3TNIA

Structure of cdk9/cyclin t f241l
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
319
structure length
297
Chain Sequence
SVECPFCDEVSKYEKLAKIGQEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 297
sequence length 319
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tniA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tniA01
4X6QC 5A4QA 4BGHA 2QR8A 2VTOA 4TYJA 5J1WA 3FMLA 4IVDA 3SA0A 5HIBA 5IA3A 1H8FA 3PJ2A 2UZOA 4ZSGA 3TV6A 2BZJA 5FGKA 2PVKA 2WTKB 5H8BA 4I4EA 3E8CA 5AMNA 3TUCA 1LR4A 3GGFA 4GMYA 4LUDA 3IW8A 4Q2AA 3QQGA 4KKHA 4XH6A 4RMZA 1UU3A 2BKZA 2VWZA 3G6GA 4WG5A 3VS3A 3ALOA 4ASXA 4I24A 4I22A 4ZMEA 3QU0A 3KMUA 4EZ7A 5M4IA 5AJQA 3SXRA 3DBQA 5FTQA 2OFUA 4F7LA 3KN6A 3MY0A 4BTMA 4NFMA 5DPVA 4E4MA 4RC3A 2UV2A 5EM5A 5CAQA 5BYLA 1XWSA 3CPCA 4IZYA 4IJPA 5CEOA 4W4VA 3QALE 4GRBA 3R21A 3LMIA 3UC4A 2QO9A 3PZHA 3AG9A 4FTAA 3U9NA 3QTUA 4BCGA 4AN9A 2JBPA 4DGOA 4FSNA 5CNOA 4QNAA 4XYFA 3GCPA 2XKEA 2Z8CA 3H9RA 4D1SA 2G2FA 2FSOX 3N4VA 2LAVA 2GNIA 3SKCA 3ENMA 4O0UA 1M2RA 5E7RA 3Q2JA 4YHTA 4ZY5A 4I20A 2R3OA 3H0YA 4HNIA 4IH8A 3QZFA 3ZTXA 1Q62A 5ACBC 4X2KA 4HYSA 4O7LA 5ACKA 4K8AA 3CY3A 2VWWA 5H9BA 4YNOA 2OGVA 4FKIA 4IWPA 4O0VA 2IZRA 3T8OA 5K5NA 4ID7A 2IW9A 4YZCA 1WFCA 2VRXA 2ETRA 4OAVB 4KABA 2X2KA 2C5XA 3DA6A 2VO0A 4MKCA 4YUQA 5IQDA 2XA4A 1VEBA 2JAMA 4QOXA 3QZIA 4TYHB 3UO6A 3ZEPA 3SRVA 3VQUA 2GHLA 4Y8DA 5FEEA 5CEQA 4FOBA 3ZLYA 3UIMA 2FSMX 5ANIA 4BKZA 2JKMA 3Q32A 4YC6A 5JSMA 5C01A 3REPA 3A61A 3QHRA 1YRPA 4IX4A 4RIXA 4QNYA 4BWKA 2R0UA 2HZNA 4TYEA 1OL2A 3PPJA 4B9DA 5CASA 4NCTC 3OOGA 3QFVA 4FT7A 3QTSA 3QTQA 3DTWA 5HGIA 2WIPA 2VTIA 5EDRA 3O23A 3FI4A 5EK7A 4OBOA 5KBRA 4K77A 2GTMA 3PVBA 2BRBA 5L2IA 1NA7A 3C7QA 5FUTA 5IMEA 1OUYA 2O0UA 2C3KA 4RVMA 5CU0A 3UP2A 3FLSA 2RFSA 3ORMA 3WE8A 2OZAB 5M06A 5K9IA 3H3CA 5JZNA 3II5A 4KRCA 4YO6A 2A27A 5BVFA 4B8LA 1M7NA 2AC3A 3IKAA 5HE3A 1JAMA 4GS6A 3PVUA 4W4YA 4AE6A 3RPOA 3FZTA 2OH4A 1Y8GA 4ONAA 4FEUA 4EHVA 2C5OA 3IGGA 2JKOA 4RFMA 2QR7A 4A9YA 1BL6A 4BCJA 4UYAA 1ATPE 3QUDA 4IB3A 3IW4A 3VS2A 3C9WA 3ZU7A 2QOFA 4KD1A 2C3LA 5TF9A 4EKKA 5IQBA 4CSVA 3R63A 3GFEA 2I0EA 4FT0A 3BU6A 1PMVA 1R78A 3VJOA 3F82A 1GNGA 1JQHA 4I0RA 4B7TA 2HZ0A 3G0FA 2R3GA 3VNTA 3AMAA 3K2LA 2PUIA 1H25A 3FMMA 1NVSA 3HA8A 5EI6A 5DT0A 3POZA 5HNBA 4EKLA 2EVAA 2J51A 5EYCA 2JBOA 3VRYA 2XF0A 3TTIA 1K2PA 4TNDA 1SNUA 1U54A 3RHXA 3KL8A 2XK3A 4OTPA 4QMYA 4JQEA 4U41A 4QMQA 3R7UA 4EBVA 2CKQA 2GNHA 4KBCA 5IQIA 2I0YA 3BHUA 4R7HA 3ZH8A 5E8SA 5IQFA 2QVSE 4C3FA 1B38A 3DBDA 4KKEA 2VTTA 3NZ0A 2W17A 3F66A 3COHA 3CIKA 4MWHA 3QWJA 3ZONA 4BDDA 3BQCA 3GB2A 4DEDA 3OG7A 1QPJA 4X0MA 1PXMA 2F2UA 3S3IA 2WU7A 4ENXA 2XNNA 3W2PA 3G15A 4OT5A 4AU8A 3GXLA 2UW4A 4APCA 4GFGA 3PLAE 3ZRKA 5LOHA 3PUPA 3UIUA 4D2VA 4FSQA 4OW8A 2C6OA 3PSCA 3UIXA 3UE4A 4EYJA 2UW0A 1VYWA 3ANRA 3R8PA 5IDPA 3F3TA 4JBVA 1MQBA 3KF7A 4AOIA 4O7YA 3DGKA 4XOZA 4U7ZA 5IEYA 3HMMA 4RIWB 4RIYB 4TYIA 3NSZA 2OI4X 1F3MC 4YTIA 5DT3A 4GG5A 3NYVA 3TZ9A 4QPMA 4FTJA 3W2QA 4H3QA 4ZAUA 2YM8A 4F6UA 3S00A 2CGVA 5KBQA 2BHEA 4F70A 4FODA 3Q2MA 4QMVA 4XLIA 4EZ3A 4I5MA 2AYPA 1QPEA 4O1PA 2PE2A 4JBPA 2RKUA 5G1XA 3WF7A 4OUCA 3RP9A 2VWXA 4BCNA 1IG1A 3QAME 2W0JA 1YVJA 3K5UA 4H1JA 4ZTSA 5KMMA 3I5ZA 3D5WA 2BFYA 3PVWA 4R6VA 4V0GB 3ZXTA 4E20A 2OJFE 2YHVA 3OCSA 1ZMWA 4F08A 3CEKA 3UP7A 4L45A 4P7EA 2QOBA 4XS2A 4FKVA 3OY3A 5G6VA 4LOOA 3QRUA 5DBXA 2C68A 2HWOA 2ITUA 5E8VA 3R9NA 2G2HA 5KZ0A 2R7IA 3ZLSA 3QCSA 3LCKA 4Y5HA 4E4LA 3VUMA 3IDPA 4QRCA 2OZOA 2PE1A 5HO7A 3GU4A 1OIYA 2ZV8A 3P79A 5TE0A 5TR6A 4IX6A 2ERZE 3D7ZA 1UU7A 4XG4A 4Z16A 2C47A 4G34A 4BVUA 5EKOA 3DJ5A 4UV0A 5IA4A 2F2CB 2X81A 4G3DA 3OCBA 3HP2A 2BVAA 3D7TB 3PXRA 4K0YA 4HJOA 2WNTA 3L8XA 5LMKC 3ATSA 3FLYA 3MPAA 4G17A 3UZPA 3Q5ZA 3M1SA 2ITTA 4JIKA 4KIKA 4J96A 4L44A 4MXXA 2BIYA 2JKQA 5HEZA 4BI1A 5L2SA 2VO6A 5L6OA 3ATTA 1BL7A 4FEVA 3R7EA 5I4NA 5A46A 5EM7A 3MY5A 1WZYA 4AW1A 1FQ1B 3U6IA 2GS7A 4G5PA 4AA0A 3MFSA 4XG6A 2F7ZE 1PHKA 1PXJA 2Y4IC 5LVMA 3UNKA 3TM0A 4OAUC 2ETKA 2RSVA 4YZDA 5GJGA 2XUUA 5CLPA 3HMIA 3KB7A 5E91A 2GSFA 2KTYA 5HBHA 3RWQA 2CSNA 4DITA 1GZNA 2EXEA 2PY3A 3H30A 1PXLA 3AC8A 4J99A 4IWQA 5HG7A 5B2KA 3ZC6A 3CR0A 4NH1A 4F09A 3NNUA 1BKXA 2EUFB 3EZVA 5M4UA 5LVNA 4MD9E 3PZEA 3DCVA 2C6DA 3AC4A 2IW8A 3NUYA 5DH3A 4BBFA 4D0XA 3CP9A 2J4ZA 1P2AA 3WF6A 2ETMA 5LARA 3UJGA 4FTKA 4C4JA 3KREA 5LXMA 4PTEA 4MQ1A 1H01A 5TKDA 4AGDA 4O27B 4S2ZA 5JFVA 3UQFA 4ZS4A 2YA9A 4AAAA 1AGWA 3CS9A 4DFXE 5DMZA 2YAKA 2C5VA 3BYMA 5AR3A 5IUIA 3ORTA 3NCGA 3PIZA 5I0BA 3F5PA 3RKBA 3UZTA 3W2SA 3EWHA 4C61A 4CFWA 2UVZA 1TQIA 1CDKA 4O21A 4OTHA 2IVVA 3MWUA 1P14A 3ZBXA 5DOSA 1FMOE 3C4ZA 3D94A 4R5SA 3R1YA 5AV1A 4IMYA 3UNZA 1REJA 4OT6A 3DKOA 4FKWA 2ESMA 4M0ZA 3F5XA 3U87A 2UW3A 4DCEA 4XP2A 5AX3A 4P2KA 1XH9A 3ORZA 2OIQA 5K3YA 4AGUA 4OTGA 3MFTA 3W55A 4F7SA 3GENA 4DFBA 4QTBA 4IZ7A 3MB7A 4H3PA 1OGUA 5L8JA 4BDHA 5LVPA 4O1OA 3I7BA 2CLXA 2B9IA 3AXWA 2UW5A 3O71A 3QGYA 4WNOA 2HW7A 4E6CA 4M66A 4LYNA 2VWUA 4CCUA 5JGAA 4L68A 2ZVAA 4X7QA 3MBLA 4FV2A 5IH4A 4DAWA 2B1PA 1IAJA 4XRJA 3VIDA 3WF5A 3EOCA 2H8HA 4MBIA 3RTPA 