3TWJA

Rho-associated protein kinase 1 (rock 1) in complex with rki1447
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
396
structure length
396
Chain Sequence
FETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Rho-associated protein kinase 1
publication title RKI-1447 Is a Potent Inhibitor of the Rho-Associated ROCK Kinases with Anti-Invasive and Antitumor Activities in Breast Cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 396
sequence length 396
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3twjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3twjA01
4O27B 2WU7A 2IW6A 3E93A 4KSQA 2WMVA 1KWPA 3P78A 4HYHA 4O6EA 3ZRMA 4MWHA 4AZVA 5HVJA 3R7EA 3GCPA 3FZ1A 2XRWA 4EK5A 2CN5A 3KU2A 4WRGA 1BMKA 4J53A 2ITXA 2YDKA 2ZAZA 2GFSA 3B8RA 2BPMA 3PPZA 1CKJA 4AGCA 3NW7A 4ASDA 4O7RA 2CNQA 1YKRA 4XG6A 2YIRA 3O17A 4MWIA 3NAYA 4OBOA 3ZBXA 5F20A 4L68A 3TZ9A 4EBWA 3MYGA 4ZXTA 5C27A 5KMNA 1AGWA 4F4PA 3FL4A 4X2NA 3QHWA 5CI7A 2PSQA 4W8DA 4PP7A 1LEZA 3NYVA 5I9UA 4F64A 3P7CA 5CAOA 4NM3A 4X3FB 5HTIA 2HYYA 4CYIA 4AOTA 3ODZX 4BTKA 4U45A 1CSNA 1Q4LA 4DGNA 3ZLSA 2GHMA 5EKOA 4TT7A 2XIKA 4R7BA 4O0VA 3QRKA 5I9XA 1GY3A 5ANGA 2EXCX 1KE9A 3CEKA 2BZKB 4EUUA 3POZA 4MK0A 5CVFA 3M42A 3BZ3A 4FKVA 4O0TA 3ZC5A 1H00A 4CMUA 5IQHA 3HRBA 3UP2A 1ZMUA 3ORPA 2WPAA 4FKPA 3VUDA 2W1IA 5FTOA 2VTTA 4C57A 4IWPA 5AUUA 2J0IA 5I5ZA 5M56A 2GTMA 4BFMA 2PVKA 3LXKA 2WTJA 2C6OA 3OCTA 4LFIA 3R1NA 3VQHA 4YJUA 5H2UA 4Z16A 4DH3A 4D2WA 4EYMA 4XV3A 1ZY5A 4WNMA 5BYYA 3RPVA 4GG5A 4Y85A 4L67A 4C59A 2JDVA 4X2GA 3FMHA 3VUHA 4F7LA 5L4QA 1YOLA 3TNQB 2QD9A 3AQVA 4KIOA 1PKDA 4QTEA 3EL7A 4EK4A 3OTVA 3TM0A 1JKSA 3HAVA 3R8PA 3CY3A 2IZSA 5A4EA 4A07A 2UZUE 1OL5A 1OPKA 2WQMA 3ZO4A 4EOMA 4A9RA 4F1MA 4G17A 5BVOA 3R2BA 3TJDA 4ZJIA 3F61A 2CLXA 2HZIA 5AM6A 3W2OA 1PXKA 4IZYA 2VN9A 1PMVA 3BEAA 4OGRA 3TG1A 3NW5A 1L8TA 3NUAA 2RL5A 1XJDA 3OS3A 4BDEA 4D5KA 4KKHA 4FV0A 2G2FA 2QODA 4NU1A 4U3ZA 