA 3DLSA 5JN2A 1YW2A 3OWLA 3UDBA 5IEYA 3W2PA 5K0KA 3C13A 4KWPA 2PVMA 4WSYA 3NUSA 3E3BX 5CSXA 2OIBA 4AWIA 4OTRA 3VBTA 1X8BA 3VNTA 3BBTB 3E62A 2J51A 5EYCA 4ANBA 3R83A 2EB2A 5CAOA 1H00A 2BAQA 2PVYA 2VTNA 2W4KA 3PSBA 5K5XA 2G9XA 3I0OA 4KS7A 4CEGA 4OUCA 2WB8A 4K1BA 2FUMA 1MUOA 4MQ1A 3CD3A 5DVRA 4APCA 2LGCA 4WIHA 2R0IA 2GHMA 3KU2A 2YM8A 1ZARA 2XK9A 3FKNA 2NP8A 2UZOA 3OP5A 3W32A 3PJ2A 1SMHA 4X7QA 1RQQA 2B9IA 1WVWA 3NUYA 5JZJA 1PYXA 2CJMA 3ZSIA 2YN8A 1H1WA 2XNPA 1U4DA 1PMUA 2X9EA 3A8XA 4FOBA 1NA7A 3OROA 3EQIA 3IGOA 1XH4A 2EWAA 2WEIA 5CEQA 5LWMA 2WD1A 3GP0A 3I6WA 4L42A 5T6KA 3ZSGA 3HZTA 4FV7A 5AM7A 4BHNA 2VNYA 4IVDA 1LUFA 2P0CA 3HV5A 2QOLA 4ZLYA 3KREA 4FTIA 4FSWA 3ZLSA 1W0XC 2QR7A 3L9PA 5GNKA 5BVKA 4NM7A 5GHVA 3GC9A 4CCUA 4DG0E 3DKFA 1Q8YA 3DT1A 3LCTA 4GL9A 3QQHA 5AP0A 5TO8A 4CZYB 1VJYA 3SW4A 4C35A 3TI1A 3P08A 3D0EA 3R7VA 2C6LA 3KF7A 5C8KA 3QQLA 2X81A 1WBVA 4FVQA 4CLIA 4W8DA 4JS8A 5LMAA 4TRLA 4G16A 2XIYA 4FVPA 3HP2A 2OH4A 3HMIA 4L45A 4R7HA 3GCUA 4ZOGA 1OBGA 2ITUA 5J9LA 2YEXA 2X39A 1M14A 1OB3A 4KBAA 1JSUA 4FV8A 2W96B 2ITNA 3ORLA 3EOCA 4Y72A 4GW8A 2HXLA 4ZY6A 5CY3A 3JY9A 5KE0A 2PK9A 5D12A 2XA4A 2QLQA 2J50A 2UW5A 2ZB1A 5D1JA 4AZFA 3P0MA 4F9WA 3ZFXA 2W99B 4F7LA 4YHTA 2X4FA 3DXQA 5D7AA 1VZOA 4TNBA 4HPTE 4RVKA 4C4GA 2O8YA 1WVYA 4EOIA 4J8MA 3TNIA 4AGCA 3ORXA 4RX5A 1OL5A 4GT3A 3LW0A 2GQRA 4PDOA 4RJ5A 4UMPA 3DQWA 2VX1A 3OT8A 3QQKA 4H3BA 4L52A 4RQKA 3PZHA 3QZGA 4XP2A 2RFDA 5E1SA 4D1SA 4YJQA 2Y6MA 4O91A 1PXNA 4TWOA 3VJOA 4MXYA 3PDTA 4QYFA 4I0SA 5L6PA 5M06A 4NIFB 1Y6BA 4O7LA 4A07A 3LXLA 2RFEA 5BYLA 3C4FA 3U4WA 2DWBA 5FTQA 2CMWA 3ENMA 4AA4A 1ZOGA 2VRXA 3R6XA 4BWXA 2XS0A 3QQFA 2OKRA 3MVMA 5LARA 3UP2A 4BCFA 4DH7A 1SVEA 3Q6WA 2XEYA 4BDHA 2XNNA 2VUWA 3HDNA 2YWVA 3DAKA 4GIHA 4QP3A 4OLIA 3GU5A 2YAAA 5HX6A 5L2WA 3MPTA 3LFEA 4FNXA 4PMSA 1M7QA 2JIIA 5AJQA 4S33A 2H34A 4PF4A 2OW3A 1YVJA 4G5JA 4M69B 5IDPA 2VTJA 5JRQA 2ZM4A 3C4CA 3KKVA 4DEAA 4OTPA 5AV4A 2VU3A 2OZAB 3A99A 3OWKA 3C9WA 3COMA 3ZRKA 3EQPA 3LE6A 4IB1A 4R1VA 2AC5A 3T8OA 5LWNA 4EHVA 1UVRA 4RWKA 2PWLA 3TKUA 3LFSA 3HL7A 1PXJA 5A4EA 4AZEA 4QMZA 3QKMA 2IPXA 3W2SA 2WTIA 2OO8X 5J1WA 2Z02A 2BTRA 3OEZA 4PDPA 4J52A 4YC6A 4CFMA 1BL6A 3QHRA 2Q0BA 4DCEA 4OBPA 4BYIA 4Z55A 2WEVA 4E6AA 3EL8A 5EDPA 4DGNA 3ZLWA 4C8BA 3KEXA 4RX7A 4NFNA 4FE2A 5CVFA 4W4YA 3VUIA 1UU3A 4GFMA 1IAJA 4YLJA 3KN6A 4IM0A 3ZEWA 4EORA 2YWPA 4KB8A 5J7HA 1R78A 2C1AA 2XM8A 3VIDA 4JDKA 2YA9A 5L2QA 3U8WA 4RMZA 4AN3A 3MY5A 3V5TA 4ZTSA 4BCIA 2YIRA 3MA6A 3QQJA 4YJRA 3PPZA 4DF3A 2WNTA 3PG3A 5IG1A 3FQEA 2FSMX 3RM7A 5IZFA 5EDQA 2CLXA 5IDNA 2ITTA 2XKFA 3FL5A 4C4HA 4O0XA 3W55A 4L68A 4EL9A 3HV4A 4PPBA 3AG9A 5EI6A 1Q24A 4XOZA 5CAQA 2RL5A 1PW2A 1W82A 2J90A 4GFOA 4C61A 3BKBA 4JQ7A 4NZWB 3LAUA 3SRVB 4JRNA 3R28A 4I94A 2WIHA 4BCGA 4NJDA 3TG1A 4FKTA 3IDBA 3FI4A 2BILB 1DAWA 1NVSA 2PMOX 3OEFX 2RG6A 3R1SA 4FSZA 1CSNA 1REKA 3R00A 4IMYA 4M67A 3RTPA 3G90X 2I0EA 3MH3A 2H9VA 5DT0A 4C38A 2O0UA 2QVSE 4IAFA 5EI8A 1SVHA 4YJNA 4J7BA 3THBA 3M11A 3ZM4A 5C8MA 3AMAA 3ERKA 3NAYA 3QZHA 4O84A 3E7OA 1HCKA 5HIDA 4GSBA 1QPJA 1JVPP 5J79A 5HO7A 1ND4A 3ZOSA 3VHEA 2V62A 2XCHA 3DY7A 3PXKA 4ASZA 1LP4A 2X6EA 2WFYA 4JR7A 4DFZE 4ZSAA 2UZTA 3EFKA 4AE9A 3VW8A 5HBHA 3SV0A 4YO6A 1Q8WA 4LOOA 