4RIWA

Crystal structure of an egfr/her3 kinase domain heterodimer
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
281
structure length
269
Chain Sequence
VLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title Structural analysis of the EGFR/HER3 heterodimer reveals the molecular basis for activating HER3 mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 269
sequence length 281
chains with identical sequence C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4riwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4riwA01
2X4FA 4AAAA 3Q3BA 3F9NA 2QC6A 2W1FA 5JH6A 2GNGA 3ID6C 4BI0A 2Y8OA 2QR8A 2G1TA 3A99A 5E1SA 3RHKA 4BKJA 4BDCA 4MWHA 5M07A 1URCA 1PXIA 2VTAA 5AMNA 2PMNX 2PZPA 4YTFA 4FTRA 4DF3A 3MVLA 3DLZA 5IQAA 2NRUA 4ANSA 3NMUF 2CGWA 5HLNA 3KF4A 4QP6A 3QUDA 3C0IA 3EFJA 5L6WL 3Q2JA 3OXZA 4KKHA 4FOBA 2UZNA 4BCKA 4ITIA 4C61A 4PRJA 4PWNA 1CSNA 3V5WA 2OI4X 3ANQA 4HYSA 1ZOEA 3MI9A 3BIZA 2BTSA 3Q5ZA 2WQEA 4OR5A 2X6DA 2YLFA 4FGRA 3OUNB 1JSUA 2JDVA 4HNFA 3PYYA 1V0OA 2YM5A 3PDTA 4F9AA 3ZUUA 2BRGA 4YZDA 3RHXA 2UZUE 2YJSA 5IG1A 4IJPA 3R8LA 3OTVA 4ZTNA 1Y8GA 3TV6A 2YISA 4ZJJA 3HRCA 4D9UA 1KV1A 4IB0A 4GJ3A 4PMSA 4M69A 4XNEA 4DCEA 3S0OA 4GT4A 5E90A 3OW3A 4QMQA 2YM8A 4TYEA 4DH8A 2I1MA 4EZ5A 1K2PA 2REIA 4I94A 2QCSA 5AP1A 4K6ZA 1PF8A 5AR7A 3F2AA 2Y0AA 4LUDA 3OC1A 4LRKA 4AN3A 2YDJA 2ZV8A 3HP2A 2O8YA 4YR8A 3OF0A 4UX9A 1WBOA 1KE6A 3PA3A 1PMEA 3OVVA 4E73A 3RPVA 1Q4LA 4D5HA 2UZDA 4KRCA 3HDMA 4WO5A 2PSQA 1TQPA 4CFMA 3K3JA 2HZNA 4F0IA 2JBOA 1VYWA 2R0UA 3BYSA 2X81A 5DE2A 2HW6A 2ZV9A 4Y46A 4HYHA 4FV9A 3VRYA 3ORXA 2A2AA 3ULZA 3CY2A 2CJMA 3E8EA 3VULA 4EOMA 2BR1A 5LWMA 2C3LA 1JWHA 1YXSA 3NR9A 5FTOA 1CKPA 4AZVA 2IVVA 1KWPA 4RIXB 4AQCA 4E4NA 4C33A 2J90A 4M67A 5C4KA 4J97A 3AMYA 4DC2A 4R5SA 4H39A 4CT2A 3TUBA 3PVBA 5KMIA 4L3PA 3SVVA 4IX5A 4CKJA 1WBNA 2BKZA 2ZMDA 4J98A 4EHEA 4DTAA 5JFVA 3R73A 3LE6A 3P23A 4P5ZA 3CXWA 4ZY6A 2CMWA 3ZO1A 1NVQA 5AUWA 3VJNA 3DS6A 4QOXA 3K5VA 2B1PA 1BL6A 3QRJA 5CAQA 3PWYA 3FL5A 4PF4A 2R3HA 5HHWA 1I09A 2CDZA 5J9YA 3HMMA 3G6HA 4BFMA 2B53A 4C4JA 2YDKA 2WKMA 5CQUA 5IH6A 2YWVA 4QMLA 5BMSA 4OAVB 2VRXA 1B39A 2WU7A 3Q6UA 5ICPA 2UW5A 3SDJA 2R2PA 3O0GA 1LUFA 4O7SA 4KAOA 2Z02A 4H05A 4AW2A 4PUZA 4EI4A 4J95A 4C3FA 5HO6A 2VTMA 2W4JA 5EQYA 1L3RE 5L8JA 3V5QA 3WARA 4PTGA 4A07A 2XIXA 4IJ9A 4QYEA 5DN3A 3UMXA 5HU9A 1YOLA 4CFWA 5J8IA 4U43A 4O7RA 1A9UA 1BI7A 4GT3A 3RALA 2W1ZA 3LQ8A 4LM5A 1ZLTA 1FQ1B 4G34A 5HE0A 3D5VA 5AX3A 4RIWA 2GMXA 3F2NA 4L8MA 4EBVA 2VN9A 4NU1A 3PSBA 1KE9A 4FKPA 3BYMA 2BZJA 1YQJA 2PVFA 2PVJA 4WA9A 4GT5A 4NK9A 4BIBA 4B0GA 3EIDA 2H6DA 5CSHA 2JGZA 4E4LA 4IEBA 4DG2E 4YJPA 2HELA 4LFIA 3MFRA 5D11A 4JT3A 5BVWA 3RK7A 4S31A 2C6KA 2XKCA 4XLVA 3WIKA 1PXKA 3ZZWA 4YU2A 3NUXA 3LXNA 3DV3A 2XNNA 3GB2A 4NT4A 3SG8A 3H0ZA 3AD5A 4LL5A 4TTHB 2GCDA 1H1RA 3VS2A 3WZJA 5L2SA 2F7ZE 4XUFA 5F9EA 4P90A 5EK7A 3V6SA 3SA0A 3R7VA 2X8EA 3OWLA 2HCKA 4HOKA 4JG7A 4JBPA 4UMQA 4BCFA 5G6VA 2BMCA 4XLIA 3ULIA 1OL7A 4FZFB 4MKCA 4PPCA 3QRIA 4H1JA 1KUTA 4CZUA 3O7LD 4CXAA 3ZFXA 2XK7A 3OS3A 1ZXEA 2VO6A 3QX2A 4X3FA 4ZXTA 4CSVA 2XYNA 1O6YA 4EH2A 5IU2A 4AT4A 3CR0A 4BCMA 3OWPA 5IZFA 5L2WA 3LFSA 4KIOA 3RWQA 5HX8A 4FKTA 4DHFA 2WMQA 3SG9A 4YZBA 4XG3A 4ZJIA 4FV6A 4BVUA 4E20A 5HBHA 2JC6A 2UVZA 3ENMA 1M14A 3IECA 3OHTA 4YO4A 2JLDA 4I0SA 4DEHA 1YKRA 5AWMA 5IH5A 2W05A 3MH0A 3GEQA 1LEWA 3OFMA 4G5PA 4CTCA 4F6SA 1Y6BA 3UP7A 5BUIA 3HP5A 2JDOA 4PX6A 4Q9ZA 4FVPA 2VAGA 1FPUA 4JAIA 3VN9A 4ASDA 4XBRA 4FIJA 3AGLA 5K3YA 2W9FB 2W9ZB 3F82A 1Q62A 4J71A 1YI6A 3JVSA 2VWYA 4TNBA 2AC3A 2R3RA 3ERKA 3UC4A 3LVPA 5DVRA 4K1BA 5D41A 4FL2A 3PJCA 3UOKA 5ANGA 3DK3A 4KS7A 4FIEA 3BU5A 4J7BA 3MWUA 3HV7A 3A62A 2R3OA 5E8XA 3QU0A 3BYOA 3LLTA 2BDWA 3FKOA 2ITPA 3FMNA 3AC1A 2QOKA 3C50A 3FQHA 3WZEA 1G3NA 4S32A 4L45A 2Z60A 3UTOA 1QPCA 5K5XA 3FPQA 2X7OA 5J95A 1SVHA 5CY3A 4EOKA 1PXLA 1T46A 5AAEA 3R9HA 2ERZE 4PP9A 2WB8A 5EHYA 3WE4A 2XIZA 5E8YA 4FA2A 3BLRA 4TN6A 4PMTA 4BWPA 4X2GA 3ZZEA 2HXLA 4APCA 3ZLXA 1R3CA 4YLLA 4CNHA 4NKSA 3EQHA 3Q4CA 3LPBA 2BILB 3HVCA 4FSQA 3A61A 4QQ5A 5TR6A 3W2PA 3D5XA 3OY3A 2QOBA 3UO6A 4A9TA 3MS9A 4KSPA 4ANNA 2R3IA 4OT6A 3NWWA 4FTLA 5F94A 5IQEA 3U55A 3E5AA 3Q9XA 3QUEA 2GS7A 3NX8A 4FT7A 3RI1A 5EDPA 3FKLA 4QP9A 2GQRA 4F1OA 3JYAA 1RJBA 2WQBA 5AP5A 2XNGA 4ZOGA 2GNFA 3RTPA 1F5QA 3ZUTA 4CYJA 4DEBA 5M4UA 3V51A 4HZSA 3K54A 4FV2A 3VHKA 4C2WA 5J1VA 3KB7A 5TOZA 4D2TA 4AZWA 3Q9ZA 1YRPA 2DWBA 5CF6A 4QMPA 4EHZA 1H0VA 1JKKA 3FJQE 3PXYA 4G3CA 2DYLA 3VS0A 2UW9A 2QVSE 4V05A 3QQUA 3NUSA 2Z7SA 1PMUA 1FGKA 2P0CA 5ITAA 4G1WA 2ZM3A 3MV5A 3NNVA 3MY5A 4FBXA 3ORMA 5LOHA 2WMRA 5DI1A 4XJ0A 5FGKA 3VS1A 3HA8A 3ET7A 2IZRA 3R1NA 4FKVA 2BRNA 4XX9A 2WD1A 4C0TA 4CZYB 4CG9A 5BYZA 3D5UA 3PSCA 3CS9A 1F3MC 3KVWA 4M97A 1YI4A 3PZHA 5FM2A 4M0ZA 4AE6A 5FD2A 4DH1A 2WTWA 1S9IA 5KBRA 2HYYA 4AW1A 3DZOA 1Q8TA 1V0BA 5CEIA 4C37A 3S4QA 3T8OA 4BHZA 5DA3A 5I3RA 2Y4IC 4UWYA 1QPDA 5IUGA 3MA3A 4G5JA 5AUXA 4F7JA 5IH4A 3ANRA 3OWJA 4W8DA 3VJOA 4OTPA 4BI1A 5AFVA 4FV4A 4U81A 1SYKA 1SZMA 1UNHA 3EH9A 3EL8A 4RGJA 2B7AA 4BICA 2RGPA 5CF5A 1OVEA 4FKQA 2OJIA 3KA0A 4FL1A 