3P78A 2W1DA 3MS9A 3FC2A 3DBEA 5DHJA 4LRJA 2BDWA 2C6LA 2OJGA 4EHGA 3DXNA 5HE2A 5JGDA 2JIVA 2OLCA 3Q4ZA 1CMKE 3ZLXA 4DT9A 4JG7A 1OL1A 4FL1A 2J0JA 1X8BA 4HCTA 4PRJA 1FVVA 2BAJA 4IIRA 3LJ1A 4JRVA 3E92A 3IG7A 4D5HA 5AUTA 5EQEA 1J1BA 3ZEWA 3CD3A 5AUXA 3EZRA 2YDJA 1ZYLA 3V5WA 4FTOA 1KV1A 4RJ4A 3BEGA 2J0MB 2VD5A 2VTPA 4FIEA 4BTJA 5HQ0A 3R71A 1Q8YA 4GJ2A 2C5NA 4XBUA 3LQ5A 4FV8A 3OTVA 3R9HA 5KUPA 3VAPA 3R9DA 2BZHB 4J71A 4IZAA 3UO4A 4Z3VA 5HTCA 3FZ1A 4RFZA 3FKNA 5F9EA 4MH7A 3HV5A 3UO5A 3KCKA 4I6FA 4USDA 5K0XA 4YSMA 1R1WA 5JQ5A 1KOBA 2WMAA 4F9AA 4U42A 3U55A 4ANLA 3DT1A 3LJ2A 4O82A 3KEXA 3F61A 5BMSA 1ZZ2A 1WBPA 3E88A 4JBOA 4A9UA 4FT5A 3I5NA 1JBPE 4DFNA 3W2OA 4BDIA 4RJ7A 4DBXA 3AT3A 3R9OA 3DZQA 1V0BA 4WG4A 3T9TA 1UKIA 2V5QA 3NAYA 4HGSA 3P7AA 4A4LA 5FG8A 2PK9A 3EKKA 4M67A 3KULA 4RT7A 4WNMA 2QOIA 3E3PA 2R5TA 2QOOA 5EW9A 3TKUA 3TZ7A 5BPYA 4IAAA 1I09A 3NX8A 2BUJA 2JIIA 4BC6A 4E5WA 3Q5IA 4I3ZA 4EK3A 3ID6C 1UNGA 1NT2A 4AS0A 5A9UA 1H1WA 2WMVA 3OD6X 4UY9A 3QX4A 1GJOA 1CTPE 3BLQA 4XV1A 3LM0A 4S33A 5JFSA 3AC3A 3D5UA 3G6HA 4J8MA 5GZAA 5FTGA 4BCIA 4RC2A 5A6OA 1U4DA 3QA8A 1OPLA 1Q61A 1W8CA 3HV3A 3P23A 5J79A 3QTXA 3ET7A 2O5KA 1TVOA 4YLJA 4Z7HA 2BAQA 2XP2A 4GVJA 4KSQA 1NVRA 3FSFA 3PP1A 4F1TA 4TNBA 4XMOA 4O38A 1OMWA 3VO3A 5LMBA 3ZM9A 4DN5A 1AQ1A 3BYSA 4CXAA 1OL5A 3U54A 3FEGA 2JLDA 3UOKA 4B0GA 2P55A 4P5ZA 3QD2B 4IDVA 3UPZA 3A99A 3JVRA 3CY2A 2ZMCA 4DEEA 3GT8A 2IN6A 2R4BA 4YPSA 3KU2A 3ZSHA 2YISA 4YTFA 4L7SA 2QLUA 1XQZA 4IM0A 4UB7A 4X6RA 4BDGA 4AZVA 4GKIA 4CQGA 2VUWA 3S95A 3D4QA 2WQEA 4DA5A 4RBLA 2W4KA 4ZLZA 3N51A 4DEAA 1YOLA 2W9FB 5CSWA 4ZIMA 4HYUA 5CSXA 3TCPA 1W82A 3P7CA 4PDOA 5HI2A 4AUAA 4UEUA 4E6AA 5CQUA 4WUAA 3TN8A 3MFRA 3S0OA 2XRWA 1V0OA 1O9UA 1Q3WA 3NYNA 3R1SA 3EQIA 4FSRA 4IB1A 5FEQA 5M55A 4QO9A 4ZP5A 1H0VA 4FV9A 4AOTA 2PZPA 2NPQA 2E9NA 3FDNA 3BPRA 4N4SA 4WHZA 3COIA 3LJ0A 4IZ5A 3ZC5A 3E5AA 3OWLA 4HZRA 2X7FA 3V5PA 5CXHA 4YP8A 3UNJA 2YCQA 2BIKB 5BVEA 5M44A 1KE5A 3RZBA 4BCOA 5B7VA 4UWCA 2W1EA 4ZTNA 3GI3A 4TKSA 5BVKA 5I9XA 5HICA 2YWPA 3LAUA 1PKDA 3Q4TA 1RJBA 4HCVA 3RAKA 5B2LA 2WAJA 5CS6A 1Z5MA 2G9XA 5L8KA 2XIYA 2QLQA 4FEWA 4O0YA 4KBAA 3C1XA 4JR3A 3KC3A 4RWJA 3R8UA 5E9EA 4PP9A 5T6KA 2XYNA 5GINE 5ANJA 3A60A 4N57A 2CNVA 5AP2A 2GNLA 3EQRA 3KA0A 1LPUA 4O6LA 4QP2A 1DAWA 1OKVA 3OP5A 2OG8A 2FVDA 3FHIA 2Z7LA 3DK6A 4J53A 5DN3A 2WOUA 3NEWA 4PMMA 2IW6A 3GC8A 4JX3A 5HBEA 5CF4A 4M7IA 4FMQA 3A62A 1IEPA 2ZV7A 2XKFA 3AT4A 1UA2A 3QTZA 3EQPA 3AD6A 4FVQA 3UODA 3L9NA 3CQEA 4G6LA 1WVXA 1H1SA 2E2BA 3BGPA 2GS2A 4MF1A 4QYHA 5AUWA 4PMSA 3W8LA 2WD1A 4KS8A 5EH0A 3CCNA 3R7IA 5J95A 5IDNA 3G0EA 4F6SA 4AGCA 4CLJA 3RM7A 4F0IA 3S1HA 2B0QA 1YDRE 1JWHA 2UZTA 4RVTA 4FSZA 5IH5A 2IJMA 1URCA 3T3VA 5DT4A 4YJRA 2WTJA 2PVYA 3BHVA 4N6YA 4RRVA 4FV3A 2I7QA 3QD0A 5AP0A 5A4CA 1Q3DA 5IU2A 3R8MA 1G8SA 4KRDA 1I44A 2GU8A 4RIXB 2VGPA 4L67A 4O2ZA 2YJRA 2OSCA 4H39A 4XV9A 3MVJA 1PXPA 4IACA 3OHTA 5L4QA 1G5SA 2R9SA 4CD0A 3Q60A 3O7LD 4ACGA 1H00A 3D5VA 4TL0A 3PPKA 2CJMA 2XK8A 4NW5A 5AUVA 5IA0A 4O7VA 3RPVA 2PVNA 1KV2A 2OXDA 3MY1A 3PSDA 4CRSA 2EWAA 4LOQA 5HNIX 4QMOA 2QNJA 3ACKA 4FV5A 3UMXA 2R3HA 3SXSA 3D0EA 3R04A 1ZOEA 5CNNA 3R8VA 3UYSA 4EUUA 5AV4A 2QOQA 1UU9A 3FQHA 4DEGA 4RJ5A 4E5AX 4C4EA 4R78A 2GS6A 3RI1A 1E1VA 2QURA 4MNEA 5AIRA 3RZFA 2CKOA 3F7ZA 5LJJA 3MJ2A 2EXMA 4O7WA 2PTKA 4QT1A 4ZTQA 1M2QA 5L2TA 4JAJA 4PUZA 4ACMA 4EOOA 4R5YA 4YPDA 1ZARA 3D2KA 2Q0NA 1GIJA 3LOKA 4L3LA 4MEDA 3VF9A 5HORA 3Q96A 3FYJX 3JY9A 3BRBA 3PXZA 4IANA 3AQVA 3DB6A 4EC9A 3BIZA 4HW7A 2R3MA 2J6MA 2V7OA 4TZRA 2A2AA 3OCGA 5LVLA 3COMA 4RLLA 2EXCX 5IQEA 3UOHA 5FDPA 1XO2B 2IPXA 3GU6A 2BZIB 4OBQA 2VNWA 1XBCA 2BAKA 3TNIA 1BI8A 3RGFA 4EC8A 4ZTMA 4DTBA 1U54B 2NP8A 1OZ1A 2ZOQA 1SVEA 5HD4A 4HVSA 1Q97A 3UG2A 3IGOA 2HCKA 5BX0A 3GU5A 4ZTLA 4G9CA 4XG8A 1J1CA 4RIOA 3RWPA 5I9VA 3WIKA 3LFQA 4R1VA 5C9CA 4GYIA 4EH5A 1RDQE 3KXMA 1RE8A 4D4SA 5A4LA 2ITZA 4FIFA 2Y8OA 2VTRA 3B2TA 5IA5A 3TKHA 2XK6A 5ANOA 2IZTA 2BDJA 3U51A 3HV4A 2X39A 2ZM4A 5IEVA 4FZFB 2GNGA 3GCVA 2GNJA 3OXIA 1IA9A 3RMFA 4C3RA 4FK6A 4FNYA 1W83A 4C7TA 5HTIA 4F99A 1ZZLA 2OF2A 3F88A 3DDQA 3IECA 3C0HA 3MH0A 5KE0A 2EU9A 4W8DA 5CEIA 3W2CA 4RX9A 4YC3A 3U9CA 1Q4LA 2VU3A 2RFEA 3UVPA 3MPTA 3U4WA 4S32A 4D9UA 2X9FA 4CGAA 4HOKA 3WBLA 2O3PA 3ORKA 1Y6AA 4G9RA 4GT3A 4IAKA 4RVKA 4G3GA 3LCSA 2RFNA 5J9LA 4C0TA 2YABA 4NFNA 2ZB0A 3F3ZA 4PP7A 4O86A 4O81A 5AUYA 5CI6A 1YW2A 4HNFA 4EQMA 4JRNA 1A06A 3UQGA 4C2WA 3KRJA 3AC1A 5BVNA 4UALA 5CSVA 2UW8A 4X21A 2X7GA 3JPVA 4BB4A 4BDKA 3EFLA 5FBNC 3TG1A 3UBDA 1ZYCA 4EJ7A 4L8MA 2KULA 4ZMFA 2BPMA 2W1GA 5CU4A 1T45A 2UZEA 3AC5A 2X7OA 3NS9A 3TUBA 3BWJA 3H10A 1WBVA 4JDIA 2GPHA 3Q3BA 4UMRA 3QQFA 4XRLA 5C8KA 4RQVA 3A7FA 3FY2A 4ZY4A 5EOLA 4KAOA 3Q6WA 4PL3A 1W0XC 4BYIA 3FI8A 1PYEA 4GK4A 4KBKA 5IKWA 5KNJA 3EJ1A 4BCQA 2WTDA 2Z2WA 4JS8A 2NRUA 2JDVA 4U44A 4D2RA 2CGUA 2JKKA 2HIWA 1J91A 4EBWA 4ZLYA 4E1ZA 3KXGA 2QOHA 3LFAA 4FBXA 4QP3A 4QMMA 3DNDA 3WZUA 1Q8WA 4YLKA 4EH8A 3CSVA 1DI8A 2WGJA 3NNWA 4XP0A 5BMMA 4I92A 3F2AA 2W99B 4CRLA 4O0SA 3R01A 4YJNA 5BYYA 4FSWA 4AT3A 3R7OA 4FE2A 3QA0A 4I5CA 