4RIWA

Crystal structure of an egfr/her3 kinase domain heterodimer
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
281
structure length
269
Chain Sequence
VLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title Structural analysis of the EGFR/HER3 heterodimer reveals the molecular basis for activating HER3 mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 269
sequence length 281
chains with identical sequence C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4riwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4riwA01
5JGDA 4J53A 4MTAA 4CMOA 3RPRA 5L2WA 4NCTA 4IFGA 5DLSA 4JBVA 3ZM4A 3R1YA 4DFXE 4CVAA 1DI9A 1OL1A 5EM5A 4ZJIA 5I9VA 4Q2AA 3UYTA 5BYYA 4O7YA 5FBOA 3DY7A 3EZRA 5E91A 1WVWA 5DFPA 3DBFA 1UWJA 4O7NA 4FKJA 5LMKA 4DFLA 2XK8A 3F2AA 5HESA 5J87A 3RAKA 3ZHPC 4JIAA 4ZMFA 4RWIA 3ZLSA 2Q83A 3PLSA 3UDBA 4GIHA 3KREA 1FMKA 3Q53A 4EH8A 2XH5A 4O27B 4CNHA 5I5ZA 4G5PA 3HAVA 1OL5A 3R73A 2IJMA 4H36A 3LCDA 5AR8A 4R6VA 3TN8A 4W9XA 4LOPA 3CJGA 1E9HA 5KKRB 5DNRA 4TL0A 2H34A 3FC1X 4BTJA 2Y9QA 3PFQA 5L4QA 5AIRA 2FGIA 1M2QA 1NA7A 5LVOA 2WMBA 5IMEA 4FSRA 4KAOA 2H96A 3IDBA 3JVSA 2B9IA 4RC4A 2XKCA 2HWPA 5IEYA 4O91A 3OUNB 4IQ6A 3S95A 3FXXA 4HYHA 2JKMA 3TKHA 4E20A 4UMUA 3LFQA 4AAAA 2JDSA 3CD3A 4FV0A 4EOLA 4TWOA 4XRLA 2C4GA 3C50A 3UQFA 4AA0A 5BVDA 2I0YA 2BAQA 2O64A 5LOHA 2PYWA 5CSHA 2C6OA 2GNJA 3UPXA 3LKMA 2C69A 4I3ZA 4TKSA 3K2LA 5DH3A 4NZWB 1WBOA 2I1MA 5DOSA 4DH3A 3OC1A 4RJ7A 2XIRA 3VBQA 4EH6A 5LMKC 2Y6OA 3C4XA 1FVTA 4QTEA 4RSSA 3WF9A 2R3JA 4WNOA 3HP5A 2W0JA 2WIPA 4L53A 4FNZA 4AFJA 4RC3A 1BL7A 3LFBA 3AMAA 4MBIA 3FMJA 4IB5A 3QCQA 4BTFA 5DHJA 3QUPA 4LUEA 2ZM4A 5M06A 1AQ1A 2R7IA 3C4WA 2X9EA 4GG5A 2G1TA 4ZP5A 3D5UA 4PX6A 4LM5A 3RAWA 4AN9A 4YZMA 5FTQA 4ANLA 3CEKA 2BR1A 2CKPA 3MH2A 2IVTA 2PVYA 1GIHA 2WTDA 4RIYA 3UNZA 2JC6A 4AGDA 1JQHA 3R04A 4HVSA 1W0XC 2XNPA 2J50A 4UWYA 2RFSA 3QRJA 2PVHA 3SD0A 3VF9A 4D2VA 4F65A 1Q97A 4R3RA 2ZM3A 3H9OA 4I0SA 3TUCA 2P4IA 4GVAA 2FYSA 4DEIA 4BCJA 2IZSA 3UQGA 3A7HA 3GENA 4FVPA 2WQNA 5K5NA 4ZLYA 3MFSA 5EFQA 4EQCA 3C13A 3C0HA 2NNWB 2VGOA 4FMQA 4G3FA 4HYUA 4JRVA 1OBGA 4TPTA 1XH9A 1U54A 4B99A 3UOLA 4MNFA 3NWWA 4WG5A 2G01A 2WMXA 3QQJA 2WZJA 3PIXA 5M51A 5FP6A 3OW3A 4I6BA 1WMKA 3DKFA 4X3JA 4XG7A 1QPDA 3MPMA 3QKKA 3ALNA 5FTGA 3OXIA 3E92A 4FTCA 3AQVA 5LVLA 4JX3A 4NM5A 4ZTNA 3ZXZA 1CMKE 4UXQA 2FSLX 4QMQA 2XNNA 3VNTA 4OGRA 4YTIA 2FVDA 2UZVA 1WBSA 4KIPA 3DK3A 2R4BA 4HGLA 4IAZA 3R0TA 4JXFA 1BLXA 4UY9A 1ZYDA 3HMNA 3CTHA 3ORTA 2GNHA 4X2GA 5DG5A 3U8WA 1TKIA 3UVQA 3MPAA 5ANEA 4Z3VA 4KSQA 3BYVA 2XNMA 3C0GA 4M69B 4MD9E 3FUPA 4XP2A 3R8MA 5JK3A 3FMLA 1ND4A 4GUEA 3KGAA 4WHZA 3UIUA 5IQGA 4D9UA 1OUYA 4XRJA 4S2ZA 4XLIA 3ZBXA 4C37A 2JFLA 3PA4A 4TTHB 3QTUA 2QR7A 2WOTA 3V5JA 4BIEA 3EFLA 1XBAA 5EYCA 4IJ9A 4ANNA 3CGOA 3OEFX 1P5EA 4G16A 3V51A 3IW7A 3DV3A 4RT7A 3PIYA 4U3YA 4FIGA 2CSNA 2Z2WA 4BDJA 4BCMA 4B9DA 3FEGA 1BI8A 4C02A 4D9TA 3U54A 4Q9ZA 4YU2A 4K8AA 4OTFA 4J52A 1OBDA 4AZTA 3NUAA 5KNJA 3DNDA 4FKOA 2E9OA 2IW9A 3FE3A 4FTKA 3WYYA 3I6WA 4XG2A 5C1QB 1IAJA 2PHKA 5D7VA 5HG9A 4E7WA 2ZYBA 3EYHA 2VO6A 4JJRA 1LEZA 4UALA 4O0WA 3W2PA 2WHBA 1BL6A 3AC8A 3Q4UA 1OITA 3RPOA 3TV7A 4O83A 2P3GX 2E9UA 2ZDUA 1KE7A 4BY9E 1YI4A 1IG1A 3SC1A 2ITYA 4X2NA 2C0IA 3M11A 3IDCA 5IQHA 4QP2A 2XRWA 3CC6A 5H2UA 1GZOA 4G6LA 4IZ5A 3ZFYA 5HORA 3GCUA 4DE4A 3LOKA 3VBWA 1M14A 5AP1A 4DCAA 5EOLA 3V3VA 1H27A 2W1CA 4BDBA 3WBLA 4YURA 4RJ3A 1SMHA 4BBFA 3COIA 2PE1A 2W06A 1YHVA 4ZTRA 4JDJA 4XG9A 3HMMA 2YM4A 4BDDA 5H8EA 1KOAA 3EYGA 2UW9A 3D5XA 2J5FA 3Q5IA 4QP1A 1K2PA 1NVSA 2KULA 2WMUA 3ACJA 3D0EA 2FSMX 3MH1A 3EN6A 3VW8A 3F6XA 4PMPA 4IWQA 3QBNA 2E9NA 1B6CB 3KK8A 3W2QA 3BYUA 3VJNA 3QD3A 1BYGA 2O3PA 4PL4A 3QTRA 3WF7A 1J1BA 1W7HA 5EYMA 4UV0A 3RK7A 4ZJVA 2R3RA 3GXLA 4U5JA 3GOPA 4A07A 4CFMA 4NFMA 4RIWB 2OLCA 2QOCA 1VEBA 5LCJA 4BR3A 3REPA 2CNQA 4Z9LA 4EL9A 4FR4A 1NXKA 5DEYA 4I6HA 5E8WA 3P23A 1NVRA 3R8LA 4X6RA 2QKRA 4FGRA 3E8EA 4FEWA 2W1GA 4TYIA 3R63A 3VRYA 4O1OA 4WNPA 5IG1A 5EYDA 2B7AA 3Q04A 2VWYA 2Q0NA 5JQ5A 4C0TA 3VS7A 3MS9A 5M07A 1URWA 2BHHA 2W05A 3CY2A 4YLKA 5C8NA 1A48A 4ITJA 4EZ3A 3QLFA 3UVRA 3CY3A 5AX3A 1Q8ZA 2GTNA 4N6YA 1KE9A 4W4VA 3R02A 5AUWA 3DDQA 3IDPA 5JKGA 4HPUE 2BIYA 2Q0BA 3EH9A 4NJ3A 5KE0A 3UZRA 1JSUA 4RJ6A 5D12A 3DJ5A 4WBBB 4GT4A 3KXGA 5CAUA 3E62A 3ZH8A 1RE8A 4WKQA 5BVEA 2YFXA 4G31A 4XNEA 4C4EA 2XK7A 4F6UA 5GJDA 2PE0A 4EK4A 3B8RA 3KFAA 3GCQA 3NAYA 5KMMA 3WIGA 5I0BA 3E87A 1Q3DA 4FVQA 3NCZA 5CYIA 3UMXA 2FSTX 4DFYA 2JBPA 4IWDA 2ITNA 3RM6A 2ETMA 2ETKA 4HJOA 1VYWA 4EWHA 5EDQA 4E5BA 4EOSA 3TIZA 2C6IA 2JGZA 4UYAA 4IADA 4NW5A 4DLIA 2IW8A 3UGCA 1ZYSA 1PXPA 1PW2A 3QCYA 4S31A 2FA2A 2AUHA 3F2RA 4RLLA 5BQ0A 4EH7A 3OTUA 4X3FB 4EHEA 2GNFA 3DXNA 3D4QA 2CGVA 4LFIA 3FKOA 4X3FA 5EYKA 3O23A 4NH1A 3NZ0A 3V8WA 4OLIA 3DTCA 4EOMA 3ZUTA 5J5TA 1OM1A 3HV5A 3OG7A 1PF8A 1ZZLA 4RC2A 3ZXTA 5AV4A 3KKVA 2J0MB 3D94A 3UNJA 1I09A 3A7JA 1WBPA 4HVIA 2O65A 2WELA 4WNMA 2BAKA 5DT0A 3KRLA 3DJ6A 4R3CA 2BDJA 4AA4A 3PA3A 1XH4A 4KUJA 5J9YA 4M12A 3K54A 3OW4A 4BDKA 1ZMVA 4JG6A 2FB8A 3Q52A 2CPKE 2IPXA 3NUPA 3UODA 3Q6WA 4C58A 3FL5A 