3HVCA 3QF9A 4E26A 3BE9A 2GQSA 2WOTA 1XBAA 2OJJA 2PHKA 3NNXA 3AC4A 3PYYA 4KRCA 3MBLA 2UZWE 2WMVA 4KIPA 3QXPA 4K6ZA 5CU3A 4L7FA 5DBXA 5K3YA 3MFSA 3DA6A 3PY3A 2BRBA 4ZSLA 4C59A 3OZ6A 1SM2A 3DK6A 3HUBA 4ORKA 5D10A 4NIFA 3ULIA 3A2CA 4NK9A 3L8SA 3CQEA 4P4CA 4RIXB 3VRZA 4HGEA 3OS3A 1K2PA 5IQIA 4Z7GA 4MK0A 2JFLA 4Y85A 4DEIA 4YBKA 3N4TA 3FLYA 3GI3A 1KE7A 3GU8A 3CPBA 4JI9A 4A4OA 4FL3A 4BI1A 4YC8A 4LL5A 4O1OA 2IW9A 3TUCA 5A14A 3KXGA 5L8JA 4MXZA 2R4BA 4M12A 4AACA 4AOTA 5M4IA 1E1XA 4NL0A 5DFPA 3K2LA 4W9XA 3QFVA 1ZY4A 2IJMA 4TT7A 4F0IA 1OMWA 3SX9A 2Q0NA 3OVVA 4FBXA 3WZKA 3OOGA 4E4LA 3TTIA 5IF1A 3HDMA 3M2WA 4MXCA 3DK7A 3R21A 3WI6A 4EC8A 4G31A 4F9YA 4M69A 3GU4A 4BGQA 5KMLA 1M17A 3CS9A 4FTUA 4MNFA 2HW7A 2WMXA 1SNXA 2W1GA 3AMYA 3I60A 3QALE 5AR5A 3BGQA 5IA2A 3SA0A 5CF5A 4G6NA 4GU6A 2HYYA 2X7FA 5IA1A 5KMNA 3UO6A 2X6DA 4IB3A 2FO0A 3I4BA 4EJNA 1XH6A 5L2SA 2XZSA 5C8NA 3HEGA 3F5GA 1PRYA 5E1EA 2VAGA 3ZXZA 5I0BA 5KNJA 4FNZA 3OW4A 4G1WA 1URWA 2C6IA 3D94A 4C62A 3P79A 4GT4A 4DEGA 4AA5A 5JH6A 2BHHA 3DOGA 3DKOA 5ETCA 4ZMFA 3PWDA 2IVTA 4IX6A 2GNIA 2GS7A 3SLSA 5EOLA 3DTCA 5B7VA 2CN5A 3D5VA 3R8LA 1OUKA 5FP6A 3DJ5A 2JD5A 5F1ZA 4EHGA 5HE0A 4FT7A 2O3PA 2OI4X 3BHHA 2WO6A 3Q53A 4P7EA 5ANKA 2J9MA 3FQHA 4P90A 1IASA 3F2AA 3ZUUA 4ANLA 4BYJA 3VS4A 5LMKC 3LMIA 5ANEA 3MESA 2REIA 2JC6A 4YZMA 2PE0A 4NJ3A 5HU9A 1Q99A 2IO6A 2FSOX 3P4KA 4MAOA 4FSYA 3FYJX 4D1XA 3LLAA 2PVKA 2XMYA 3DB6A 4OAVB 1FOTA 2EXEA 3NYVA 2QG7A 3BE2A 2VO7A 3S00A 4F1TA 2HZNA 4Q9SA 4ZLOA 4KIOA 3Q3BA 3FI3A 5AWMA 3SAYA 4USEA 4G9CA 2ZYBA 4LMUA 5GZAA 4WNPA 2W1FA 2XP2A 1FBNA 4QMMA 1B39A 4FZDB 3VUTA 1G8SA 2ONLA 4CQEA 2JKMA 4X0MA 3MY0A 5M09A 4MNEA 4XHKB 5E7RA 4FR4A 3LZBA 4RIOA 4BBEA 3SVVA 4DCAA 2PZPA 2YM7A 4FEUA 2NNWB 2HOGA 3UGCA 2C0IA 5KUPA 4G5PA 3RHXA 2JBPA 4QMVA 4ALUA 2QOOA 3JVRA 3EKNA 4EHEA 3PZEA 5EOBA 1OPLA 2YM6A 2F49A 3FV8A 4UBAA 5FEEA 3ZZEA 3PVWA 4B8LA 4IX4A 4E4XA 4QMQA 4JNWA 2C5VA 4RRVA 5JSMA 5I4NA 1YKRA 4I23A 3NPCA 2RFNA 3VUDA 3AC8A 4LRKA 2BAJA 1L3RE 3U51A 4ZJIA 3MB7A 3R8ZA 4A9YA 2WTKB 5CALA 3I1AA 5H3QA 5HBEA 5HTIA 4RIXA 2J6MA 3LFAA 3DJ7A 3QX4A 3RPOA 4ZY5A 4U44A 4C3PA 2B4SB 5HICA 3M1SA 1JSTA 3TNWA 3U6JA 4N4SA 4YO4A 4RIYA 3UZTA 3R7IA 1OKYA 4FSRA 2C6OA 1Q8ZA 2PL0A 5CT7A 3COHA 4ITHA 5IEXA 2ITQA 4YR8A 4BF2A 1CKJA 1PKGA 3ID6C 5HQ0A 5KMJA 5CSWA 2JKKA 3R8UA 3VS1A 3DNDA 1Q5KA 4OTWA 4H1JA 3UOJA 3FLQA 3II5A 3NNUA 5AX9A 2OXDA 1OVEA 4IX5A 5CSHA 2CKPA 3Q52A 3R7EA 4XNEA 3ZU7A 5E4HA 2HZ4A 4ZTRA 4FK6A 4YC3A 2JEDA 4YJUA 3CP9A 3WZUA 4QMTA 3AD6A 1U5RA 3FMMA 5H9BA 3T3VA 2JAVA 4AZWA 3DKCA 1UV5A 4RFZA 4FZ7A 4ID7A 4CSVA 3COIA 3UOKA 4HZSA 3UYTA 3V8WA 5DIAA 3GCVA 2QKRA 5E8ZA 4A7CA 4FICA 5ANIA 3Q9XA 3QCXA 5AR7A 5IA4A 3MJ2A 4QOXA 3G15A 4D28A 5KMKA 2ETRA 4ZIMA 3VWAA 3HLLA 2J5FA 5IEVA 3IPHA 2BROA 5GJDA 1NY3A 4JDJA 3CKXA 1GY3A 3ITZA 4LV5A 5H2UA 1YI3A 1SZMA 4AF3A 4BIDA 3PG1A 4L3PA 3ZO2A 4G3FA 4GK2A 5AP2A 4NT4A 5BVNA 1A9UA 3CC6A 4IVAA 1NVRA 4EK6A 2I0YA 2EU9A 2Y4IB 2YAKA 3AC2A 3GC7A 4GVAA 3O8UA 4NCTA 2JDOA 3BV3A 3TTJA 2YJRA 3NCGA 3QRKA 5HVJA 5DYJA 2XUUA 2VTMA 4WNOA 2WQNA 2X8EA 3TNPC 5J7BA 3CE3A 3I0QA 5E91A 1KUTA 2PULA 3PLSA 1AD5A 3OXZA 3ZH8A 4EQUA 1UNHA 2R3PA 3QGWA 4MXOA 4A9TA 3WYXA 3MVLA 2B0QA 2J2IB 5CF4A 2VWIA 3GCQA 5EM6A 5ETAA 