3HP5A 3Q04A 4BKYA 5EYMA 4USEA 1GIHA 5BYZA 2BHHA 5FP5A 4FIJA 2Q0BA 4J7BA 2A4LA 5FP6A 4AQCA 3IQ7A 1NXKA 4KIKB 4AXAA 4EOKA 4IB5A 3R8LA 1DS5A 3RAHA 4BIDA 4CTBA 3PG1A 4IAFA 3F2RA 3IDBA 3DBCA 4JX7A 4KKGA 3ORXA 2XB7A 4UWBA 4CVAA 5JN2A 2O63A 4HVDA 4GEOA 4H1MA 4ORKA 2CN5A 2FSTX 2CHLA 1PKGA 4IWDA 2XZSA 4BR3A 4XV3A 3MN3A 4ACHA 2C6KA 4C38A 3GOPA 1VR2A 4EK5A 3RPYA 3VHEA 3GU7A 3NUUA 5GNKA 4O6EA 1RW8A 4ANSA 5HX8A 3KXHA 4OTFA 2X6EA 5D11A 5HE0A 4A9SA 1GZKA 3BHYA 3E87A 4CNHA 4L53A 3OUKA 3LFEA 4FOCA 3SHEA 5BUIA 5EI2A 1QL6A 1H1PA 4AW5A 4JDJA 3DLSA 3A7GA 4G5JA 3E8NA 4CLIA 4NW6A 4DTKA 2F4JA 3SV0A 4XG2A 1R3CA 4V04A 3RCDA 5KKRC 1H27A 3QZHA 4DC2A 3R73A 1MRUA 3QLGA 3ORIA 2ZAZA 5JKGA 1ZY5A 3DXPA 2W4JA 2WQMA 4NJDA 4P90A 5ETFA 4FTQA 3TT0A 4DEIA 5DNRA 3DFCB 5HG8A 3C4XA 1JKKA 2C6MA 3QXPA 4BDAA 3RK9A 3GVUA 2J50A 3A7IA 3NYOA 3OXZA 4FV0A 4O0WA 3ELJA 4L9IA 3MVLA 3FLZA 4GL9A 2AUHA 5HLWA 1JKLA 1KWPA 1VYZA 2HYYA 2ITNA 3LHJA 3O51A 4PDPA 5GJDA 5HLPA 5IZFA 4YO4A 3V3VA 3KMMA 1XH7A 2GTNA 3O7LB 1OB3A 4QP1A 2X8EA 4QTAA 3Q9ZA 4JDHA 4EL9A 4AE9A 4O7SA 1Q8UA 4MWIA 4XG7A 5EOBA 4FUYA 5FTOA 5ICPA 3NDMA 3O8UA 4PNIA 2VX3A 4F7NA 4QMWA 4FG8A 2C1AA 3QRTA 3PFQA 4DH1A 4D2PA 5IUGA 2R3IA 2PUUA 1UU8A 4JNWA 4CZYB 5HE1A 1WBWA 2Y6MA 2YAAA 3FZSA 3PXFA 3TJDA 4FKGA 2OICA 2OJ9A 1J7IA 3LFNA 4ARKA 1OVEA 4CV8A 4F1MA 2QCSA 4JDKA 3F5UA 2YIYA 3BE9A 2VWYA 3EFWA 3K54A 5DR2A 5HCYA 4CKRA 1H26A 4NWMA 4CYJA 3G5DA 3H4JA 3V6SA 5KKRB 2YM6A 4BI2A 3HNGA 4RLKA 3FAAA 5FRIA 3P7BA 4HVHA 2HW6A 4MQ2A 1TKIA 3LLAA 2F9GA 3CJFA 3PRFA 3I6WA 3EN7A 3LIJA 1ZMUA 2VTHA 4QP8A 4DFYA 2IWIA 3QBNA 2PZYA 3ORPA 3QLFA 4U3ZA 3MA6A 2CMWA 5JFWA 3H9FA 3IOKA 4IM2A 4NTTA 2CCHA 3PA5A 3PY1A 4F0FA 2QO2A 2UZVA 1KE9A 4IFCA 5GZ9A 2UW6A 1CM8A 3FXWA 4CMOA 4HGEA 3O8PA 4QYFA 3NNXA 3BWFA 3PXYA 1MQ4A 3KCFA 5AR7A 4DEHA 1Q5KA 2JDOA 3FI2A 4QTDA 5CAOA 5DR9A 4ERKA 2YLFA 3A2CA 1A9UA 4D2SA 4U0IA 3R1QA 5KMOA 1OIQA 3BQRA 4QQCA 4RWIA 5AA8A 4XV2A 3D9VA 1ZMVA 3WF9A 4IVCA 2JDRA 3EHAA 3IW5A 3E93A 4U5JA 2ITPA 4ZS0A 5IG1A 3PIXA 5AUUA 3CPBA 2ITYA 4FKOA 3AD5A 2X2MA 5IMXA 5M4FA 3EQGA 4AGWA 3I7CA 3TUDA 4H05A 3KN5A 3P86A 3F3WA 4LG4A 4D4RA 5AR2A 4RX8A 4UBAA 4EK6A 3HGKA 4F65A 2YLEA 2QKRA 2WMRA 4R3PA 5DVRA 2V62A 5J8IA 5LVOA 4BCMA 3PJ1A 2WMSA 2RG6A 3R02A 5HD7A 5AR5A 2P4IA 3BHTA 4KS7A 4YZNA 5M07A 3LCDA 1LEWA 3DXQA 1UWJA 1JNKA 3HMPA 5A4TA 2WU6A 4U40A 3WARA 3MFUA 3Q4CA 1SM2A 3G90X 3VW6A 5CF6A 2QD9A 3WE4A 2IZSA 3BE2A 3UOJA 4CZUA 5EQYA 4LFIA 2VTMA 5DRBA 3EQHA 4APPA 3FLWA 1Y8YA 4FL3A 1F0QA 2BRGA 3ZUVA 4NYEA 2FH9A 1KSWA 1YI4A 4AOJA 1PYXA 3M11A 3N4UA 2VZ6A 5EI8A 3ZHPC 4CFVA 5FXQA 4ANOA 4RC4A 5HTBA 3TEIA 3UG1A 3GEQA 2UZDA 4IE9A 3DAJA 5CEKA 2WQOA 1M2PA 4QMXA 3V8SA 1KE6A 4YZMA 1FMKA 4BF2A 4HVGA 4RWKA 5AP3A 3DBFA 4M97A 3DPKA 3KQ7A 1MRYA 4TWPA 1YHVA 4A4OA 4FKSA 2CGWA 2GHMA 1FBNA 2G01A 2RIOA 2YACA 1FINA 2VWVA 4L52A 5M51A 3L8SA 3KK9A 3K3JA 3CE3A 4TYHA 4C37A 1SVGA 3PWDA 2UVXA 2HK5A 3FMJA 2I0VA 3QD4A 3WZJA 4AZFA 4CG9A 2PUPA 3FYKX 4S30A 1YXUA 3LFBA 3RAIA 4BICA 4U3YA 4FGRA 2XNGA 3ALNA 4KUJA 4QMSA 3UDBA 5AM6A 3OEFX 3BGQA 4NSTA 4NL0A 2R2PA 4F64A 4C4IA 3ERKA 5AP7A 5KMLA 1FOTA 3DKFA 3WOWA 4RWLA 4LL0A 4RZWA 3TDWA 2CGXA 1ZY4A 3CKWA 4LRMA 4ALUA 5EW3A 2FGIA 3D14A 3TKIA 1IA8A 3Q53A 1YDTE 3MPMA 2X4FA 1OUKA 1PMNA 3TNWA 5I9WA 4PDYA 5DA3A 1GOLA 2YDIA 4GV1A 5HVJA 4F9CA 2V55A 2BRHA 3BGZA 4WNKA 3KXZA 2OXYA 3RJCA 3QRIA 1YHWA 3FC1X 4W4XA 2BTRA 2GQSA 3VS4A 4GH2A 4H36A 2WELA 1M52A 5M53A 2Y4IB 2PZRA 3VUDA 4L43A 5ITAA 3GNIB 3GP0A 3HMOA 4FZDB 2ONLA 4HGLA 5ETAA 5CU3A 2JD5A 4K33A 1OI9A 3EN6A 4L7FA 1QPCA 3L8PA 2XCHA 2YFXA 3UC3A 3WF8A 3FL5A 4BHNA 3DOGA 4PMTA 3ANQA 3HKOA 1HOWA 5L8LA 4JQ8A 3CTHA 5CX9A 4GFMA 5I9UA 3E8DA 4M84A 3W18A 5HBJA 2XMYA 4R3CA 3ENHA 3TTJA 3DS6A 2WTVA 3EN5A 4E93A 5J5SA 3FMHA 2WMXA 4D9TA 2A19B 5DG5A 4ALWA 1YXSA 2QOKA 1WBTA 2ZYBA 4PPBA 1F5QA 4U79A 4J8NA 4C58A 4N0SA 4MF0A 4DTAA 4Q9SA 1P5EA 2CKEA 2HOGA 3K5VA 5KZIA 4A9TA 2CCIA 5D7VA 3LM5A 1H28A 1SNXA 2Z7RA 2W1ZA 2QHNA 4OTRA 4G31A 4TYGA 3Q4UA 3QCYA 4BRXA 4E6QA 3GCSA 3LFFA 2CPKE 5EHOA 5HO6A 3ZXZA 2QU5A 4IX5A 4M13A 4RFYA 2PVMA 2YEXA 2X6DA 4FNZA 4K18A 4FVPA 5CWZA 3RVGA 3UQCA 3QQLA 4YJTA 3PSBA 4BDBA 5CF8A 3U6HA 3TJCA 1H1RA 4WIHA 2JITA 2YCRA 5HVKA 5EDPA 1OKYA 3H9OA 4Y73A 2XK7A 4AP7A 2XVDA 2ITWA 3D5XA 3PJ8A 1SYKA 4FTNA 1YWRA 3CXWA 4I93A 5JRSA 3LXLA 4JI9A 4LM5A 3RPSA 4EH6A 3FHRA 3BV3A 1PF8A 4O2PA 5LMAA 3FL4A 3RM6A 4TWNA 3GQIA 4F0GA 4MNEB 2GFCA 2RFDA 2QHMA 3EL7A 3VUTA 4RG0A 3FMNA 1APME 1FPUA 2VX0A 2HXLA 5JFXA 4O83A 1OL7A 3F3VA 3OROA 3RPRA 2WQBA 3CJGA 5DWRA 2YM4A 2C0TA 3ZS5A 2OH0E 3HA6A 4UWYA 4IXPA 5LWMA 3QZGA 2PMOX 2WQNA 4G2FA 4U97A 4WNPA 5E1EA 4AX8A 3BU5A 4EOIA 4OR5A 4OTWA 4GG7A 4BDEA 5HIEA 2NRYA 2FUMA 5F4NA 5HG5A 5EFQA 3UOLA 3I1AA 3I6UA 4BCFA 1BI7A 3ULIA 3VS1A 2XKDA 1YQJA 3PA3A 1H1QA 4H3BA 1OL6A 4BDFA 4FV4A 3SD0A 2PSQA 4O7NA 2R64A 4TWCA 4JIAA 2YZLA 3ODYX 4X2FA 2B9FA 2XNMA 5CZHA 2W5AA 2PPQA 2YJSA 2JDSA 3ZSIA 4MXOA 1S9IA 4NEUA 4YTHA 1E1XA 3C4FA 3MESA 2BFXA 4MD8E 4I94A 4LMNA 4DG0E 4CZTA 2UZWE 3R7YA 3ORNA 4RA4A 3FQEA 2DUVA 1CKIA 3TWJA 2B55A 