4CFFA 3MV5A 5KMNA 4ZSJA 5GJGA 1M7QA 3C4EA 4C4HA 2C5XA 4IZAA 1WBVA 3R83A 4CFXA 1Q3WA 2UZWE 3H0YA 4OTRA 2V7AA 1ZWSA 4G3GA 4MCVA 3RWPA 3FWQA 3ZC5A 4C62A 2UUEA 4J1RA 5HQ0A 2EVAA 4F70A 3Q4ZA 3VUKA 3ZEPA 4W4WA 5HBEA 5BYLA 4BYJA 2QOFA 3DNEA 3KRWA 3LFCA 4O22A 5C4KA 1OIQA 1ZYCA 4JOAA 4AN2A 4AW2A 3KXNA 4ZZOA 4FOBA 5A54A 3F3VA 3E7VA 4B0GA 4NKAA 1XJDA 2YZLA 4FV7A 4CMUA 5IQDA 4H05A 4H1MA 3JPVA 2HCKA 4FIHA 4DHFA 5E1EA 3KN5A 4FIFA 1G8SA 3E63A 4CMTA 2YDJA 4RJ8A 3FI8A 1JSVA 4C61A 3ZBFA 2R3IA 2HELA 3HUBA 4UEUA 1KE8A 5HD4A 4C34A 3D2IA 4PMTA 3EN5A 3ZEWA 4NM7A 5A6NA 2WB8A 5CZIA 2KTYA 3PSCA 3KC3A 4GV1A 4F6WA 3BWFA 4MHAA 3CCNA 4TY1A 4O7ZA 5CTPA 1UU8A 3HX4A 4ZMEA 3A7FA 4CT1A 2PZ5A 3H30A 1U46A 3OEZA 5ACKA 4I24A 3F69A 2V5QA 1YOLA 2PVKA 2EB2A 2YABA 3FKNA 3MVLA 5CU2A 1SVGA 5HBHA 4CFWA 3LJ0A 4F1MA 2ESMA 3UQCA 4PNIA 3RAIA 3QHWA 1YXXA 2XYNA 4HNIA 3VS2A 4E1ZA 3PZEA 1APME 2X7FA 3CP9A 1GZ8A 2WQBA 4O2PA 4XG3A 3RNIA 4GK3A 4XCUA 5C01A 4ASDA 5IQBA 4BHNA 4FKWA 3IW6A 4L68A 1PKGA 1J7LA 4QMOA 3ALOA 4XYFA 3G9NA 2GHMA 2PVNA 4U7ZA 2CN5A 3F61A 3R71A 4AZFA 3G0EA 3UBDA 3F3ZA 5IA0A 3KMWA 3Q96A 4FSMA 4TYGA 4B4LA 3QLGA 3EJ1A 3KMMA 2QO7A 4NM3A 5BUEA 3OCTA 3UG1A 5GZ9A 2Y0AA 3MFUA 3GT8A 3NNXA 1HCKA 4M7IA 4MNEB 3PJ1A 2V62A 4XBRA 1H1WA 3PPZA 1GIIA 3EFWA 3V01A 3V6SA 5CX9A 3WZJA 3MA3A 3DLZA 2JKKA 4BBEA 4MF0A 4FKIA 4OTIA 4XHKB 1Z5MA 4C4GA 5HE1A 3C4FA 2CLQA 5FEDA 2WEVA 4YZDA 1JAMA 5LWMA 4N57A 1SYKA 5HNIX 4WSYA 4TNBA 1WFCA 3U4WA 3LE6A 1H0VA 3SRVB 4O1PA 4ALVA 5KUPA 4U40A 4B8LA 5L8LA 4MQ1A 3PJCA 2UZTA 1OUKA 4X2FA 3FLNC 2F7ZE 3EFJA 2Z8CA 3OD6X 4FG9A 3NUUA 2W1DA 3C5UA 3HV7A 5J7HA 2XK4A 4YPSA 2OZOA 2O8YA 4PMSA 4I23A 3LFAA 2X2KA 3CKXA 1M2RA 2HZ0A 4BYIA 4ENXA 1BKXA 2BCJA 2J4ZA 1PMVA 2WXVA 1JKSA 3DLSA 4KINA 2UVYA 3KXXA 3PTGA 3U51A 3N4UA 1P14A 3AXWA 2LAVA 2P55A 3GUBA 5E9EA 4G1WA 2PUIA 5CU4A 5AV2A 4DFBA 4GYGA 2CGXA 1TQIA 1I44A 2A4LA 5EQPA 3OXZA 4WD5A 1OZ1A 3TJCA 1KE5A 2VRXA 2G2IA 5CU0A 2X8IA 2VTAA 5HCYA 2GFSA 2R3LA 2QC6A 3R7GA 3C5IA 3UZPA 2XKDA 3CBLA 4E4NA 4O96A 2XVDA 3LHJA 5KX8A 5CU3A 3VUMA 4OBPA 1J91A 5JGAA 2IG7A 4MYGA 1OKYA 2XK6A 3A7IA 4V01A 4A4OA 1F5QA 3OZ6A 4AZSA 3GI3A 4ZJJA 4F9CA 2FO0A 2GNLA 4M84A 1STCE 3H0ZA 3QU0A 4AACA 4D4SA 5M53A 2JKQA 5EG3A 4HCUA 1LP4A 3H9FA 4ZLOA 3PJ3A 4R7BA 3SKCA 1Q62A 1XH7A 4JRNA 4OAUC 2ZM1A 4IVAA 5JEBA 1V1KA 5LWNA 5I3RA 4AS0A 4B7TA 4F0GA 3L8PA 2ZVAA 4GCJA 4CD0A 4FTLA 1BMKA 5HLNA 4U0IA 1LEWA 2XIXA 3GCPA 3LMGA 4USEA 4NFNA 5FM2A 5J79A 2WIHA 4C35A 4I22A 2FSOX 5G1XA 4F64A 3FMDA 2ONLC 5J95A 1MRVA 2BRMA 4AX8A 2RG5A 3SXFA 3MW1A 3PYYA 3DAKA 1H1QA 4QPAA 1H1SA 4JDHA 2YM7A 3RK5A 4ORKA 2VZ6A 4LOOA 4OTQA 4AOIA 3AC5A 4H3QA 4M13A 5AP4A 4BN1A 2QOQA 3HV3A 3DGKA 5CLPA 5E1SA 4BI1A 2NPQA 4DC2A 3U55A 5CXZA 3V6RA 1UNHA 4EH2A 1Q61A 4QO9A 5HNGA 2WU6A 3TT0A 4CZUA 5HTIA 3PXFA 2WQEA 4S33A 3RI1A 3SW4A 3NNUA 5E7RA 4DT9A 3KVXA 4O84A 4WG4A 3M2WA 2P2IA 4FNWA 5DT3A 2C0OA 2W1FA 3VS5A 5HIBA 3T9IA 2XS0A 3PLAE 2BALA 4ANMA 3VC4A 4I41A 5EKNA 5FXRA 5AUTA 3PSDA 4YZ9A 4MBLA 2PVFA 3I6UA 3OOMA 3QTSA 2CCHA 3DS6A 3LCOA 2YACA 5HNBA 3FDNA 4YJTA 4AN3A 4XP0A 1HOWA 2IVSA 4QNAA 2R3FA 1PMEA 2YM3A 3LVPA 4JVGA 4V0GB 4YNEA 4V0GA 5E8YA 4FEUA 5E4HA 4BC6A 2BHEA 3VHKA 3A2CA 4QRCA 2A19B 3RJCA 4Y73A 3GU8A 4I94A 5CEPA 3O17A 4BZDA 3DBEA 4YMJA 4FUXA 2R3MA 4G5JA 3NUXA 4BZNA 5AA8A 4UMTA 3POZA 4LI5A 3NW7A 5HLPA 3VUIA 5CVGA 4YC6A 3PDTA 4C3RA 2GNGA 3RCDA 4EQMA 2QKWB 4G17A 4S30A 3ZTXA 4L3PA 4O0UA 3BHUA 4TYEA 5I9YA 2BAJA 3HLLA 1XKKA 3VS4A 4R5YA 2RF9A 2PMNX 2YN8A 1IAHA 3G15A 3LMIA 4E3CA 3CS9A 4FVRA 4JG8A 4OR5A 4OBQA 2SRCA 5L6PA 3NYXA 2QD9A 3ORKA 3GBZA 1CKJA 1BUHA 2X6DA 4C4IA 1UNGA 2A0CX 1Y57A 3EHAA 3LJ1A 4I6FA 3R8ZA 3OWKA 1Z57A 4CXAA 4W4XA 3ZDIA 2YLEA 4CSVA 5KHWA 5KMJA 1ZY4A 4DEEA 4FV5A 2R3OA 3E64A 1PXIA 3OWLA 5J8IA 5LQFA 2DWBA 3HAMA 3NUSA 3R28A 4IM0A 4EK3A 1U5QA 4HYSA 4YJRA 2YCSA 3L9NA 4D4VA 3FXZA 2Y6MA 2OH4A 5EHLA 4FSUA 4ARKA 3FAAA 4DGOA 4FT5A 4K2RA 1LPUA 4Y83A 3TNPC 2DS1A 4QP7A 4GFGA 1GIJA 5JZNA 4ALWA 2A1AB 1IR3A 2C68A 3LAUA 4RX8A 2BZIB 4YPDA 4DG0E 4UZHA 2BMCA 5IDNA 5CSWA 3NUNA 4PL3A 2XIKA 3MVMA 3IG7A 2H8HA 4E4LA 3MH0A 2PVMA 4FTMA 2J7TA 2QLUA 3DT1A 2UZDA 3P0MA 3QYZA 5CENA 4AGWA 2XJ2A 2YJRA 3BX5A 3F3WA 4K0YA 4OT6A 3RINA 2GQGA 4G3CA 4QYFA 4WG3A 3MH3A 4ASEA 2YM8A 5EW3A 4F63A 3PY0A 3Q9XA 5ETAA 5HTCA 3R6XA 5IPJA 5K9IA 3F88A 5AV1A 2RG6A 3W18A 2CNUA 2C3IB 4FT9A 3GGFA 1PYEA 2B53A 4IW0A 4ERWA 4OTHA 3PZHA 5IZFA 4CKJA 3ZLWA 3PVWA 4V04A 2QOKA 3E7OA 4BIBA 4BCIA 3UO5A 5AAFA 2I0VA 4D2RA 3COMA 3DXQA 4NKSA 3H10A 3ZO2A 3WYXA 3M42A 5E8ZA 2QHNA 5GJFA 4RIXB 3O96A 3ZM9A 3ROYA 2YIWA 5DGZA 4GG7A 3EQFA 5FEQA 3TNWA 5J9LA 4RIXA 2R3KA 3CR0A 5CSPA 1BX6A 3EN9A 4FG8A 1F3MC 2R5TA 2WTKC 4FV3A 4TZRA 3W2OA 3NNVA 3ACKA 4YTHA 3FQSA 2GQRA 4L43A 2VAGA 3F82A 1R1WA 5LXMA 2W1HA 4UXLA 5ANKA 2CNVA 3L9MA 3VBXA 2OXXA 3H4JA 2WMTA 3QRTA 4QMTA 4HVDA 3V04A 1T46A 4DH1A 4FE2A 5ETCA 3PVGA 3KMUA 1UU7A 2WMQA 1YOJA 4FKLA 4U6RA 3MIYA 3PWDA 4I5MA 3TCPA 4NCTC 4NWMA 1G3NA 3TKUA 4JQ8A 4AW0A 2X9FA 2WD1A 4LYNA 3W8LA 2YDIA 4D55A 2CJMA 4FTUA 1SZMA 3VVHA 2C5VA 1M52A 3CPCA 4TRLA 3EN7A 4DFNA 2JITA 2JAVA 2XIYA 