4UX9A 3RM6A 4GU9A 4AZSA 3AD5A 5HX8A 3OC1A 2W1HA 4WBOA 2BAKA 4AA0A 4I20A 5JGDA 3U8WA 3MB6A 5AUZA 5LWMA 3SRVA 4APCA 3GI3A 2XNMA 3ZO2A 5LJJA 4LRMA 2ZOQA 1M17A 1E1VA 3QTSA 5AR3A 1WBSA 5AR2A 4GV1A 2YZLA 4KABA 3QQGA 4EQCA 2O64A 2QR8A 3PFQA 3R2YA 4YLJA 5M06A 1H08A 4FTLA 5AX9A 3Q4TA 4O96A 4BR3A 1Y8YA 5DRDA 3CSVA 2XK3A 3DJ7A 3Q52A 3DFAA 3Q5IA 4IDTA 3OWLA 2OJIA 5CU4A 1P14A 4YJSA 3W55A 4FBXA 2BROA 3F7ZA 1T46A 3LFNA 4PMPA 3RK9A 3RPYA 5IU2A 3SG8A 2WIHA 2OZAB 4FIHA 3KF7A 4CG8A 3L8SA 1TQPA 2ITZA 4NKSA 4JOAA 4UMPA 5HTCA 1H01A 3QCSA 4ERWA 2PE0A 3PG3A 5CXHA 5DE2A 2HXLA 3NEWA 4EHEA 1VZOA 4ZOGA 5GIPE 5J95A 5AAFA 1GZKA 3Q53A 4FK6A 5J79A 4I0SA 1ZOEA 4ONAA 4IX6A 4QPSA 4PDPA 4RQVA 4ZLYA 4BDKA 3ALNA 1UA2A 5C9CA 4M0ZA 4EH7A 5M57A 4O7TA 1WZYA 4FZ6A 4D5HA 1XBBA 3FMDA 4M12A 4NH1A 4V01A 3ORXA 1U4DA 1KE7A 4H3QA 3V5PA 4LM5A 3W10A 3L1SA 5DGZA 4AZFA 2C5XA 3KREA 4M68A 5AR7A 3TZ8A 1PXPA 2CKEA 5EQPA 4ZTRA 3MTFA 4FR4A 3RHKA 2VUWA 3W1FA 3BI6A 3O71A 5C8KA 5EOLA 5IZFA 3R8ZA 2CKPA 3R9DA 4FEXA 3FMLA 5GJFA 3H0YA 4IZ5A 4RIWA 4RVTA 5HIDA 4IDVA 4E7WA 5IA0A 2XRUA 4O22A 5HE2A 2BVAA 4H39A 4DFBA 1U54B 5EQYA 3SXSA 3DLZA 4FTCA 5FP5A 4NM7A 3D5XA 3MY1A 2CGXA 4GSBA 4NM5A 4ALWA 1Q8UA 3ORZA 3UZTA 4U42A 4YNOA 3GXLA 5FD2A 3FEGA 3KXGA 2CLQA 5KX8A 4RJ6A 4EK6A 3R22A 3AG9A 3UOKA 4EWQA 3LFAA 4AP7A 1TKIA 1AQ1A 4FUYA 3AOXA 5DT0A 4HVSA 3UODA 1H26A 3DBDA 5KNJA 3VNTA 1ZRZA 3ZXZA 5L2QA 4WNKA 4EBVA 4IVAA 3TTIA 3EQPA 2FB8A 3N51A 3BV3A 4O7LA 2YZAA 3EQDA 3MVJA 4D2TA 4BY9E 3Q4ZA 1ZYLA 2DWBA 5HNGA 5L8JA 5EQEA 5AV3A 4BYJA 5A6OA 2BAQA 2JIUA 4P5ZA 2PZYA 1ZZLA 5HIEA 5FUTA 2J0MB 2GHGA 1FMKA 5I9VA 2P55A 4XCUA 5D9HA 3MI9A 5L6PA 1V1KA 4CQGA 3T8OA 5HORA 4QP2A 3E92A 4GH2A 3UVQA 4EOOA 3I5NA 2XEYA 3U54A 2GQRA 4ZTSA 4XG4A 5D41A 4B6LA 2BRHA 3MH0A 3IDBA 3CJGA 2B52A 4L3JA 1J91A 4IX5A 2PVHA 5CWZA 5AUVA 4GT4A 2X6DA 5EHLA 5KKRB 3P79A 4S30A 2QO7A 4B0GA 4TY1A 3KY2A 3HL7A 4GK4A 4HYIA 4EOSA 4YSMA 2WELA 3OEFX 2IZUA 3R30A 4IAAA 