4GYGA 3CQUA 4C02A 4D5KA 5J1VA 4FG9A 4DLIA 5J9ZA 3HZTA 3I0QA 3OF0A 3PIYA 5EYKA 3MA3A 3O0GA 4YHFA 3FBVA 2OO8X 4D4VA 4KINA 2QONA 3AGMA 2YITA 3A7HA 4DFUA 4YZBA 4AFJA 3D7TA 4LOPA 3EFJA 3ZM4A 3N4TA 4IAIA 2BTSA 4IB0A 4AACA 4M69A 4X3FA 3ZBFA 4FKRA 3WZDA 4FA2A 2WFYA 3TV7A 5EW8A 4FTLA 5BUEA 4F6WA 3UVQA 3I4BA 2IO6A 2UW9A 3VBTA 4LGHA 2E9VA 4QMPA 2ITOA 3E7VA 3JVSA 4FIHA 4DG2E 4L3PA 3NIEA 4B8MA 2W96B 2YCFA 3NCZA 4Q9ZA 3D15A 4ZK5A 3LW0A 3P9JA 3RINA 4P4CA 3GFWA 3G51A 1ERKA 4FGBA 4MAOA 5HX6A 3QQJA 5ANGA 1V1KA 4EQCA 1WCCA 1OBDA 2BR1A 2VV9A 4BZNA 4YMJA 4MXYA 3SG9A 2HZIA 4QPAA 3HEGA 3OS3A 3JUHA 3LFCA 4FV6A 3QX2A 4FTUA 4M14A 4F1OA 3C5UA 3G33A 3D2IA 4DH7A 2Y4PA 5CXZA 3SQQA 2ZDTA 4YZ9A 3EB0A 5LWNA 1PMEA 2O64A 3C13A 4EOMA 2FO0A 2UZLA 3GCQA 5BVOA 2GCDA 2PWLA 1U5RA 3GOKA 4MXCA 3QUPA 3OXTA 4ZOGA 5BQ0A 2P3GX 4DGMA 3ZO3A 5GIPE 3CTQA 3DK3A 2WTIA 4QPSA 3BV2A 1ZYJA 2RF9A 1NW1A 2J5FA 4D55A 2RL5A 4FNXA 2BCJA 4OTDA 4MCVA 3ULZA 1KE8A 3NLBA 2UUEA 3V5LA 4IADA 4F7JA 1JVPP 4YJQA 4HVIA 4WSQA 4FV1A 2HXQA 2JAVA 3OEZA 5CU6A 2QOCA 3ROCA 3DB8A 4BBMA 2WOTA 4EZ5A 1L8TA 1YOMA 3QC9A 2FYSA 3EL8A 4CFNA 3DAKA 5E8ZA 3GC9A 5TO8A 3VBYA 3CQWA 2Z60A 1B39A 2OK1A 2HENA 3AT2A 2I6LA 2PZ5A 3FLNC 4FYNA 3NVMB 2P0CA 4R8QA 3Q9WA 4XJ0A 4DINA 3BHHA 3BYUA 3E3BX 3E8EA 1M14A 2I1MA 3I81A 1P4OA 3WYXA 5BUJA 3FMEA 3MB6A 4I5PA 3SRVB 4FEXA 3HYHA 5I9YA 4KWPA 5FLFA 1J7UA 2WHBA 4HPTE 4LI5A 5JT2A 1WBSA 3TDVA 1JLUE 4L42A 1VZOA 3UYTA 4DBNA 5A3XA 5T68A 2Y9QA 2YCSA 1J7LA 1XBBA 2EB2A 3HAVA 3HRFA 5CQWA 4FV7A 3DQXA 4AWIA 1IASA 1QMZA 3ZCLA 3PA4A 4N70A 5I3OA 4O96A 1XHAA 1PMUA 5HLNA 1ZRZA 4YJOA 4IJ9A 5E8XA 4NIFA 2OFVA 2P2HA 1PJKA 2RGPA 3QHWA 3BELA 4QYEA 4CFFA 2CKPA 4U81A 4ANMA 3DLZA 2YDKA 2E9OA 3SOAA 4CMTA 3FI3A 3SAYA 4PL5A 4A4XA 2ITVA 4YHJA 3W8QA 4FX3A 2OIBA 4EWQA 4EI4A 4ANNA 2ZMDA 4IX3A 3CGOA 1XBAA 3V5JA 5J7HA 3RCJA 4FSUA 4DGGA 2XYUA 5CZIA 5CSHA 2EB3A 3MH2A 3OBGA 3G9LX 1OPJA 4EYMA 3PY0A 5A14A 4JLCA 1WBOA 2ITXA 2W1CA 4O22A 2QOLA 4RJ3A 5E8WA 3DZOA 3VC4A 4GW8A 4D4YA 2VN9A 3BBTB 4BTFA 3NUSA 2VWBA 4F63A 5I3RA 4I23A 2BRNA 2XM9A 2ZJWA 3DY7A 5IA2A 4XG9A 2W4OA 4WT6A 2XJ1A 4AG8A 4RX5A 4O84A 5EG3A 5D12A 5F1ZA 4FSYA 2B52A 3DK7A 3OMVA 5F20A 2UZUE 4YGAA 1XR1A 2Q83A 5C26A 1O6YA 4NU1A 5FXRA 4ZSLA 4NKAA 1GZ8A 3NNVA 5J5TA 3UTOA 3F5GA 2QODA 1YWNA 4I6HA 3U6JA 3F6XA 4I6QA 3OC1A 1FVRA 2B4SB 1O6LA 3ZO4A 4BL1A 4X2NA 2XIKA 5CEPA 1W98A 4WO5A 1OM1A 3FSKA 4ITJA 4OLIA 3SXFA 4QMZA 3UIBA 3OCTA 4UX9A 5ANDA 5AV0A 2R3QA 2W1IA 1CSNA 3I79A 3ZO1A 2BZKB 3FXXA 5E90A 3TACA 1O6KA 2XJ0A 2P33A 5EM6A 3QQUA 5AFVA 4ZTHA 4M0YA 4EORA 4ZSAA 3BX5A 3P08A 3I60A 4G3EA 4D2WA 4FZ6A 3IOPA 2SRCA 5A54A 3VHKA 5H2UA 4XNEA 3V51A 2VAGA 3ZYAA 4PTCA 3BZ3A 3V8WA 4RJ8A 3GU8A 1R39A 3TV4A 1K9AA 2V7AA 5FQDC 2QU6A 4XEYA 2IZUA 5L6WL 1UV5A 4FL2A 5EKNA 2J0KA 4U8ZA 1FVTA 2ZM3A 4AZSA 3EYHA 2WMUA 3QCXA 3SOCA 4G6OA 3HV6A 4XX9A 5BNJA 3HECA 3PPZA 3TNPC 3UVRA 5K4IA 3NAXA 1UNHA 3F3UA 4ERWA 3MI9A 1VJYA 4Z9LA 4ITIA 2G15A 3HRBA 3HMNA 3PLSA 3KKVA 1P4FA 3PG3A 4QQ5A 3SC1A 4FTRA 2VTAA 4DH5A 4MXAA 4ANBA 4YBKA 4JVGA 2C0IA 3TZ8A 2WTCA 3ZFXA 3KXNA 2B9HA 4G16A 3VN9A 4BGGA 3E63A 1QPDA 1PXIA 3LCTA 3Q9YA 4JT3A 4C33A 5C1QB 4XCUA 4PL4A 4FKUA 4AN2A 4D58A 5LCKA 4FI1A 4GSBA 3C4EA 4C3PA 3FE3A 1EH4A 1IRKA 2OJJA 3LE6A 3LFSA 4AF3A 5IPJA 4OGRA 2DS1A 5DE2A 2JGZA 4AA5A 3QRKA 4ITHA 4QD6A 2GHGA 5C8NA 1YXXA 2XK4A 1MP8A 3EYGA 2HAKA 5DRDA 1DI9A 4IDTA 1ZLTA 4R7IA 2C6TA 4W9XA 2XIXA 2I0HA 2C3JA 3H0ZA 1KE7A 5CTPA 5D10A 3W10A 3AOXA 3NR9A 2XBAA 4CG8A 5ETIA 2QO7A 2W1FA 1IAHA 3QQHA 4DFZE 3IO7A 4CT1A 4PY1A 4B99A 2XBJA 4K11A 4UZHA 4YJUA 4BWPA 4QQJA 1YOJA 3UZRA 1ZWSA 3DKCA 4E4NA 2XKCA 2I40A 2PYWA 2OJIA 3C4CA 2CN8A 5CT7A 4DEBA 3W32A 4E7WA 1A48A 3ZFMA 3LQ8A 4QTEA 2PL0A 4BCKA 1Y57A 4C36A 4EOJA 4GIIA 3TL8A 2W06A 1YXVA 4KIPA 4UZDA 2OF4A 4QMNA 1GIIA 3AMBA 4DGLC 3KGAA 4QP4A 5IQAA 3GCUA 4GUBA 1BLXA 2Z02A 2VTQA 4I5HA 3CGFA 1SZMA 5KX8A 4A06A 2ONLC 4C35A 3FWQA 5HOAA 4C4GA 3A4PA 4IC8A 5CF5A 2IVUA 2F57A 4EK4A 3M42A 3FMKA 4DGNA 4K6ZA 2ZB1A 3O50A 4YBJA 5CEMA 5FD2A 2JFMA 5AP5A 4AT4A 2VTLA 3FKOA 2X0GA 3RAWA 4AZWA 4ACDA 1JSVA 3MJ1A 4M12A 3EQCA 4BY9E 4FUXA 3KRRA 4EH4A 4OTIA 5L2WA 3KRWA 2X4ZA 4DLJA 3AGLA 4FKQA 4NM5A 3NW7A 5DLSA 1M7QA 5DYJA 3PJ3A 5LCJA 2PZIA 2GFSA 4AW2A 2UW7A 5JRQA 3UGCA 1AD5A 1NVQA 2IVTA 2FSLX 4JG8A 2XIRA 3FMDA 5DEWA 4U43A 3R6XA 4J95A 4ZJJA 2R0IA 1SVHA 3PY3A 5IH6A 3F7WA 2R3LA 4HGTA 4UMTA 4FIGA 4L6QA 1H07A 4FICA 2F7XE 5TT7A 3S2PA 3VRZA 3LLTA 3HDMA 3MW1A 3SGCA 3G2FA 5TOZA 5C4LA 1B6CB 4II5A 4LMUA 4FSMA 4ENYA 3NUAA 1PXOA 5AR8A 2JIUA 3IDCA 4MHAA 5ANEA 1PXNA 3LXPA 5HCXA 4G6NA 4NZWB 4JXFA 1H4LA 3DJ7A 3HL7A 3KVWA 4XBRA 3KF4A 4RX7A 5E1SA 5CENA 3R8ZA 3EIDA 5CANA 2C1BA 5M56A 5AV2A 3V5TA 4O7ZA 4IAYA 3R1NA 3HX4A 4MVFA 1OKZA 4FC0A 1YWVA 5H3QA 3RK5A 4IQ6A 4BCPA 1WVWA 5EM8A 4FKTA 3QKMA 5FEDA 4N6ZA 3V01A 3ZDIA 2W1HA 1ZOHA 3S4QA 4FR4A 4FT3A 2XH5A 3QTIA 4FTTA 5F94A 3HRCA 3ODZX 4HPUE 2PVJA 4BI0A 1WVYA 2IG7A 5KHXA 3LMGA 3F69A 4FZAB 2XNOA 2QI8A 2C4GA 3GUBA 3ZSGA 1XJDA 5EHLA 2XRUA 4PPCA 2HY81 4M68A 3WIGA 5D7AA 2J7TA 3BU3A 3MTFA 1Q8ZA 2QKWB 