3ROYA 3RPSA 1Q3WA 3Q9WA 5ACBC 3SC1A 1Q8UA 2FYSA 2X7OA 3QRJA 4L8MA 4YNEA 3C4EA 3MS9A 3WBLA 4E5AX 1PXOA 4WG3A 3PE1A 4O0SA 3IONA 2W9FB 3UC3A 4OBOA 1FINA 2V0DA 4W4WA 3A7HA 4QMLA 3OT3A 4OTDA 5F20A 5HCXA 5HI2A 4AAAA 4C37A 1F3MC 4QYHA 3FMKA 4I6FA 1MP8A 3ALNA 3EQDA 3HMNA 3KRLA 2IVUA 4IZ7A 5J87A 2ZAZA 4G3CA 4XRJA 1O6LA 3HP5A 2HK5A 3UMXA 5DG5A 2C6MA 3A7GA 3BZ3A 4GJ2A 4QQJA 4QTDA 3OD6X 4GG5A 4XCUA 5CYIA 4AW0A 5D7VA 3FKLA 2W17A 2ONLC 4EYJA 2NO3A 3VVHA 1VYWA 2YCQA 4B7TA 2E9NA 1L8TA 5HESA 3FY0A 4EONA 1XR1A 2JAMA 3PIXA 2PVJA 2F57A 4M97A 3EQBA 2UVYA 5CLPA 4F1MA 2VTHA 3A8WA 4DGLC 4ANSA 3E64A 4U97A 1VR2A 5HOAA 3EZVA 1XO2B 3S95A 3DBDA 4AN9A 3QKLA 3L9MA 2VTLA 5CXZA 3VQHA 3BGZA 3TT0A 4BC6A 3L8XA 4JXFA 1ZZLA 2QCSA 3PFQA 4J53A 4JBVA 3GFWA 2WPAA 5ANGA 3DJ6A 4QYYA 3UQCA 2BZJA 4O6EA 3CXWA 3IOKA 1H4LA 1LPUA 3BHVA 3DXNA 2VO0A 5FXRA 4AOJA 2YIXA 5E8WA 3FMEA 2XIKA 2BDWA 2XK3A 1NVQA 4QO9A 3KMUA 2JDTA 4IANA 3A60A 4UZDA 3RZBA 4C36A 5GIOE 4EHZA 2BRGA 1P14A 1WCCA 2C6DA 3CSVA 2QOBA 2VTOA 3LJ0A 3IW5A 4AP7A 3QHWA 1NT2A 4JG7A 2QG5A 2VWYA 3T9IA 4GG7A 2JIUA 3C0IA 4HVGA 4GKHA 4BTMA 3KRXA 2YISA 2WIPA 4M8TA 2C5OA 2V55A 3MYGA 2JIVA 3H0YA 4KBCA 5C9CA 4CXAA 5CANA 3Q2MA 3O8TA 4I6QA 2XBJA 5EM8A 4ZSGA 3G6HA 5EQPA 1YXUA 4GJ3A 4O7ZA 2JGZA 3ATTA 5HEZA 2ITYA 4BDIA 2H6DA 2ETMA 4PTCA 4ZAUA 3JUHA 3Q32A 4PPAA 4O7TA 2G15A 4YZ9A 3CBLA 3NNWA 3EN9A 4O27B 2XNMA 3F3TA 4D4VA 2O63A 5K0XA 3QD4A 4BCMA 5ACKA 3SXFA 2B55A 5I9ZA 5HD4A 2YDIA 3FLNC 4HCTA 4Z7HA 5AA9A 3FMJA 4X2GA 5FWKK 4ASDA 3R9NA 2DYLA 2ZMDA 3ZLXA 5BUEA 3I6UA 1YI4A 3VBYA 4IJ9A 3QRTA 1BKXA 4BDKA 4PNIA 4FT0A 2BCJA 2B53A 4FTQA 4BZDA 4FG7A 4BI2A 4A9SA 4TYGA 4I20A 1ZOEA 1KWPA 4QP9A 4I5MA 2Z7SA 4M68A 4QP7A 2CHLA 4QNYA 5CEIA 2GU8A 5IQEA 3PUPA 4FKQA 3IW8A 5JEBA 3KULB 1FGIA 4NCTC 4YHJA 3AT2A 5HIEA 4CTCA 4PP7A 2W9ZB 4GUEA 3QC9A 2UW0A 4FKVA 3KK9A 2F9GA 3ZCLA 3MA3A 2XNOA 3GNIB 2PE2A 3F5PA 1REJA 1AQ1A 5CQUA 3FXZA 3VUKA 3QKKA 3MFUA 5FD2A 1ZYCA 2ZM3A 4MWIA 2WMUA 3QUPA 3JY0A 4ERKA 3D83A 5HNIX 3NUNA 3U6HA 4J1RA 1QMZA 5EM5A 2JDVA 3S3IA 1SYKA 4FL1A 4IWQA 2W06A 4M0YA 4QPAA 3QLFA 4ZXTA 3MW1A 2BPMA 3MVHA 3V51A 4CKIA 4J96A 2C5NA 3VS0A 5GINE 2H8HA 2PTKA 3UZPA 1GJOA 1PXIA 3AMBA 4QRCA 3D2KA 4BTJA 5J5TA 3R1YA 5M4CA 4ENYA 1JPAA 3BWJA 3RPYA 3C4XA 2OJFE 3ZM9A 4KIKB 5EYMA 1H1RA 2RG5A 5M4UA 2OJ9A 4I92A 1V1KA 1YWNA 1I44A 5IH4A 5BYYA 2W1EA 5BUIA 5DT4A 1YDSE 3D14A 4CKJA 4KBKA 5M57A 3EHAA 2OJIA 4QP8A 4RLLA 1UU8A 4R3PA 4JR3A 4QP2A 5IMXA 3R01A 4PX6A 5FLFA 1XH5A 4RZVA 5A9UA 3Q6UA 4IX3A 4IJPA 4BTKA 1P2AA 5I9VA 3HMMA 4C4IA 4MQ2A 5HBJA 4RA4A 1MQBA 5IQFA 1KV1A 3ETAA 3BU6A 4F0GA 2VTTA 4AFEA 3OOMA 5T68A 1W83A 4JIAA 2FSTX 4ZSJA 2V5QA 4IE9A 4CMTA 3W8QA 1PMEA 3MN3A 4D55A 4EC9A 2A19B 3VBVA 2WTKC 4DFXE 4XBUA 4JAIA 4FKOA 3WZDA 5KHXA 5CXHA 4EK8A 2WMSA 2O65A 4LFIA 5IUHA 2UV2A 3MTFA 4GCJA 5AP5A 3C7QA 3UOLA 4BCKA 4DLJA 4BCPA 4YMJA 4X2KA 4QMOA 2F7ZE 4U0IA 4U43A 2WAJA 5AIRA 4MHAA 1RW8A 1ZWSA 2GNFA 3GC0A 3MFRA 5HHWA 4E7WA 1J7LA 2GSFA 3FC1X 2GPHA 4DEHA 5JK3A 4O7YA 2OSCA 2ZV8A 3JXWA 4X6QC 3QC4A 4R3CA 2XIXA 3G2FA 1JQHA 5DR9A 3SD0A 5CSPA 2VGPA 4ANOA 1Q61A 4AZVA 2IZRA 1OIUA 2A4LA 2GTMA 3Q4TA 4XP3A 4UZHA 4B8MA 3H9OA 3IECA 3JS2A 4HYSA 4QMNA 2R3QA 3RWQA 3C1XA 2C6TA 5M08A 5CEKA 4R78A 