3U6HA 3IW5A 3UOJA 2PZRA 3R1YA 4EEVA 1YHVA 5HCYA 3OT3A 4AGUA 4BB4A 3VBWA 4EJNA 1H25A 5TE0A 4IMYA 2YHVA 5L3AA 1OL6A 2ETMA 3MH1A 3BRBA 3BU5A 4GS6A 4JRVA 4L7SA 5HE1A 5BX0A 4XRLA 2QKWB 3FI3A 4MD7E 3CKWA 4WD5A 3R21A 4XNEA 4BCOA 3F9NA 1MRUA 3AT2A 4MXOA 3FLQA 3EQFA 4ZZOA 5EOBA 1M52A 3R0TA 3HDMA 5EM8A 3MPTA 4XJ0A 5CQUA 1IAHA 4ZSJA 3CY2A 4G3DA 3P9JA 3PPKA 3HRFA 2WTVA 5DIAA 4QMOA 3E7OA 4XOZA 2WEIA 3EQCA 1OL7A 2E9UA 3Q5ZA 2YWVA 3NYXA 3HP2A 3UZPA 3ZONA 3EHAA 1B39A 4HW7A 3RNIA 3LW0A 1JKTA 4O1PA 3EFWA 4ZLOA 3MSSA 3DB8A 3ZCLA 5C4LA 1R3CA 4ZSGA 3V04A 2HW7A 2XKDA 3KB7A 4V05A 2OIBA 3BHVA 4FTKA 3H3CA 4AQCA 4RC4A 4IM0A 3CGOA 5HGIA 4QMQA 3TV6A 4FV7A 4L8MA 4XG8A 1W83A 3FZTA 4CT2A 4JDHA 4GIIA 3KFAA 4FV4A 5EM7A 1YXSA 2PE2A 2PUUA 4FIIA 4BCGA 2OKRA 4WT6A 4YJTA 3VBVA 1U5QA 5FXSA 3VO3A 1IA8A 5AP1A 3A8XA 4UZHA 4D9TA 2JBPA 5EI8A 4I21A 4JQ7A 5AX3A 4TRLA 3V5QA 2W1EA 4JIKA 3UBDA 2QOHA 2C6KA 2C3JA 2WOUA 2C5YA 1OECA 5FXRA 2YLFA 1J1BA 3GCUA 3FC1X 2BILB 3BQCA 3GCVA 3LE6A 5E7RA 3QAME 5HE0A 3GBZA 3HUBA 4TXCA 3L8VA 4C2WA 3A8WA 4K8AA 2C3LA 2XMYA 3BYVA 1U59A 4L42A 5CU6A 4RJ4A 5M4FA 4QPMA 2HELA 3NUYA 3QC4A 4G6LA 3QTWA 4GT3A 3PXRA 4K6ZA 3OZ6A 4TTHB 4FMQA 4GVAA 3P7BA 4FTRA 3Q9WA 2HK5A 5FWKK 3PYYA 4FSUA 4EL9A 3FAAA 3H9RA 3PXFA 2C6TA 4K9YA 3WE4A 2OJFE 3OVVA 3VW6A 1ZARA 1SYKA 3GGFA 4O0WA 5D7AA 1BL6A 3BLQA 2CSNA 3GU4A 4PDYA 3FV8A 5CZHA 5L8LA 3AD6A 2VU3A 3P4KA 1TQMA 4XG2A 2VWVA 2C5OA 4E3CA 3MGYA 5K0KA 5DPVA 2GQSA 2UW6A 1K3AA 3HYHA 4D28A 4D58A 4XHKB 3IDPA 1V0OA 3JPVA 2X7GA 4TWNA 3I7CA 3O7LB 3CD8A 2VGPA 3FQEA 3GUBA 3RWPA 2FYSA 3HNGA 2WEVA 2WTWA 4BIEA 5K5XA 3VS2A 4RX9A 3H10A 3QX4A 3VUGA 1WBOA 4F9YA 5F1ZA 4FT0A 3D7TB 1OITA 3EKKA 5D10A 2QLUA 2QU6A 2C6DA 4AUAA 3FMKA 2YIXA 5EK7A 4YTCA 2W5BA 2YACA 3QQJA 4GCJA 4C62A 4ID7A 1Q3WA 3EH9A 4C33A 1PXIA 2HOGA 5BVNA 3MVHA 3R01A 2PY3A 2C6MA 2WOTA 3VS5A 4PL4A 4Z9LA 2BR1A 1OPJA 4JLCA 4FTAA 1I09A 2XH5A 1R78A 3NPCA 1EH4A 5FM3A 2G2IA 2J9MA 4E6CA 