3L9PA 4MBLA 4WRSA 3ZMMA 3VUKA 3ZZWA 1U46A 1S9JA 2R3KA 5E8UA 3AD4A 5FDXA 5HO8A 4ZZMA 4D28A 3O96A 3IW6A 4KIOA 4UYNA 3ACJA 3W2RA 4PF4A 5FM2A 5M09A 5GZ8A 4LRKA 4UXQA 4WA9A 3K3IA 3ETAA 2E9PA 4DH3A 2W5HA 4E73A 2B53A 4YU2A 4RQKA 4BIBA 3FLQA 4B6LA 4JBQA 1MUOA 3GBZA 5JQ8A 5L3AA 1OPKA 3EQFA 4KIQA 4BBEA 4JG6A 3OVVA 1MRVA 2V0DA 4JQ7A 3U8WA 4CT2A 3POOA 3QGWA 3LMHA 4YNEA 4BYJA 2XNBA 3MIAA 4LUEA 2C30A 1OIUA 2JFLA 3NW6A 4ZZNA 3ZZEA 3C4WA 4U45A 2HZ4A 3B2WA 4ZJIA 2PUNA 1K3AA 3CD8A 2PVFA 4Q5HA 5HG9A 3TNQB 5D9HA 3IS5A 4X3FC 5E92A 5AR4A 4E6DA 1H0WA 4EH2A 5JGBA 5JMSA 4BFMA 4R1YA 4DG3E 4CEGA 3GQLA 3V04A 2OBJA 2WEIA 3NYXA 3O2MA 4RPVA 3KULB 1OBGA 1BMKA 2XS0A 2YWVA 1Q24A 2OW3A 2A1AB 4DFLA 4R3RA 5IQHA 4L00A 3RBWA 4UMQA 3UMWA 4GT5A 3R2YA 4JR7A 2BKKA 1YKRA 5F95A 3Q6UA 4R77A 4G1WA 4HZSA 4D0WA 3OZ6A 2VNYA 1WMKA 2C5YA 2CDZA 1Q41A 4Y95A 3KRLA 4ZTRA 5AM7A 2J2IB 5GHVA 2YM3A 4YURA 3C0IA 5AEPA 4L01A 3ZUUA 2YIQA 4LGGA 3KXXA 2DYLA 2NO3A 5AIKA 4FG7A 4KNBA 1XH4A 2GQGA 4JJRA 4J1RA 5JZJA 5AAFA 1LP4A 5DFPA 3VVHA 4FZ7A 4EWHA 1JPAA 3NPCA 2OU7A 4Y85A 3MH1A 1Q99A 2A0CX 1LEZA 1G8AA 2W05A 2VGOA 3ZRMA 5IEXA 1OITA 4EHEA 5DIAA 1XH6A 3NW5A 3LVPA 4O7TA 2DQ7X 2O2UA 5ETCA 2WXVA 2Y0AA 3NIZA 3PXKA 3NRMA 1U5QA 5DI1A 1OIRA 2YIWA 3LXKA 4UXLA 3PXQA 4LV5A 3FZOA 3ITZA 3OOMA 4KSPA 3DAEA 5IUHA 4QP6A 4BKJA 2C69A 4PMPA 4M69B 4X3FB 2WB8A 3COKA 2BROA 2PVLA 2YZAA 5FXSA 3CTJA 3RALA 3FY0A 3OWJA 3KFAA 5HIDA 1UKHA 5HESA 3PE1A 4CFUA 3HVCA 4KA3A 4S31A 4EJNA 2J9MA 5KMKA 1BUHA 4XP3A 1H08A 1J3HA 1YI6A 2E9UA 1H24A 5CAVA 4O0TA 5C8MA 2WTWA 4NUSA 1TQMA 2XK9A 5K0KA 2WO6A 4PNKA 2OIDA 2UVYA 4TRLA 4ZEGA 4EH9A 4Y72A 3BYOA 3R7VA 3IPHA 4FKJA 4FVRA 3U4UA 3TXOA 4ANQA 3KMWA 3TI1A 2IVSA 1JOWB 1G3NA 5AP1A 2FA2A 2WMTA 4NM3A 1PRYA 3B8RA 4PPAA 4EONA 3V8TA 4GUEA 2WPAA 2WMBA 3DFAA 2QQ7A 2FB8A 5HNGA 5C27A 4F4PA 2OZAA 2XEZA 3P0MA 4IVBA 3V5QA 4IEBA 3MIYA 4X3JA 2REIA 4NM0A 5CI7A 3O8TA 4QQTA 3NMUF 2ZV2A 3ROYA 3MGYA 4ACCA 4BTKA 2YERA 4MNFA 5JEBA 3ZO2A 5FWKK 2C6EA 3R28A 5K5XA 5M57A 3LXNA 1PXKA 3M2WA 2ZM1A 3QUEA 4EEVA 3FQSA 4Y5QA 3EN9A 1HCLA 2Y6OA 3FUPA 3JY0A 4FTCA 4AW0A 1JKTA 4PDSA 1W84A 3VS6A 5CVGA 5CVHA 5LQFA 2J90A 3OTUA 3R22A 4AA4A 3THBA 4NK9A 3C5IA 4CMUA 3VS5A 1DM2A 3AMYA 3OUNB 4XG3A 3QTRA 3BKBA 3L8VA 2QC6A 1YXTA 2PVRA 4IW0A 5AV3A 3C51A 3QL8A 2VO7A 5E8TA 2C3IB 3HUBA 3P1AA 3EMGA 2R3PA 3NVKI 1Y91A 3LKMA 4DF3A 4AZTA 3PYYA 4PWNA 4U9AA 3OWPA 5AX9A 3QXOA 5HZNA 2ZDUA 3OW3A 4GT4A 5IF1A 2GDOA 4DHFA 4I0SA 4RVLA 2ACXA 4RSSA 4X2GA 5FBOA 4D1ZA 3P4KA 4W9WA 3V6RA 4Q5EA 1UNLA 4ASDA 4EOLA 3CBLA 1LUFA 3QD3A 4NCTA 4V01A 2YIXA 3NGAA 4IHPA 2F49A 2J0LA 2XJ2A 4V05A 5KHWA 2H34A 4KB8A 4ASEA 3QQKA 2PHKA 3ZRLA 3F2NA 3DV3A 2BILB 4ALVA 4BZDA 5KMNA 4G3FA 3EQBA 3CLYA 4EOSA 4FNWA 4O0RA 3SW4A 2X2LA 4OBPA 4Y83A 2HWPA 2BALA 3FV8A 1FGIA 2VO3A 2XNPA 2B54A 3T3UA 4D1XA 5IQCA 4NIFB 3EKNA 3AC2A 4WRGA 4C8BA 3VS0A 3VJNA 2JEDA 3MTLA 4B4LA 2QG7A 4NKSA 4E5BA 3R00A 4LGDA 4C57A 4RJ6A 5AUZA 5BVWA 4YSJA 2RG5A 1ZOGA 4PTGA 3C0GA 4EK8A 3SDJA 1GY3A 4EUTA 2F7EE 2W9ZB 2UZBA 1U59A 5DGZA 4D2TA 2O65A 1L3RE 3FZRA 4K2RA 4RIWA 1Y6BA 2XEYA 4RIYA 3KVXA 3VUGA 2YM7A 3MV5A 4C59A 4C34A 4YJPA 5E8YA 1PW2A 3KK8A 3RHKA 3SG8A 4FTIA 5K4JA 4J97A 4JOAA 3OY1A 5AAGA 4GVAA 2WEVA 3WILA 5CALA 4NTSA 2R3RA 4QMUA 5CY3A 2BMCA 3A7JA 3C50A 4AT5A 3IW7A 5B2MA 2YIRA 3DNEA 2R3NA 3PDTA 4IC7A 3VS7A 2JDTA 2WMQA 4EHZA 5JK3A 1R0EA 4U80A 5HKMA 3WZEA 3MDYA 3VBQA 5HVYA 3LPBA 2PULA 4IM3A 5CT0A 4K9YA 4V0GA 4NT4A 2H9VA 1BX6A 3MVHA 3SW7A 4A9RA 4RZVA 3BLRA 2XM8A 3VQHA 4JL9A 4YLLA 4F9YA 4USFA 1DAYA 4CKJA 3OBJA 4X2JA 2GNFA 4QYGA 4ZSEA 5JH6A 1W7HA 5DR6A 3VULA 1YHSA 2J0IA 5A4EA 5AP6A 3RNYA 3OT3A 4R7BA 4FF8A 4GK3A 1ZYSA 1UWHA 4MD7E 3T9IA 4ASZA 2CLQA 2X8IA 3NWWA 4LV8A 4ZZOA 3FXZA 3CKXA 3VUIA 4TPTA 2H6DA 4BDCA 2XNEA 4TTHB 1ZXEA 2DWBA 4GFOA 4NJ3A 4HYHA 5HHWA 3TZMA 3UPXA 3TNHA 3JS2A 3N9XA 3QCQA 3QYZA 3FJQE 4GJ3A 5AADA 4CKIA 5HU9A 2PMNX 3NUPA 4YR8A 2ERKA 3WYYA 3IONA 4CYIA 4TN6A 3BBWA 1GZOA 3KY2A 3A4OX 3A8XA 1XH8A 3R30A 4FSTA 4O0XA 4S34A 4C4HA 2Y7JA 3RK7A 4WD5A 2WZJA 5BVDA 4XUFA 4XOYA 2B7AA 4P5QA 4TW9A 3HV7A 3VBXA 3JYAA 2OWBA 5L2QA 3PVGA 4MTAA 5CSPA 4I41A 4I1ZA 3ZLWA 4RGJA 2BRMA 4BWXA 1STCE 3RNIA 5EYDA 2VTSA 4GKHA 2H96A 3L1SA 4C4FA 4QP7A 3JR1A 3OWKA 4JAIA 2X1NA 4J98A 4CQEA 4LQMA 3VF8A 3L9LA 3BYVA 2QG5A 2UZNA 2VTNA 4M8TA 2P2IA 5B0XA 4FT9A 5KMIA 1ND4A 4ZXTA 3OT8A 3EN4A 1KUTA 4BHZA 4FYOA 4Y46A 3MYGA 5IA1A 4BZOA 3BEAA 4PV0A 4U6RA 4IFGA 3QKLA 5HCZA 3BI6A 1BYGA 5D1JA 3MSSA 4TXCA 4EOQA 4MK0A 4UMPA 1R0PA 4EOPA 2AC5A 4LL5A 4F9WA 1QCFA 4MXZA 1TQPA 3EFKA 3QKKA 4WUNA 3Q52A 4NM7A 3HUCA 4PQNA 4O7RA 5IISA 5LMKA 2OKRA 5EDQA 3DKGA 4DH8A 4OTQA 4BCHA 3LZBA 4F9BA 4UMUA 2O8YA 1OECA 4FKPA 4XHKB 3WZKA 4Z55A 4IBMA 1XH5A 3G9NA 4FKLA 2GMXA 2G1TA 3W1FA 2PMIA 5GIOE 2WKMA 4DYMA 4IVAA 5T3QA 5J7BA 5CYIA 5AWMA 5I9ZA 1Z57A 3PP0A 5M4CA 1Z9XA 3QF9A 3MVMA 4GU6A 2LGCA 4QP9A 3OFMA 3R0TA 3I0OA 5GJFA 1V0PA 3JXWA 4MBJA 4BIEA 3GC7A 3EH9A 4E8AA 3PE2A 3CC6A 2VWIA 4YJVA 5IQGA 1M17A 4I0TA 4AZEA 3BLHA 3QYWA 5FM3A 3FZPA 2YM5A 4E3CA 4C62A 4WG3A 4EH3A 5HU3A 1HCKA 