4XG9A 3EHAA 4EHGA 4X7QA 3E8CA 5DGZA 2BKKA 2X2MA 3GVUA 2VV9A 1J3HA 1XR1A 3KVXA 4U41A 5BVEA 5CSWA 3II5A 3NUPA 4ZMEA 4FK3A 2RF9A 5H8GA 4TYGA 1S9JA 3Q4TA 3VS6A 1H0WA 3KRXA 2V55A 5ANOA 5CF8A 4IVBA 1AGWA 5FDXA 4EH8A 3VHEA 3VUTA 3VRZA 4MX9A 4FV5A 2LGCA 1R1WA 5E7RA 2ZV7A 1U5QA 4WRSA 2IVTA 3GCUA 3SRVB 5KMOA 1Q8YA 4NW5A 3SXFA 4XH6A 2WOTA 2BAKA 2EXCX 2J7TA 2BTRA 4QQCA 3H9RA 3SRVA 3P0MA 3D4QA 3E92A 3D2KA 4D9TA 4MQ1A 3ZXTA 1H08A 4BIEA 4C4EA 1U4DA 5LWNA 3F2RA 1OPKA 4L46A 2Y6MA 4ERKA 3LCSA 5JKGA 5ETFA 3TTIA 3HMNA 3QGWA 3TCPA 5TT7A 4NJ3A 5BVDA 1NVRA 4OLIA 3VUKA 4MNFA 1L8TA 5DMZA 3DU8A 4Z7GA 3W33A 3AGMA 4RMZA 2HAKA 4HZRA 3G0EA 3FMJA 3FLNC 4ID7A 2J0MB 4IWOA 4JRVA 2W06A 2W96B 3AC5A 1NXKA 1XBCA 4A4XA 3BWJA 3CPBA 3VAPA 2BALA 3DB8A 4EOJA 4R3PA 2VX3A 4FG7A 2QLQA 2B9IA 3PE2A 2JBPA 3DJ6A 2IZUA 2VWBA 3U4UA 2ZM1A 1MRYA 3MDYA 4JIAA 1M7QA 4S33A 4AUAA 4BCQA 4YPSA 4EJ7A 4JLCA 3DK6A 3WYXA 5LVLA 3OOMA 4NIFB 4TNDA 4AE9A 4YLKA 4LI5A 4ZSGA 4N70A 4NIFA 5IA0A 2I0VA 3O17A 5AR4A 3RWPA 3R83A 3DBEA 2BFXA 2UZEA 2KULA 3FZSA 3QD0A 4MVFA 4FSYA 2ITZA 4AOTA 5AIKA 3L8XA 3IKAA 3JUHA 2W1HA 4WHZA 4AACA 5JQ5A 1G8SA 2UVXA 4HCUA 4W4VA 4YJQA 4X21A 4R3RA 1FMOE 2E9NA 2WFYA 3F3WA 5JRSA 2WZJA 1VYZA 4O0TA 3LFFA 5EI6A 5KMKA 4F6WA 2JITA 3FMHA 4TL0A 3FAAA 4IAIA 1WBWA 3KMUA 5CT7A 5HBEA 3MFTA 4KBKA 3E87A 2VTSA 4TWPA 5L6PA 4J96A 3C4WA 2QI8A 1ZY4A 3CTJA 2PWLA 4RA4A 4GS6A 5B2KA 2R0IA 4N6YA 1NVSA 4IANA 1Q97A 4YC6A 2W5BA 1T45A 3O8PA 5DR2A 4ZJVA 5HBJA 2ACXA 4PDOA 4PDPA 3TXOA 5J9LA 3R9DA 4U80A 4XG2A 4YSMA 4I0RA 5IA3A 3ZCLA 4LOOA 4XEYA 5CXZA 3BRBA 5BYLA 3CKWA 2WTJA 3R7OA 1PRYA 4KBAA 2ITYA 2GHGA 5T3QA 3V5PA 4NL0A 5AUVA 3MH2A 4QMYA 4EEVA 4XMOA 4O7NA 2Y6OA 3FZRA 3G0FA 3BGZA 1PXNA 4QNAA 5DT4A 4AF3A 3R9OA 5IEVA 3BHUA 5LVNA 3DA6A 5FBNC 4F9CA 3WIGA 3TKHA 4BY9E 3H30A 4R6VA 4QO9A 1ZYDA 2RSVA 4FTQA 2HZIA 4NTSA 4WUAA 4AOIA 5E4HA 3AC2A 2YABA 2YZLA 2UW0A 5LVPA 4G6OA 3PA5A 5AV2A 3UZPA 5JFWA 4BTMA 1UU8A 2IZSA 2Q83A 4K8AA 4LV5A 2VWWA 4TY1A 4BGQA 2PTKA 2XK3A 3DQWA 3ORNA 2VNYA 3K2LA 3DJ5A 4AX8A 4O0UA 4U97A 4YZMA 5HNBA 3R1QA 4O0WA 4RIYA 5CSPA 3CY3A 4MXZA 4UEUA 5M53A 5EM8A 4N57A 4ORKA 3O23A 3UODA 3ZC6A 4EK4A 2YITA 5C8NA 1YWNA 4YC8A 2C5XA 3UIBA 5HD7A 3FL4A 2BZHB 5E1EA 3S00A 3KGAA 4YGAA 4IZ5A 5ANEA 2WU6A 2QU5A 5A4QA 5AR8A 2PE2A 1P14A 4TYIA 4FE2A 4G9CA 2I40A 3RPOA 3UPXA 4DYMA 3DDPA 2EUFB 3FZTA 1UNLA 3BEAA 5EQPA 2W1IA 3HLLA 4RLLA 5JZJA 4NJDA 3L9LA 3I5ZA 4R1VA 4C3PA 4ACMA 4CT1A 4X2NA 2A27A 2UZOA 3W8QA 1E1VA 2OSCA 4BDKA 3TDVA 2EU9A 3DKFA 5AP2A 3QTXA 2UZBA 2C6MA 4Y8DA 5J87A 4YJVA 5A14A 5JGDA 4GUBA 3DTWA 5FXSA 5ACBC 2YLEA 3OW4A 3P7CA 4C3RA 2QOQA 4K11A 3TJCA 4JOAA 4LV8A 3MB7A 3BU6A 5IUIA 2ITOA 4Y95A 5ETAA 4N4SA 2QLUA 2XK9A 1J91A 1GY3A 2YCQA 3FSFA 1MRUA 3SV0A 5GJGA 3BV2A 4YJNA 5CX9A 5D12A 1GZ8A 1GZKA 3R30A 3AMBA 3EN9A 4D2SA 2CKQA 2C6TA 2O0UA 5DNRA 3F3UA 4G3EA 2O3PA 2Z2WA 4MHAA 5E8VA 4FTNA 3A4OX 3ALNA 3LFNA 5AADA 4D4YA 4L7FA 4M15A 5AP0A 1LEZA 1OM1A 2ZB0A 3OMVA 3DAEA 3H4JA 1ZOGA 5TKDA 2YHVA 1V0PA 2QKWB 4FKRA 3Q2MA 1LR4A 1ZYCA 2XJ1A 4IMYA 4RC3A 1PXJA 2CKEA 3DBDA 2FUMA 3LXPA 4KNBA 3TIYA 3V04A 2Y9QA 4BTJA 4EH9A 5HGIA 3FEGA 4RX7A 2BDJA 1JKLA 3REPA 3Q53A 4CG8A 4NM0A 5D7VA 5FP6A 5C4LA 2X9EA 3EFKA 5LARA 2GQSA 4M0YA 5CEOA 3E3BX 5LMBA 4RFYA 2JKQA 4YJRA 1QPJA 5EG3A 1PJKA 1UVRA 3VW6A 5JGBA 4RT7A 4QMZA 4ZTRA 2JDRA 3JXWA 1JBPE 5DWRA 2IO6A 4I5HA 3A8XA 3TDWA 4F70A 4QMVA 4A4LA 3LQ5A 5F4NA 4MCVA 4ENXA 2BIYA 1MUOA 2C6IA 3DZQA 3MJ1A 3OP5A 4UYNA 1UA2A 3HYHA 3IW5A 1W0XC 1K9AA 2EXEA 4QP3A 4QYFA 4X0MA 5CVGA 2OXYA 3VS3A 2XM8A 4D2WA 3BZ3A 4YZ9A 1CMKE 5BUEA 3KMMA 5EHLA 2IJMA 4O1OA 3CKXA 2VWVA 3OEFX 3QKLA 2ONLA 4O7VA 5FM3A 2WMVA 3F66A 3BX5A 4C4HA 2QO7A 3FQEA 2BUJA 3CJGA 5E8TA 2YCSA 2R3GA 2W1GA 4AT3A 1JQHA 5J1WA 2XA4A 3KXNA 3C9WA 5B2LA 4FV0A 4ACCA 1HCKA 1TQMA 3PPKA 4U3YA 2CLXA 3RM6A 4BDFA 4D55A 4O82A 5FTGA 4E5AX 4FKOA 4F0FA 3A7IA 4LGDA 1R0EA 2RG6A 1YOMA 3ZTXA 3KC3A 4C35A 2VX1A 1Y8YA 2E9OA 3KULA 5CEMA 2YCFA 5CSVA 4DEAA 4F6UA 4QQTA 4YSJA 4MQ2A 4PP7A 4EJNA 4X2FA 4PMMA 5B0XA 5KE0A 1Q3WA 1W7HA 2UW8A 4L42A 3MJ2A 5ANIA 4YLJA 2GHMA 4BTFA 3SC1A 3O2MA 3Q9YA 1ZYLA 3R21A 3O96A 3S95A 3P5KA 5L8LA 5LJJA 4MBJA 3TG1A 2FSOX 4H36A 4D1XA 5HIEA 2E9VA 4JDJA 3TJDA 3AD4A 3R28A 4YJUA 2JAMA 4EKLA 4XHKB 4GH2A 4U0IA 4RRVA 2XF0A 2ITTA 2J0IA 5G1XA 5M44A 5EDQA 3R7GA 5CAVA 3ZS5A 3PY0A 3U9CA 3K5UA 3TNHA 3ZLSA 5EYKA 3V5TA 5K5NA 2PVHA 4TYJA 4UXLA 3GQLA 3DQXA 1FINA 1OB3A 4M66A 5K4JA 2P55A 3LXKA 2E2BA 3VUMA 4C4GA 4IWDA 3PIZA 3ZBFA 1PMNA 1H24A 2W5HA 2VWXA 5J7HA 4WG5A 3HAVA 3EKKA 4DEDA 4OTGA 5IUHA 5JEBA 1ZMWA 1SNXA 5HG7A 2V62A 5HNGA 1GIIA 4JBQA 3AC8A 3G33A 4TRLA 4K2RA 3ZSGA 4NYEA 3DLSA 2XP2A 3U8WA 2A4LA 5C9CA 2UZWE 2C3KA 5HIDA 3AT2A 3UGCA 2W7XA 2Q0BA 2CCHA 2IZTA 4AA4A 2I7QA 3OCSA 2C30A 2UV2A 4KIQA 2OZAB 3L8PA 2I0EA 3I7CA 2UW3A 4JDHA 5HORA 5IDPA 1W83A 3T3UA 3LCTA 2PL0A 1KOBA 4XP3A 2FO0A 3QAME 4IAYA 3SHEA 4BC6A 1CTPE 4BBMA 2B4SB 2V22A 4LUEA 3FLSA 3SQQA 4RJ4A 3NEWA 2PVNA 4KINA 4TW9A 5DBXA 2QOOA 4RJ3A 2F7EE 2BRMA 2VTTA 4JXFA 3TKUA 2ETRA 3MW1A 3Q9WA 4BKZA 4U44A 3F88A 1VJYA 4FTAA 2B9JA 5I9UA 4BI2A 3LFCA 5HTIA 