5J87A 4FKUA 2V5QA 4QTDA 2F49A 3LHJA 3PJ1A 3VWAA 2VNWA 2OF2A 1JAMA 4AZEA 5DYJA 1WVWA 2BDFA 4CNHA 4GEOA 5IG1A 5CEQA 2ETKA 2X4FA 3I4BA 5B2MA 5IQCA 4I41A 5L8KA 2CNVA 3GU7A 2BRMA 3C4WA 3D7ZA 4NL0A 2CGUA 5L2WA 3Q3BA 2UZDA 3ENMA 3DXNA 3LFDA 5AP2A 2XKEA 5C01A 4U5JA 2Y6MA 3QX2A 2W9FB 4ENYA 2V7OA 4RX5A 4NCTA 3IOKA 1RQQA 4LRJA 1Q97A 1UNHA 5E9EA 3AT3A 4IWQA 1CTPE 4RMZA 3O8TA 1F3MC 3EFLA 3SKCA 4OTPA 4BICA 4JR3A 5BYZA 4EC9A 1S9IA 3PJ2A 5BMSA 5JZJA 3TIYA 4GVJA 5JQ5A 4Z55A 4DA5A 3RPOA 5HG8A 2XIRA 1FGIA 2YDIA 3QQHA 2UW8A 3D2KA 4I6FA 2I0YA 5CYIA 4DTKA 5DMZA 4BDGA 4D4SA 3DBEA 5DEYA 5H8EA 5CEPA 4EH8A 1OBDA 4RG0A 5E8SA 2XB7A 4DEIA 3H9OA 3UNKA 2JBOA 3NMUF 3QQLA 1LUFA 4Y83A 5G1XA 4ARKA 3W32A 1GAGA 4CFXA 1PYXA 5CVHA 3P86A 3N4TA 4PPCA 4F63A 2O3PA 4FZ7A 2O5KA 4FYNA 4BN1A 4BTMA 4CRLA 5IMEA 5IQIA 2EXMA 1FQ1B 2F57A 3MIYA 5FEQA 1SNUA 3ZYAA 2GNJA 1Z5MA 3UIMA 1OKYA 3UVRA 1W82A 4TKSA 3RM7A 3CJFA 3PVBA 2H34A 3DDQA 5AV4A 1ZYJA 4DITA 3HKOA 2W5HA 4GUBA 4ANBA 4CKJA 5HCZA 1GZ8A 2XK6A 1WCCA 2YM3A 3A60A 2ZV7A 3QRJA 5H9BA 3UVPA 4CFMA 4C58A 2YM6A 2FSLX 3R63A 3RPRA 4A9TA 4AN3A 3IONA 1KOAA 2C0IA 3ITZA 1HOWA 5I4NA 3C0HA 2GHLA 3HGKA 1K9AA 4NJ3A 1UU9A 3OCSA 5HI2A 4AAAA 1NVRA 3FMJA 4IX4A 1JSUA 3RGFA 5CF5A 5IQBA 3K5UA 4I3ZA 4QO9A 3GU8A 3AC4A 3PY0A 1ZOGA 4FGBA 2VX3A 1YDSE 5BVFA 4MNEB 5KE0A 3HMMA 5BVEA 4FGRA 2Y0AA 3PSBA 4ASZA 1JNKA 3LCDA 4NEUA 4BL1A 2XNPA 3IG7A 4U97A 2Y4IB 2XNEA 2C5NA 3ZMMA 5D11A 5HU9A 5AV1A 3OBGA 4BDBA 3OTUA 4JJRA 1BYGA 3GCQA 5CY3A 3COHA 5A46A 3DKGA 4X3FA 3LCKA 1OIRA 3OXIA 4FT9A 3F66A 3ROYA 3L8PA 4IB0A 4LRKA 5JGBA 5JRQA 4EORA 5F4NA 4L3PA 5JFXA 4I94A 1H1SA 4IM2A 4D0WA 2XK4A 4X2FA 1J7UA 2Z60A 3VBTA 4AOJA 2VTOA 5IA5A 1YI6A 3NGAA 2IN6A 4I93A 1WBVA 4QMVA 4Q5HA 3MVMA 3QBNA 4FNWA 3TL8A 2FUMA 4EH2A 4HGTA 2OK1A 2PK9A 3FKLA 3KKVA 4O91A 4E4NA 4CFUA 2ZDTA 4FKIA 1JSVA 4M84A 4NK9A 5HICA 4L01A 5L6OA 1YHWA 3LFEA 3AC8A 4JDKA 3U9NA 4IFGA 5IEXA 2RFSA 4DBXA 3ET7A 3QRUA 4YC6A 3DK3A 