5CU6A 4AW5A 4EEVA 3WZKA 4GJ2A 1ZOEA 1UWHA 4QMPA 2C6LA 3R2YA 2YCQA 5DVRA 4FK3A 3ITZA 4U43A 5DMZA 5F20A 4YJPA 3TNHA 2QO2A 5D9HA 5TE0A 4EOPA 4EYMA 4HNFA 4E6QA 4LL5A 5A4LA 1YWRA 3NYVA 2C5OA 4IB3A 4HOKA 1O6LA 3OOGA 4O21A 3U6JA 2RFDA 4M15A 2GHLA 2W1EA 2XMYA 4D0XA 4DEGA 3ORLA 5A46A 4FSTA 5H9BA 5KKRC 3AD4A 3ZLYA 5DR2A 3CQWA 2HZIA 4CYJA 4EH5A 4ENYA 5HOAA 5M56A 2XEYA 4IM2A 1UU3A 2G9XA 3BYSA 2NRUA 1ZY5A 5DR9A 2VGPA 4A06A 5G6VA 3F7ZA 3IKAA 4AE9A 3OT8A 3VS3A 4MX9A 4BICA 3GC0A 3W33A 1XQZA 3W2CA 4E4XA 2JDTA 2QURA 3MPTA 4OUCA 5IEVA 5FM3A 3AD5A 5K3YA 1OL7A 4JLCA 3Q9WA 1UVRA 4PNKA 2RIOA 5J9ZA 3SW7A 4MXOA 4FT7A 2CKOA 2OZAB 3E5AA 5EH0A 4RJ4A 3L8SA 2PVLA 4YBJA 4CLJA 1H1RA 2HW7A 3MN3A 4RX7A 5CQUA 5EI6A 3DU8A 4DFZE 5IUGA 5JGBA 3MIAA 1WBWA 1PXJA 4FI1A 5HG7A 1KE6A 4YJUA 1URCA 1J3HA 2QOIA 3II5A 4IAFA 4O0XA 4FGBA 4PWNA 5FQDC 5C03A 4DBXA 3I81A 5DEWA 3CSVA 4JS8A 5HO6A 5HD7A 2QOLA 4H3PA 4FV6A 3ZUUA 1FINA 4UB7A 4Y85A 4K77A 4FKQA 2ERKA 3FSKA 3TZ8A 4GFOA 4EBWA 4QMUA 3O71A 3HMPA 3MFRA 4WBOA 4XV2A 2P2HA 2WGJA 4FODA 4IWPA 1H1PA 3QD0A 4BDGA 5EM6A 1UKIA 1Q8TA 3FLQA 4CKRA 4NK9A 3OCGA 4ZIMA 3OWJA 4FIIA 5KBRA 1S9JA 2HY0A 4M69A 4O6LA 1FOTA 4M3QA 4V05A 4GS6A 4ZSAA 3F7WA 4N0SA 3HZTA 1YW2A 3PY1A 4YO4A 1YWVA 3FLZA 3OS3A 1HCLA 2VTPA 3EB0A 4E8AA 1YDTE 4ZXTA 5C8MA 4QMNA 4ZTMA 5FXSA 2CN8A 2XM9A 3TJDA 5DT4A 2ETRA 5DE2A 5EI8A 5CI6A 1MP8A 4KSPA 2W99B 4IX4A 3NUYA 5BUJA 5LJJA 3Q6UA 3PP1A 4F08A 3OUKA 4QNYA 4HVGA 3PJ8A 4W8DA 4FC0A 4CFNA 2VD5A 3PXQA 4EOJA 3F9NA 3PY3A 3WIKA 5FD2A 2BKZA 3HMIA 2UW0A 3NLBA 5HVJA 4JL9A 3O50A 5AAEA 4IC8A 4R7IA 3TG1A 3UZTA 3ATSA 1ZRZA 3MA6A 4EC9A 5L6OA 4GW8A 4FL1A 5AP2A 3LQ3A 2V0DA 3ENHA 1VYZA 3DQXA 3EL8A 3UPZA 2V55A 1YWNA 3G33A 3D14A 3VUHA 5TKDA 4OTPA 1YXUA 3QXPA 4LMNA 1QPCA 2BFYA 2J2IB 3IW8A 5B2KA 4S34A 4AXAA 5AADA 3MTLA 1GY3A 5HU3A 4DCEA 1L3RE 4TXCA 4DEDA 1H28A 2XBJA 3FV8A 3UG2A 2QO9A 3IPHA 3GC9A 5CF5A 4AQCA 1M17A 2VTTA 4F0FA 3ZO4A 4FL2A 2C0TA 4BKJA 3E3BX 3ANRA 2ZMDA 3G51A 3S00A 5CS6A 2R3QA 2GNIA 5B2LA 1RJBA 5JSMA 5CAOA 3GU6A 4C36A 3O8UA 4BKZA 4NM0A 2WMAA 4ZZMA 4YSMA 3QWJA 4YUQA 3QCXA 2AYPA 4QMXA 2YCRA 3F5UA 2UW6A 4J71A 5HX6A 2WTJA 3WF8A 4XV3A 5T68A 4D4RA 4PQNA 4RJ5A 4ZY4A 1DAWA 1YHSA 2WAJA 3FI4A 3LPBA 4ZTLA 4GUBA 4DH7A 3W55A 4CTCA 3A7GA 3BYOA 5K0XA 4ZSGA 4P90A 3ZRKA 1H0WA 4BF2A 4G2FA 2GFCA 2V7OA 1NVQA 1JOWB 3EOCA 3GFEA 3OFMA 3SHEA 5A4QA 3N51A 5AA9A 4JAJA 5KMKA 2YLFA 4BFMA 4IHPA 4PTGA 5LVNA 2ITOA 3PVBA 4PMMA 5CSVA 5EI2A 5CASA 4RIWA 4G6OA 4YSJA 3MESA 2I0HA 2OJJA 4L46A 1JVPP 3WE8A 4FEVA 3A4OX 4GH2A 5LCKA 4BI2A 3DBDA 2R3GA 2EWAA 2JD5A 4FX3A 2WNTA 4XMOA 4DH8A 4O0TA 4L8MA 5DN3A 4MXYA 2W5BA 4DEAA 4FYNA 2I0EA 4EH4A 4M8TA 3PPJA 4LG4A 2WTWA 4JBPA 4O7LA 3D2KA 4UZDA 3ZO3A 5HE0A 2OXYA 1CKIA 2UW3A 5FLFA 1S9IA 3WF5A 5L6WL 4NL0A 3EQIA 3MY5A 5AEPA 3BLHA 4IZYA 2C30A 1OIUA 3FY2A 3Q5ZA 1PKDA 4IEBA 4FT0A 4OTGA 4QD6A 3EQRA 3CLYA 3SLSA 4F9AA 4KD1A 2F7EE 3BGQA 4WO5A 2R3NA 3NDMA 2WQMA 3SG8A 3V8SA 3QKLA 3CGFA 2PZRA 2RSVA 3G6GA 2Z7QA 3K5UA 4LGGA 4RVKA 4U8ZA 3JUHA 4G6NA 2OK1A 5CWZA 1DM2A 2ZV2A 2X8EA 3TL8A 2IVVA 4O0RA 4U44A 4ZTQA 4I5CA 2J90A 5T6KA 4ACGA 1H8FA 5HICA 1Q8WA 3FMKA 3KVWA 4IC7A 3HP2A 4ACDA 4EOQA 1MUOA 5IMXA 3AC2A 4U80A 3W16A 2CCIA 3OCBA 4GK4A 3JVRA 4CQGA 5I9ZA 4JG7A 4JDIA 4PV0A 4D1XA 5C8KA 2H6DA 5KZ0A 3RGFA 3AMBA 4MXCA 5C9CA 4C3PA 5HO7A 4XG8A 2O63A 5AMNA 5FGKA 2QHMA 3UP7A 2J0LA 4FA2A 5AP7A 1SVEA 5CEKA 4DG2E 5KBQA 2PZYA 3UE4A 3MY1A 4EOKA 3FYJX 3BHHA 5AV3A 5JFWA 2DYLA 3TUDA 2C5YA 1XH8A 3AGMA 3T9TA 3ZC6A 5M09A 4QMSA 4XH6A 3LFDA 1UNLA 2JIUA 3EQGA 2XBAA 4IX6A 5EW8A 4F7SA 5KCVA 3UMWA 3I60A 5HG8A 3F5PA 3LFEA 2UW8A 2HZNA 4IXPA 4J7BA 3NIEA 3U6IA 4JT3A 3QRIA 3QWKA 5LMAA 4A9SA 4D58A 3DK6A 4E93A 5AUUA 5DBXA 1DI8A 3RKBA 3K3IA 1WBNA 2CMWA 5FUTA 2YERA 3A4PA 3QZFA 4BDCA 3O0GA 3R21A 4A4XA 3I7CA 3UOKA 4CTBA 3S1HA 1UV5A 1B38A 2OBJA 4MF1A 2VWIA 5IH4A 3LXNA 5ANOA 4RVLA 3R01A 3UJGA 1FGKA 5HLWA 5E8VA 3BZ3A 4IIRA 5LMBA 3Q9YA 2W1IA 4F7LA 2ZMCA 4ACMA 1Y8YA 2ZJWA 2OG8A 2VX0A 2YCFA 2DQ7X 5H8BA 3WARA 2Z7SA 4CCUA 4B8MA 3V5TA 4AT3A 4RBLA 4NUSA 4LGDA 3QQLA 4X21A 3IQ7A 2VN9A 3Q2MA 4IVDA 4OTWA 4PPAA 2WTIA 2R3PA 5CEIA 1Q8UA 3KRRA 3P7BA 3R8PA 4X3FC 4FG7A 1OL2A 5A4CA 5EQEA 3UNKA 3LXLA 4TYHB 4GK2A 4MXZA 3VWAA 4HZSA 3RNYA 4BDFA 2B0QA 2B9JA 4S32A 4ASXA 2X81A 2ZV8A 3EQDA 3MWUA 4FF8A 5JFSA 4F7JA 2UZOA 4E6CA 4O2ZA 3LCTA 4HGTA 4PY1A 4EJ7A 1QL6A 4GVJA 4CLIA 2PULA 4EKKA 3NEWA 3N9XA 4FKSA 4AGUA 4M66A 2X7GA 3DK7A 5ANJA 4ZY6A 5BYZA 4F9YA 2UZNA 5CAQA 2GTMA 3OHTA 2F9GA 4RVTA 3BU5A 2UZEA 3GQLA 2HOGA 2GSFA 2FUMA 2PVRA 4A9RA 3DCVA 3HA6A 4HPTE 5M4UA 5JZJA 2Y8OA 5M4IA 1ZARA 3EIDA 3KXHA 3DQWA 3R7YA 2BZKB 3PSBA 2W96B 2IO6A 3QUEA 5EDRA 4Q5HA 4EK5A 3WZUA 1QPJA 3FL4A 1ZMWA 3EZVA 1OB3A 5FP5A 1PMUA 3FSFA 4JNWA 5AR2A 3HGKA 5AP0A 4C8BA 2JEDA 4DG3E 4L67A 2RKUA 5IU2A 3K5VA 4MD8E 3ODZX 4IM3A 5I3OA 5AUZA 2XNOA 3DAEA 3WZDA 4X2JA 2C5NA 1DAYA 4I5HA 4PP7A 4FIJA 2PU8A 5AFVA 4WIHA 3ZSIA 4EK8A 4R77A 4ZAUA 2WOUA 5KMIA 5FG8A 1QCFA 3FLSA 3OBJA 3QQGA 4DA5A 2QU5A 3E8NA 2B55A 4QMZA 3IGGA 2YJSA 3HUCA 4AE6A 5GZ8A 2OU7A 4FZ7A 3THBA 1OPKA 2G15A 2EXMA 1R78A 