4O7YA 5HU3A 3F6XA 4YUQA 2ERKA 3R04A 4RC4A 3IG7A 4W4YA 5D9HA 2H9VA 2FSTX 2QU6A 4Y83A 2PUPA 4Q2AA 2Y4IB 4CV9A 2XRWA 4O2ZA 3AQVA 5I9VA 3QTSA 5C8MA 2GHLA 2X39A 2OH4A 1ZYJA 3NYVA 1OKWA 4ZSEA 5HICA 2XJ2A 4NKAA 1OBGA 3W18A 2HXQA 4GU9A 4CEGA 3GCPA 4A4OA 3GOPA 3VBVA 3EYGA 3FLQA 3SX9A 4XG6A 2C5NA 3E63A 2PUIA 4I24A 3R02A 4PL4A 1PXMA 4FG9A 4CV8A 5A4CA 3RAIA 4RIXA 4BIDA 3KXXA 4B6LA 4Y72A 3FE3A 4D4RA 1CM8A 3ZBXA 1YXVA 2O5KA 3BELA 2WQMA 3OWKA 4OW8A 2CLQA 2CGUA 2C5VA 1APME 2EVAA 2WMWA 3QZIA 4FKUA 3Q04A 4GIHA 3RPYA 4YURA 4LGGA 3SOCA 4LOQA 3QTIA 3V3VA 4JR3A 5HNIX 5GIOE 2PHKA 3ORPA 3HDNA 2QO9A 1Y91A 3B8RA 3HL7A 4MXXA 2UVYA 2YEXA 4YNEA 3DKGA 3Q96A 5IDNA 2WMAA 3LKMA 1IA9A 4UMRA 3ZHPC 3GU8A 4GYGA 3HGKA 2ITUA 5HG8A 1QCFA 4NTTA 2YJRA 5HCZA 1J7UA 4EUTA 3EL7A 2X8DA 3RGFA 1U46A 2JDTA 4UN0C 2X7GA 3IDCA 1M2QA 4D1ZA 3F5UA 4KKEA 2C0IA 2HY81 1SVGA 2IVSA 1P5EA 1URWA 3B8QA 4LYNA 3SKCA 5BX0A 2QG5A 3FXWA 3FUPA 4FKLA 4QYGA 4XCUA 2O65A 1DM2A 4FNZA 4FSMA 3IONA 2JEDA 2OK1A 2V0DA 4IVAA 4L67A 3SOAA 4ZS4A 2I0YA 3PPJA 3I1AA 2QQ7A 1RDQE 4AFEA 3UQFA 4KRDA 4HVGA 3JPVA 4ZP5A 5A3XA 4BF2A 1JOWB 4C38A 3PVWA 3DB6A 3DFAA 4O0RA 3UNJA 4MH7A 3UZRA 1W82A 1OL2A 3TV4A 3KREA 1J1BA 4JQ7A 2GNIA 2H96A 4ZIMA 4D1SA 3ATSA 4BDGA 2CGXA 2G2FA 3QD3A 4MEDA 3CCNA 5EW9A 2IPXA 4ZLZA 5IPJA 3ENHA 3O8TA 3QD2B 1M7NA 5FEDA 4WG4A 2Q0NA 2W1EA 4NSTA 5J9ZA 3W1FA 4ASEA 3GU6A 3FSKA 4EOSA 4IH8A 5LMKA 4DEEA 4CKRA 1O6KA 3ZONA 3CGOA 5CT0A 2WHBA 5I9ZA 3NRMA 4O91A 5DEYA 5BPYA 4IX4A 2J2IB 3FDNA 3C1XA 5E8UA 2BVAA 5M56A 2HW7A 5EW3A 3KRLA 3ZU7A 5IMEA 3NYNA 3EQCA 2P2IA 3MFUA 4FVQA 5CI7A 3F5PA 1G5SA 4G6NA 4M14A 3JY9A 5FTQA 4F1MA 2R3PA 3EN7A 3TI1A 4LMNA 2VTHA 5I3OA 2XKFA 1H25A 3PIYA 2OBJA 3HRBA 4RSSA 3TL8A 4D2PA 2GTMA 1YWRA 5L3AA 4U9AA 4W9XA 5I9YA 3EJ1A 3S2PA 4CYIA 1Q8WA 4Z16A 1FOTA 4IB3A 5GINE 2R3QA 4GIIA 4JDKA 2XNBA 3QGYA 1PXOA 1UU9A 3SLSA 4MYGA 3VBYA 4AFJA 3R2BA 1EH4A 3HAMA 2ZV2A 3GCSA 2WQOA 4BL1A 5EM5A 2GFCA 4QP4A 3IS5A 1RW8A 4EOPA 3U6IA 2PVMA 3V5JA 5CVHA 3BLQA 5AP7A 4WRGA 4Y73A 4FZDB 5AA8A 2XS0A 4A9UA 1VEBA 5IQIA 3QD4A 5CNOA 4USFA 4ALWA 3PG1A 4FZAB 4L44A 1IAHA 2XNMA 1WBPA 4USDA 4EH6A 1TQIA 4FT5A 1K3AA 4YMJA 2GS6A 1BLXA 4DFXE 3E88A 4FEWA 4OAUC 4NM5A 4B7TA 4F09A 3RK5A 4BDBA 3BI6A 5IQFA 2HOGA 2QURA 4L3LA 5F1ZA 3ORIA 3UQGA 3SW7A 4RJ5A 1WFCA 4CRLA 1H28A 1CDKA 1KE7A 3CEKA 3BE9A 3SD0A 4JRNA 4EL9A 1GJOA 4C7TA 3PG3A 4ZZMA 4YTIA 5GJFA 5M55A 2OJ9A 4ZTHA 5KCVA 4QRCA 4CLJA 4NCTC 5AIRA 3M11A 1ZWSA 1WBTA 2GS2A 2YCRA 3I6UA 3LFQA 4JBOA 4ZTLA 5EQEA 3IDBA 4EUUA 3POZA 2C0TA 1YOJA 4R5YA 1BX6A 5LCJA 5CLPA 3MY1A 5E92A 2XK6A 2UW6A 5HZNA 3VIDA 2OXXA 4M8TA 3UIMA 3QHWA 3LJ2A 1PKGA 2VD5A 3COKA 3PP1A 5BVFA 2WIHA 2XB7A 4U3ZA 5EM6A 2EXMA 2VTLA 4L52A 3VUGA 3ZDIA 1ZMUA 3PP0A 4RX9A 4HVIA 2QKRA 2WOUA 1MP8A 5GZAA 5AUZA 3LXLA 2A1AB 4GUEA 5K0KA 3S1HA 2C3IB 3LZBA 4EOLA 4TPTA 4OUCA 1LP4A 2XMYA 5DG5A 3R7IA 5JMSA 2YM4A 2GNJA 4F99A 4A06A 3R01A 3NUAA 2ZOQA 4TWOA 3R2YA 2IWIA 4HJOA 5CZIA 1P4OA 4R1YA 3ZRMA 4Y5QA 4UMTA 3LQ3A 4MD9E 2CPKE 3LW0A 3FLZA 4D5KA 4RJ6A 2PMIA 1OITA 1YHWA 4XG7A 4XBUA 5EYMA 3WYYA 5LXMA 1IR3A 5EYCA 1JKSA 4TWCA 1XQZA 4NW6A 4I4FA 3EQRA 3FZ1A 5M4FA 4XOZA 4Q5EA 3R8PA 2GTNA 1IASA 2PZ5A 3O8UA 3WF9A 1BYGA 1SM2A 2I0HA 3DAKA 3C4CA 3C4EA 3PIXA 3MTLA 3Q60A 4FKWA 2W1DA 4FSWA 1W84A 1Q8ZA 3D2IA 4EK8A 5HO7A 4YTCA 5K0XA 3Q6WA 5FEQA 1KE8A 4B8MA 3PLSA 4ENYA 3PRFA 2WIPA 3N4TA 1O6LA 2XCKA 4NZWB 4FEVA 4YJSA 4YC3A 3QRTA 3U9NA 2XNOA 4FTCA 4FYOA 4RWIA 3LLAA 5FXQA 3MH1A 4D0WA 1QPEA 4QNYA 4O7ZA 1DS5A 1WVXA 2O2UA 4F64A 4GFOA 5HVKA 3KMWA 4KUJA 4KIKB 4QYYA 4H3QA 5AM6A 5C01A 5CWZA 3F69A 4C62A 3BPRA 3UNZA 1RE8A 3FBVA 3FI2A 3MY0A 2JIIA 3AT4A 4K18A 4CGAA 2CNQA 5HX6A 4G31A 2CKPA 3R8ZA 4BYJA 3F5XA 4GKIA 5H8EA 1IG1A 3S3IA 3FI3A 5AM7A 4EQUA 4RA5A 2YWPA 3DFCB 3BU3A 3WBLA 3KN5A 5CVFA 3OCTA 4DCAA 3BE2A 3NPCA 2WTVA 4AG8A 3ZLWA 2KTYA 2GFSA 4DTKA 4Z3VA 4B99A 3LM5A 4KKGA 2A19B 3TV7A 1GIJA 3GXLA 3D7TB 1XH9A 1XH4A 3W2SA 3DXQA 2C6DA 2C6OA 3KCFA 1PMVA 2XVDA 3D7TA 3QQGA 5TF9A 4JQ8A 3HV4A 3MGYA 4XP2A 3CE3A 2IW8A 3GU4A 3I6WA 3M1SA 3R71A 3MPTA 5HG9A 2RFNA 3IQ7A 4IC8A 3QUPA 3LFEA 3V8TA 5HD4A 4I5CA 4C02A 2P33A 1H07A 1RQQA 3U4WA 4IM2A 4BWKA 4ZY5A 2WEVA 2W4OA 4FSUA 4I3ZA 3BV3A 1OUKA 2G01A 3T9IA 3HNGA 3D94A 1F0QA 4B9DA 3QA8A 3P9JA 3LHJA 5HTCA 3ORTA 4G17A 4WNMA 1OIRA 3RCDA 3P7AA 3B2WA 3D9VA 3WF5A 1UKIA 2B9HA 3P1AA 3UO4A 5I5ZA 5AX9A 4PDYA 3MIAA 3QWJA 2CGVA 4YHFA 3RZFA 4WUNA 5IF1A 3FI8A 4FEUA 3PLAE 4CMTA 3QX4A 4UWBA 5ANDA 4B8LA 1JLUE 2HZ4A 2PY3A 4AZSA 3NUUA 2WTCA 4H1MA 4QMMA 3E62A 3OCBA 3G9NA 2OXDA 2WMUA 3BYUA 4HW7A 2UW7A 3ZSHA 5CEKA 4O86A 4U5JA 4AZEA 4BZOA 3KQ7A 2JDSA 4GK4A 5F95A 4C4IA 4K9YA 1ERKA 5ETCA 4DH5A 4I6FA 4AA0A 4FICA 2RG5A 4CCBA 3HUCA 4EONA 2PE1A 4O7LA 4R7IA 4ANOA 4WNOA 3OROA 4FTOA 3PA4A 4O0YA 3WF8A 3FWQA 3TUCA 3POOA 3BHVA 2QHMA 5GIPE 1OI9A 5CU6A 4F1TA 1WVWA 3FC1X 2X7FA 1JKTA 4FODA 5AR2A 2OW3A 5IA2A 4ZSLA 4E6CA 3DCVA 4GVJA 4L53A 5K9IA 2P4IA 4HYIA 1QMZA 3PJ2A 1ZOHA 4MF0A 2ZM4A 5CENA 3PXQA 4IIRA 3UP2A 4AZTA 4ZZNA 4CLIA 4MK0A 2BFYA 5CQWA 2JAVA 4LRJA 3QKKA 5JQ8A 2X6EA 4JG6A 4RWLA 3RNIA 4ZMFA 4AW5A 