4GIHA 4YTCA 5L6PA 2NNWB 3PRIA 3IK3A 3ORLA 2Z7QA 5DEYA 4RA5A 3FPQA 5C4KA 5I5ZA 3OW4A 2W7XA 4CCBA 4Z7GA 3NUNA 1GAGA 3W16A 4PX6A 4K1BA 4MYGA 4CV9A 3ZUTA 1JSUA 3R7GA 1CKPA 5C03A 4J52A 3Q9XA 4AFEA 4BDJA 3E64A 2PE0A 4L3JA 4WBBB 4E4XA 4M3QA 5J9YA 3EQDA 2WMWA 3A8WA 4YC8A 4I6BA 1OKWA 4G3CA 5CVFA 5AAEA 3WI6A 4CFMA 1FGKA 5EHYA 4MX9A 1KOAA 3DJ6A 2PU8A 2BDFA 5KO1A 4GCJA 5H8GA 3LQ3A 5M08A 5CAUA 1NY3A 4L46A 2CNUA 4ZJVA 2X8DA 3E62A 1SMHA 2VTJA 4W4WA 3FPMA 1T46A 2PVHA 4CFXA 2HELA 2R3JA 2R3FA 4TY1A 2ZV9A 2R7BA 4DT8A 3O17A 3L9MA 3LCOA 4WSYA 3SX9A 5A6NA 5AA9A 1Q8TA 4I4FA 1WAKA 1ZYDA 5D41A 3MH3A 4UN0C 1PY5A 4ZSJA 3HDNA 1ZAOA 3GC0A 4O91A 2W5BA 2V22A 5AP4A 2YN8A 3SLSA 3DTCA 4QYYA 4EQUA 2HY0A 3ZDUA 1JSTA 5ANKA 1RQQA 4BN1A 4EH7A 2C6IA 1E9HA 1URWA 1WBNA 3E7OA 2JC6A 2WTKC 3F9NA 2WIHA 1CKJA 2XCKA 2J5EA 4FEQA 4QTCA 3QC4A 4TT7A 4IAZA 2PMLX 3DQWA 3R2BA 4QMLA 4I21A 4FIIA 3VWAA 4FK3A 5KMJA 3QTWA 3VBWA 3R9RA 1REKA 1YI3A 2ITQA 4H58A 2XIZA 3B8QA 3R83A 3KRXA 4BGQA 3D83A 2VX1A 2Z7SA 5H8EA 1UVRA 4GU9A 4ZY6A 3BCEA 3VW8A 4ZLOA 2B9JA 3P5KA 3TIZA 4YJSA 3FKLA 3VUHA 2OXXA 1XKKA 3W33A 4HCUA 4AN3A 3PTGA 4XLVA 4E26A 4IWOA 5E4HA 3QWKA 1YDSE 2G2IA 4WOVA 4C2VA 3DDPA 3ZFYA 3PWYA 4WKQA 4DE4A 4QMTA 3HLLA 4DCAA 3SVVA 3LFDA 4HYIA 5CU2A 1JKSA 3QRJA 3HAMA 3PJCA 5J87A 4WBOA 4A7CA 4FTMA 2C0OA 3VBVA 3ZOSA 2CNQA 5CAPA 2X9EA 4M15A 3DU8A 3NUXA 4W8EA 1IR3A 5KCVA 4A07A 2GQRA 4GK2A 4CTCA 5EQPA 3TIYA 4TWOA
chains in the Genus database with same CATH superfamily
4X6QC 5A4QA 4BGHA 2QR8A 2VTOA 4TYJA 5J1WA 3FMLA 4IVDA 3SA0A 5HIBA 5IA3A 1H8FA 3PJ2A 2UZOA 4ZSGA 3TV6A 2BZJA 5FGKA 2PVKA 2WTKB 5H8BA 4I4EA 3E8CA 5AMNA 3TUCA 1LR4A 3GGFA 4GMYA 4LUDA 3IW8A 4Q2AA 3QQGA 4KKHA 4XH6A 4RMZA 1UU3A 2BKZA 2VWZA 3G6GA 4WG5A 3VS3A 3ALOA 4ASXA 4I24A 4I22A 4ZMEA 3QU0A 3KMUA 4EZ7A 5M4IA 5AJQA 5BV3A 3SXRA 4DHIB 3DBQA 5FTQA 2OFUA 4F7LA 3KN6A 3MY0A 4BTMA 4NFMA 5DPVA 4E4MA 4BJJA 4RC3A 2UV2A 5EM5A 5CAQA 5BYLA 1XWSA 3CPCA 4IZYA 4IJPA 5CEOA 4W4VA 3QALE 4GRBA 3R21A 3LMIA 3UC4A 2QO9A 3PZHA 3AG9A 4FTAA 3U9NA 3QTUA 4BCGA 4AN9A 2JBPA 4DGOA 4FSNA 5CNOA 4QNAA 3W0NA 4XYFA 3GCPA 2XKEA 2Z8CA 3H9RA 4D1SA 2G2FA 2FSOX 3N4VA 2LAVA 2GNIA 3SKCA 3ENMA 4O0UA 1M2RA 5E7RA 3Q2JA 4YHTA 4ZY5A 4I20A 2R3OA 3H0YA 4HNIA 4AXFA 4IH8A 1W2CA 3QZFA 3ZTXA 3P5JC 1Q62A 5ACBC 4X2KA 4HYSA 4O7LA 5ACKA 4K8AA 3CY3A 2VWWA 5H9BA 4YNOA 2OGVA 4FKIA 4IWPA 4O0VA 2IZRA 3T8OA 5K5NA 4ID7A 2IW9A 4YZCA 1WFCA 2VRXA 2ETRA 4OAVB 4KABA 2X2KA 2C5XA 3DA6A 2VO0A 4MKCA 4YUQA 5IQDA 2XA4A 1VEBA 2JAMA 4QOXA 1W2FA 3QZIA 4TYHB 3UO6A 3ZEPA 3SRVA 3VQUA 2GHLA 4Y8DA 5FEEA 5CEQA 4FOBA 3ZLYA 3UIMA 2FSMX 5ANIA 4BKZA 2JKMA 3Q32A 4YC6A 5JSMA 5C01A 3REPA 3A61A 3QHRA 1YRPA 4IX4A 4RIXA 4QNYA 4BWKA 2R0UA 2HZNA 4TYEA 1OL2A 3PPJA 4B9DA 5CASA 4NCTC 3OOGA 3QFVA 4FT7A 3QTSA 3QTQA 3DTWA 5HGIA 2WIPA 2VTIA 5EDRA 3O23A 3FI4A 5EK7A 4OBOA 5KBRA 4K77A 2GTMA 3PVBA 2BRBA 5L2IA 1NA7A 3C7QA 5FUTA 5IMEA 1OUYA 2O0UA 2C3KA 4RVMA 5CU0A 3UP2A 3FLSA 2RFSA 3ORMA 3WE8A 2OZAB 5M06A 5K9IA 3H3CA 5JZNA 3II5A 4KRCA 4YO6A 2A27A 5BVFA 4B8LA 1M7NA 2AC3A 3IKAA 5HE3A 1JAMA 4GS6A 3PVUA 4W4YA 4AE6A 3RPOA 3FZTA 2OH4A 1Y8GA 4ONAA 4FEUA 4EHVA 2C5OA 3IGGA 2JKOA 4RFMA 2QR7A 4A9YA 1BL6A 4BCJA 4UYAA 1ATPE 3QUDA 4IB3A 3IW4A 3VS2A 3C9WA 3ZU7A 2QOFA 4KD1A 2C3LA 5TF9A 4EKKA 5IQBA 4CSVA 3R63A 3GFEA 2I0EA 4FT0A 3BU6A 1PMVA 1R78A 3VJOA 3F82A 1GNGA 1JQHA 4I0RA 4B7TA 2HZ0A 3G0FA 2R3GA 3VNTA 3AMAA 3K2LA 2PUIA 1H25A 3FMMA 1NVSA 3HA8A 5EI6A 5DT0A 3POZA 5HNBA 4EKLA 2EVAA 2J51A 5EYCA 2JBOA 3VRYA 2XF0A 3TTIA 1K2PA 4TNDA 1SNUA 1U54A 3RHXA 3KL8A 2XK3A 4OTPA 4QMYA 4JQEA 4U41A 4QMQA 3R7UA 4EBVA 2CKQA 2GNHA 4KBCA 5IQIA 2I0YA 3BHUA 4R7HA 3ZH8A 5E8SA 5IQFA 2QVSE 4C3FA 1B38A 3DBDA 4KKEA 2VTTA 3NZ0A 2W17A 3F66A 3COHA 3CIKA 4MWHA 3QWJA 3ZONA 4BDDA 3BQCA 3GB2A 4DEDA 3OG7A 1QPJA 4X0MA 1PXMA 2F2UA 3S3IA 2WU7A 4ENXA 2XNNA 3W2PA 3G15A 4OT5A 4AU8A 3GXLA 2UW4A 4APCA 4GFGA 3PLAE 3ZRKA 5LOHA 3PUPA 3UIUA 4D2VA 4FSQA 4OW8A 2C6OA 3PSCA 3UIXA 3UE4A 4EYJA 2UW0A 1VYWA 3ANRA 3R8PA 5IDPA 3F3TA 4JBVA 1MQBA 3KF7A 4AOIA 4O7YA 1TFFA 3DGKA 4XOZA 4U7ZA 5IEYA 3HMMA 4RIWB 4RIYB 4TYIA 3NSZA 2OI4X 1F3MC 4YTIA 5DT3A 4GG5A 3NYVA 3TZ9A 4QPMA 4FTJA 3W2QA 4H3QA 4ZAUA 2YM8A 4F6UA 3S00A 2CGVA 5KBQA 2BHEA 4F70A 4FODA 3Q2MA 4QMVA 4XLIA 4EZ3A 4I5MA 2AYPA 1QPEA 4O1PA 2PE2A 4JBPA 2RKUA 5G1XA 3WF7A 4OUCA 3RP9A 2VWXA 4BCNA 1IG1A 3QAME 2W0JA 1YVJA 3K5UA 4H1JA 4ZTSA 5KMMA 3I5ZA 3D5WA 2BFYA 3PVWA 4R6VA 4V0GB 3ZXTA 4E20A 2OJFE 2YHVA 3OCSA 1ZMWA 4F08A 3CEKA 3UP7A 4L45A 4P7EA 2QOBA 4XS2A 4FKVA 3OY3A 5G6VA 4LOOA 3QRUA 5DBXA 2C68A 2HWOA 2ITUA 5E8VA 3R9NA 2G2HA 5KZ0A 2R7IA 3ZLSA 3QCSA 3LCKA 4Y5HA 4E4LA 3VUMA 3IDPA 4QRCA 2OZOA 2PE1A 5HO7A 3GU4A 1OIYA 2ZV8A 3P79A 5TE0A 5TR6A 4IX6A 2ERZE 3D7ZA 1UU7A 4XG4A 4Z16A 2C47A 4G34A 4BVUA 5EKOA 3DJ5A 4UV0A 5IA4A 2F2CB 2X81A 4G3DA 3OCBA 3HP2A 2BVAA 3D7TB 3PXRA 4K0YA 4HJOA 2WNTA 3L8XA 5LMKC 3ATSA 3FLYA 3MPAA 4G17A 3UZPA 3Q5ZA 3M1SA 2ITTA 4JIKA 4KIKA 4J96A 4L44A 4MXXA 2BIYA 2JKQA 5HEZA 4BI1A 5L2SA 2VO6A 5L6OA 3ATTA 1BL7A 4FEVA 3R7EA 5I4NA 5A46A 5EM7A 3MY5A 1WZYA 