1UKHA 2BKZA 4L7SA 4QP1A 3EN7A 2CKEA 2WTJA 4BGGA 3LQ8A 1ZYLA 3PP0A 2I7QA 2UZNA 2VX3A 3B2TA 4Z9LA 2R9SA 4GYIA 3DV3A 3R8VA 4IZ5A 3ZO3A 2OZOA 4IZAA 4IAAA 4F7JA 2EXCX 3HKOA 4RWIA 3RBWA 4B6LA 3O51A 4WNKA 4FIIA 2BALA 3LXKA 4OTQA 3PJ3A 5A54A 4JG6A 3M42A 5CEPA 3CR0A 4J95A 3NYNA 3F3ZA 3HNGA 3QTSA 4IXPA 3Q9YA 3U9NA 4BDJA 4BTFA 1XBBA 3FAAA 4N6YA 3ORZA 5M53A 4JL9A 4QP6A 1PYEA 4FT3A 2Y4IC 3TUBA 1YWVA 2W5HA 3BBWA 3DKGA 3U4UA 5M07A 4RWJA 3KULA 4LQMA 4XLVA 5AV3A 3WE4A 4A06A 4PMPA 4CFXA 3NW6A 1U5QA 4A4XA 4W8EA 2XK6A 2PZ5A 2WQBA 3LCSA 4P2KA 4QPMA 1WBWA 5J5SA 3LFFA 2IWIA 2F2UA 3O0GA 3L8VA 2I0VA 5I3OA 4XG2A 3FJQE 4Y5QA 1OKWA 1P4FA 1YOJA 4FKPA 4EH5A 3EB0A 3ORPA 3LMHA 3SDJA 3KVWA 2PUPA 2UVXA 3R2BA 4DITA 4QYEA 4HNIA 4O0VA 2OFVA 3GOKA 3OUKA 3ZUTA 4G3EA 2EXMA 4MCVA 4KIQA 1S9JA 4O21A 5FXQA 5C26A 5EH0A 3LOKA 2VTPA 3NLBA 4KIKA 4F09A 5A4QA 2YDKA 4MBIA 4MKCA 3R8PA 2VX0A 4GEOA 3W16A 4WG5A 1S9IA 4L67A 4BR3A 1M52A 4FG9A 4UXLA 4JT3A 4BCHA 5DOSA 1UU7A 3LCDA 5HG8A 2VWXA 4FK3A 3VS2A 3FE3A 1LR4A 1DAYA 4GMYA 4R1YA 4L46A 5AP3A 4L6QA 3P7BA 3PJ8A 2IVSA 3IDCA 5K9IA 5H8EA 3ZO4A 3ET7A 1TQPA 4DEDA 4CFVA 4EI4A 4X3FA 3F3WA 5E92A 3RAHA 3NVMB 2HW6A 4EH9A 1PHKA 4JLCA 4ACMA 3MH1A 3GT8A 5A6OA 3LKMA 3AT4A 3PJCA 2VO6A 4CTBA 4GVJA 5ITAA 1UWJA 1YOLA 1KOBA 2YCSA 2PVRA 4II5A 4G6LA 3BQRA 5AIKA 4ALVA 2CNQA 1JKKA 4EH3A 4JX3A 4F9BA 3MI9A 5IQBA 2VNWA 4YSJA 3ZFYA 1ZRZA 1U54B 5FEDA 5D11A 4EOOA 2C30A 1GZ8A 2F7EE 2WTWA 4OR5A 2Y0AA 4UY9A 2OXYA 3LM5A 4AQCA 4RFMA 3LFQA 1KE8A 4QTAA 1G5SA 1H8FA 4J97A 1ZMUA 4C33A 4HVIA 5B0XA 4CD0A 1PXLA 4CFNA 4ZS0A 2JKQA 3UNJA 4M3QA 5JFVA 5AUYA 5DPVA 1LEZA 3UIUA 3KF4A 2GS2A 3FDNA 4Z3VA 3KB7A 4BN1A 5LVLA 4QQCA 4GK3A 1JWHA 2HY0A 3NW7A 1OI9A 3ZC6A 3E8NA 2XJ0A 2BHEA 2XKEA 3DAEA 4MVFA 4CFUA 3ELJA 3FHRA 4CRSA 1STCE 5HE3A 1URCA 5JFWA 3LJ1A 3EH9A 5FQDC 3BX5A 3AOXA 4FEWA 3GEQA 5HG7A 2XK4A 2F7XE 3VS3A 4YZBA 4L3JA 3ACKA 5KKRB 4YJTA 4IB0A 3COKA 3HMOA 5ANDA 3SQQA 1OIRA 1OGUA 1Z5MA 2Z8CA 4FV0A 3R02A 5AP4A 4BDGA 3ZMMA 2YITA 5C03A 4PRJA 4D0WA 4QP4A 4YUQA 3R7YA 1T45A 2UUEA 4NM5A 4RFYA 3K54A 4DFBA 4ZY4A 2WMAA 3G5DA 3GOPA 3NCZA 1Y8YA 3UIMA 5C4KA 4ITIA 4MNEB 3BELA 4WBOA 3V3VA 1RE8A 3D15A 4I24A 4YJOA 5I9UA 2P2HA 2X1NA 3UE4A 4HVDA 5M4FA 1WVXA 2ITZA 3PP1A 3TKIA 3VS6A 4XOYA 3FSKA 2WTDA 3A62A 4RIWB 2B1PA 4DFYA 2BRMA 2R3OA 4W4XA 5DN3A 4F08A 5F9EA 5DWRA 2XIZA 2QO7A 5HKMA 3NUPA 4LUDA 3U6IA 4UMTA 5FRIA 3QRIA 5LVOA 2EB3A 3ZTXA 3N9XA 2JITA 4CZTA 3Q04A 5EKNA
chains in the Genus database with same CATH superfamily
1PMVA 4OGRA 4K2RA 4QMUA 3WZEA 2UZDA 3Q5ZA 3OF0A 4WOVA 4TPTA 4EH4A 4U45A 2Z7QA 3HUCA 4D2RA 5M55A 2XYUA 4FIGA 5KBQA 4DHIB 3EN5A 1PF8A 2AYPA 4EH7A 5AAEA 4TYIA 2XKCA 3V01A 2PZIA 4D9UA 1R1WA 4C4JA 4RIYB 4UYAA 4AOIA 5E8YA 1CDKA 4EBVA 4DE4A 3VRYA 4JOAA 4NUSA 3TACA 3C5UA 2QC6A 4ZMEA 2W5AA 3CKWA 3IGGA 4F78A 1J1CA 4LGGA 4LL0A 4DINA 4ENXA 4G34A 5BNJA 4RC4A 4DG3E 5HORA 4MWHA 3MPMA 1VYZA 2ZDTA 3NFGB 2WQEA 4U3YA 4E6CA 5IPJA 4FKUA 1SNUA 5D41A 4O82A 3QTWA 4YPSA 3Q5IA 1Q4LA 1ERKA 4FTJA 4CRLA 2O64A 2XF0A 3PVBA 4EWHA 2QKWB 3NS9A 4RC3A 4L43A 4XP0A 1GZOA 4XS2A 4IC7A 1W2DA 5DH3A 4LOQA 5AUUA 4RJ8A 1BLXA 4QD6A 4Q5EA 2GDOA 3KQ7A 3ZBXA 4C58A 4DTBA 3QQUA 2X2KA 4OBQA 2HY81 4APPA 1Y91A 2FH9A 4RGJA 3UVPA 