2RFDA 3KN5A 2GS7A 5DOSA 4RJ7A 4O0SA 4ZP5A 2HWPA 4F0FA 4FSQA 2ONLC 2VX1A 2W1ZA 3BBTB 4J1RA 2F4JA 3WF8A 5M08A 4IIRA 4KINA 5CEKA 2PMLX 3NSZA 4FTJA 4Y5HA 1X8BA 4QP9A 3D5VA 1YXVA 4LI5A 4WUNA 4QMNA 1LPUA 4O0XA 2ITOA 2JKKA 4U6RA 1KE5A 4HCTA 3FI4A 4GL9A 4RLLA 3TJCA 1IG1A 4AN2A 2OJJA 1PY5A 3ZFMA 5IA2A 4J8MA 2C3IB 1ZLTA 4F70A 2R3NA 2W17A 3B8QA 4AW5A 2I7QA 4AT5A 2IW9A 4FSWA 4KAOA 1B38A 3MDYA 1OVEA 1XR1A 4R8QA 2F2CB 3SLSA 4E26A 4U40A 4LOQA 4A4XA 5CXZA 2XP2A 4GJ3A 2QO2A 2B1PA 4FTIA 4GU6A 5FTQA 3SDJA 4MH7A 3U6IA 3M1SA 4IB3A 3MH3A 3L9NA 4BWPA 4JBQA 1PMEA 3FXZA 3D2IA 4AG8A 4NTSA 1JBPE 4I6HA 4RPVA 5AEPA 5HBHA 4IVBA 5HLPA 4AA5A 5HNBA 2WGJA 3EL8A 3PVWA 4DG0E 3SX9A 2BTSA 3RNYA 4D2RA 4RWIA 5CNOA 5FXQA 1HCKA 3R7UA 3F3WA 2XEZA 3I81A 3ORTA 3QWKA 2H6DA 4QQCA 1Q99A 3ZS5A 3DBFA 3OMVA 2KULA 3R00A 4FSTA 3PJ3A 2LAVA 5ETCA 2X9FA 4ZS0A 5M53A 2PVNA 4M69A 4G3EA 4Q9SA 3IQ7A 1OGUA 5LWNA 5EG3A 3OOMA 4FKTA 1Q41A 2Q0NA 3MA6A 2OLCA 1FVVA 1YDRE 3DXPA 2PVMA 3ERKA 3HMPA 2PVJA 2PUNA 3RK7A 2YABA 2XIXA 3ZZWA 4HNFA 2YM4A 4QTCA 4USDA 4WSYA 5TO8A 2X6EA 1NVSA 3ELJA 4L00A 1OUYA 1KE6A 1XH4A 2V22A 4R1VA 5DT4A 4EH5A 3DTCA 1P4FA 4DFYA 5AP4A 4H3PA 4LUDA 4FZAB 3WYYA 3VUMA 1I44A 4AFJA 3WF7A 2AYPA 4S34A 4PV0A 4KB8A 3G0EA 3NX8A 2C4GA 3JR1A 5ICPA 5CT7A 3F5UA 2BIKB 3QFVA 5DT3A 3QHRA 3LFBA 1TVOA 5BVDA 4QNAA 1Q8YA 3KL8A 4N4SA 4E4LA 4LGDA 3ZRKA 3PXZA 2WU6A 1U54A 4ZSAA 1SNXA 2X0GA 4UN0C 5B7VA 3QC9A 3E88A 5EHYA 4DGOA 3LVPA 3P23A 4JIAA 3QUPA 4L53A 4L7FA 3EFJA 1R0EA 2O2UA 3PZEA 4RJ3A 2YWPA 4JS8A 1M2QA 4RWLA 3IPHA 4BCFA 3GP0A 2XYNA 4F0IA 4QYFA 3NRMA 2VTQA 3TXOA 4JR7A 3EQGA 1XH6A 3A7IA 5H3QA 2F7ZE 2ERZE 5L2SA 2VO7A 5GJGA 3SAYA 2F7XE 2VWBA 3GOKA 2B53A 5GZAA 3S00A 3EN9A 2FSMX 4CRSA 4BWXA 4HCVA 3F3ZA 4GRBA 1QMZA 1JOWB 3IKAA 4RIXA 1L3RE 5HO6A 4ZY5A 4K1BA 5IEVA 5IQFA 2QLQA 3FXWA 3C9WA 4FV3A 5HBJA 3NDMA 4QMLA 3DK6A 4XV9A 3R7YA 4DAWA 3BHTA 4AGWA 4MBIA 4CTBA 3KMUA 3ZXTA 3VC4A 4MTAA 5T3QA 4FV1A 3HV4A 