2VTRA 3H9FA 3IDPA 3G5DA 3F7WA 3IW4A 3K3IA 4AW0A 4AXAA 3WZUA 4MWIA 4FT3A 4DEIA 3R9RA 1ZRZA 5H8BA 2PE0A 4O38A 2LAVA 4ARKA 5EI8A 3VS4A 4EH5A 4CFNA 4FSZA 3UOLA 2FVDA 2QODA 3O71A 2C0OA 2XKDA 3EFWA 3PJ8A 2QNJA 4ITJA 1Q61A 1UWJA 2BROA 3QCSA 4C8BA 4E8AA 5AV4A 2P3GX 4IB1A 2CNUA 3VUDA 2WTKC 4DEGA 4E6QA 3UPZA 3NZ0A 1P2AA 4IDTA 2J4ZA 4QTEA 1XH6A 3UOHA 4DN5A 3U6HA 4GU6A 5C8KA 2J51A 2OZOA 5HCYA 4XRLA 3W16A 2XEYA 4TXCA 2W99B 5CSXA 3UNKA 1M2RA 1KSWA 4WKQA 3DKOA 3OXTA 1JSTA 4FKJA 5HO8A 3PVUA 2WXVA 2GNLA 5CS6A 2SRCA 5ANKA 2WGJA 2VNWA 3DPKA 4GK3A 3RP9A 1UNGA 2R3MA 4BDEA 5C1QB 1A06A 2PUNA 3BGPA 3MIYA 3PXRA 4FYNA 5FG8A 3ZMMA 3ROYA 2IG7A 3ZLYA 2G2HA 4NM3A 4ZSJA 3VO3A 3GNIB 3FV8A 3ZRKA 3TNPC 2ITNA 3C51A 3FLWA 3CIKA 4JL9A 4GEOA 4X3FC 3F3ZA 3DGKA 2E9UA 4FX3A 5FQDC 3VVHA 3W10A 4F7NA 4K0YA 3CGFA 4FV7A 5DT0A 2WPAA 4HVSA 2OJGA 5GJDA 5M4CA 2EB3A 5BQ0A 3TNIA 4AU8A 5HKMA 3D83A 5CYIA 4RWKA 4AGDA 5M51A 5FUTA 3RMFA 5M4IA 4FTMA 4IB5A 3AXWA 3BBWA 4P4CA 4QMTA 2VTOA 3DOGA 4ZZOA 2VTJA 4D4VA 2YM3A 4DT8A 3F3TA 3AD6A 1WZYA 3W2RA 3LJ1A 4ACHA 1ATPE 3WF6A 4JVGA 2NO3A 3TN8A 5J7BA 3ORZA 3TT0A 5HOAA 4DBXA 4S2ZA 4FT9A 3JY0A 4QTCA 4EOOA 5IEXA 1PHKA 2V7AA 3C0GA 4F63A 3RM7A 3NGAA 3QRKA 1PXPA 4I23A 3ZFYA 3QLGA 4HCVA 3ZO3A 4BHNA 3OXIA 4DGNA 2BAJA 3VNTA 2OLCA 3UDBA 4XRJA 4HYUA 2C1BA 2UW4A 4QTBA 5A4LA 1AQ1A 4RIOA 4BZDA 4HVDA 3QCXA 5CU4A 5IISA 2UZTA 5IEYA 3AC4A 3QQKA 2JIVA 1W98A 1OL1A 3F5GA 3FZOA 4IQ6A 3CQUA 1E1XA 3R0TA 3EN4A 3N51A 4BWXA 4O83A 4JBVA 3HMOA 4UZHA 3VC4A 3QZHA 4FKSA 4BBFA 4R8QA 3GFEA 4QMUA 3V8WA 3PXFA 3WZDA 3VUIA 4BYIA 3EB0A 4C58A 3RCJA 5BVOA 3MESA 1XBBA 2C5OA 4FSTA 5LVOA 1GZOA 1H8FA 3DXNA 3O7LB 2WO6A 5CF4A 4V0GB 2OG8A 4YJTA 3NUNA 2PMOX 4V0GA 4I0TA 5DT3A 3MH3A 2AUHA 4FR4A 5DOSA 4RFZA 4JI9A 3FI4A 3R8UA 2JFLA 3GU7A 4IAKA 4WNKA 5EH0A 4E4MA 4HVHA 3ATTA 2PMLX 2JIUA 2X9FA 3QBNA 3VBQA 3NIZA 4UWCA 4X2KA 1OECA 3SGCA 1PYEA 2FB8A 4E6AA 2HY0A 3FMEA 3R7YA 4FTIA 4G9RA 1CKIA 4L7SA 4A7CA 5AAGA 4IWQA 2VO7A 2B9FA 1XJDA 2QR7A 5CZHA 4DGOA 1OKVA 1SMHA 4AN2A 2H34A 2OH0E 4YTHA 3FMKA 4ZSAA 3I4BA 2Z8CA 4BCGA 3WILA 3VUHA 5KMNA 2O63A 4FZ7A 1VR2A 3MVHA 1G8AA 3QC4A 1JSVA 4TZRA 3E8NA 3TACA 5J79A 1GOLA 5K4IA 5FWKK 2VO0A 3F61A 4WOVA 2VO3A 4PL5A 4DFNA 5KHWA 4ANLA 4AGUA 2GU8A 2FSMX 4JIKA 1YW2A 4AZFA 5AP6A 1Z57A 3NAYA 5AJQA 5HE1A 4M7IA 1IRKA 4FIIA 2GDOA 2WEIA 5HE3A 3UVRA 2ESMA 3LJ0A 2ZJWA 3NCGA 4V01A 5GZ9A 5HI2A 1Z5MA 3QTZA 3RPRA 4WNPA 3P4KA 3AT3A 3FPMA 3EQFA 4MAOA 4FTKA 4NCTA 1HCLA 3JS2A 4FTTA 3TTJA 4NFNA 1ZZLA 3QHRA 4DFUA 4ALVA 4XG4A 3QQJA 3VQUA 3ETAA 4WBOA 1FBNA 2C5YA 4GYIA 3C13A 4YZNA 5FEEA 4TWNA 3T9TA 4MBLA 4KD1A 1IEPA 2NRYA 4GW8A 4OTFA 1REJA 4IADA 2JFMA 3V8SA 3A4PA 5HESA 3CBLA 3RPSA 4OT5A 4K77A 2J0KA 4IAZA 3ZXZA 4QQJA 3EFLA 2PZRA 5EI2A 2IW9A 4UMUA 3D5WA 2YACA 2V5QA 4Y85A 3KRJA 4BCJA 2QG7A 1PKDA 3FYKX 5HIBA 3W2CA 3IGOA 5JZNA 2NPQA 1VZOA 5LMAA 4BCNA 3EQGA 3EQIA 3DTCA 4BRXA 4NUSA 4U6RA 4J53A 2R64A 1GNGA 2OO8X 3KF7A 2O64A 4AOJA 3CTQA 1OKZA 4O7WA 3DJ7A 3ZRLA 2WMSA 3W8LA 3LCKA 4EC8A 1YDRE 3E3PA 1MQ4A 1XHAA 4A9YA 4AT5A 4MXYA 2PUUA 4RJ7A 2VTPA 3OG7A 1H1WA 1H01A 5HE2A 2XKEA 4F7SA 4UALA 4FT0A 1H1SA 5KUPA 4R77A 3C4XA 2Y7JA 3C5UA 4DAWA 1V1KA 5I4NA 2QHNA 3I5NA 4WSQA 3NW6A 2VTIA 3M42A 4F9YA 4Q9SA 4PMPA 5DEWA 4EQCA 4L6QA 4BZNA 5EKOA 5I0BA 2XBJA 5CAUA 2VU3A 3MA6A 3Q52A 2ETMA 3HV3A 4U7ZA 2PU8A 4U8ZA 4E93A 1ZARA 3IGGA 3NNUA 3UG2A 1U59A 3FMLA 4NH1A 2PULA 5IQDA 3EYHA 2QOFA 5CALA 1Q5KA 3MFSA 2X8IA 4O0VA 4MF1A 4PTCA 5DRBA 5HVJA 3D0EA 5L2QA 2OZAA 3L8SA 4DFLA 3TM0A 4EYMA 3TNWA 4NEUA 3DAJA 4P2KA 3G90X 5FBOA 3WE8A 4I4EA 4EK3A 2OIBA 2BDFA 4EH7A 3ZYAA 5T68A 3HEGA 4CFXA 2F7XE 2WQNA 3PXZA 5H9BA 5E9EA 4KSQA 3IW6A 2G15A 3AOXA 5L8KA 3OUKA 2PYWA 2RL5A 3R1YA 4JQEA 3ODYX 4E1ZA 2R3NA 3ITZA 3WI6A 4MD7E 2XK8A 3W2OA 4BB4A 4BCHA 4HCTA 4PTEA 4UZDA 4CD0A 4D28A 4XP0A 5IMXA 5H2UA 4CQEA 3OEZA 2XEZA 3QFVA 5C03A 3PJ3A 4O7TA 2W0JA 3E8DA 4I41A 5AUUA 4M69B 5GZ8A 3BEGA 5IQGA 4WD5A 5AV0A 4EYJA 3OTUA 4RX5A 4L01A 4PL3A 5EDRA 3AG9A 2JKMA 3CLYA 2HENA 4KS8A 5DIAA 3RVGA 5A6NA 3QZFA 3R8VA 4GCJA 4YBJA 2EB2A 2R9SA 2X2KA 3L8VA 1OMWA 1MQBA 3NVMB 5CAPA 4DFZE 4IC7A 3SXSA 4YHTA 2YM7A 5KKRC 3C4ZA 3ZH8A 2AYPA 1U5RA 5A6OA 1BUHA 4GV1A 5CXHA 4G3DA 5HVYA 4AP7A 3P86A 4RQKA 3B2TA 3KU2A 1UU7A 2CKOA 2OJFE 3DNDA 4MXCA 2W5AA 2FH9A 3BQCA 4ZS0A 1CKJA 3I81A 4C57A 4E5WA 2CSNA 3FMMA 4U79A 3KY2A 3GC8A 3HKOA 3DBFA 5TE0A 2JKKA 4IZAA 1OIUA 1JNKA 3A7GA 3GFWA 4GVAA 4KWPA 4E4XA 2R7BA 4LRMA 4QD6A 4W4XA 1BMKA 3GT8A 2WELA 5DH3A 1JVPP 3NCZA 3PJ1A 4C36A 4FEXA 3C4FA 1OZ1A 1YHSA 5E91A 2FGIA 2GQGA 4N6ZA 4YP8A 2JD5A 4FEQA 3UYSA 2XIYA 4CTBA 4JJRA 2ITVA 4PDSA 1XKKA 4RX8A 4L9IA 4RFMA 5AP3A 2PVYA 3I79A 5I9XA 3EOCA 5AA9A 4F7LA 5FP5A 1J7IA 4BDIA 2F9GA 3COHA 4BBEA 3GCVA 1B6CB 2RFDA 2FA2A 2XUUA 1PW2A 2YIXA 4UBAA 3LCDA 5CU3A 2ETKA 3QQHA 2XH5A 2WNTA 4MXAA 4RWJA 3PY1A 5IKWA 5KX8A 5ACKA 4ANQA 3LM0A 3UIUA 4O0SA 2YAKA 4QP1A 4DGMA 4MTAA 5I9WA 3W55A 4U45A 3KRRA 2C47A 5LCKA 4GKHA 4PNIA 3ACKA 4RQVA 4C2VA 4I1ZA 3C7QA 4UB7A 3DBQA 3OY1A 2X1NA 3PE1A 2Z7RA 3OBJA 3ORKA 4U42A 2F2CB 2OGVA 3QXPA 4GRBA 4QMOA 5CI6A 5B2MA 5A4TA 5HCXA 