2XYUA 3HEGA 3MB7A 4MQ2A 5CT0A 4NW6A 5JQ8A 3EQCA 3C7QA 4YBKA 4MNEA 1KOBA 3LXKA 2GS7A 5IUIA 4DGGA 3TM0A 1SNUA 3UYSA 4YZCA 4O7RA 4KABA 2W5HA 2VU3A 4QTCA 3R8VA 3SXSA 3ZFXA 4LGHA 3BGZA 3QGWA 1V0BA 4FIEA 4ZS4A 2OJ9A 3HYHA 2A27A 4K18A 4LV5A 3CQUA 3UIMA 1JNKA 5AX9A 2B9HA 5A3XA 3VIDA 3OTVA 3MJ1A 1VJYA 4PRJA 4Y72A 2JIVA 5GINE 3SRVA 2GS6A 4FV2A 4L52A 3G2FA 5I9XA 3Q2JA 2XNEA 3R2BA 2RGPA 5TF9A 3TTIA 3WI6A 4U3ZA 3E8CA 4UMQA 5K5XA 3P9JA 2O5KA 4E26A 2WTCA 1FGIA 2ITUA 4CT2A 2OI4X 5DRBA 4BBMA 3FI2A 3QX2A 4FSNA 4FNXA 3UOJA 4J97A 4BGGA 5AR3A 3ZCLA 4GYIA 2HIWA 3V5WA 3BYMA 3IW5A 5GNKA 5CEQA 3DB6A 3SXRA 2B52A 2PZPA 3K3JA 3D15A 2X8DA 4ZTSA 3MVJA 4BCOA 2WQOA 2XF0A 2W9FB 5E8XA 3IS5A 2X4ZA 5BMSA 3ANQA 3TDWA 3I0QA 2V22A 2FH9A 3R30A 4EJNA 5M4FA 2EUFB 3Q4CA 3DB8A 4C59A 5AP6A 5AR7A 2W4JA 4K9YA 2JDRA 1R0PA 4DF3A 1W83A 5M55A 2GCDA 3BWJA 2C1AA 3BU3A 3FLWA 3PA5A 2WMWA 2VTJA 1WAKA 4LRMA 3FMMA 4NU1A 5CALA 3W10A 4K33A 2XK3A 3RM7A 4BGQA 5AUVA 3MYGA 3KULB 5D11A 3S3IA 4CZTA 4G9RA 1KV2A 2YHVA 4I21A 3AGLA 3JS2A 4QP9A 5HTBA 3R7IA 5JMSA 4U42A 2HZ4A 3CIKA 2ITXA 4EWQA 2DUVA 3GCSA 4GMYA 5I9UA 2ACXA 5ANIA 1M7NA 1FQ1B 3OY1A 3OVVA 1OIYA 2CGWA 1JKKA 5IA5A 3U9NA 4YGAA 3BEGA 3R1SA 4UYNA 4KS8A 2C6KA 2UZLA 3TKIA 5J5SA 5LVMA 5AUXA 3Q32A 3DBQA 3A99A 3FZTA 5A4EA 2XJ1A 1O6YA 4C4JA 4UN0C 4EQUA 4EUTA 3OXTA 3QTZA 5IA1A 2OJGA 3E3PA 3ZDUA 5HO8A 4YO6A 1ZAOA 2VO7A 3NAXA 4YJQA 4GU9A 5DRDA 3KRXA 3FZPA 2X39A 4YJVA 3SX9A 4FTQA 1SVHA 2ZB0A 3RK9A 2BPMA 4FTIA 3GNIB 4P5QA 3WF6A 4YC3A 4HCTA 5EM8A 4XEYA 3CXWA 1XO2B 1YI6A 1ZMUA 2Y4IC 4CRLA 5F94A 5KHXA 2I6LA 4KWPA 1W8CA 4KIQA 1EH4A 5BVKA 1CKPA 2QVSE 4QP8A 4JIKA 5A9UA 2VTIA 4KS7A 3D5WA 5CNOA 5IISA 4X2KA 1IRKA 3HKOA 5L3AA 1FVVA 4K1BA 3TI1A 4F4PA 5TT7A 1YXSA 4HZRA 3PIZA 4GT5A 3TZMA 2VWWA 2YIRA 3FMEA 4JR3A 3GU5A 4OW8A 3R8UA 1QMZA 4R1VA 1VR2A 4X6QC 3BGPA 2OIQA 3C4ZA 4WT6A 5IKWA 5A4TA 5IQAA 3V5PA 4L45A 3OROA 3BRBA 1GJOA 3EKKA 3FPMA 4F9WA 2ZB1A 4KA3A 2J9MA 4YJOA 4D2WA 2W17A 2VTMA 1GZKA 2PMLX 3BHVA 3FHRA 3G6HA 3A61A 3QTIA 3QX4A 4KKGA 5TR6A 4E6DA 2ZV7A 2ITVA 3CE3A 2VNWA 2YITA 3TZ7A 4TWCA 5CI7A 1YI3A 5HVYA 4IDTA 2C6EA 4NIFB 3QTXA 4NSTA 3R7VA 3QD2B 1Q24A 2REIA 4J99A 4IAYA 1BI7A 3GVUA 1PY5A 4NIFA 2VWBA 3ZSGA 3DKCA 1PYXA 2JIIA 1AGWA 5AUYA 2J5EA 4KRDA 3NW6A 3SOCA 4AZEA 3FMNA 2QODA 3H9RA 3O8TA 4II5A 4CFVA 4FZAB 5CZHA 2OIBA 2CDZA 3QA8A 1KSWA 4XG4A 3UTOA 3JXWA 4CEGA 1A9UA 2JAMA 4QOXA 3FPQA 5C4LA 4DITA 2F49A 3KCKA 2XB7A 2W4OA 4D5HA 2OXDA 2Z02A 4D5KA 5DPVA 3PPKA 2BRGA 2PE2A 2VNYA 2ITZA 2PSQA 2AC3A 4AFEA 4DGLC 2GHGA 5EDPA 4DBNA 1O6KA 2F2CB 4W4YA 4DEBA 4F7NA 4AZWA 3PXZA 1U59A 1Q41A 4NT4A 3KN6A 4WUAA 5IH6A 2C1BA 2PVJA 3VULA 5ACBC 3JY0A 4FV1A 2UW7A 4JBOA 4ANSA 4GT3A 3MSSA 1OECA 3LFNA 3GU7A 1K9AA 2VTRA 4UBAA 4CV9A 3KXMA 4O7WA 4I4EA 4ERKA 3T8OA 1E1XA 4C2WA 2G2HA 3EQBA 4BTKA 3UC3A 4KKEA 4ALUA 1IA8A 4Y8DA 3SOAA 4HW7A 3ZLXA 2WMVA 3UVPA 4GKHA 5HI2A 4J8NA 1PRYA 3QKMA 4LRKA 1GAGA 4UWBA 3HRFA 3TDVA 5J7BA 4F6SA 4IANA 3W32A 3KF4A 4A9UA 2QOOA 3QQFA 4IB0A 2C6DA 2CKQA 4L6QA 3GP0A 4CZYB 3QALE 3VS0A 1ZXEA 3HNGA 3QD4A 4ZSEA 3SV0A 4FTRA 2R7BA 4APPA 4RIOA 3C1XA 2BILB 3F5GA 4I93A 2PL0A 3P4KA 3A8XA 4BCHA 2OSCA 1XR1A 2VTLA 5HHWA 4R3PA 4MAOA 4MBJA 3UO4A 4FICA 4XG6A 2IZUA 4PDPA 3PWYA 1FBNA 5B2MA 5KMOA 1G5SA 3AD6A 3PUPA 5BNJA 4UWCA 4D2SA 4EHGA 2BUJA 4TT7A 3NYOA 5TOZA 3D5VA 4TWNA 4X7QA 4D1ZA 2G2FA 2BDWA 2WPAA 4AWIA 4C4FA 4XOYA 5DI1A 3BQRA 3L1SA 4U97A 1IA9A 4G3EA 3BI6A 2W9ZB 3DKOA 5E8TA 5K0KA 4EONA 3VF8A 1Y6BA 4GU6A 3CD8A 4X0MA 4RLKA 1JWHA 2GPHA 1ZZ2A 2EXEA 3EQPA 3OY3A 4WNKA 5GIPE 2J51A 4RRVA 2PUUA 4LUDA 1E1VA 4IH8A 2B9FA 5IF1A 5AJQA 3F3UA 3B8QA 2GU8A 1PJKA 2ZDTA 3A8WA 2WFYA 1FPUA 3BEAA 3QQKA 5AP3A 3P08A 4U41A 1WZYA 5IH5A 4KBAA 4AGCA 4L44A 3F2NA 2GDOA 2UZUE 4R8QA 3ZU7A 4RGJA 4EC8A 5EK7A 1JPAA 5CEMA 3R9DA 2HYYA 4J96A 5AP5A 3RTPA 5CEOA 4FSZA 5DR6A 3F3TA 5C26A 4CQEA 1K3AA 4DTAA 1TQPA 3HA8A 5IQEA 3LM0A 1XBBA 3FMHA 4GRBA 4XOZA 3MBLA 3COKA 1Y91A 2Z7RA 2EB3A 4USFA 5CY3A 3HRBA 2XKEA 3M1SA 4RZVA 4WOVA 4ZTHA 4QYYA 4XV9A 4DGNA 3RALA 2OICA 3BLQA 1FMOE 3LIJA 2VO3A 3D9VA 5AAGA 5BPYA 3O51A 3VBTA 4P5ZA 4AF3A 4CV8A 2JKOA 3A62A 1GOLA 3HECA 5L8JA 4BHZA 3SVVA 3SG9A 3FZSA 3TXOA 1H24A 4LRJA 1H07A 2RFEA 4D28A 4G9CA 2PY3A 2F57A 2OO8X 4FTOA 2OIDA 3KCFA 5HBJA 2PK9A 4HGEA 5HG5A 3UP2A 3KL8A 3VBVA 5B7VA 4CFUA 3S4QA 4BVUA 3T3VA 3FY0A 1M2PA 4Y46A 2C3JA 4W9WA 4FTJA 2YWVA 3FHIA 2IZTA 3JY9A 4FV4A 5M4CA 4PDYA 4AT4A 3OWPA 2PUPA 2XCHA 3IK3A 4O82A 2ITPA 4ITHA 4DH5A 4D4YA 4O81A 4UX9A 2XP2A 2X2LA 4KBCA 4BDEA 3AG9A 3P79A 4L42A 4RIYB 2QG7A 2OZAA 2XK9A 2GS2A 4GKIA 2HW6A 3R7OA 4ITIA 4RZWA 4C33A 1OKZA 3FLYA 5EM7A 3VO3A 2YAKA 2ZV9A 4U45A 3LFSA 4JDKA 4FOCA 3R9HA 4JQ7A 5F4NA 3FI3A 4XV1A 5H8GA 5AWMA 3DOGA 2EXCX 3B2TA 3MI9A 4FL3A 3EMGA 3QTQA 1CSNA 1XHAA 3LJ2A 4O0SA 4QT1A 1X8BA 3QQHA 5E8SA 4ID7A 1U54B 4ZSLA 3EKNA 4GJ3A 4IX3A 4KKHA 3D7TB 3IONA 1W84A 4BCQA 3ZONA 3LQ8A 4IX5A 4FUYA 3WE4A 3D7TA 3FXWA 2VTHA 5HIEA 4BL1A 3I1AA 4RG0A 5AM7A 3AC4A 5D41A 4CCBA 2VTNA 3NPCA 4OTDA 3R9RA 1JSTA 3GQIA 3NSZA 5DWRA 3QTWA 3TWJA 4BRXA 5M44A 3ORIA 4EUUA 1H00A 3C4CA 3HDNA 2XA4A 2YAAA 