2XM9A 4BBFA 4FNWA 5AV2A 4CLJA 4D2SA 3OXTA 4KABA 3ZXTA 3LQ3A 2W1CA 2WELA 4D5HA 1H08A 1XQZA 1UNGA 3CCNA 3A7FA 2GHLA 3F7ZA 3DS6A 1BUHA 3PXYA 4FI1A 4K9YA 3RNIA 3ROCA 4FA2A 4UV0A 5CASA 4YZCA 3MH0A 3HV3A 4TW9A 3A61A 3W33A 2VD5A 3BU5A 3O50A 4AGUA 2WOUA 5I5ZA 2XAMA 3FMHA 2E9PA 4PY1A 2J0JA 1U54A 3IKAA 5ETFA 3VN9A 4BBMA 4BIEA 3GU7A 4ZJJA 3RGFA 5HTBA 3ZONA 1ATPE 4WUAA 1F5QA 4N6ZA 2EUFB 4Y73A 2QO2A 5CNOA 3OBGA 3ZHPC 3CJFA 2J5EA 4C02A 3HECA 2WQMA 4AS0A 2HWOA 2C69A 3CTJA 4O96A 5KCVA 4ZTQA 1YHWA 1Q62A 3ZDIA 2OJGA 2R7BA 2UZUE 3PE2A 4H1MA 4NYEA 4K11A 3KCKA 2ESMA 4UXQA 4FIJA 4V01A 4EUTA 2IZUA 4BI0A 1H25A 3A4PA 3LLTA 3DAJA 4MF1A 3UODA 2JFMA 4DC2A 3P1AA 4QNAA 5TT7A 3QQGA 4F64A 3FWQA 5H8BA 3Q4UA 4FTMA 3DFAA 3TNHA 3QUDA 3QA0A 1H26A 2XK7A 4N57A 4FSUA 5FDXA 3RCDA 5KMMA 5L3AA 4KKHA 3SW7A 5EHOA 1ZAOA 3WF6A 5E8SA 4F9AA 4D9TA 4V0GA 2A2AA 5HE1A 3OMVA 3KVXA 2ZFYA 3CTHA 3FC2A 1J91A 4R3RA 4QMSA 2ZVAA 4PUZA 5CF6A 3A7JA 4BRXA 4D1ZA 4FV4A 4E8AA 2OXXA 4EK3A 3F2RA 3CGFA 4Q9ZA 1MRYA 4CKRA 4QEBA 1YRPA 2YABA 3D9VA 3FZOA 4ACCA 3FL4A 3UNKA 4D2VA 3OCTA 2H96A 2WQOA 3CY2A 3F82A 3WE8A 4RIWA 2XJ2A 4I6HA 4ZEGA 4CV8A 4IAYA 4AT3A 4FEVA 3QLGA 4J99A 2HELA 4MX9A 2XCKA 3QD2B 3LVPA 3RWPA 3W0PA 3RMFA 5CT0A 5F95A 5CU6A 3S4QA 4HCVA 2PSQA 3HAMA 4MBLA 4K8AA 4AG8A 2B9JA 4O0WA 2KTYA 2VWBA 5L2IA 4TY1A 1OPJA 3A7IA 3Q9ZA 3QYZA 4KD1A 5CQWA 4IFGA 2OG8A 5LVMA 3G9NA 5KBRA 4TZRA 4BCJA 2EVAA 1R0EA 4JG8A 2IZSA 4WO5A 2Y6OA 3BCEA 3G0EA 4AX8A 4G6OA 4IAZA 3VUHA 3SXRA 3E8CA 4FL2A 3WF9A 3I5ZA 2BFXA 4GH2A 2QO9A 4FTTA 4BKZA 1JAMA 4C2WA 3FYKX 4BZNA 3VS7A 3BLRA 2PVFA 2HZ0A 3N4VA 4TYHB 4ZTNA 3RK7A 4S32A 2UW6A 3DBFA 2W1DA 4Y8DA 4DH1A 2YJSA 3RHKA 4RVMA 1OKVA 4RC2A 2WHBA 4RX9A 4RA5A 4RWLA 3BYSA 5IH5A 2G2HA 4I0RA 4RT7A 3D2IA 3FUPA 5GZ9A 2BTSA 2GNLA 2PU8A 3QRUA 2ZM1A 5G6VA 2YM5A 4YTFA 4JDIA 3RJCA 2PPQA 3D5WA 4MEDA 4C57A 3EIDA 4FV2A 2A0CX 3ZO1A 3OCSA 5BV3A 2XVDA 4BFMA 3DZOA 1YWRA 3MFTA 5BQ0A 5K4IA 1PXPA 1V0OA 4U42A 2JLDA 4Q5HA 3U87A 4Y46A 2P3GX 5CS6A 3ORNA 3DDPA 5DT3A 5EHLA 4AA0A 2YIQA 3GQLA 5JFSA 5FGKA 5HU3A 5EHYA 3CPCA 5L8KA 2VGOA 5DMZA 4LV8A 5DHJA 3LCOA 3OG7A 4FV1A 3T3UA 2A98A 3SOAA 2X2MA 2Z2WA 3PA3A 1GZKA 4X2FA 4C0TA 4FSTA 4M7IA 3H30A 3TZ9A 3E88A 3RK5A 1APME 3RAKA 3L9NA 3QL8A 2QLUA 3N51A 1O9UA 3TZ7A 4NKSA 4O86A 4O2PA 3V8TA 2RFSA 4IBMA 2J7TA 4O7WA 1PXMA 2QHMA 4FV9A 5LVPA 4YLKA 5A4CA 3GC8A 3ZEPA 4FF8A 2HENA 3SG9A 5BX0A 2WTCA 4IVBA 5EW3A 4OTHA 3KC3A 4C4FA 1DI8A 2R3MA 4F65A 3CQWA 2X0QA 4XJ0A 3BIZA 2C4GA 4X6RA 1OITA 2RSVA 3TWJA 2HCKA 3OWPA 4MBJA 4NH1A 4R5YA 4CG9A 4Y5HA 2WTVA 4D5KA 3ZSHA 5A6NA 5JFXA 5L8LA 4TYJA 5CNNA 5EM7A 4RPVA 1OL7A 4UMRA 4AQKA 3E8EA 4PPCA 4LMNA 4CQGA 2ZV2A 1OUYA 3ODZX 4IIRA 4C4EA 3QWKA 4F70A 1MRVA 4MD9E 4ZK5A 3DGKA 3FPQA 4IACA 3MWUA 5KKRC 4OT5A 4QMXA 2WZJA 5CU0A 3S1HA 4ZZOA 5EQEA 1WBNA 3D7TB 5KZ0A 4EK5A 2PVLA 4AW1A 2I0HA 5EYKA 1YDRE 2PMNX 5DNRA 1E1VA 3BQCA 4GS6A 5DR6A 5DRBA 1KV2A 4GUBA 4UWBA 3LXPA 3DBQA 4JX7A 3UIBA 5HO8A 5IA0A 5J9YA 3KXHA 1LEWA 4FV6A 1Q97A 4WUNA 5ETIA 4BVUA 5IQGA 4QYGA 4J71A 5EDRA 3KRJA 2ITXA 4DBNA 2Y7JA 5CU2A 5EFQA 3ZUVA 4HPUE 3BGPA 2DS1A 1M2RA 2ERKA 3F5XA 3QX2A 5A3XA 4GT5A 1Y57A 3UDSA 4MD8E 2P55A 3BHYA 2IVVA 3NVKI 2XB7A 4UN0C 4YZDA 5J95A 2X0OA 4FEXA 3OC1A 2AQXA 4TKSA 