2YM6A 4JS8A 5F20A 1UKHA 1YI3A 3QTQA 1STCE 4BN1A 3CD8A 3AC3A 4FZ6A 4TKSA 4J99A 3KXMA 4WBBB 4RIWB 2W17A 3PTGA 4RVKA 4GMYA 1YDTE 2XIRA 3IK3A 5DHJA 2OFUA 2OF4A 4HGEA 3PY3A 4O22A 4M68A 3GGFA 3TZ8A 4ZAUA 3PZEA 5CU0A 3MB6A 3OZ6A 4YBKA 4YJOA 4EK6A 4IX6A 4DFBA 3RINA 1OUYA 2HK5A 2UZVA 3EN6A 4ERWA 2ITQA 5BNJA 3N4VA 5IA5A 4EZ3A 5IQCA 4PY1A 2WTKB 1W8CA 3PWDA 4RLKA 5AV3A 2XZSA 4X3JA 3R6XA 4RVTA 3D7ZA 3ODZX 5KO1A 4EHVA 4CFVA 3BYVA 3DK7A 3P08A 5KNJA 2XRUA 2CNVA 3VF8A 3L9NA 3FLYA 1B38A 3RNYA 3HV5A 3CQEA 4XV3A 3VBWA 3QL8A 3VBXA 3LIJA 4H3BA 4FF8A 5JRQA 2F2UA 3NYXA 4DBNA 4I21A 5EOLA 5CNNA 1XH8A 4OTIA 4OTRA 5ANJA 2Z7QA 3E7VA 3Q4UA 4ZTSA 3UC3A 3KKVA 1LPUA 2VZ6A 3FKNA 3KXGA 3FHIA 2XK4A 3MPMA 2XIKA 4CVAA 1DI8A 4X3FB 4LG4A 5IA1A 3DT1A 2YIWA 4EBWA 4IXPA 4DA5A 3OD6X 4GFMA 4LQMA 2QONA 4J52A 4GL9A 1JPAA 2ITXA 2W4KA 4CMUA 4DH3A 1OBDA 3MYGA 4IAAA 3UYTA 2WMXA 5CASA 3FYJX 2R3KA 2RFEA 3LFDA 1TVOA 4I6HA 2WMTA 4IBMA 4XOYA 4E26A 5LVMA 2ZB1A 4EZ7A 2IW6A 3EQBA 1ZAOA 3P7BA 5DRDA 3NAXA 2X0GA 3ZFMA 2NNWB 3G15A 5M57A 3E93A 1TKIA 4JG8A 3I0OA 2YAAA 3NUYA 3NW5A 1XO2B 4WSYA 2J0LA 2BAQA 3SXRA 1WVYA 4QMWA 5CEPA 2RFSA 5JSMA 2ONLC 4RZWA 1YXXA 1H27A 3R63A 4ZTMA 3BCEA 4FIFA 1SNUA 4FSRA 4I6QA 4YHJA 2WTDA 2PK9A 2CN5A 2FYSA 3R00A 5HG5A 5T6KA 2B0QA 3H10A 2OWBA 4J8NA 4Q5HA 4Y5HA 3O50A 4X6RA 3UOJA 4E6DA 4I22A 2C6LA 3I60A 4LL0A 5L2TA 3G2FA 3I7BA 2X4ZA 4QT1A 3GI3A 3IPHA 3A8WA 4QMXA 5TO8A 4O2PA 2YZAA 1WBVA 4ZLYA 4TT7A 4FNWA 4ACGA 3I0QA 5L6OA 1GIHA 4XV9A 3D15A 4RPVA 4FVRA 3ZSIA 5A54A 3FZPA 4O96A 3NNXA 4PPAA 3FY0A 3EN5A 4D4SA 3BKBA 3RAHA 4DGGA 2A0CX 2VWZA 5BMMA 4H3PA 2XNPA 4FKGA 2J9MA 2I6LA 2Z7LA 3GC9A 3LCOA 4IAFA 5JFSA 4S34A 4O1PA 3MVMA 4OBQA 4APPA 3KXZA 3TNQB 4X2JA 4DFYA 2CN8A 4R7HA 3GQIA 4O6EA 3EKNA 2F57A 4GJ2A 4RVLA 2ZVAA 4FUYA 2BRHA 2ZDTA 3V5LA 4GFGA 4F9BA 3R7EA 5HTBA 4EWQA 1AD5A 5B7VA 4QTAA 3H9OA 1U54B 3ZM4A 4ANBA 5BVKA 4BGHA 3KXHA 4BCIA 4J1RA 4HNIA 1U54A 4AA5A 3ORLA 3L9PA 4DLJA 3QKMA 3CJFA 3IO7A 4NWMA 5FXRA 3UQCA 4M13A 2C4GA 2PVRA 3NS9A 1Q24A 4CKIA 4WT6A 3ROCA 3NYOA 4QP8A 3UMWA 3ZUVA 4IZ7A 3CTHA 1GZNA 1H1QA 3CP9A 4R78A 3R7UA 2VGPA 4FNXA 4LMUA 4TYHB 3VS5A 4L00A 1NT2A 3FXZA 4TYHA 4O21A 3VW8A 3BHYA 2BRBA 3FC2A 4FKIA 1GAGA 4FIGA 4DLIA 3QYWA 3A7JA 4BKYA 4IDVA 1M2PA 2VWUA 4KIKA 3D14A 4XS2A 3ZM9A 4G3FA 3P79A 4O27B 5DR9A 4HGLA 4CQGA 3LAUA 4FNYA 4QMNA 5AR3A 3QRUA 4ZEGA 3DKCA 4ALUA 2PVKA 4NM7A 3QA0A 4WIHA 4P7EA 4D2RA 2NP8A 2ZDUA 4G2FA 4CCUA 3EMGA 3QYZA 3QCQA 3F3VA 1I44A 2YIQA 4FTUA 4XYFA 4GK2A 2BHEA 3OT3A 4ZY4A 2VTNA 4J8MA 3TZ7A 5BUJA 4OTQA 1H26A 3F7ZA 3OCGA 3UG1A 1IAJA 3UE4A 1DAWA 4I92A 2OIDA 5KHXA 2QOHA 4I6BA 3HMPA 4OTHA 5CTPA 4BCPA 2J0JA 2VTQA 4JR7A 1JAMA 1XH5A 2DQ7X 3A60A 4I93A 4JNWA 4XG8A 2OIQA 2B54A 3GCQA 3TKIA 3ACJA 3UVQA 3U6JA 3HV6A 5DYJA 2GPHA 3KK8A 4AGWA 4QPMA 3LFBA 1Q41A 3LMIA 2B55A 4IM3A 1E9HA 2VGOA 1UU3A 1SVEA 3E64A 1XWSA 5C26A 3QLFA 4FV3A 1PY5A 3G6GA 4PV0A 5ETIA 5IQBA 1XH7A 5A46A 4AN9A 4C59A 4RBLA 4W9WA 3COMA 3T3VA 3MTFA 5IA4A 5DFPA 5HLWA 5M09A 4BR3A 3V6RA 3DXPA 2ZMCA 2PPQA 4HPTE 1NW1A 3ZOSA 4EOIA 1FVVA 3LOKA 3SW4A 4FSNA 4DE4A 3GOKA 2CCIA 2ITWA 3L1SA 3QTUA 4O84A 4DTBA 4X6QC 4DG0E 3VWAA 4ONAA 5BVNA 3FY2A 3RAKA 4IHPA 2OU7A 3MN3A 5AUYA 1Q99A 4DINA 3BWFA 2PZYA 4EORA 3RBWA 3V01A 2HWOA 1R39A 3GUBA 3C5IA 4O81A 5M06A 4EKKA 5J5TA 4IW0A 5EW8A 1H1PA 4MNEB 1OL5A 3OT8A 4QYHA 4MNEA 4DT9A 3CQWA 3NNWA 3BLHA 2HZ0A 2XM9A 1FMKA 3BHTA 2IVUA 3KL8A 2VUWA 4BDAA 3LMHA 4FL3A 3TIZA 3FQSA 5FLFA 5EFQA 3C0HA 1DAYA 1H00A 2E9PA 3EZRA 4IVCA 4JX7A 4UYAA 4F65A 1BL7A 1J7LA 3EQDA 4GG7A 4W4WA 4FV1A 5AAFA 5AR5A 1Q8UA 1Z9XA 4IM0A 4EQMA 4F08A 1J1CA 2PZIA 3QTWA 4BDDA 2OJJA 4D0XA 1IA8A 3PPZA 4UY9A 5JK3A 5IQHA 4FIHA 4YO6A 1BI8A 1OGUA 3H0YA 3Q32A 4L3JA 4EH4A 4BCOA 5JN2A 4RG0A 4MD8E 3QXOA 5EHOA 1HOWA 3KFAA 3W32A 1OL6A 2JKOA 5L4QA 4DG3E 3ZO4A 1KV2A 3U51A 1OIYA 4EH3A 3HUBA 3RAWA 1A48A 1NA7A 2ZAZA 1YXUA 4WG3A 4AS0A 4KB8A 1YWVA 3BGQA 2R3LA 5LMKC 5FDPA 3IW8A 4IFGA 5BYYA 4E5BA 3KN6A 3NSZA 2F4JA 4CFFA 2YA9A 4OBOA 1OPJA 2BPMA 5E8SA 2XNEA 4V04A 2J50A 4FTJA 3ZO2A 5KKRB 1ZZ2A 3N9XA 3RZBA 3RK9A 5FRIA 1Q3DA 4M12A 1XBAA 5DPVA 4D58A 5M08A 4O6LA 2AC5A 4QP2A 5D10A 4MXOA 4W8EA 3EQPA 3U87A 2C3JA 5EYDA 1H4LA 2C6EA 3LFAA 1WAKA 1YHVA 2FSLX 4GG5A 4IX3A 1WBSA 2R3JA 4A9RA 5EOBA 5HEZA 1FVRA 4DH7A 5E8ZA 2R7IA 4QMSA 3TUDA 2RIOA 2HIWA 3H3CA 3MSSA 4PQNA 1YDSE 2G9XA 5D1JA 5HLPA 3WF7A 3GENA 4ASZA 4IACA 4ZLOA 3R8MA 2C69A 3PXKA 2QOLA 4FG8A 3HZTA 5AV1A 2YERA 1REKA 3QWKA 4CZTA 3ELJA 4QPAA 2OFVA 4YPDA 3NDMA 3TZ9A 4FV8A 2GNHA 4LOPA 4ACDA 3WZKA 3E7OA 1OKYA 5CANA 4ZTQA 4II5A 4OGRA 4QPSA 2VX0A 5E8WA 4XV1A 1YXTA 4ZK5A 4U40A 4GSBA 4UXQA 4JDIA 2J5FA 3PFQA 2WMBA 3P78A 4G16A 4L68A 4CRSA 1ZMVA 4JAJA 4M3QA 4G6LA 5CEQA 1FVTA 2QD9A 5A9UA 3QC9A 1M17A 2QO2A 2YDIA 3PSDA 1PYXA 3TWJA 3CC6A 4RIYB 4IFCA 3VQHA 4UMPA 1WMKA 4FOCA 4RZVA 3RJCA 3PVGA 4K33A 3N4UA 2EWAA 2C68A 2YIYA 4D2VA 4Z7HA 1MRVA 3GU5A 4RVMA 3PUPA 1KOAA 2XYUA 5L2IA 1UWHA 2R5TA 3QTRA 3CPCA 5KZIA 3THBA 2V7OA 4Z55A 4ANMA 3QQLA 5HQ0A 2F49A 3A2CA 1O9UA 4N0SA 2OF2A 2J5EA 3HRFA 3Q5IA 3NLBA 4M84A 4NFMA 4BDHA 3G9LX 1Y6AA 2B52A 4XV2A 