3PJ2A 4QMWA 3PG3A 4QP6A 5C27A 3C9WA 3GC7A 3EN4A 4BGHA 3ZRMA 4HVHA 4HGSA 2XEZA 4I0RA 4O7TA 5L2TA 1SNXA 2HXQA 4GFMA 4C3FA 4L3LA 2R9SA 3CPBA 1XWSA 4PF4A 4RWKA 3VRZA 1P2AA 1H25A 2P0CA 2W1ZA 3SA0A 1OKWA 3QRUA 5D7AA 2R2PA 3DA6A 3R1NA 4IJPA 3TTJA 4PL5A 2E2BA 3RPYA 3MFTA 3G0FA 4M0YA 4QMYA 3PXRA 4CG8A 2JDVA 3BV2A 3FQEA 1W82A 4R7HA 4IACA 5CVFA 4IE9A 4YP8A 4Q9SA 4QTAA 1YDSE 3TNIA 2OJIA 2W5AA 4M68A 2YIQA 1Q99A 2BVAA 5AR4A 1J1CA 3UOHA 4WUNA 2F7XE 4EOIA 2Y7JA 4RA5A 2RFNA 3BE2A 3KEXA 4AP7A 3GCVA 4O0YA 3ZO1A 4OAVB 4GSBA 4CGAA 2WMRA 3DBCA 1PXOA 2XZSA 2QQ7A 4N4SA 4NEUA 4PPCA 3PXKA 1YVJA 3VHEA 5FXQA 4BTMA 3TIYA 3ORMA 4EZ7A 4XX9A 3W2RA 4F1TA 1OPLA 3ZS5A 2UVZA 4AU8A 1KV1A 3C51A 2PMIA 3DKGA 4YR8A 2YDKA 1YHWA 4QQTA 4GEOA 2BFXA 2VTSA 4ONAA 4RX5A 4IAKA 2VO0A 3BBWA 1LR4A 4P7EA 3TEIA 4PTCA 5AIKA 2Z60A 3RAHA 1J7IA 3BV3A 1OMWA 2WKMA 5HIDA 2XNBA 3LM5A 4EYJA 1YXVA 3BIZA 4I6QA 3BHTA 4QQCA 5DIAA 3ORNA 5ANGA 1IASA 3VUDA 1Q4LA 3L8VA 1XH6A 5HE3A 3LZBA 4PPBA 3RP9A 2CKEA 4Z16A 3LMHA 5FDXA 4BWXA 1R39A 3QC4A 4BIDA 1ZOGA 4N6ZA 3I5ZA 4Z7GA 5BVFA 1TVOA 1H08A 1GZNA 5TO8A 3C0IA 4PTEA 2ITTA 4AOTA 2C3KA 3MB6A 2XNGA 4DAWA 3FZRA 3AC3A 4D2PA 3BELA 1PXMA 5CF8A 5IA3A 3HRCA 3QQUA 4MH7A 2YZAA 2YISA 3MGYA 4I5PA 4L00A 4H1JA 3RZBA 4DINA 3ROCA 3I5NA 4BCKA 3TV4A 5M57A 3DFCB 4QYEA 2C6MA 4EKLA 4I20A 3ULZA 3HL7A 4D2TA 1G8AA 5IA4A 2OJFE 4PP9A 3G90X 4PUZA 1YOMA 4E6AA 4DTBA 4MXAA 4WRGA 2HENA 4FKUA 1JLUE 5F9EA 3U6HA 5EQYA 4NYEA 3V8TA 5IQIA 1ATPE 3P7AA 3OT3A 3U4UA 4R78A 3B2WA 2IW6A 4R5SA 3ZRLA 5JRSA 3LLAA 4QMLA 5ITAA 4FV9A 5LARA 1KUTA 4MXXA 5T3QA 4RQKA 3QZIA 2JLDA 4K11A 4CKIA 3O7LD 2C47A 5GIOE 3FKLA 3R9NA 4UMRA 2VWZA 1OIRA 3DJ7A 2HY81 2YM5A 1UA2A 1QPEA 2IVUA 3HV4A 3ZZWA 1NY3A 1GNGA 2R0UA 3KA0A 3UIXA 2QU6A 3WOWA 4AW1A 4O38A 4RA4A 2WMSA 1YQJA 5EW9A 5F95A 3ZMMA 4Z7HA 3R7EA 3CQEA 4A4LA 3IO7A 3LW0A 2C3LA 4G34A 3F66A 4FEQA 1YKRA 3D7ZA 3EFKA 5E8UA 4AT5A 4WA9A 5ICPA 5IUHA 5D1JA 5EOBA 3NRMA 1LUFA 3LFFA 4FTTA 4R1YA 3ZSHA 3D83A 2UW4A 5IQCA 3QXOA 4EBVA 4I4FA 2C6TA 1H4LA 1V0PA 1ERKA 3KF7A 4QQJA 3RHXA 2QONA 4ZK5A 2BTRA 3FBVA 1FVRA 3UO6A 2LGCA 4NTSA 4O7VA 1CM8A 3ZYAA 3DTWA 4F09A 2F4JA 2RL5A 3VQUA 4RFZA 4RMZA 3QL8A 3V5QA 4IMYA 1R0EA 3VJOA 4YTFA 2JFMA 2OH0E 3ERKA 5HCZA 3O2MA 4TN6A 3AC1A 5E90A 3CTQA 4QQ5A 2JBOA 3AT3A 4FKTA 4C57A 2YWPA 1REKA 2HWOA 3P5KA 4BCPA 5FWKK 2B4SB 5K4JA 3S0OA 2OFVA 3MTFA 2J6MA 5CVHA 1Y8GA 5D10A 3RWQA 4ZLZA 1L8TA 1WVXA 4DGMA 3ORZA 2UV2A 2YM6A 1OPJA 5JH6A 1WBTA 2B54A 1RDQE 5L2SA 2QI8A 5HCXA 4E4MA 4MWHA 2A2AA 3CTJA 4YHFA 5IQFA 3DDPA 4TYHA 3NNWA 3CKWA 5DYJA 3E88A 4DT8A 1B39A 4LMUA 3FZ1A 5L2IA 2QOHA 3P78A 3FQHA 1RW8A 2IZRA 3IOKA 4MEDA 4RWJA 3P86A 3TZ9A 3RPSA 2BRNA 3BE9A 4K6ZA 2XKFA 3BQCA 3NVKI 4KBKA 2YEXA 3DZQA 4G3DA 4EH3A 3MDYA 4MK0A 2UZBA 2QG5A 4YHTA 3VW6A 4AZVA 5CAPA 5CF4A 3I4BA 2R3HA 5HGIA 3QYWA 1PHKA 2E9VA 3VN9A 2B1PA 3ID6C 1IEPA 4FTAA 4BDHA 4QMVA 1NW1A 1Q5KA 3ODYX 1XH5A 3TUBA 5HZNA 5B0XA 1NT2A 2BKKA 2VX3A 4JAIA 5CAVA 2H9VA 2ERZE 3PRFA 2X4FA 4RPVA 2QNJA 1WCCA 5ETFA 4QYHA 4EK6A 3GC8A 2JDOA 2BROA 4JBQA 3P7CA 3QUDA 3A60A 2I7QA 1U5RA 4ANOA 3ZUVA 4BKYA 5ETIA 4F1OA 2J0IA 2O2UA 4EH9A 4QPMA 3NW5A 4ANQA 3Q4TA 5GHVA 4FSQA 3QRKA 2VTOA 4FT3A 4DTKA 2WO6A 4XBUA 5FTOA 3V5LA 3ZZEA 2UVXA 2QCSA 4QPSA 4Y5QA 3NVMB 3GU4A 4RFYA 4DFUA 3VS1A 5JN2A 2E9PA 4QP3A 1OI9A 3BLRA 4QTBA 4GIIA 4FZ6A 5KO1A 2VWVA 4YTCA 1MQBA 4KIOA 4QYGA 2GQSA 1AD5A 2AC5A 1W98A 2W4KA 5CNNA 4KB8A 4EI4A 3O8PA 3PP0A 3ZFMA 3I7BA 3FJQE 4O86A 5JFXA 4BDIA 4MVFA 4CYIA 2ZOQA 3S2PA 4FKRA 3NR9A 1YXTA 4FSWA 4YLLA 3IOPA 4IAAA 1SM2A 5AM6A 2YA9A 2NRYA 2VWUA 4FZFB 3TACA 3SDJA 3BBTB 3W8QA 4AOJA 2EU9A 2VWXA 4I0TA 5L2QA 3TNQB 4BWPA 3ORPA 2BIKB 4O0VA 4TW9A 4H58A 4L3JA 1U4DA 4JX7A 3W2SA 4EHZA 3MVHA 2HXLA 4H39A 5I9WA 2QLQA 5I4NA 3F5XA 1R3CA 4J95A 1PXNA 4EOOA 3R1QA 3WILA 1P4FA 1JKLA 4Y95A 4YLJA 2WEIA 3LCSA 2OFUA 2XCKA 4WRSA 3WZEA 1RQQA 3BPRA 3PG1A 3PE2A 3RCJA 5A6OA 2OGVA 2XUUA 3HMOA 2GMXA 4Q5EA 3VBYA 4YNOA 2PZIA 4HCVA 4D1SA 3AOXA 4C7TA 3OF0A 3PVUA 4EORA 2R64A 3AMYA 2CHLA 5BMMA 5H3QA 5M08A 2I40A 2HAKA 3ZOSA 4PDSA 2QR8A 3O7LB 4BI0A 3W1FA 4YZNA 3MJ2A 2W7XA 4ZS0A 4ZOGA 5IDPA 2OWBA 3VQHA 3R9OA 3I79A 1MRYA 2ONLA 1CTPE 4IB1A 5E92A 4H3BA 4NTTA 3AT2A 4P4CA 4LL0A 3ET7A 3H3CA 3KXZA 3N4VA 4KNBA 3BU6A 3VUTA 4RVMA 2ITQA 4OBOA 3RHKA 4YZBA 4I92A 4PDOA 1TQMA 4IFCA 3BKBA 4YJNA 4IBMA 1CDKA 4FYOA 3QCSA 2X7OA 2F2UA 3R22A 3KULA 4XJ0A 4L01A 5EHYA 3KY2A 5K4IA 3FYKX 3NIZA 4IZ7A 2VUWA 4ACHA 2BZHB 1A06A 4RX9A 4L9IA 4XS2A 5CT7A 3U9CA 4BCNA 2PMOX 2Y4IB 4U81A 4E5AX 1OL6A 4AG8A 4O7SA 3COHA 1T45A 3FZOA 3EWHA 3NGAA 5CSXA 3QF9A 2IWIA 2QOBA 1Z9XA 2YIXA 4JQEA 4BZOA 4F9BA 2BRHA 4D0WA 3IECA 3DAJA 4FBXA 4EHVA 1XBCA 4IWOA 1OKVA 3L9LA 4FV8A 4RWLA 5F1ZA 2BDFA 4O6EA 4DLJA 4IAIA 1PMNA 4E73A 3PXYA 4KIKB 2BTSA 3N4TA 4FK6A 4A7CA 1PXKA 4IDVA 5CF6A 4KIKA 3POOA 2X1NA 3RVGA 3BCEA 4J8MA 2O0UA 1ZYJA 4USDA 4C38A 4ZZNA 2OKRA 3QGYA 2P33A 1OGUA 2XIZA 5BVNA 1H01A 3L8XA 3E93A 5IA2A 2XRUA 1ZLTA 3KQ7A 3QFVA 4Z55A 4BDAA 5EKOA 2J0KA 2VTQA 3DXPA 3QHRA 4P2KA 3MY0A 4FKPA 3T3UA 3LXPA 4XLVA 3R00A 5CANA 4MWIA 5CXHA 3GEQA 4U9AA 1P4OA 3Q3BA 