4AW1A 1FQ1B 3U6IA 2GS7A 4G5PA 4AA0A 3MFSA 4XG6A 2F7ZE 1PHKA 1PXJA 2Y4IC 5LVMA 3UNKA 3TM0A 4OAUC 2ETKA 2RSVA 4YZDA 5GJGA 2XUUA 5CLPA 3HMIA 3KB7A 5E91A 2GSFA 2KTYA 1VLRA 5HBHA 3RWQA 2CSNA 4DITA 1GZNA 2EXEA 2PY3A 3H30A 1PXLA 3AC8A 4J99A 4IWQA 5HG7A 5B2KA 3ZC6A 3CR0A 4NH1A 4F09A 3NNUA 1BKXA 2EUFB 3EZVA 5M4UA 5LVNA 4MD9E 3PZEA 3DCVA 2C6DA 3AC4A 2IW8A 3NUYA 5DH3A 4BBFA 4D0XA 3CP9A 2J4ZA 1P2AA 3WF6A 2ETMA 5LARA 3UJGA 4FTKA 4C4JA 3KREA 5LXMA 4PTEA 4MQ1A 1H01A 5TKDA 4AGDA 4O27B 4S2ZA 5JFVA 3UQFA 4ZS4A 2YA9A 4AAAA 1AGWA 3CS9A 4DFXE 5DMZA 2YAKA 2C5VA 3BYMA 5AR3A 5IUIA 3ORTA 3NCGA 3PIZA 5I0BA 3F5PA 3RKBA 3UZTA 3W2SA 3EWHA 4C61A 4CFWA 2UVZA 1TQIA 1CDKA 4O21A 4OTHA 2IVVA 3MWUA 1P14A 3ZBXA 5DOSA 1FMOE 3C4ZA 3D94A 4R5SA 3R1YA 5AV1A 4IMYA 3UNZA 1REJA 4OT6A 3DKOA 4FKWA 2ESMA 4M0ZA 3F5XA 3U87A 2UW3A 4DCEA 4XP2A 5AX3A 4P2KA 1XH9A 3ORZA 2OIQA 5K3YA 4AGUA 4OTGA 3MFTA 3W55A 4F7SA 3GENA 4DFBA 4QTBA 4IZ7A 3MB7A 4H3PA 1OGUA 5L8JA 4BDHA 5LVPA 4O1OA 3I7BA 2CLXA 2B9IA 3AXWA 2UW5A 3O71A 3QGYA 4WNOA 2HW7A 4E6CA 4M66A 4LYNA 2VWUA 4CCUA 5JGAA 4L68A 2ZVAA 4X7QA 3MBLA 4FV2A 5IH4A 4DAWA 2B1PA 1IAJA 4XRJA 3VIDA 3WF5A 3EOCA 2H8HA 4MBIA 3RTPA 3P78A 2W1DA 3MS9A 3FC2A 3DBEA 5DHJA 4LRJA 2BDWA 2C6LA 2OJGA 4EHGA 3DXNA 5HE2A 5JGDA 2JIVA 2OLCA 3Q4ZA 1CMKE 3ZLXA 4DT9A 4JG7A 1OL1A 4FL1A 2J0JA 1X8BA 4HCTA 4PRJA 1FVVA 2BAJA 4IIRA 3LJ1A 4JRVA 3E92A 3IG7A 4D5HA 5AUTA 5EQEA 1J1BA 3ZEWA 3CD3A 5AUXA 3EZRA 2YDJA 1ZYLA 3V5WA 4FTOA 1KV1A 4RJ4A 3BEGA 2J0MB 2VD5A 2VTPA 4FIEA 4BTJA 5HQ0A 3R71A 1Q8YA 4GJ2A 1XMLA 2C5NA 4XBUA 3LQ5A 4FV8A 3OTVA 1ST0A 3R9HA 5KUPA 3VAPA 3R9DA 3W0OA 2BZHB 4J71A 4IZAA 3UO4A 4Z3VA 5HTCA 3FZ1A 4RFZA 3FKNA 5F9EA 4MH7A 3HV5A 3UO5A 3KCKA 4I6FA 4USDA 5K0XA 4YSMA 1R1WA 5JQ5A 1KOBA 2WMAA 4F9AA 4U42A 3U55A 4ANLA 3DT1A 3LJ2A 4O82A 3KEXA 3F61A 5BMSA 1ZZ2A 1WBPA 3E88A 4JBOA 3NFFB 4A9UA 4FT5A 3I5NA 1JBPE 4DFNA 3W2OA 4BDIA 4RJ7A 4DBXA 3AT3A 3R9OA 3DZQA 1V0BA 4WG4A 3T9TA 1UKIA 2V5QA 3NAYA 4HGSA 3P7AA 4A4LA 5FG8A 2PK9A 3EKKA 4M67A 3KULA 4RT7A 4WNMA 2QOIA 3E3PA 2R5TA 2QOOA 5EW9A 3TKUA 3TZ7A 3AKJA 5BPYA 4IAAA 1I09A 3NX8A 2BUJA 2JIIA 4BC6A 4E5WA 3Q5IA 4I3ZA 4EK3A 3ID6C 1UNGA 1NT2A 4AS0A 5A9UA 1H1WA 2WMVA 3OD6X 4UY9A 3QX4A 1GJOA 1CTPE 3BLQA 4XV1A 3LM0A 4S33A 5JFSA 3AC3A 3D5UA 3G6HA 4J8MA 5GZAA 5FTGA 4BCIA 4RC2A 5A6OA 1U4DA 3QA8A 1OPLA 1Q61A 1W8CA 3HV3A 3P23A 5J79A 3QTXA 3ET7A 2O5KA 1TVOA 4YLJA 4Z7HA 2BAQA 2XP2A 4GVJA 4KSQA 1NVRA 3FSFA 3PP1A 4F1TA 4TNBA 4XMOA 4O38A 1OMWA 3VO3A 5LMBA 3ZM9A 4DN5A 1AQ1A 3BYSA 4CXAA 1OL5A 3U54A 3FEGA 2JLDA 3UOKA 4B0GA 2P55A 4P5ZA 3QD2B 4IDVA 3UPZA 3A99A 3JVRA 3CY2A 2ZMCA 4DEEA 3GT8A 2IN6A 2R4BA 4YPSA 3KU2A 3ZSHA 2YISA 4YTFA 4L7SA 3UDTA 2QLUA 1XQZA 4IM0A 4UB7A 4X6RA 4BDGA 4AZVA 4GKIA 4CQGA 2VUWA 3S95A 3D4QA 2WQEA 4DA5A 4RBLA 2W4KA 4ZLZA 3N51A 4DEAA 1YOLA 2W9FB 5CSWA 4ZIMA 4HYUA 5CSXA 3TCPA 1W82A 3P7CA 4PDOA 5HI2A 4AUAA 4UEUA 4E6AA 5CQUA 4WUAA 3TN8A 3MFRA 3S0OA 2XRWA 1V0OA 1O9UA 1Q3WA 3NYNA 3R1SA 3EQIA 4FSRA 4IB1A 5FEQA 5M55A 4QO9A 4ZP5A 3AKKA 1H0VA 4FV9A 4AOTA 2PZPA 2NPQA 2E9NA 3FDNA 3BPRA 4N4SA 4WHZA 3COIA 3LJ0A 4IZ5A 3ZC5A 3E5AA 3OWLA 4HZRA 2X7FA 3V5PA 5CXHA 4YP8A 3UNJA 2YCQA 2BIKB 5BVEA 5M44A 1KE5A 3RZBA 4BJJB 4BCOA 5B7VA 4UWCA 2W1EA 4ZTNA 1ST4A 3GI3A 4TKSA 5BVKA 5I9XA 5HICA 2YWPA 3LAUA 1PKDA 3Q4TA 1RJBA 4HCVA 3RAKA 5B2LA 2WAJA 5CS6A 1Z5MA 2G9XA 5L8KA 2XIYA 2QLQA 4FEWA 4O0YA 3TMOA 4KBAA 3C1XA 4JR3A 3KC3A 4RWJA 3R8UA 1XMMA 5E9EA 4PP9A 5T6KA 2XYNA 5GINE 5ANJA 3A60A 4N57A 2CNVA 4O4DA 5AP2A 2GNLA 3EQRA 3KA0A 1LPUA 4O6LA 4QP2A 1DAWA 1OKVA 3OP5A 2OG8A 3W0PA 2FVDA 3FHIA 2Z7LA 3DK6A 4J53A 5DN3A 2WOUA 3NEWA 4PMMA 2IW6A 3GC8A 4JX3A 5HBEA 5CF4A 4M7IA 4FMQA 3A62A 1IEPA 2ZV7A 2XKFA 3AT4A 1UA2A 3QTZA 3EQPA 3AD6A 4FVQA 3UODA 3L9NA 3CQEA 4G6LA 1WVXA 1H1SA 2E2BA 3BGPA 2GS2A 4MF1A 4QYHA 5AUWA 4PMSA 3W8LA 2WD1A 4KS8A 5EH0A 3CCNA 3R7IA 5J95A 5IDNA 3G0EA 4F6SA 4AGCA 4CLJA 3RM7A 3VONA 4F0IA 3S1HA 2B0QA 1YDRE 1JWHA 2UZTA 4RVTA 4FSZA 5IH5A 2IJMA 1URCA 3T3VA 5DT4A 4YJRA 2WTJA 2PVYA 3BHVA 4N6YA 4RRVA 4FV3A 2I7QA 3QD0A 5AP0A 5A4CA 1Q3DA 5IU2A 3R8MA 1G8SA 4KRDA 1I44A 2GU8A 4RIXB 2VGPA 4L67A 4O2ZA 2YJRA 2OSCA 4H39A 4XV9A 3MVJA 1PXPA 4IACA 3OHTA 5L4QA 1G5SA 2R9SA 4CD0A 3Q60A 3O7LD 4ACGA 1H00A 3D5VA 4TL0A 3PPKA 2CJMA 2XK8A 4NW5A 5AUVA 5IA0A 4O7VA 3RPVA 2PVNA 1KV2A 2OXDA 3MY1A 3PSDA 4CRSA 2EWAA 4LOQA 5HNIX 4QMOA 2QNJA 3ACKA 4FV5A 3UMXA 2R3HA 3SXSA 3D0EA 3R04A 1ZOEA 5CNNA 3R8VA 3UYSA 4EUUA 5AV4A 2QOQA 1UU9A 3FQHA 4DEGA 4RJ5A 4E5AX 4C4EA 4R78A 2GS6A 3RI1A 1E1VA 2QURA 4MNEA 5AIRA 3RZFA 2CKOA 3F7ZA 5LJJA 3MJ2A 2EXMA 4O7WA 2PTKA 4QT1A 4ZTQA 1M2QA 5L2TA 4JAJA 4PUZA 4ACMA 4EOOA 4R5YA 4YPDA 1ZARA 3D2KA 2Q0NA 1GIJA 3LOKA 4L3LA 4MEDA 3VF9A 5HORA 3Q96A 3FYJX 3JY9A 3BRBA 4MUQA 3PXZA 4IANA 3AQVA 3DB6A 4EC9A 3BIZA 4HW7A 2R3MA 2J6MA 2V7OA 4TZRA 2A2AA 3OCGA 5LVLA 3COMA 4RLLA 2EXCX 5IQEA 3UOHA 5FDPA 1XO2B 2IPXA 3GU6A 2BZIB 4OBQA 2VNWA 1XBCA 2BAKA 3TNIA 1BI8A 3RGFA 4EC8A 4ZTMA 4DTBA 1U54B 2NP8A 1OZ1A 2ZOQA 1SVEA 4JMQA 5HD4A 4HVSA 1Q97A 3UG2A 3IGOA 2HCKA 5BX0A 3GU5A 4ZTLA 