3DDQA 1KE5A 1NY3A 3QZGA 3AMAA 4IVDA 4L43A 3CSVA 2DS1A 5AEPA 2ZYBA 4RC2A 3LMGA 3MVJA 4IWPA 4QTDA 4ASXA 3BBTB 4R3CA 3UVPA 2OICA 5C27A 3DY7A 3NIEA 3DBCA 4G3GA 2UZLA 4F9WA 2GSFA 2J6MA 5EKNA 3PRIA 4QP7A 4BTKA 3NVKI 1ZY5A 3UJGA 3QALE 2PVLA 3HMIA 3R9NA 2W1CA 3A7FA 4YNOA 3HECA 2IN6A 2RKUA 2Y4PA 2YFXA 2HWPA 3KCKA 4AGCA 4AWIA 2BZIB 5KMJA 1WCCA 4E3CA 1X8BA 1R78A 1OIQA 4KA3A 5AP4A 4LGHA 3FXXA 3VBTA 5KBQA 4EWHA 4I20A 3L9MA 2OKRA 4A9SA 4KIPA 2WAJA 4O0XA 1UV5A 4UV0A 5DLSA 2XJ0A 4FC0A 5J5SA 4E7WA 5CU2A 2R4BA 2BCJA 3EWHA 1ZYSA 2G2IA 3KRWA 4JX3A 5AUTA 4DITA 3QF9A 2QOCA 2UUEA 4HPUE 4C34A 3A7HA 5H3QA 1YVJA 5GNKA 3IW7A 3WOWA 5JGAA 3GC7A 4USEA 4OBPA 4EOQA 2YN8A 1FGIA 3GBZA 3VS7A 4IZYA 3UZTA 1OPLA 4CFUA 3QCYA 4ITHA 5A4EA 4BGGA 4FUXA 3CD3A 4KBCA 4OTWA 4F4PA 1P4FA 3U54A 3OBGA 4RJ8A 3EZVA 4IE9A 3M2WA 3ZEPA 2XBAA 3QQFA 3R22A 4F0GA 3Q4ZA 4FGBA 1Y57A 2BIKB 2R3FA 3BQRA 3OOGA 4KABA 4PNKA 3NW7A 3GC0A 2QOIA 4S30A 4I5MA 3IOKA 3MBLA 4CMOA 3UO5A 1R0PA 3SAYA 3IOPA 1BKXA 3FHRA 3RKBA 3VF9A 1QL6A 4YZCA 5KMLA 3DNEA 3COIA 4OTDA 4B4LA 3ZDUA 1M52A 3JR1A 2DUVA 5LQFA 4BDJA 5KZ0A 3O51A 2CHLA 4EC9A 3UIXA 2BHHA 2YIRA 2BZKB 4PPBA 3FMDA 3R1SA 4R7BA 2P2HA 3KULB 2WTIA 4MBIA 4FMQA 2VWIA 4FI1A 4DGLC 5JFXA 4FK6A 2C1AA 4P5QA 3W2QA 3TZMA 1ND4A 4H58A 4EK5A 3HX4A 5DR6A 3TEIA 4HGTA 3KK9A 4I5PA 3ZEWA 1DI9A 2XCHA 3GP0A 5EM7A 5CAOA 3UBDA 2X2LA 3JVRA 3G51A 3KEXA 4C4FA 3ZC5A 2H8HA 3HA6A 3BHHA 5GHVA 3ALOA 4Z9LA 5JT2A 4HGSA 5KMMA 5D7AA 3MPAA
chains in the Genus database with same CATH superfamily
2X4FA 4AAAA 3Q3BA 3F9NA 2QC6A 2W1FA 5JH6A 2GNGA 3ID6C 4BI0A 2Y8OA 2QR8A 2G1TA 3A99A 5E1SA 3RHKA 4BKJA 4BDCA 4MWHA 5M07A 1URCA 4LDTA 1PXIA 2VTAA 5AMNA 2PMNX 2PZPA 4YTFA 4FTRA 4DF3A 3MVLA 3DLZA 5IQAA 2NRUA 4ANSA 3NMUF 2CGWA 5HLNA 3KF4A 4QP6A 3QUDA 3C0IA 3EFJA 5L6WL 3Q2JA 3OXZA 4KKHA 4FOBA 2UZNA 4BCKA 4ITIA 4C61A 4DHZA 4PRJA 4PWNA 1CSNA 3V5WA 2OI4X 3ANQA 4HYSA 1ZOEA 3MI9A 3BIZA 2BTSA 3Q5ZA 2WQEA 4OR5A 2X6DA 2YLFA 4FGRA 3OUNB 1JSUA 2JDVA 4HNFA 3PYYA 1V0OA 2YM5A 3PDTA 3BLAA 4F9AA 3ZUUA 2BRGA 4YZDA 3RHXA 2UZUE 2YJSA 5IG1A 4IJPA 3R8LA 3OTVA 4ZTNA 1Y8GA 3TV6A 2YISA 4ZJJA 3HRCA 4D9UA 1KV1A 4IB0A 4GJ3A 4PMSA 4M69A 4XNEA 4DCEA 3S0OA 4GT4A 5E90A 3OW3A 4QMQA 2YM8A 4TYEA 4DH8A 2I1MA 4EZ5A 1K2PA 2XANA 2REIA 4I94A 2QCSA 5AP1A 4K6ZA 1PF8A 5AR7A 3F2AA 2Y0AA 4LUDA 3OC1A 4LRKA 4AN3A 1G8KA 2YDJA 2ZV8A 3HP2A 2O8YA 4YR8A 3OF0A 4UX9A 1WBOA 1KE6A 3PA3A 1PMEA 3OVVA 4E73A 3RPVA 1Q4LA 4D5HA 2UZDA 4KRCA 3HDMA 4WO5A 2PSQA 1TQPA 4CFMA 3K3JA 2HZNA 4F0IA 2JBOA 1VYWA 2R0UA 3BYSA 2X81A 5DE2A 2HW6A 2ZV9A 4Y46A 4HYHA 4FV9A 3VRYA 3ORXA 2A2AA 3ULZA 2CJMA 3CY2A 3E8EA 3VULA 4EOMA 2BR1A 5LWMA 2C3LA 1JWHA 1YXSA 3NR9A 5FTOA 1CKPA 4AZVA 2IVVA 1KWPA 4RIXB 4AQCA 4E4NA 4C33A 2J90A 4M67A 5C4KA 4J97A 3AMYA 4DC2A 4R5SA 4H39A 4CT2A 3TUBA 3PVBA 5KMIA 4L3PA 3SVVA 4IX5A 4CKJA 1WBNA 2BKZA 2ZMDA 4J98A 4EHEA 4DTAA 5JFVA 3R73A 3LE6A 3P23A 4P5ZA 3CXWA 4ZY6A 2CMWA 3ZO1A 1NVQA 5AUWA 3VJNA 3DS6A 4QOXA 3K5VA 2B1PA 1BL6A 3QRJA 5CAQA 3PWYA 3FL5A 4PF4A 2R3HA 5HHWA 1I09A 2CDZA 5J9YA 3HMMA 3G6HA 4BFMA 1W2FA 2B53A 4C4JA 2YDKA 2WKMA 5CQUA 5IH6A 2YWVA 4QMLA 5BMSA 4OAVB 2VRXA 1B39A 2WU7A 3Q6UA 5ICPA 2UW5A 3SDJA 2R2PA 3O0GA 1LUFA 2IEWA 4KAOA 4O7SA 2Z02A 4DDIA 4H05A 4AW2A 4PUZA 4EI4A 4J95A 4C3FA 5HO6A 2VTMA 2W4JA 5EQYA 1L3RE 5L8JA 3V5QA 3WARA 4PTGA 4A07A 2XIXA 4IJ9A 4QYEA 5DN3A 3UMXA 2XALA 5HU9A 1YOLA 4CFWA 5J8IA 4U43A 4O7RA 1A9UA 1BI7A 4GT3A 3RALA 2W1ZA 3LQ8A 4LM5A 1ZLTA 1FQ1B 4G34A 5HE0A 3D5VA 5AX3A 4RIWA 2GMXA 3F2NA 4L8MA 4EBVA 2VN9A 4NU1A 3PSBA 1KE9A 4FKPA 3BYMA 2BZJA 1YQJA 2PVFA 2PVJA 4WA9A 4GT5A 4NK9A 4BIBA 4B0GA 3EIDA 2H6DA 5CSHA 5BV3A 2JGZA 4E4LA 4IEBA 4DG2E 4YJPA 2HELA 4LFIA 3MFRA 5D11A 4JT3A 5BVWA 3RK7A 4S31A 2C6KA 2XKCA 4XLVA 3WIKA 1PXKA 3ZZWA 4YU2A 3NUXA 3LXNA 3DV3A 2XNNA 3GB2A 4NT4A 3SG8A 3H0ZA 3AD5A 4LL5A 4TTHB 2GCDA 1H1RA 3VS2A 3WZJA 5L2SA 2F7ZE 4XUFA 5F9EA 4P90A 5EK7A 3V6SA 3SA0A 3R7VA 2X8EA 3OWLA 2HCKA 4HOKA 4JG7A 4JBPA 4UMQA 4BCFA 2XAOA 1TZDA 2BMCA 5G6VA 4XLIA 3ULIA 1OL7A 4FZFB 4MKCA 4PPCA 3QRIA 4H1JA 1KUTA 4CZUA 3O7LD 4CXAA 3ZFXA 2XK7A 4AXDA 3OS3A 1ZXEA 2VO6A 3QX2A 4X3FA 4ZXTA 4CSVA 2XYNA 1O6YA 4EH2A 5IU2A 4AT4A 3CR0A 4BCMA 3OWPA 5IZFA 5L2WA 3LFSA 4KIOA 3RWQA 5HX8A 4FKTA 4DHFA 2WMQA 3SG9A 4YZBA 4XG3A 4ZJIA 4FV6A 4BVUA 4E20A 5HBHA 2JC6A 2UVZA 3ENMA 1M14A 3IECA 3OHTA 4YO4A 2JLDA 4I0SA 4DEHA 1YKRA 5AWMA 5IH5A 2W05A 3MH0A 3GEQA 1LEWA 3OFMA 3W0QA 4G5PA 4CTCA 4F6SA 1Y6BA 3UP7A 5BUIA 3HP5A 2JDOA 4PX6A 4Q9ZA 4FVPA 2VAGA 1FPUA 4JAIA 3VN9A 4ASDA 4XBRA 4FIJA 3AGLA 5K3YA 3KIOC 2W9FB 2W9ZB 3F82A 1Q62A 4J71A 1YI6A 3JVSA 2VWYA 4TNBA 2AC3A 2R3RA 3ERKA 3UC4A 3LVPA 5DVRA 4K1BA 5D41A 4FL2A 3PJCA 3UOKA 5ANGA 3DK3A 4KS7A 4FIEA 3BU5A 4J7BA 3MWUA 3HV7A 3A62A 2R3OA 5E8XA 3QU0A 3BYOA 3LLTA 2BDWA 3FKOA 2ITPA 3FMNA 3AC1A 2QOKA 3C50A 3FQHA 3WZEA 1G3NA 4S32A 4L45A 2Z60A 3UTOA 1QPCA 5K5XA 3FPQA 2X7OA 5J95A 1SVHA 5CY3A 4EOKA 1PXLA 1T46A 5AAEA 3R9HA 2ERZE 4PP9A 2WB8A 5EHYA 3WE4A 2XIZA 5E8YA 4FA2A 3BLRA 4TN6A 4PMTA 4BWPA 4X2GA 3ZZEA 2HXLA 4APCA 3ZLXA 1R3CA 4YLLA 4CNHA 4NKSA 3EQHA 3Q4CA 3LPBA 2BILB 