4YJSA 4APCA 1O9UA 3SGCA 5BUIA 4A9TA 1VZOA 1JKTA 2IN6A 3JYAA 4UMPA 1MQ4A 4MKCA 2PTKA 3PE1A 4BCGA 3LLTA 1MRUA 1Y6AA 3ULIA 5HKMA 5L8KA 4JR7A 3NCGA 3EQHA 4RFMA 5DA3A 1PXLA 5EHOA 4M14A 3HVCA 5FBNC 1WVYA 4AA5A 2XM8A 5HVKA 4QMMA 5BVWA 1V0OA 4NJDA 4XP3A 3R7UA 1UKHA 4J98A 4FSYA 4FKVA 2X6EA 4BCFA 3KK9A 3ATTA 4FEXA 5FRIA 2PWLA 4WSQA 2OF2A 5FEEA 2BZJA 2X0GA 3Q60A 4F0IA 5GZAA 3UIBA 2CGUA 2UW5A 3HDMA 2Z7LA 3BHYA 5J1WA 2VX1A 4L7FA 2NP8A 4EZ5A 4TNDA 4LOQA 4DN5A 5JRQA 5AR5A 2VV9A 1YDRE 3ELJA 4DEHA 3NYNA 1JBPE 3P1AA 3PRIA 4OT5A 4DYMA 4QTDA 5KZIA 3IW4A 4F99A 2ZAZA 3G5DA 2OW3A 4M97A 5ANDA 2Y4PA 5HEZA 2NO3A 2X2MA 4CG9A 2XJ0A 3OCSA 4M67A 4ASZA 3ENMA 4L7SA 4BB4A 5J1VA 3VS6A 1UU9A 3TV6A 4A9YA 2PUNA 4JI9A 3AT4A 4FNYA 5JT2A 1F0QA 4B6LA 3EL7A 3HV6A 2HK5A 4AUAA 3DZOA 3LCKA 3KU2A 3VUGA 3QAME 5HE2A 3RMFA 5KMLA 4XUFA 3LQ5A 3OBGA 3QC9A 4FZDB 3GB2A 4LQMA 2J0JA 4RQVA 4CRSA 3SQQA 5LVPA 3GFWA 4FKGA 3OP5A 4QP4A 4TYJA 3ETAA 4W8EA 4Y5HA 4ZY5A 1REJA 4M0ZA 3G9LX 5CQWA 3QZHA 3FC2A 2BRBA 1H26A 4I1ZA 4YC8A 1Q8YA 4FTNA 4KRCA 5HX8A 4C2VA 3GOKA 3VAPA 5IEXA 3U87A 3NS9A 3DFAA 5JFVA 2WTVA 3QA0A 3SAYA 3JR1A 1OVEA 1DS5A 4TWPA 5FDPA 3E8DA 3RPVA 4LV8A 1J7UA 3RBWA 2R0IA 2WU7A 2YIYA 3OMVA 2WTKB 2PPQA 3RZFA 3NX8A 2ITWA 4U79A 4ACCA 3ORXA 3DPKA 4MD7E 1ZOHA 4BWKA 3KB7A 3CJFA 3L9PA 4HYIA 4YHJA 4GL9A 4IVBA 1YRPA 5AV0A 4ANBA 5A14A 3Q9ZA 5BVOA 3IGOA 4ZEGA 2OF4A 3KRJA 3UC4A 3NMUF 5HU9A 1KWPA 4N70A 4IVCA 3I0OA 1ZYLA 5BX0A 2CLXA 3QZGA 4E5WA
chains in the Genus database with same CATH superfamily
5JGDA 4J53A 4MTAA 4CMOA 3RPRA 5L2WA 4NCTA 4IFGA 5DLSA 4JBVA 3ZM4A 3R1YA 4DFXE 4CVAA 1DI9A 1OL1A 5EM5A 4ZJIA 5I9VA 4Q2AA 3UYTA 5BYYA 4O7YA 5FBOA 3DY7A 3EZRA 5E91A 1WVWA 5DFPA 3DBFA 1UWJA 4O7NA 4FKJA 5LMKA 4DFLA 2XK8A 3F2AA 5HESA 5J87A 3RAKA 3ZHPC 4JIAA 4ZMFA 4RWIA 3ZLSA 2Q83A 3PLSA 3UDBA 4GIHA 3KREA 1FMKA 3Q53A 4EH8A 2XH5A 4O27B 4CNHA 5I5ZA 4G5PA 3HAVA 1OL5A 3R73A 2IJMA 4H36A 3LCDA 5AR8A 4R6VA 3TN8A 4W9XA 4LOPA 3CJGA 2XAOA 1E9HA 5KKRB 5DNRA 4TL0A 2H34A 3FC1X 4BTJA 2Y9QA 3PFQA 5L4QA 5AIRA 2FGIA 1M2QA 1NA7A 5LVOA 2WMBA 5IMEA 4FSRA 4KAOA 2IF8A 2H96A 3IDBA 3JVSA 2B9IA 4RC4A 2XKCA 2HWPA 5IEYA 4O91A 3OUNB 4IQ6A 3S95A 3FXXA 4HYHA 2JKMA 3TKHA 4E20A 4UMUA 3LFQA 4AAAA 2JDSA 3CD3A 4FV0A 4EOLA 4TWOA 4XRLA 2C4GA 3C50A 3UQFA 4AA0A 5BVDA 4JMQA 2I0YA 2BAQA 2O64A 5LOHA 2PYWA 5CSHA 2C6OA 2GNJA 3UPXA 3LKMA 2C69A 4I3ZA 4TKSA 3K2LA 5DH3A 4NZWB 1WBOA 2I1MA 5DOSA 4DH3A 3OC1A 4RJ7A 2XIRA 3VBQA 4EH6A 5LMKC 2Y6OA 3C4XA 1FVTA 4QTEA 4RSSA 3WF9A 2R3JA 4WNOA 3HP5A 2W0JA 2WIPA 4L53A 4FNZA 4AFJA 4RC3A 1BL7A 3LFBA 3AMAA 4MBIA 3FMJA 4IB5A 3QCQA 4BTFA 5DHJA 3QUPA 4LUEA 2ZM4A 5M06A 1AQ1A 2R7IA 3C4WA 2X9EA 4GG5A 2G1TA 4ZP5A 3D5UA 4PX6A 4LM5A 3RAWA 4AN9A 4YZMA 5FTQA 4ANLA 3CEKA 2BR1A 2CKPA 3MH2A 2IVTA 2PVYA 1GIHA 2WTDA 4RIYA 3UNZA 2JC6A 4AGDA 1JQHA 3R04A 4HVSA 1W0XC 2XNPA 2J50A 4UWYA 2RFSA 3QRJA 2PVHA 3SD0A 3VF9A 4D2VA 4F65A 1Q97A 4R3RA 2ZM3A 3H9OA 4I0SA 3TUCA 2P4IA 4GVAA 2FYSA 4DEIA 4BCJA 2IZSA 3UQGA 3A7HA 3GENA 4FVPA 2WQNA 5K5NA 4ZLYA 3MFSA 5EFQA 4EQCA 3C13A 3C0HA 2NNWB 2VGOA 4FMQA 4G3FA 4HYUA 4JRVA 1OBGA 4TPTA 1XH9A 1U54A 4B99A 3UOLA 4MNFA 3NWWA 4WG5A 2G01A 2WMXA 3QQJA 2WZJA 3PIXA 5M51A 5FP6A 3OW3A 4I6BA 1WMKA 3DKFA 4X3JA 4XG7A 1QPDA 3MPMA 3QKKA 3ALNA 5FTGA 3OXIA 3E92A 4FTCA 3AQVA 5LVLA 4JX3A 4NM5A 4ZTNA 3ZXZA 1CMKE 4UXQA 2FSLX 4QMQA 2XNNA 3VNTA 4OGRA 4YTIA 2FVDA 2UZVA 1WBSA 4KIPA 3DK3A 2R4BA 4HGLA 3TMOA 4IAZA 3R0TA 4JXFA 1BLXA 4UY9A 1ZYDA 3HMNA 3CTHA 3ORTA 2GNHA 4X2GA 5DG5A 3U8WA 1TKIA 3UVQA 3MPAA 5ANEA 4Z3VA 4KSQA 3BYVA 2XNMA 3C0GA 4M69B 4MD9E 3FUPA 4XP2A 3R8MA 5JK3A 3FMLA 1ND4A 4GUEA 3KGAA 4WHZA 3UIUA 3P5JC 4D9UA 5IQGA 1OUYA 4XRJA 4S2ZA 4XLIA 3ZBXA 4C37A 2JFLA 3PA4A 4TTHB 3QTUA 2QR7A 2WOTA 3V5JA 4BIEA 3EFLA 1XBAA 5EYCA 4IJ9A 4ANNA 3CGOA 3OEFX 1P5EA 4G16A 3V51A 3IW7A 3DV3A 4RT7A 3PIYA 4U3YA 4FIGA 2CSNA 2Z2WA 4BDJA 4BCMA 4B9DA 3FEGA 1BI8A 4C02A 4D9TA 3U54A 4Q9ZA 4YU2A 4K8AA 4OTFA 4J52A 1OBDA 4AZTA 3NUAA 5KNJA 3DNDA 4FKOA 2E9OA 2IW9A 3FE3A 4QDEA 4FTKA 3WYYA 3I6WA 4XG2A 5C1QB 1IAJA 2PHKA 5D7VA 4DHIB 5HG9A 4E7WA 2ZYBA 3EYHA 2VO6A 4JJRA 1LEZA 4UALA 4O0WA 3W2PA 2WHBA 1BL6A 3AC8A 3Q4UA 1OITA 3RPOA 3TV7A 4O83A 2P3GX 2E9UA 2ZDUA 1KE7A 4BY9E 2X0OA 1YI4A 1IG1A 3SC1A 2ITYA 4X2NA 2C0IA 3M11A 3IDCA 5IQHA 4O4DA 2XRWA 3CC6A 4QP2A 5H2UA 1GZOA 4G6LA 4IZ5A 3ZFYA 5HORA 3GCUA 4DE4A 3LOKA 3VBWA 1M14A 5AP1A 4DCAA 5EOLA 3V3VA 1H27A 2W1CA 4BDBA 3WBLA 4YURA 4RJ3A 1SMHA 4BBFA 3COIA 2PE1A 2W06A 1YHVA 4ZTRA 4JDJA 4XG9A 3HMMA 2YM4A 4BDDA 5H8EA 1KOAA 3EYGA 2UW9A 3D5XA 2J5FA 3Q5IA 4QP1A 1K2PA 1NVSA 2KULA 2WMUA 3ACJA 3D0EA 2FSMX 3MH1A 3EN6A 3VW8A 3F6XA 4PMPA 4IWQA 2NYAA 3QBNA 2E9NA 1B6CB 3KK8A 3W2QA 3BYUA 3VJNA 3QD3A 1BYGA 2O3PA 4PL4A 3QTRA 3WF7A 1J1BA 1W7HA 5EYMA 4UV0A 3RK7A 4ZJVA 2R3RA 3AKLA 3GXLA 4U5JA 3GOPA 4A07A 4CFMA 4NFMA 4RIWB 2OLCA 2QOCA 1VEBA 5LCJA 4BR3A 3REPA 2CNQA 4Z9LA 4EL9A 4FR4A 1NXKA 5DEYA 4I6HA 5E8WA 4QDVA 3P23A 1NVRA 3R8LA 4X6RA 2QKRA 4FGRA 3E8EA 4FEWA 2W1GA 4TYIA 3R63A 3VRYA 4O1OA 4WNPA 5IG1A 5EYDA 2B7AA 3Q04A 2VWYA 2Q0NA 5JQ5A 4C0TA 3VS7A 3MS9A 5M07A 1URWA 