3MVJA 2WXVA 4DHZA 3HAVA 5HTCA 2CCIA 4OTIA 4LDTA 5AM6A 3JPVA 4O7NA 4ANMA 2B52A 2CPKE 3F88A 2UVZA 2C6EA 5M44A 3CJGA 5HCYA 3T9TA 3F9NA 4I1ZA 4NW6A 5C27A 3FI2A 4FEQA 5AV1A 4AT4A 1OL1A 4AAYA 1Q41A 5DA3A 1V0BA 4GKIA 1TQMA 4QQ5A 4A4LA 4Z16A 5EW9A 2X7GA 4GU9A 3RM6A 3ZC5A 4ACHA 3D5XA 4LI5A 3UVRA 1MRUA 3FZRA 4XH6A 4TYHA 1JOWB 1H0WA 4FSMA 4NSTA 3WILA 2OF4A 4BDDA 3MTLA 3N4UA 4OT6A 2W5BA 2BRNA 3QD0A 3R04A 4PTEA 2FSLX 3QTIA 4CYJA 3VS5A 5AUTA 5IA5A 4FTRA 4IEBA 3TZMA 4ACGA 3OBJA 4E20A 5IQAA 3P7CA 3UNZA 4CVAA 5LMBA 1KOAA 4JQEA 4WRSA 4F6SA 4LGHA 4YTCA 4NTTA 2PZYA 2YCRA 3LFCA 3DBEA 4HYUA 4WNMA 1IA8A 3UMWA 1IRKA 3UZRA 1CKIA 3WIKA 3GU6A 3LMGA 1IR3A 2XIRA 2XBAA 4I41A 1R39A 2VWUA 4LGDA 2CKOA 2QONA 4BB4A 4F9CA 4M14A 4CYIA 1GOLA 3KXMA 1JBPE 4HGTA 4FZ6A 4UWCA 3QTZA 1P5EA 2B54A 3HX4A 4NTSA 4BKJA 5KO1A 4GFGA 3H10A 4F1OA 3VBWA 4BHZA 4EH8A 2ERZE 3V8SA 2C3KA 4XBRA 1DM2A 5CI6A 4XV3A 3CGOA 4A9RA 1ZOHA 4C34A 3FPMA 4DLIA 4AW2A 4ZTMA 3ML1A 4YJVA 3VUMA 3S2PA 4E93A 2QOQA 4EOSA 4OAUC 4G3DA 3RAIA 2JDRA 1AGWA 4S31A 4RJ6A 5LXMA 2YM4A 2XARA 1J3HA 5IU2A 3BYUA 3HMPA 3TZ8A 3B8QA 3W0OA 4YJPA 2ZV7A 4M66A 5J1VA 4FKJA 2QURA 3O2MA 2SRCA 3F7WA 4MXAA 3JVSA 4CZUA 4DDIA 5BVEA 3TMOA 4AXDA 3OTUA 3TEIA 4C2VA 2BZHB 5FTGA 4U40A 5DI1A 5G1XA 3QTRA 3E63A 2J4ZA 1YXVA 2QQ7A 5E90A 4DAWA 3MB6A 4PWNA 4DG2E 5BUJA 1Z9XA 3OW3A 4X3JA 3F66A 2R3KA 3R2YA 3NUUA 5IUIA 1GNGA 1Y8GA 2HWPA 3D7TA 3PIZA 3PXQA 4TYEA 1JNKA 2VTQA 1H27A 3DZQA 3HA8A 3ZS5A 4B9DA 3FZTA 5IQDA 4L00A 3VULA 3F3UA 5HLNA 4AGDA 1FMOE 5AUWA 4JBQA 3VF9A 5HG9A 1A48A 5EW8A 1Q3DA 4U8ZA 3V04A 4C3FA 3BLQA 1XH7A 3VJNA 4E6QA 5EQYA 2AEGA 3E5AA 5FP5A 2E2BA 3HGKA 4EOKA 4QPSA 3D5UA 3I7CA 3S0OA 3V5PA 3W2OA 5GJGA 4HJOA 4X3FB 4FTOA 1H1PA 4DFNA 2PUNA 4FGBA 2YDJA 4MTAA 3ATSA 1FMKA 2GNHA 2AUHA 3QCSA 5CAUA 5LQFA 4HGLA 3WIGA 3TDWA 1B6CB 4PL5A 4DT9A 4QT1A 3FBVA 4M15A 4UYNA 3EMGA 1RJBA 4QTBA 3FY2A 1ZYSA 2XK8A 3AGMA 3ENHA 4JJRA 3TIYA 1T46A 1XJDA 4RG0A 5CVGA 5JGBA 4DYMA 3IO7A 4D2PA 3CIKA 4FKGA 4NEUA 3OWJA 2HZIA 2G2IA 1F0QA 1OM1A 4Q2AA 2ZMCA 4FSQA 4AGWA 4EKKA 3NNVA 2C0TA 2Y9QA 1XH8A 1PKDA 3SKCA 4CG8A 3PIYA 2QI8A 4WA9A 5JKGA 3ANQA 4HNFA 5CZHA 2JDSA 3G9LX 4JIKA 5GIPE 5AMNA 2IZTA 4JBPA 3W10A 3HRFA 2R3GA 3DTWA 4W9WA 4EOLA 4O7RA 4Y83A 3A4OX 4ONAA 2GCDA 3VQUA 2ZJWA 3IW7A 4W4VA 5KX8A 2R3IA 4YJSA 4EH6A 3PRIA 3L9LA 1CKPA 3TCPA 1Y6AA 3E3PA 4EKLA 3EQHA 5AX3A 1OZ1A 1PMNA 1IG1A 3EQFA 5CZIA 4I3ZA 4WHZA 3TV4A 4F7NA 2W4OA 3TIZA 5H8GA 4EOQA 3QGYA 4BWPA 5AUXA 1JKSA 5JQ8A 3C5IA 3R7GA 5IQCA 1J7IA 4HCUA 5JMSA 3LQ5A 3W2QA 2W1HA 3BV2A 3D4QA 1G3NA 3POZA 3GCPA 4O7SA 4DA5A 1UNLA 1OPKA 3EQGA 3UOHA 4U81A 3UG1A 4I6BA 4C7TA 4IFCA 3K5VA 4DBXA 4AUAA 1WBPA 1YHVA 3TN8A 4CFWA 4JMQA 1ZZ2A 3PA4A 4ZS4A 4N70A 2XRUA 3GQIA 4KSPA 3ZRLA 3AC3A 5GZ8A 5I9WA 3AD5A 5CAPA 4FNYA 2QHNA 3G0FA 3IW6A 4L53A 2VTIA 5C1QB 3QU0A 1PY5A 5B2MA 3BWFA 5AUZA 4F6UA 1TQIA 3KMMA 4AZTA 2UZBA 2R3FA 4YLLA 3R8MA 2QODA 3GGFA 3EYHA 4DFLA 4M0ZA 1W7HA 4ZP5A 4DH5A 2YERA 4O2ZA 3NYXA 4NWMA 4XV2A 5E8UA 2GMXA 3WF8A 3FZPA 5FG8A 4TXCA 3PXZA 2W7XA 3KFAA 4R6VA 4EZ5A 2BVAA 2BR1A 3K3JA 5HX8A 3VUGA 3LXNA 1GZNA 2HAKA 3BU3A 3CY3A 1WFCA 2UW4A 2WGJA 4IM2A 4LRJA 3P9JA 5EYDA 2WMRA 1ZY5A 3KA0A 2VV9A 3QD3A 4TTHB 3VBQA 4IM3A 3PWYA 4AU8A 5AADA 