3HVCA 4FSQA 3A61A 4QQ5A 5TR6A 3W2PA 2AQXA 3D5XA 3OY3A 2QOBA 3UO6A 4A9TA 3MS9A 4KSPA 4ANNA 2R3IA 4OT6A 3NWWA 4FTLA 5F94A 5IQEA 3U55A 3E5AA 3NFGB 3Q9XA 3QUEA 2GS7A 3NX8A 4FT7A 3RI1A 5EDPA 3FKLA 4QP9A 2GQRA 4F1OA 3JYAA 1RJBA 2WQBA 5AP5A 2XNGA 4ZOGA 2GNFA 3RTPA 1F5QA 3ZUTA 4CYJA 4DEBA 5M4UA 3V51A 4HZSA 3K54A 4FV2A 3VHKA 4C2WA 5J1VA 3KB7A 5TOZA 4D2TA 4AZWA 3Q9ZA 1YRPA 2DWBA 5CF6A 4QMPA 4EHZA 1H0VA 1JKKA 3FJQE 3PXYA 4G3CA 2DYLA 3VS0A 2UW9A 2QVSE 4V05A 3QQUA 3NUSA 2Z7SA 1PMUA 1FGKA 2P0CA 5ITAA 4G1WA 2ZM3A 3MV5A 3NNVA 3MY5A 4FBXA 3ORMA 5LOHA 2WMRA 5DI1A 4XJ0A 5FGKA 3VS1A 3HA8A 3ET7A 2IZRA 3R1NA 4FKVA 2BRNA 4XX9A 2WD1A 4C0TA 4CZYB 4CG9A 5BYZA 3D5UA 3PSCA 3CS9A 1F3MC 3KVWA 4M97A 1YI4A 3PZHA 5FM2A 4M0ZA 4AE6A 5FD2A 4DH1A 2WTWA 1S9IA 5KBRA 2HYYA 4AW1A 3DZOA 1Q8TA 1V0BA 5CEIA 4C37A 3S4QA 3T8OA 4BHZA 5DA3A 5I3RA 2Y4IC 4UWYA 1QPDA 5IUGA 3MA3A 4G5JA 5AUXA 4F7JA 5IH4A 3ANRA 3OWJA 4W8DA 3VJOA 4OTPA 4BI1A 5AFVA 4FV4A 4U81A 1SYKA 1SZMA 1UNHA 3EH9A 3EL8A 4RGJA 2B7AA 4BICA 2RGPA 5CF5A 1OVEA 4FKQA 2OJIA 3KA0A 4FL1A 4XG9A 3EHAA 4EHGA 4X7QA 3E8CA 5DGZA 2BKKA 2X2MA 3GVUA 2VV9A 1J3HA 1XR1A 3KVXA 4U41A 5BVEA 5CSWA 3II5A 3NUPA 4ZMEA 4FK3A 2RF9A 5H8GA 4TYGA 1S9JA 3Q4TA 3VS6A 1H0WA 3KRXA 2V55A 5ANOA 5CF8A 4IVBA 1AGWA 5FDXA 4EH8A 3VHEA 3VUTA 3VRZA 4MX9A 4FV5A 2ZFYA 2LGCA 1R1WA 5E7RA 2ZV7A 1U5QA 4WRSA 2IVTA 3GCUA 3SRVB 3BL9A 5KMOA 1Q8YA 4NW5A 3SXFA 4XH6A 2WOTA 2BAKA 2EXCX 2J7TA 2BTRA 4QQCA 3H9RA 3SRVA 3P0MA 3D4QA 3E92A 3D2KA 4D9TA 4MQ1A 3ZXTA 1H08A 4BIEA 4C4EA 1U4DA 5LWNA 3F2RA 1OPKA 4L46A 2Y6MA 4ERKA 3LCSA 5JKGA 5ETFA 3TTIA 3HMNA 3QGWA 3TCPA 5TT7A 4NJ3A 5BVDA 1NVRA 4OLIA 3VUKA 4MNFA 1L8TA 5DMZA 3DU8A 4Z7GA 3W33A 3AGMA 4RMZA 2HAKA 4HZRA 3G0EA 3FMJA 3FLNC 4ID7A 2J0MB 4IWOA 4JRVA 2W06A 2W96B 3AC5A 1NXKA 1XBCA 4A4XA 3BWJA 3CPBA 3VAPA 2BALA 3DB8A 4EOJA 4R3PA 2VX3A 4FG7A 2QLQA 2B9IA 3PE2A 2JBPA 3DJ6A 2IZUA 2VWBA 3U4UA 2ZM1A 1MRYA 3MDYA 4JIAA 1M7QA 4S33A 4AUAA 4BCQA 4YPSA 4EJ7A 4JLCA 3DK6A 3WYXA 5LVLA 3OOMA 4NIFB 4TNDA 4AE9A 4YLKA 4LI5A 4ZSGA 4N70A 4NIFA 5IA0A 2I0VA 3O17A 5AR4A 3RWPA 3R83A 3DBEA 2BFXA 2UZEA 2KULA 3FZSA 3QD0A 4MVFA 4FSYA 2ITZA 4AOTA 5AIKA 3L8XA 3IKAA 3JUHA 2W1HA 4WHZA 4AACA 5JQ5A 1G8SA 2UVXA 4HCUA 4W4VA 4YJQA 1XMMA 4X21A 4R3RA 1FMOE 2E9NA 2WFYA 3F3WA 5JRSA 2WZJA 1VYZA 4O0TA 3LFFA 5EI6A 5KMKA 4F6WA 2JITA 3FMHA 4TL0A 3FAAA 4IAIA 1WBWA 3KMUA 5CT7A 5HBEA 3MFTA 1OGYA 4KBKA 3E87A 3W0MA 2VTSA 4TWPA 5L6PA 4J96A 3C4WA 2QI8A 1ZY4A 3CTJA 2PWLA 4RA4A 4GS6A 5B2KA 2R0IA 4N6YA 1NVSA 4IANA 1Q97A 4YC6A 2W5BA 1T45A 3O8PA 5DR2A 4ZJVA 5HBJA 2ACXA 4PDOA 4PDPA 3TXOA 5J9LA 3R9DA 4U80A 4XG2A 4YSMA 4I0RA 5IA3A 2A98A 3ZCLA 4LOOA 4XEYA 5CXZA 3BRBA 5BYLA 3CKWA 2WTJA 3R7OA 1PRYA 4KBAA 2ITYA 2GHGA 5T3QA 3V5PA 4NL0A 5AUVA 3MH2A 4QMYA 4EEVA 4XMOA 4O7NA 2Y6OA 3FZRA 3G0FA 3BGZA 1PXNA 4QNAA 5DT4A 4AF3A 3R9OA 5IEVA 3BHUA 5LVNA 3DA6A 5FBNC 4F9CA 3WIGA 3TYKA 3TKHA 4BY9E 3H30A 4R6VA 4QO9A 1ZYDA 2RSVA 4FTQA 2HZIA 4NTSA 4WUAA 4AOIA 5E4HA 3AC2A 2YABA 2YZLA 2UW0A 5LVPA 4G6OA 3PA5A 5AV2A 3UZPA 5JFWA 4BTMA 1UU8A 2IZSA 2Q83A 4K8AA 4LV5A 4AXEA 2VWWA 4TY1A 4BGQA 2PTKA 2XK3A 3DQWA 3ORNA 2VNYA 3K2LA 3DJ5A 4AX8A 4O0UA 4U97A 4YZMA 5HNBA 3R1QA 4O0WA 4RIYA 5CSPA 3CY3A 4MXZA 4UEUA 5M53A 5EM8A 4N57A 4ORKA 3O23A 3UODA 3ZC6A 4EK4A 2YITA 5C8NA 1YWNA 4YC8A 2C5XA 3UIBA 5HD7A 3FL4A 2BZHB 5E1EA 3S00A 3KGAA 4YGAA 4IZ5A 5ANEA 2WU6A 2QU5A 5A4QA 5AR8A 2PE2A 1P14A 4TYIA 4FE2A 4G9CA 2I40A 3RPOA 3UPXA 4DYMA 3DDPA 2EUFB 3FZTA 1UNLA 3BEAA 5EQPA 2W1IA 3HLLA 4RLLA 5JZJA 4NJDA 3L9LA 4BJJB 3I5ZA 4R1VA 4C3PA 4ACMA 4CT1A 4X2NA 2A27A 2UZOA 3W8QA 1E1VA 2OSCA 1TFFA 4BDKA 4BJJA 3TDVA 2EU9A 3DKFA 5AP2A 3QTXA 2UZBA 2C6MA 4Y8DA 5J87A 4YJVA 5A14A 5JGDA 4GUBA 3DTWA 5FXSA 5ACBC 2YLEA 3OW4A 3P7CA 4C3RA 2QOQA 4K11A 3TJCA 4JOAA 4LV8A 3MB7A 3BU6A 5IUIA 2ITOA 4Y95A 5ETAA 4N4SA 2QLUA 2XK9A 1J91A 1GY3A 2YCQA 3FSFA 1MRUA 3SV0A 5GJGA 3BV2A 4YJNA 5CX9A 5D12A 1GZ8A 1GZKA 3R30A 3AMBA 3EN9A 4D2SA 2CKQA 2C6TA 2O0UA 5DNRA 3F3UA 4G3EA 2O3PA 2Z2WA 4MHAA 5E8VA 4FTNA 3A4OX 3ALNA 3LFNA 5AADA 4D4YA 4L7FA 4M15A 5AP0A 1LEZA 1OM1A 2ZB0A 3OMVA 3DAEA 3H4JA 1ZOGA 5TKDA 2YHVA 1V0PA 2QKWB 4FKRA 3Q2MA 1LR4A 1ZYCA 2XJ1A 4IMYA 4RC3A 1PXJA 2CKEA 3DBDA 2FUMA 3LXPA 4KNBA 3TIYA 3V04A 2Y9QA 4BTJA 4EH9A 5HGIA 3FEGA 4RX7A 2BDJA 1JKLA 3REPA 3Q53A 4CG8A 4NM0A 5D7VA 5FP6A 5C4LA 2X9EA 3EFKA 5LARA 1ST0A 2GQSA 4M0YA 5CEOA 3E3BX 5LMBA 4RFYA 2JKQA 4YJRA 1QPJA 5EG3A 1PJKA 1UVRA 3VW6A 5JGBA 4RT7A 4QMZA 4ZTRA 2JDRA 3JXWA 1JBPE 5DWRA 2IO6A 4I5HA 3A8XA 3TDWA 4F70A 4QMVA 4A4LA 3LQ5A 5F4NA 4MCVA 4ENXA 2BIYA 1MUOA 2C6IA 3DZQA 3MJ1A 3OP5A 4UYNA 1UA2A 3HYHA 3IW5A 1W0XC 1K9AA 2EXEA 4QP3A 4QYFA 4X0MA 5CVGA 2OXYA 3VS3A 2XM8A 4D2WA 3BZ3A 4YZ9A 1CMKE 5BUEA 3KMMA 5EHLA 2IJMA 4O1OA 4I6LA 3CKXA 2VWVA 3OEFX 3QKLA 2ONLA 4O7VA 5FM3A 2WMVA 3F66A 3BX5A 4C4HA 2QO7A 3FQEA 2BUJA 3CJGA 5E8TA 2YCSA 2R3GA 2W1GA 4AT3A 1JQHA 5J1WA 2XA4A 3KXNA 3C9WA 5B2LA 4FV0A 4ACCA 1HCKA 4QEBA 1TQMA 3PPKA 4U3YA 2CLXA 3RM6A 4BDFA 4D55A 4O82A 5FTGA 4E5AX 4FKOA 4F0FA 3UDSA 3A7IA 4LGDA 1R0EA 2RG6A 1YOMA 3ZTXA 3KC3A 4C35A 2VX1A 1Y8YA 2E9OA 