2BHHA 2W05A 3CY2A 4YLKA 5C8NA 1A48A 4ITJA 4EZ3A 3QLFA 3UVRA 3CY3A 5AX3A 1Q8ZA 2GTNA 4N6YA 1KE9A 4W4VA 3R02A 5AUWA 3DDQA 3IDPA 5JKGA 4HPUE 2BIYA 2Q0BA 3EH9A 4NJ3A 5KE0A 3UZRA 1JSUA 4RJ6A 5D12A 3DJ5A 4WBBB 4GT4A 3KXGA 5CAUA 3E62A 3ZH8A 1RE8A 4WKQA 5BVEA 2YFXA 4G31A 4XNEA 4C4EA 2XK7A 4F6UA 5GJDA 2PE0A 4EK4A 3B8RA 3KFAA 3GCQA 3NAYA 5KMMA 3WIGA 5I0BA 3E87A 1Q3DA 4FVQA 3NCZA 5CYIA 3UMXA 2FSTX 4DFYA 2JBPA 4IWDA 2ITNA 3RM6A 2ETMA 2ETKA 4HJOA 1VYWA 4EWHA 5EDQA 4E5BA 4EOSA 3TIZA 2C6IA 2JGZA 4UYAA 4IADA 4NW5A 4DLIA 2IW8A 3UGCA 1ZYSA 1PXPA 1PW2A 3QCYA 4S31A 2FA2A 2AUHA 3F2RA 4RLLA 5BQ0A 4EH7A 3OTUA 4X3FB 4EHEA 2GNFA 1ST0A 3DXNA 3D4QA 2CGVA 4LFIA 3FKOA 4X3FA 5EYKA 3O23A 4NH1A 3NZ0A 3V8WA 4OLIA 3DTCA 4EOMA 3ZUTA 5J5TA 1OM1A 3HV5A 3OG7A 1PF8A 1ZZLA 4RC2A 3ZXTA 5AV4A 3KKVA 2J0MB 3D94A 3UNJA 1I09A 3A7JA 1WBPA 4HVIA 2O65A 2WELA 4WNMA 2BAKA 5DT0A 3KRLA 3DJ6A 4R3CA 2BDJA 4AA4A 3PA3A 1XH4A 4KUJA 5J9YA 4M12A 3K54A 3OW4A 4BDKA 1ZMVA 4JG6A 2FB8A 3Q52A 3O5AA 2CPKE 2IPXA 3NUPA 3UODA 3Q6WA 4C58A 3FL5A 4CFFA 3MV5A 5KMNA 4ZSJA 5GJGA 1M7QA 3C4EA 4C4HA 2C5XA 4IZAA 1WBVA 3R83A 4CFXA 1Q3WA 2UZWE 3H0YA 4OTRA 2V7AA 1ZWSA 4G3GA 4MCVA 3RWPA 3FWQA 3ZC5A 4C62A 2UUEA 4J1RA 5HQ0A 2EVAA 4F70A 3Q4ZA 3VUKA 3ZEPA 4W4WA 5HBEA 5BYLA 4BYJA 2QOFA 3DNEA 3KRWA 3LFCA 4O22A 5C4KA 1OIQA 1ZYCA 4JOAA 3PUFC 4AN2A 4AW2A 3KXNA 4ZZOA 4FOBA 5A54A 3F3VA 3E7VA 4B0GA 4NKAA 1XJDA 2YZLA 4FV7A 4CMUA 5IQDA 4H05A 4H1MA 3JPVA 2HCKA 4FIHA 4DHFA 5E1EA 3KN5A 4FIFA 1G8SA 3E63A 4CMTA 2YDJA 4RJ8A 3FI8A 1JSVA 4C61A 3ZBFA 2R3IA 2HELA 3HUBA 4UEUA 1KE8A 5HD4A 4C34A 3D2IA 4PMTA 3EN5A 3ZEWA 4NM7A 5A6NA 2WB8A 5CZIA 2KTYA 3PSCA 3KC3A 4GV1A 4F6WA 3BWFA 4MHAA 3CCNA 4TY1A 4O7ZA 5CTPA 1UU8A 4DDIA 3HX4A 4ZMEA 3A7FA 4CT1A 2PZ5A 2XAMA 3H30A 1U46A 3OEZA 5ACKA 4I24A 3F69A 2V5QA 1YOLA 2PVKA 2EB2A 2YABA 3FKNA 3MVLA 5CU2A 1SVGA 5HBHA 4CFWA 3LJ0A 4F1MA 2ESMA 3UQCA 4PNIA 3RAIA 3QHWA 1YXXA 2XYNA 4HNIA 3VS2A 4E1ZA 3PZEA 1APME 2X7FA 3CP9A 1GZ8A 2WQBA 4O2PA 4XG3A 3RNIA 4GK3A 4XCUA 5C01A 4ASDA 5IQBA 4BHNA 4FKWA 3IW6A 4L68A 1PKGA 1J7LA 4QMOA 3ALOA 4XYFA 3G9NA 2GHMA 2PVNA 4U7ZA 2CN5A 3TYKA 3F61A 3R71A 4AZFA 3G0EA 3UBDA 3F3ZA 5IA0A 3KMWA 3Q96A 4FSMA 4TYGA 1W2FA 3QLGA 4B4LA 3EJ1A 3KMMA 2QO7A 4NM3A 5BUEA 3OCTA 3UG1A 5GZ9A 2Y0AA 3MFUA 3GT8A 3NNXA 1HCKA 4M7IA 4MNEB 3PJ1A 2V62A 4XBRA 1H1WA 3PPZA 1GIIA 3EFWA 3V01A 3V6SA 5CX9A 3WZJA 3MA3A 3DLZA 2JKKA 4BBEA 4MF0A 4FKIA 4OTIA 4XHKB 1Z5MA 4C4GA 5HE1A 3C4FA 2CLQA 5FEDA 2WEVA 4YZDA 1JAMA 5LWMA 4N57A 1SYKA 5HNIX 4WSYA 4TNBA 1WFCA 3U4WA 3LE6A 1H0VA 3SRVB 4O1PA 4ALVA 5KUPA 4U40A 4B8LA 5L8LA 4MQ1A 3PJCA 2UZTA 1OUKA 4X2FA 3FLNC 2F7ZE 3EFJA 2Z8CA 3OD6X 4FG9A 3NUUA 2W1DA 3C5UA 3HV7A 5J7HA 2XK4A 4YPSA 4O4FA 2OZOA 2O8YA 4PMSA 4I23A 3LFAA 2X2KA 3CKXA 1M2RA 2HZ0A 4BYIA 4ENXA 1BKXA 2BCJA 2J4ZA 1PMVA 2WXVA 1JKSA 3DLSA 4KINA 2UVYA 3KXXA 3PTGA 3U51A 3N4UA 1P14A 3AXWA 2LAVA 2P55A 3GUBA 5E9EA 4G1WA 2PUIA 5CU4A 5AV2A 4DFBA 4GYGA 2CGXA 1TQIA 1I44A 2A4LA 5EQPA 3OXZA 4WD5A 1OZ1A 3TJCA 1KE5A 2VRXA 2G2IA 5CU0A 2X8IA 2VTAA 5HCYA 2GFSA 2R3LA 3VONA 2QC6A 3R7GA 3C5IA 3UZPA 2XKDA 3CBLA 4AXFA 4E4NA 4O96A 2XVDA 3LHJA 5KX8A 5CU3A 3VUMA 4OBPA 1J91A 5JGAA 2IG7A 4MYGA 1OKYA 2XK6A 3A7IA 4V01A 4A4OA 1F5QA 3OZ6A 4AZSA 3GI3A 4ZJJA 4F9CA 2FO0A 2GNLA 4M84A 1STCE 3H0ZA 3QU0A 4AACA 4D4SA 5M53A 2JKQA 5EG3A 4HCUA 1LP4A 3H9FA 4ZLOA 3PJ3A 4R7BA 3SKCA 1Q62A 1XH7A 4JRNA 4OAUC 2ZM1A 4IVAA 5JEBA 1V1KA 5LWNA 5I3RA 4AS0A 4B7TA 4F0GA 3L8PA 2ZVAA 4GCJA 4CD0A 4FTLA 1BMKA 5HLNA 4U0IA 1LEWA 2XIXA 3GCPA 3LMGA 4USEA 4NFNA 5FM2A 5J79A 2WIHA 4C35A 4I22A 2FSOX 4AQKA 5G1XA 4F64A 3FMDA 2ONLC 5J95A 1MRVA 2BRMA 4AX8A 2RG5A 3SXFA 3MW1A 3PYYA 3DAKA 1H1QA 4QPAA 1H1SA 4JDHA 2YM7A 3RK5A 4ORKA 2VZ6A 4LOOA 4OTQA 4AOIA 3AC5A 4H3QA 4M13A 5AP4A 4BN1A 2QOQA 3HV3A 3DGKA 5CLPA 5E1SA 4BI1A 2NPQA 4DC2A 3U55A 5CXZA 3V6RA 1UNHA 4EH2A 1Q61A 4QO9A 5HNGA 2WU6A 3TT0A 4CZUA 3AKKA 5HTIA 3PXFA 2WQEA 4S33A 3RI1A 3SW4A 3NNUA 5E7RA 4DT9A 3KVXA 4O84A 4WG4A 3M2WA 2P2IA 4FNWA 5DT3A 3W0OA 2C0OA 2W1FA 3VS5A 4O4CA 5HIBA 3T9IA 2XS0A 3PLAE 2BALA 4ANMA 3VC4A 4I41A 5EKNA 5FXRA 5AUTA 3PSDA 4YZ9A 4MBLA 2PVFA 3I6UA 3OOMA 3QTSA 2CCHA 3DS6A 3LCOA 2YACA 5HNBA 3FDNA 4YJTA 4AN3A 4XP0A 1HOWA 2IVSA 4QNAA 2R3FA 1PMEA 2YM3A 3LVPA 4JVGA 4V0GB 4YNEA 3NFGB 4V0GA 5E8YA 4FEUA 5E4HA 4BC6A 2BHEA 3VHKA 3A2CA 4QRCA 2A19B 3RJCA 4Y73A 3GU8A 4I94A 5CEPA 3O17A 4BZDA 3DBEA 4YMJA 4FUXA 2R3MA 4G5JA 3NUXA 4BZNA 5AA8A 4UMTA 3POZA 4LI5A 3NW7A 5HLPA 3VUIA 5CVGA 4YC6A 1ST4A 3PDTA 4C3RA 2GNGA 3RCDA 4EQMA 2QKWB 4G17A 4S30A 3ZTXA 4L3PA 4O0UA 3BHUA 4TYEA 5I9YA 2BAJA 3HLLA 1XKKA 3VS4A 4R5YA 2RF9A 2PMNX 2YN8A 1IAHA 3G15A 3LMIA 4E3CA 3CS9A 4FVRA 4JG8A 4OR5A 4OBQA 2SRCA 5L6PA 3NYXA 2QD9A 3ORKA 3GBZA 1CKJA 1BUHA 2X6DA 4C4IA 1UNGA 2A0CX 1Y57A 3EHAA 3LJ1A 4I6FA 3R8ZA 3UDSA 3OWKA 1Z57A 4CXAA 4W4XA 3ZDIA 2YLEA 4CSVA 5KHWA 5KMJA 1ZY4A 4DEEA 4FV5A 2R3OA 3E64A 1PXIA 3OWLA 5J8IA 5LQFA 2DWBA 3HAMA 3NUSA 3R28A 4IM0A 4EK3A 1U5QA 4HYSA 4YJRA 2YCSA 3L9NA 4D4VA 3FXZA 2Y6MA 2OH4A 5EHLA 4FSUA 4ARKA 3FAAA 4DGOA 4FT5A 4K2RA 1LPUA 4Y83A 3TNPC 2DS1A 4QP7A 4GFGA 