3BLAA 2WMBA 1BL7A 2PMIA 4XMOA 4HGSA 2LAVA 3DQXA 3B2WA 2V7AA 4DH8A 3AC5A 3RPRA 5HCZA 1U59A 3KMWA 4YBJA 5FUTA 4PL4A 4UB7A 4X2NA 1WBOA 3R7OA 4I4FA 4G3GA 4O0UA 4WT6A 3UTOA 5L4QA 4K0YA 2DQ7X 2W4JA 4BCQA 2X9FA 3ODYX 2RIOA 4R7IA 3LHJA 1O6KA 4IZYA 5KHWA 4H58A 4ZLZA 5M56A 4MH7A 5TR6A 5K5NA 3NIZA 4RZWA 3NFFB 4MYGA 3RPVA 4O83A 3HA6A 3QYWA 4FX3A 4N0SA 4XX9A 4YGAA 4YU2A 2ITPA 1OIYA 3L8PA 4I22A 4FTCA 3QCYA 4GYGA 3FKOA 3ORKA 3WF7A 1XKKA 1BMKA 3HYHA 3KL8A 3UJGA 4B99A 3WARA 3QA8A 4D58A 3EQRA 3FXXA 4L3LA 5AUVA 5HNBA 3O96A 3O7LB 3R71A 1P4OA 3KN5A 4AFJA 5IUGA 2ZB0A 4LUEA 3UPXA 3KXXA 3RAWA 4LOPA 4RX8A 4O0RA 4BDEA 2C1BA 3RALA 2R0UA 3UPZA 3EFJA 3EFWA 4BDFA 2IG7A 4XEYA 2E9UA 5AP6A 3BYOA 4WG4A 5CWZA 3K5UA 4F6WA 4QMWA 3E87A 4LM5A 5IH6A 5JQ5A 4LRMA 3EL7A 3GVUA 5AR4A 4J8NA 2GS6A 3QTQA 3R0TA 3R22A 1WBTA 5KZIA 3H9RA 4FKSA 3V5WA 4D2TA 5AA8A 5LMKA 4R7BA 3O71A 1FPUA 2GHGA 3DB8A 4V04A 3HRCA 4G17A 1QPCA 4EJ7A 2YIYA 4FT9A 4V0GB 5B2KA 5JZNA 4AN2A 3DK3A 5IISA 4P5ZA 4FSNA 3UBDA 5JGDA 3LPBA 4DGMA 3QTXA 2VN9A 4NW5A 4NM0A 1TVOA 3PLAE 1JLUE 4DTAA 2CNVA 5LJJA 4FV3A 1M7NA 2X0GA 3V5LA 4ALWA 3PTGA 3CLYA 1YXXA 1UU9A 3VO3A 4I6LA 3SGCA 5E8XA 2GFCA 4E4NA 2QNJA 3ZFMA 1DS5A 2UZLA 4KA3A 3KK8A 5E8VA 4CV9A 5HZNA 1UA2A 2PMLX 2O2UA 1RDQE 4YTIA 3QCQA 3FMDA 5TF9A 3KRRA 2OF2A 2OIDA 2QD9A 3RKBA 3KGAA 3NDMA 3UDTA 4BGHA 1M2QA 2FA2A 5E9EA 3MPAA 4XG8A 4MF0A 3ORIA 2QOKA 1ZYDA 3BHTA 5FBOA 2IW8A 3RI1A 3Q2JA 2BAKA 3BI6A 3H3CA 4IWDA 3F69A 4PMMA 5EG3A 3PVGA 4H39A 3UP7A 2YHVA 3FSFA 2CGXA 1IA9A 2J0IA 5BMMA 4YURA 2QOCA 1V0PA 3DPKA 3F6XA 3MJ1A 4U7ZA 4ITJA 4XUFA 3DDQA 4XV9A 3C0GA 4YZNA 5FDPA 3JR1A 2WKMA 5GJFA 3UYSA 1Q8TA 1H07A 3NRMA 4KS8A 2G01A 1YQJA 1ZMVA 2CLQA 1YDTE 2G2FA 3NSZA 4R5SA 2RF9A 2VTAA 3NR9A 3FMNA 4RJ7A 2ITOA 2VZ6A 5AP7A 3LJ2A 4A9UA 3EJ1A 1OKZA 3GBZA 5LCKA 4TWNA 2R3HA 4FVRA 4EQMA 1H28A 2E9OA 5L2TA 3ANRA 4NKAA 5KMOA 4ARKA 4U6RA 4I5PA 5BYZA 3OHTA 3ZLYA 1OL2A 3P86A 4M13A 3MGYA 4ZSEA 5CEMA 2J0LA 3OTVA 4FIEA 2XH5A 3QUEA 3OY3A 4EBWA 1KE5A 4PQNA 4U80A 4F4PA 3MH2A 2P2IA 3I5NA 2C5XA 4HVHA 3UC4A 2GFSA 2XYNA 3B8RA 5CEOA 1ZLTA 2YCFA 2J0KA 3DLZA 2YZLA 4TWCA 4QMPA 4XLIA 4EYMA 5DR2A 1UKIA 1EH4A 2BFYA 3IS5A 4FTNA 3AD4A 2ZV9A 4FG8A 3MSSA 2CGWA 5I9YA 3NGAA 5BVWA 1CM8A 3W18A 2OLCA 1K3AA 4IH8A 2ZOQA 4PV0A 1OBDA 4UMQA 4HVSA 2IW6A 3EQCA 1QL6A 3VONA 4R8QA 4X3FC 4MXXA 1FVVA 4IW0A 5IMEA 4BCOA 5IKWA 1U46A 4IWPA 4RJ4A 4XYFA 4CT2A 4TNDA 5HLWA 3IDPA 2W1ZA 4YP8A 4L01A 3IW4A 4MUQA 2OZAA 4JDHA 1ST4A 1BI8A 3NW5A 5DRDA 4ACDA 2ITWA 3E8DA 3IK3A 4F99A 2VTSA 4GRBA 3RK9A 3FLWA 4FT5A 1OIQA 3IOPA 3BLHA 2XRWA 4FKLA 2R3JA 3C4ZA 4BDAA 3R63A 4S34A 5KMIA 4YNOA 3G51A 2ETKA 4EOMA 3BL9A 4BKYA 4PL3A 2R3RA 5L6WL 3EYGA 2P33A 5AEPA 4FKRA 1H1SA 3FQSA 1GIJA 1QCFA 1YHSA 4BJJB 2WMTA 2HXQA 1FQ1B 3CEKA 1OL6A 2A27A 2JBOA 3QBNA 4L44A 3PVUA 4XG3A 1QPEA 3QZIA 4FZAB 3R7UA 4D0XA 3O7LD 4ZTHA 3VC4A 2ITVA 4HZRA 5HE2A 1NW1A 4GK4A 3Q4CA 4OTGA 4CMUA 1PJKA 1HOWA 4WD5A 4F7SA 4OTFA 2OICA 3V6RA 3NX8A 1WZYA 4EOPA 2PYWA 2NRUA 2R3LA 2ZDUA 4ANQA 2NPQA 5J9ZA 3V5JA 1B38A 1MQ4A 1O6YA 1W8CA 4V05A 4XG6A 5ICPA 3BHUA 5DEYA 4ZZNA 2UW9A 3C50A 4GIIA 1KE9A 4O22A 5AFVA 4HYHA 3ORTA 4U9AA 5CSVA 2X2LA 2VWWA 3AC1A 3PA5A 3TYKA 3W0NA 1BI7A 3RINA 4H3QA 5BMSA 1TKIA 2Q83A 