3KULA 5CEMA 2YCFA 5CSVA 4DEAA 4F6UA 4AXCA 3TMOA 4QQTA 4YSJA 4MQ2A 4PP7A 4EJNA 4X2FA 4PMMA 5B0XA 5KE0A 1Q3WA 1W7HA 2UW8A 4L42A 3MJ2A 5ANIA 4YLJA 2GHMA 4BTFA 3SC1A 3O2MA 3Q9YA 1ZYLA 3R21A 2X0OA 3O96A 3S95A 3P5KA 5L8LA 5LJJA 4MBJA 3TG1A 2FSOX 4H36A 4D1XA 5HIEA 2E9VA 4JDJA 3TJDA 3AD4A 3R28A 4YJUA 2JAMA 4EKLA 4XHKB 4GH2A 4U0IA 4RRVA 2XF0A 2ITTA 2J0IA 5G1XA 5M44A 5EDQA 3R7GA 5CAVA 3ZS5A 3PY0A 3U9CA 3K5UA 3TNHA 3ZLSA 5EYKA 3V5TA 5K5NA 2PVHA 4TYJA 4UXLA 3GQLA 3DQXA 1FINA 1OB3A 4M66A 5K4JA 2P55A 3LXKA 2E2BA 3VUMA 4C4GA 4IWDA 3PIZA 3ZBFA 1PMNA 4O4FA 1H24A 2W5HA 2VWXA 5J7HA 4WG5A 3HAVA 3EKKA 4DEDA 4OTGA 5IUHA 5JEBA 1ZMWA 1SNXA 5HG7A 2V62A 5HNGA 1GIIA 4JBQA 3AC8A 3G33A 4TRLA 4K2RA 3ZSGA 4NYEA 4AXFA 3DLSA 2XP2A 3U8WA 2A4LA 5C9CA 2UZWE 2C3KA 5HIDA 3AT2A 3UGCA 2W7XA 2Q0BA 2CCHA 2IZTA 4AA4A 2I7QA 3OCSA 2C30A 2UV2A 4KIQA 2OZAB 3L8PA 2I0EA 3I7CA 2UW3A 4JDHA 5HORA 5IDPA 1W83A 3T3UA 3LCTA 2PL0A 1KOBA 4XP3A 2NYAA 2FO0A 3QAME 4IAYA 3SHEA 4BC6A 1CTPE 4BBMA 2B4SB 1G8JA 2V22A 4LUEA 3FLSA 3SQQA 4RJ4A 3NEWA 2PVNA 4KINA 4TW9A 5DBXA 2QOOA 4RJ3A 2F7EE 2BRMA 2VTTA 4JXFA 3TKUA 2ETRA 3MW1A 3Q9WA 4BKZA 4U44A 3F88A 1VJYA 4FTAA 2B9JA 5I9UA 4BI2A 3LFCA 5HTIA 4O7YA 1W2DA 5HU3A 3F6XA 4YUQA 2ERKA 3R04A 4RC4A 3IG7A 4W4YA 5D9HA 2H9VA 2FSTX 2QU6A 4Y83A 2PUPA 4Q2AA 3ML1A 2Y4IB 4CV9A 2XRWA 4O2ZA 3AQVA 5I9VA 3QTSA 5C8MA 2GHLA 2X39A 2OH4A 1ZYJA 3NYVA 1OKWA 4ZSEA 5HICA 2XJ2A 4NKAA 1OBGA 3W18A 2HXQA 4GU9A 4CEGA 3GCPA 4A4OA 3GOPA 3VBVA 3EYGA 3FLQA 3SX9A 4XG6A 2C5NA 3E63A 2PUIA 4I24A 3R02A 4PL4A 1PXMA 4FG9A 4CV8A 5A4CA 3RAIA 4RIXA 4BIDA 3KXXA 4B6LA 4Y72A 3FE3A 4D4RA 1CM8A 3ZBXA 1YXVA 2O5KA 3BELA 2WQMA 3OWKA 4OW8A 2CLQA 2CGUA 2C5VA 1APME 2EVAA 2WMWA 3QZIA 4FKUA 3Q04A 4GIHA 3RPYA 4YURA 4LGGA 3SOCA 4LOQA 3QTIA 3V3VA 4JR3A 5HNIX 5GIOE 2PHKA 3ORPA 3HDNA 2QO9A 1Y91A 3B8RA 3HL7A 4MXXA 2UVYA 2YEXA 4YNEA 3DKGA 3Q96A 5IDNA 2WMAA 3LKMA 1IA9A 4UMRA 3ZHPC 3GU8A 4GYGA 4O4EA 3HGKA 2ITUA 5HG8A 1QCFA 4NTTA 2YJRA 5HCZA 1J7UA 4EUTA 3EL7A 2X8DA 3RGFA 1U46A 2JDTA 4UN0C 2X7GA 3IDCA 1M2QA 4D1ZA 3F5UA 4KKEA 2C0IA 2HY81 1SVGA 2IVSA 1P5EA 1URWA 3B8QA 4LYNA 3SKCA 5BX0A 2QG5A 3FXWA 3FUPA 4FKLA 4QYGA 4XCUA 2O65A 1DM2A 4FNZA 4FSMA 3IONA 2JEDA 2OK1A 2V0DA 4IVAA 4L67A 3SOAA 4ZS4A 2I0YA 3PPJA 3I1AA 2QQ7A 1RDQE 4AFEA 3UQFA 4KRDA 4HVGA 3JPVA 4ZP5A 5A3XA 4BF2A 1JOWB 4C38A 3PVWA 3DB6A 3DFAA 4O0RA 3UNJA 4MH7A 3UZRA 1W82A 1OL2A 3TV4A 3KREA 1J1BA 4JQ7A 2GNIA 2H96A 4ZIMA 4D1SA 3ATSA 4BDGA 2CGXA 2G2FA 3QD3A 4MEDA 3CCNA 5EW9A 2IPXA 4ZLZA 5IPJA 3ENHA 3O8TA 3QD2B 1M7NA 5FEDA 4WG4A 2Q0NA 2W1EA 4NSTA 5J9ZA 3W1FA 4ASEA 3GU6A 3FSKA 4EOSA 4IH8A 5LMKA 1W2CA 4DEEA 4CKRA 1O6KA 3ZONA 3CGOA 5CT0A 2WHBA 5I9ZA 3NRMA 4O91A 5DEYA 5BPYA 4IX4A 2J2IB 3FDNA 3C1XA 5E8UA 2BVAA 5M56A 2HW7A 5EW3A 3KRLA 3ZU7A 5IMEA 3NYNA 3EQCA 2P2IA 3MFUA 4FVQA 5CI7A 3F5PA 1G5SA 4G6NA 4M14A 3JY9A 5FTQA 4F1MA 2R3PA 3EN7A 3TI1A 4LMNA 2VTHA 5I3OA 2XKFA 1H25A 3PIYA 2OBJA 3HRBA 4RSSA 3TL8A 4D2PA 2GTMA 1YWRA 5L3AA 4O4DA 4U9AA 4W9XA 5I9YA 3EJ1A 3S2PA 4CYIA 1Q8WA 4Z16A 1FOTA 4IB3A 5GINE 2R3QA 4GIIA 4JDKA 2XNBA 3QGYA 1PXOA 1UU9A 3SLSA 4MYGA 3VBYA 4AFJA 3R2BA 1EH4A 3HAMA 2ZV2A 3GCSA 2WQOA 4BL1A 5EM5A 2GFCA 4QP4A 3IS5A 1RW8A 4EOPA 3U6IA 2PVMA 3V5JA 5CVHA 3BLQA 5AP7A 4WRGA 4Y73A 4FZDB 5AA8A 2XS0A 4A9UA 1VEBA 5IQIA 3QD4A 5CNOA 4USFA 4ALWA 3PG1A 4FZAB 4L44A 1IAHA 2XNMA 1WBPA 4USDA 4EH6A 1TQIA 4FT5A 1K3AA 4YMJA 2GS6A 1BLXA 4DFXE 3E88A 4FEWA 4OAUC 4NM5A 4B7TA 4F09A 3RK5A 4BDBA 3BI6A 5IQFA 2HOGA 2QURA 4L3LA 5F1ZA 3ORIA 3UQGA 3SW7A 4RJ5A 1WFCA 4CRLA 1H28A 1CDKA 1KE7A 3CEKA 3BE9A 3SD0A 4JRNA 4DDGA 4EL9A 1GJOA 4C7TA 3PG3A 4ZZMA 4YTIA 5GJFA 5M55A 2OJ9A 4ZTHA 5KCVA 4QRCA 4CLJA 4NCTC 5AIRA 3M11A 1ZWSA 3AKKA 1WBTA 2GS2A 2YCRA 3I6UA 3LFQA 4JBOA 4ZTLA 5EQEA 3IDBA 4EUUA 3POZA 2C0TA 1YOJA 4R5YA 1BX6A 5LCJA 5CLPA 3MY1A 5E92A 2XK6A 2UW6A 5HZNA 3VIDA 2OXXA 4M8TA 3UIMA 3QHWA 3LJ2A 1PKGA 2VD5A 3COKA 3PP1A 5BVFA 2WIHA 2XB7A 4U3ZA 5EM6A 2EXMA 2VTLA 4L52A 3VUGA 3ZDIA 1ZMUA 3PP0A 4RX9A 4HVIA 2QKRA 2WOUA 1MP8A 2X0QA 5GZAA 5AUZA 3LXLA 2A1AB 4GUEA 5K0KA 3S1HA 2C3IB 3LZBA 4EOLA 4TPTA 4OUCA 1LP4A 2XMYA 5DG5A 3R7IA 5JMSA 2YM4A 2GNJA 4F99A 4A06A 3R01A 3NUAA 2ZOQA 4TWOA 3R2YA 2IWIA 4HJOA 5CZIA 1P4OA 4R1YA 3ZRMA 4Y5QA 4UMTA 3LQ3A 4MD9E 2CPKE 3LW0A 3FLZA 4D5KA 4RJ6A 2PMIA 1OITA 1YHWA 4XG7A 4XBUA 5EYMA 3WYYA 5LXMA 1IR3A 5EYCA 1JKSA 4TWCA 1XQZA 4NW6A 4I4FA 3EQRA 3FZ1A 5M4FA 4O4BB 4XOZA 4Q5EA 3R8PA 2GTNA 1IASA 2PZ5A 3O8UA 3WF9A 1BYGA 1SM2A 2I0HA 3DAKA 3C4CA 3C4EA 3PIXA 3MTLA 3Q60A 4FKWA 2W1DA 4FSWA 1W84A 1Q8ZA 3D2IA 4EK8A 5HO7A 4YTCA 5K0XA 3Q6WA 5FEQA 1KE8A 4B8MA 3PLSA 4ENYA 3PRFA 2WIPA 3N4TA 1O6LA 2XCKA 4NZWB 4FEVA 4YJSA 4YC3A 3QRTA 3U9NA 2XNOA 4FTCA 4FYOA 4RWIA 3LLAA 5FXQA 3MH1A 4D0WA 1QPEA 4QNYA 4O7ZA 1DS5A 3NFFB 1WVXA 2O2UA 4F64A 4GFOA 5HVKA 3KMWA 4KUJA 4KIKB 4QYYA 4H3QA 5AM6A 5C01A 5CWZA 3F69A 4C62A 3BPRA 3UNZA 1RE8A 3FBVA 3FI2A 3MY0A 2JIIA 3AT4A 4K18A 4CGAA 2CNQA 5HX6A 4G31A 2CKPA 3R8ZA 4BYJA 3F5XA 3AKLA 4GKIA 5H8EA 1IG1A 3S3IA 3FI3A 5AM7A 4EQUA 4RA5A 2YWPA 3DFCB 3BU3A 3WBLA 3KN5A 5CVFA 3OCTA 4DCAA 3BE2A 3NPCA