1GIJA 5JZNA 4ALWA 2A1AB 1IR3A 2C68A 3LAUA 4RX8A 2BZIB 4YPDA 4DG0E 4UZHA 2BMCA 5IDNA 5CSWA 3NUNA 4PL3A 2XIKA 3MVMA 3IG7A 2H8HA 4E4LA 3MH0A 2PVMA 4FTMA 2J7TA 2QLUA 3DT1A 2UZDA 3P0MA 3QYZA 5CENA 4AGWA 2XJ2A 2YJRA 3BX5A 3F3WA 4K0YA 4OT6A 3RINA 2GQGA 4G3CA 4QYFA 4WG3A 3MH3A 4ASEA 2YM8A 5EW3A 4F63A 3PY0A 3Q9XA 5ETAA 5HTCA 3R6XA 5IPJA 5K9IA 3F88A 5AV1A 2RG6A 3W18A 2CNUA 2C3IB 4FT9A 3GGFA 1PYEA 2B53A 4IW0A 4ERWA 4OTHA 3PZHA 5IZFA 4CKJA 3ZLWA 3PVWA 4V04A 2QOKA 3E7OA 4BIBA 4BCIA 3UO5A 5AAFA 2I0VA 4D2RA 3COMA 3DXQA 4NKSA 3H10A 3ZO2A 3WYXA 3M42A 5E8ZA 2QHNA 5GJFA 4RIXB 3O96A 3ZM9A 3ROYA 2YIWA 5DGZA 4GG7A 3EQFA 5FEQA 3TNWA 5J9LA 4RIXA 2R3KA 3CR0A 5CSPA 1BX6A 3EN9A 4FG8A 1F3MC 2R5TA 2WTKC 4FV3A 4TZRA 3W2OA 3NNVA 3ACKA 4YTHA 1G8JA 3FQSA 2GQRA 4L43A 2VAGA 3F82A 1R1WA 5LXMA 2W1HA 4UXLA 5ANKA 2CNVA 3L9MA 3VBXA 2OXXA 3H4JA 2WMTA 3QRTA 4QMTA 4HVDA 3V04A 1T46A 4DH1A 4FE2A 5ETCA 3PVGA 3KMUA 1UU7A 2WMQA 1YOJA 4FKLA 4U6RA 3MIYA 3PWDA 4I5MA 3TCPA 4LDTA 4NCTC 4NWMA 1G3NA 3TKUA 4JQ8A 4AW0A 2X9FA 2WD1A 4LYNA 3W8LA 2YDIA 4D55A 2CJMA 4FTUA 1SZMA 3VVHA 2C5VA 1M52A 3CPCA 4TRLA 3EN7A 4DFNA 2JITA 2JAVA 2XIYA 5CU6A 4AW5A 4EEVA 3WZKA 4GJ2A 1ZOEA 1UWHA 4QMPA 2C6LA 3R2YA 2YCQA 5DVRA 4FK3A 3ITZA 4U43A 5DMZA 5F20A 4YJPA 3TNHA 2QO2A 5D9HA 5TE0A 4EOPA 4EYMA 4HNFA 4E6QA 4LL5A 5A4LA 1YWRA 3NYVA 2C5OA 4IB3A 4HOKA 1O6LA 3OOGA 4O21A 3U6JA 2RFDA 4M15A 2GHLA 2W1EA 2XMYA 4D0XA 4DEGA 3ORLA 5A46A 4FSTA 5H9BA 5KKRC 3AD4A 3ZLYA 5DR2A 3CQWA 2HZIA 4CYJA 4EH5A 4ENYA 5HOAA 5M56A 2XEYA 4IM2A 1UU3A 2G9XA 3BYSA 2NRUA 1ZY5A 5DR9A 2VGPA 4A06A 5G6VA 3F7ZA 3IKAA 4LV7A 4AE9A 3OT8A 3VS3A 4MX9A 4BICA 3GC0A 3W33A 1XQZA 3W2CA 4E4XA 2JDTA 2QURA 3MPTA 4OUCA 5IEVA 5FM3A 3AD5A 5K3YA 1OL7A 4JLCA 3Q9WA 1UVRA 4PNKA 2RIOA 5J9ZA 3SW7A 4MXOA 4FT7A 2CKOA 2OZAB 3E5AA 5EH0A 4RJ4A 3L8SA 2PVLA 4YBJA 4CLJA 3UDZA 1H1RA 2HW7A 3MN3A 4RX7A 5CQUA 5EI6A 3DU8A 4DFZE 5IUGA 5JGBA 3MIAA 1WBWA 1PXJA 4FI1A 5HG7A 1KE6A 4YJUA 1URCA 1J3HA 2QOIA 3II5A 4IAFA 4O0XA 4FGBA 4PWNA 5FQDC 5C03A 4DBXA 3I81A 5DEWA 3CSVA 4JS8A 5HO6A 5HD7A 2QOLA 2IEWA 4H3PA 4FV6A 3ZUUA 1FINA 4UB7A 4Y85A 4K77A 4FKQA 2ERKA 3FSKA 3TZ8A 4GFOA 4EBWA 4QMUA 3O71A 3HMPA 3MFRA 4WBOA 2XARA 4XV2A 2P2HA 2WGJA 4FODA 4IWPA 1H1PA 3QD0A 4BDGA 5EM6A 1UKIA 1Q8TA 3FLQA 4CKRA 4NK9A 3OCGA 3W0RA 4ZIMA 3OWJA 4FIIA 5KBRA 1S9JA 2HY0A 4M69A 4O6LA 1FOTA 4M3QA 2AQXA 4GS6A 4V05A 3F7WA 4ZSAA 4N0SA 3HZTA 1YW2A 3PY1A 4YO4A 1YWVA 3FLZA 3OS3A 4FRFA 1HCLA 2VTPA 3EB0A 4E8AA 1YDTE 4ZXTA 5C8MA 4QMNA 4ZTMA 5FXSA 2CN8A 2XM9A 3TJDA 5DT4A 2ETRA 5DE2A 5EI8A 5CI6A 1MP8A 4KSPA 2W99B 4IX4A 3NUYA 5BUJA 5LJJA 3Q6UA 3PP1A 4F08A 3OUKA 4QNYA 4HVGA 3PJ8A 4W8DA 4FC0A 4CFNA 2VD5A 3PXQA 4EOJA 3F9NA 3PY3A 3WIKA 5FD2A 2BKZA 3HMIA 2UW0A 3NLBA 5HVJA 4JL9A 3O50A 5AAEA 4IC8A 4R7IA 3TG1A 3UZTA 3ATSA 1ZRZA 3MA6A 4EC9A 5L6OA 4GW8A 4FL1A 5AP2A 3LQ3A 2V0DA 3ENHA 1VYZA 3DQXA 3EL8A 3UPZA 2V55A 1YWNA 3G33A 3D14A 3VUHA 5TKDA 4OTPA 1YXUA 3QXPA 4LMNA 1QPCA 2BFYA 2J2IB 3IW8A 5B2KA 4S34A 4AXAA 5AADA 3MTLA 1GY3A 5HU3A 4DCEA 1L3RE 4TXCA 4DEDA 1H28A 2XBJA 3FV8A 3UG2A 4QEBA 2QO9A 3IPHA 3GC9A 5CF5A 4AQCA 1M17A 2VTTA 4F0FA 3ZO4A 4FL2A 2C0TA 4BKJA 3E3BX 3ANRA 2ZMDA 3G51A 3S00A 5CS6A 2R3QA 2GNIA 5B2LA 1RJBA 5JSMA 5CAOA 3GU6A 4C36A 3O8UA 4BKZA 4NM0A 2WMAA 4ZZMA 4YSMA 3QWJA 4YUQA 3QCXA 3W0NA 2AYPA 4QMXA 2YCRA 3F5UA 2UW6A 4J71A 5HX6A 2WTJA 3WF8A 4XV3A 5T68A 4D4RA 4PQNA 4RJ5A 4ZY4A 1DAWA 1YHSA 2WAJA 3FI4A 3LPBA 4ZTLA 4GUBA 4DH7A 3W55A 4CTCA 3A7GA 3BYOA 5K0XA 4ZSGA 4P90A 3ZRKA 1H0WA 4BF2A 4G2FA 2GFCA 2V7OA 1NVQA 1JOWB 3EOCA 3GFEA 3OFMA 3SHEA 5A4QA 3N51A 5AA9A 4JAJA 5KMKA 2YLFA 4BFMA 4IHPA 2XANA 4PTGA 5LVNA 2ITOA 3PVBA 4PMMA 5CSVA 5EI2A 5CASA 4RIWA 4G6OA 4YSJA 3MESA 2I0HA 2OJJA 4L46A 1JVPP 3WE8A 4FEVA 3A4OX 4GH2A 5LCKA 4BI2A 3DBDA 2R3GA 2EWAA 2JD5A 4FX3A 2WNTA 4XMOA 4DH8A 4O0TA 4L8MA 5DN3A 4MXYA 2W5BA 4DEAA 4FYNA 2I0EA 4EH4A 4M8TA 3PPJA 4LG4A 2WTWA 4JBPA 4O7LA 3D2KA 4UZDA 3ZO3A 5HE0A 2OXYA 1CKIA 2UW3A 5FLFA 1S9IA 3WF5A 5L6WL 4NL0A 3EQIA 3MY5A 5AEPA 3BLHA 4IZYA 2C30A 1OIUA 3FY2A 3Q5ZA 1PKDA 4IEBA 4FT0A 4OTGA 4QD6A 3EQRA 3CLYA 3SLSA 4F9AA 4KD1A 2F7EE 3BGQA 4WO5A 2R3NA 3NDMA 2WQMA 3SG8A 3V8SA 3QKLA 3CGFA 5BV3A 2PZRA 2RSVA 3G6GA 2Z7QA 3K5UA 4LGGA 4RVKA 4U8ZA 3JUHA 4G6NA 2OK1A 5CWZA 1DM2A 2ZV2A 2X8EA 3TL8A 2IVVA 4O0RA 4U44A 4ZTQA 4I5CA 2J90A 5T6KA 4ACGA 1H8FA 5HICA 1Q8WA 3FMKA 3KVWA 4IC7A 3HP2A 4ACDA 4EOQA 1MUOA 5IMXA 3UDTA 3AC2A 4U80A 3W16A 2CCIA 3OCBA 3PFYA 4GK4A 3JVRA 4CQGA 5I9ZA 4JG7A 4JDIA 4PV0A 4D1XA 5C8KA 2H6DA 5KZ0A 3RGFA 3AMBA 4MXCA 5C9CA 4C3PA 5HO7A 4XG8A 2O63A 5AMNA 5FGKA 2QHMA 3UP7A 2J0LA 4FA2A 3W0SA 5AP7A 1SVEA 5CEKA 4DG2E 5KBQA 2PZYA 3UE4A 3MY1A 4EOKA 3FYJX 3BHHA 5AV3A 5JFWA 2DYLA 3TUDA 2C5YA 1XH8A 3AGMA 3T9TA 3ZC6A 5M09A 4QMSA 4XH6A 3LFDA 1UNLA 2JIUA 3EQGA 2XBAA 4IX6A 5EW8A 4F7SA 5KCVA 3UMWA 3I60A 5HG8A 3F5PA 3LFEA 2UW8A 2HZNA 4IXPA 4J7BA 3NIEA 3U6IA 4JT3A 3QRIA 3QWKA 5LMAA 4A9SA 4D58A 3DK6A 4E93A 5AUUA 5DBXA 1DI8A 3RKBA 3K3IA 1WBNA 2CMWA 5FUTA 2YERA 3A4PA 3QZFA 4BDCA 3O0GA 3R21A 4A4XA 3I7CA 3UOKA 4CTBA 3S1HA 1UV5A 1B38A 2OBJA 4MF1A 2VWIA