4KINA 3TUDA 2Z60A 3V6SA 1OECA 4F0FA 1SVGA 3E7VA 5HNGA 3ULZA 3SRVA 5L6OA 3FZSA 2VO3A 4B4LA 2PE1A 1E9HA 3P23A 2I1MA 2FVDA 5AR3A 4U79A 4IDTA 5AAGA 3TXOA 4KSQA 2P4IA 1YXSA 2Y8OA 5AR8A 4DFUA 4HOKA 3WF5A 1XWSA 3W0RA 3ZBFA 3LCKA 3GUBA 3P5KA 4PDYA 5HIBA 1XHAA 3NAXA 5FTOA 4O6LA 3VF8A 3ALOA 2V22A 3DCVA 4IQ6A 4RQVA 4S2ZA 1I09A 4FOCA 3R9HA 3WOWA 5LCJA 1IAHA 4BCNA 1TFFA 2R3NA 3P78A 4GV1A 3E93A 3FLZA 3PXRA 1GIIA 3FLSA 3BEGA 4CFFA 4FMQA 2RGPA 3JYAA 2PY3A 5CU4A 4JBOA 3TDVA 2C68A 3SHEA 3U9CA 4I4EA 2XJ1A 5JT2A 2NRYA 4JAJA 2X8DA 2FB8A 3PPJA 3W2CA 2VWZA 2C3LA 2QOFA 4QTCA 1M2PA 1W2FA 3DNEA 4WKQA 2WU7A 2BKKA 3VBXA 4O7VA 2W05A 2AC3A 2I6LA 4DGGA 4UMUA 4Y95A 3R1NA 3NIEA 3PSDA 4RBLA 4PP9A 2BDFA 3TM0A 4KUJA 4KNBA 5I9XA 4L9IA 3LFNA 3ZRMA 3AXWA 2PVHA 4RSSA 4K33A 5E8TA 4XV1A 3PRFA 2OU7A 2XNGA 4LYNA 5FEQA 4KAOA 2PVNA 2CSNA 2R5TA 3Q96A 4EOJA 4FUYA 2R64A 4FIFA 5DLSA 2C3IB 4FUXA 5C4LA 3SXSA 3PPKA 4XG4A 4TN6A 4AT5A 3KY2A 4QMYA 2JKOA 5CI7A 2OBJA 5EI2A 2B7AA 3R73A 4J98A 3C4WA 1QPDA 2YFXA 2VTRA 3EN6A 4AZSA 4C3RA 2A1AB 1VEBA 1IEPA 1YXTA 2BIYA 1XH9A 4PDSA 5DEWA 4EH2A 3MY1A 3SG8A 4X21A 2BRHA 2GNJA 1J7UA 2B9FA 4FC0A 2IEWA 1ZYJA 3OFMA 2ACXA 1NXKA 3D7ZA 3TV6A 1HCLA 4BWKA 1UWHA 4TL0A 1XBCA 2QU6A 1YI6A 2UW3A 3QZFA 5A4TA 3QTUA 4UWYA 3W1FA 3CTQA 3REPA 3TJDA 4XRLA 4BDBA 3H4JA 3TL8A 3MIYA 4H05A 1BYGA 1H0VA 2WMQA 3GB2A 3OY1A 3QWJA 3AKLA 4HW7A 3EFLA 2PZRA 3L1SA 3TJCA 4B0GA 3DU8A 3CD8A 3NUXA 2YIWA 3F61A 3HV7A 5EKOA 1FVRA 1H24A 5A4LA 1ZXEA 3AGLA 4G2FA 5HG5A 4BJJA 1H1QA 1YOMA 2OWBA 2BIKB 3EKKA 4D4SA 2QOHA 4DT8A 3CQUA 2OH0E 5J8IA 1W84A 1JKTA 2W1IA 4WBBB 2XKDA 3AQVA 5HD7A 2UZEA 5JRSA 2CDZA 5HLPA 4DTKA 4EWQA 1BX6A 4I5CA 3DFCB 3C51A 5AP1A 5TOZA 4U3ZA 5AV0A 4E3CA 3OUNB 5JGAA 2BMCA 2WMWA 4IB5A 4PMTA 4QTEA 4IWOA 4D4RA 5IA3A 3G6GA 5M51A 2YZAA 4YHFA 5ANJA 2OK1A 3LIJA 3TNQB 3NEWA 2XALA 1ZMWA 2I40A 4RVLA 4BZOA 4MD7E 3GCSA 2BZIB 3E92A 4KKEA 2XNBA 2R2PA 4UX9A 4FJVA 4BIBA 1K9AA 1XMMA 2CKQA 3NZ0A 3W0SA 2OIQA 5CTPA 4FGRA 3RNYA 4EUUA 4RJ3A 1GIHA 1KE6A 5D9HA 4CT1A 4O0YA 4OW8A 2NYAA 3LM0A 3BYVA 4JQ8A 2YACA 5CVHA 4ASXA 2B9HA 4O1PA 4XG7A 4FRFA 4KRDA 4EK4A 4FZFB 5CX9A 5FXSA 3I7BA 3R9OA 3FI8A 4KKGA 3BRBA 2Z7LA 4USDA 5BPYA 1WAKA 1CMKE 4E73A 5HO6A 2CNUA 4TWPA 4ZTLA 3OCGA 4M84A 4NFMA 4K18A 3BEAA 4DGOA 4P5QA 2QOIA 2C47A 2YLEA 2BUJA 4FYNA 4FYOA 2CGUA 5F4NA 3UQGA 3ZDUA 4RVTA 2QR8A 3EN4A 3HV6A 4DH3A 2O5KA 3OCBA 3O23A 4O38A 3WYYA 4R77A 4I0TA 2GNGA 2YLFA 3ZZWA 3FEGA 4EZ7A 3F2NA 3H0ZA 4FV5A 4IC8A 1GAGA 3C0HA 4XG9A 2HIWA 3IQ7A 4CNHA 2C6KA 3KRWA 4I93A 5I3RA 3BYMA 5A46A 4CGAA 3GENA 3FMLA 3O5AA 1FVTA 3O8PA 3NMUF 5K4JA 3KXZA 4IDVA 4NM3A 1W98A 2OFUA 2R7IA 2Z7RA 3SOCA 4AW5A 1VLRA 4NU1A 2FGIA 4IAKA 3FZ1A 4ERWA 3PY1A 2GQGA 2OGVA 5DGZA 3PJ1A 5CAVA 4CCBA 2V7OA 4FTAA 3FXWA 3GXLA 4FTKA 3R30A 4I21A 1Z57A 4YSMA 4QDVA 5FM3A 5IQHA 3GFEA 2F2CB 3FHIA 3I81A 4E1ZA 3UIXA 5HVKA 3RCJA 2UW8A 2C0OA 3O17A 4ANNA 3UO5A 5EK7A 1H01A 2C3JA 5DE2A 2CCHA 4EQCA 4X2JA 2UW7A 5LVNA 4D4YA 4FIHA 5BVDA 3V5QA 4G9RA 3MDYA 3WZJA 3R9RA 3UG2A 2DUVA 4O0TA 3ZYAA 4E5BA 2PUUA 5CENA 3Q60A 1CTPE 2KULA 5B2LA 1A06A 4H36A 4IADA 5TKDA 3I79A 4DHFA 3KCFA 2YM3A 5AR2A 3KXNA 5T3QA 3VAPA 3VHKA 2XEZA 3UQFA 2IN6A 1G8AA 2Y4PA 3F5UA 3LFDA 4HYIA 3P5JC 3H9FA 3OXIA 4F63A