4G9CA 4XG8A 1J1CA 4RIOA 3RWPA 5I9VA 3WIKA 3LFQA 4R1VA 5C9CA 4GYIA 4EH5A 1RDQE 3KXMA 1RE8A 4D4SA 5A4LA 2ITZA 4FIFA 2Y8OA 2VTRA 3B2TA 5IA5A 3TKHA 2XK6A 5ANOA 2IZTA 2BDJA 3U51A 3HV4A 2X39A 2ZM4A 5IEVA 4FZFB 2GNGA 3GCVA 2GNJA 3OXIA 1IA9A 3RMFA 4C3RA 4FK6A 4FNYA 1W83A 4C7TA 5HTIA 4F99A 1ZZLA 2OF2A 3F88A 3DDQA 3IECA 3C0HA 3MH0A 5KE0A 2EU9A 4W8DA 1G8JA 5CEIA 3W2CA 4RX9A 4YC3A 3W0SA 3U9CA 1Q4LA 2VU3A 2RFEA 3UVPA 3MPTA 3U4WA 4S32A 4D9UA 2X0QA 2X9FA 4CGAA 4HOKA 3WBLA 2O3PA 3NFGB 3ORKA 1Y6AA 4G9RA 4GT3A 4IAKA 4RVKA 4G3GA 3LCSA 2RFNA 5J9LA 4C0TA 2YABA 4NFNA 2ZB0A 3F3ZA 4PP7A 4O86A 4O81A 5AUYA 5CI6A 1YW2A 4HNFA 4EQMA 4JRNA 1A06A 3UQGA 4C2WA 3KRJA 3AC1A 5BVNA 4UALA 5CSVA 2UW8A 4X21A 2X7GA 3JPVA 4BB4A 4BDKA 3EFLA 5FBNC 3TG1A 3UBDA 1ZYCA 4EJ7A 4L8MA 2KULA 4ZMFA 2BPMA 2W1GA 5CU4A 1T45A 2UZEA 3AC5A 2X7OA 3NS9A 3TUBA 3BWJA 3H10A 1WBVA 4JDIA 2GPHA 3Q3BA 4UMRA 3QQFA 4XRLA 5C8KA 4RQVA 3A7FA 3FY2A 4ZY4A 5EOLA 4KAOA 3Q6WA 4PL3A 1W0XC 4BYIA 3FI8A 1PYEA 4GK4A 4KBKA 5IKWA 5KNJA 3EJ1A 4BCQA 2WTDA 2Z2WA 4JS8A 2NRUA 2JDVA 4U44A 4D2RA 2CGUA 2JKKA 1G8KA 2HIWA 1J91A 4EBWA 4ZLYA 4E1ZA 3KXGA 2QOHA 3LFAA 4FBXA 4QP3A 4QMMA 1OGYA 3DNDA 3WZUA 1Q8WA 4YLKA 4EH8A 3CSVA 1DI8A 2WGJA 3NNWA 4XP0A 5BMMA 4I92A 3F2AA 2W99B 4CRLA 4O0SA 3R01A 4YJNA 5BYYA 4FSWA 4AT3A 3R7OA 4FE2A 3QA0A 4I5CA 3HP5A 3Q04A 4BKYA 5EYMA 4USEA 1GIHA 5BYZA 2BHHA 5FP5A 4FIJA 2Q0BA 4J7BA 2A4LA 5FP6A 4AQCA 3IQ7A 1NXKA 4KIKB 4AXAA 4I6LA 4EOKA 4IB5A 3R8LA 1DS5A 3RAHA 4BIDA 4CTBA 3PG1A 4IAFA 3F2RA 3IDBA 3DBCA 4JX7A 4KKGA 3ORXA 2XB7A 4UWBA 4CVAA 5JN2A 4DHZA 2O63A 4HVDA 4GEOA 4H1MA 4ORKA 2CN5A 2FSTX 2CHLA 1PKGA 4IWDA 2XZSA 4BR3A 4XV3A 3MN3A 4ACHA 2C6KA 4C38A 3GOPA 1VR2A 4EK5A 3RPYA 3VHEA 3GU7A 3NUUA 5GNKA 4O6EA 1RW8A 4ANSA 5HX8A 3KXHA 4OTFA 2X6EA 5D11A 5HE0A 4A9SA 1GZKA 3BHYA 3E87A 4CNHA 4L53A 3OUKA 3LFEA 4FOCA 3SHEA 5BUIA 5EI2A 1QL6A 1H1PA 4AW5A 4JDJA 3DLSA 3A7GA 4G5JA 3E8NA 4CLIA 4NW6A 4DTKA 2F4JA 3SV0A 4XG2A 1R3CA 4V04A 3RCDA 5KKRC 1H27A 3QZHA 4DC2A 3R73A 1MRUA 3QLGA 3ORIA 2ZAZA 5JKGA 1ZY5A 3DXPA 2W4JA 2WQMA 4NJDA 4P90A 5ETFA 4FTQA 3TT0A 4DEIA 5DNRA 3DFCB 5HG8A 3C4XA 1JKKA 2C6MA 3QXPA 4BDAA 3RK9A 3GVUA 2J50A 3A7IA 3NYOA 3OXZA 4FV0A 4O0WA 3ELJA 4L9IA 3MVLA 3FLZA 4GL9A 2AUHA 5HLWA 1JKLA 1KWPA 1VYZA 2HYYA 2ITNA 3LHJA 3O51A 4PDPA 5GJDA 5HLPA 5IZFA 4YO4A 3V3VA 3KMMA 1XH7A 2GTNA 3O7LB 1OB3A 4QP1A 2X8EA 4QTAA 3Q9ZA 4JDHA 4EL9A 4AE9A 4O7SA 1Q8UA 4MWIA 4XG7A 5EOBA 4FUYA 5FTOA 5ICPA 3NDMA 3O8UA 4PNIA 2VX3A 4F7NA 4QMWA 4FG8A 2C1AA 3QRTA 3PFQA 4DH1A 4D2PA 5IUGA 2R3IA 2PUUA 2A98A 1UU8A 4JNWA 4CZYB 5HE1A 1WBWA 2Y6MA 2YAAA 3FZSA 3PXFA 3TJDA 4FKGA 2OICA 2OJ9A 1J7IA 3LFNA 4ARKA 1OVEA 4CV8A 4F1MA 2QCSA 4JDKA 3F5UA 2YIYA 3BE9A 2VWYA 3EFWA 3K54A 5DR2A 5HCYA 4CKRA 1H26A 4NWMA 2XARA 4CYJA 3G5DA 3H4JA 3V6SA 5KKRB 2YM6A 4BI2A 3HNGA 4RLKA 3FAAA 5FRIA 3P7BA 4HVHA 2HW6A 4MQ2A 1TKIA 3LLAA 2F9GA 3CJFA 3PRFA 3I6WA 3EN7A 3LIJA 1ZMUA 2VTHA 4QP8A 4DFYA 3UDSA 2IWIA 3QBNA 2PZYA 3ORPA 3QLFA 4U3ZA 3MA6A 2CMWA 4LDTA 5JFWA 3H9FA 3IOKA 4IM2A 4NTTA 2CCHA 3PA5A 3PY1A 4F0FA 2QO2A 2UZVA 1KE9A 4IFCA 5GZ9A 2UW6A 1CM8A 3FXWA 4CMOA 4HGEA 3O8PA 4QYFA 3NNXA 3BWFA 3PXYA 1MQ4A 3KCFA 5AR7A 4DEHA 1Q5KA 2JDOA 3FI2A 4QTDA 5CAOA 5DR9A 4ERKA 2YLFA 3A2CA 1A9UA 4D2SA 4U0IA 3R1QA 5KMOA 1OIQA 3BQRA 4QQCA 4RWIA 5AA8A 4XV2A 3D9VA 1ZMVA 3WF9A 4IVCA 2JDRA 3EHAA 3IW5A 3E93A 4U5JA 2ITPA 4ZS0A 5IG1A 3PIXA 5AUUA 3CPBA 2ITYA 4FKOA 3AD5A 2X2MA 5IMXA 5M4FA 3EQGA 4AGWA 3I7CA 3TUDA 4H05A 3KN5A 3P86A 3F3WA 4LG4A 4D4RA 5AR2A 4RX8A 4UBAA 4EK6A 3HGKA 4F65A 2YLEA 2QKRA 2WMRA 4R3PA 5DVRA 2V62A 5J8IA 5LVOA 4BCMA 3PJ1A 2WMSA 2RG6A 3R02A 5HD7A 5AR5A 2P4IA 3BHTA 4KS7A 4YZNA 5M07A 3LCDA 1LEWA 3DXQA 1UWJA 1JNKA 3HMPA 5A4TA 2WU6A 4U40A 3TYKA 3WARA 3MFUA 3Q4CA 1SM2A 3G90X 3VW6A 5CF6A 2QD9A 3WE4A 2IZSA 3BE2A 3UOJA 4CZUA 5EQYA 4LFIA 4AXCA 2VTMA 5DRBA 3EQHA 4APPA 3FLWA 1Y8YA 4FL3A 1F0QA 2BRGA 3ZUVA 4NYEA 2FH9A 1KSWA 1YI4A 4AOJA 4AXDA 1PYXA 3M11A 3N4UA 2VZ6A 5EI8A 3ZHPC 4CFVA 5FXQA 4ANOA 4RC4A 5HTBA 3TEIA 3UG1A 3GEQA 2UZDA 4IE9A 3DAJA 5CEKA 2WQOA 1M2PA 4QMXA 3V8SA 1KE6A 4YZMA 1FMKA 4BF2A 4HVGA 4RWKA 5AP3A 3DBFA 4M97A 3DPKA 3KQ7A 1MRYA 4TWPA 1YHVA 4A4OA 4FKSA 2CGWA 2GHMA 1FBNA 1W2DA 2G01A 2RIOA 2YACA 1FINA 2VWVA 4L52A 5M51A 3L8SA 3KK9A 3K3JA 3CE3A 4TYHA 4C37A 1SVGA 3PWDA 2UVXA 2HK5A 3FMJA 2I0VA 3QD4A 3WZJA 4AZFA 4CG9A 2PUPA 3FYKX 4S30A 1YXUA 3LFBA 3RAIA 4BICA 4U3YA 4FGRA 2XNGA 3ALNA 4KUJA 4QMSA 3UDBA 5AM6A 3OEFX 3BGQA 4NSTA 4NL0A 2R2PA 4F64A 4C4IA 3ERKA 5AP7A 5KMLA 1FOTA 3DKFA 3WOWA 4RWLA 4LL0A 4RZWA 3TDWA 2CGXA 1ZY4A 3CKWA 4LRMA 4ALUA 4AQKA 5EW3A 2FGIA 3D14A 3TKIA 1IA8A 3Q53A 1YDTE 3MPMA 2X4FA 1OUKA 1PMNA 3TNWA 5I9WA 4PDYA 5DA3A 1GOLA 2YDIA 4GV1A 5HVJA 4F9CA 2V55A 2BRHA 3BGZA 4WNKA 3KXZA 2OXYA 3RJCA 3QRIA 1YHWA 3FC1X 4W4XA 2BTRA 2GQSA 3VS4A 4GH2A 4H36A 2WELA 1M52A 5M53A 2Y4IB 2PZRA 3VUDA 4L43A 5ITAA 3PUFC 3GNIB 3GP0A 3HMOA 4FZDB 2ONLA 4HGLA 5ETAA 5CU3A 2JD5A 4K33A 1OI9A 3EN6A 4L7FA 1QPCA 3L8PA 2XCHA 2YFXA 3UC3A 3WF8A 3FL5A 4BHNA 3DOGA 4FRFA 4PMTA 3ANQA 3HKOA 1HOWA 5L8LA 4JQ8A