3R71A 4U9AA 3MN3A 3PXQA 2FO0A 4L6QA 4FVQA 4UY9A 4XBRA 3ZEWA 5AV2A 3BE9A 3VF9A 4N70A 2F7EE 4JI9A 2ZM4A 4AFEA 4KIQA 4O84A 3FQHA 5EDPA 2YERA 2P33A 5M55A 2ZV8A 4D9UA 3C5IA 2X81A 4H58A 5BUIA 3A62A 2JEDA 4EWHA 3HA6A 4RJ5A 3B2TA 4XMOA 2PL0A 1P5EA 2CCHA 3Q2MA 4MF0A 2GU8A 3NUUA 3BPRA 3PWYA 4WHZA 5HNIX 4X2JA 5D1JA 5E90A 4RQKA 3K3IA 3QKLA 5TOZA 4K0YA 5K3YA 3L9MA 4EKLA 1J7LA 4QP3A 4TYHB 3ZM4A 2YN8A 1YXUA 2QO9A 2XK7A 4RIOA 3VAPA 3Q04A 2A1AB 3AMAA 5CX9A 3F7WA 4XUFA 1BLXA 4JDIA 3PSCA 1PJKA 4O6LA 4W4VA 4R78A 3Q96A 2VWWA 1BI7A 3EN7A 5I0BA 4FT3A 4FSRA 4RSSA 4FL1A 3FDNA 2XNBA 2X8EA 5E8YA 3UO4A 1O9UA 4QP1A 3VN9A 2WMQA 3ANRA 4I5PA 3WF6A 3TNIA 4AT3A 2EXEA 3PJCA 3FKOA 1SVHA 4J97A 3ZU7A 3G51A 4IEBA 1B6CB 3LCSA 4BBFA 4EOLA 4RC2A 2J6MA 3QRIA 2J5EA 2BUJA 2HZ0A 3E3PA 5F94A 2UW9A 3MY0A 1M7QA 4ZMFA 4JQEA 5HOAA 3CXWA 3QD0A 2QOKA 1ZY4A 1OKZA 3BE2A 3EQHA 3OXZA 3ZFXA 3R9NA 3CR0A 4R6VA 5C26A 3RAKA 3RHXA 4CFVA 4PTEA 5IA4A 5HVYA 4GKHA 4B4LA 5IA1A 4EH9A 2QOBA 4E5BA 4QMTA 2W4OA 4IAYA 4MXCA 1URCA 2XM8A 3EKNA 5BVKA 2R3FA 5DEWA 3R8VA 2UVZA 4KBAA 2Y8OA 3S4QA 3IDCA 5JFWA 4KS8A 2XF0A 4OTGA 1W7HA 1PXJA 4J99A 2X2KA 3CPBA 5FEEA 3FC2A 2B7AA 2O8YA 3A7JA 3KC3A 4MXXA 2UZTA 3VBQA 3WYXA 4FC0A 3LCOA 2YAAA 4IW0A 1KOBA 4ZJJA 4OT6A 3TNPC 3TV7A 2ITWA 4MXYA 2CKOA 3GOPA 4QMZA 3WF5A 5CEOA 2C0OA 2FSTX 3IECA 4KWPA 4CCUA 3UMXA 2XS0A 5IMXA 4XYFA 5LVOA 2YITA 2R4BA 3QZIA 1NY3A 4HPTE 5ANJA 3R8MA 1H28A 5A14A 3O2MA 2O0UA 4AOIA 4PP9A 4AWIA 4QYYA 4YJRA 2QOOA 2W05A 4F6UA 2YCRA 3KVXA 2EWAA 2QG5A 4K18A 3UOHA 3FHIA 4ZIMA 5EW3A 1TQIA 4RGJA 2BRNA 4JXFA 4DH8A 2QOIA 4UYNA 1WFCA 1ATPE 3MIAA 3OFMA 1GJOA 4K2RA 3PA4A 3UC3A 1Q5KA 5M07A 5DN3A 4QMYA 5H8GA 3Q6UA 3QTRA 1REJA 4LGGA 3TKIA 4MD9E 4RZVA 1NA7A 2I6LA 2J5FA 1PKGA 2RG6A 5ACBC 5E1EA 3PVGA 2UW3A 4XV2A 1Q3DA 2B9JA 1U5RA 5L2TA 4LUEA 2OH4A 3UE4A 3UMWA 4F1OA 3UIUA 3D4QA 3EN5A 5CT0A 1H07A 4I0RA 3SOAA 2PVYA 2JDRA 5J7BA 3KRWA 3I1AA 2Z8CA 1BX6A 1Y57A 1XH9A 5AP5A 3S95A 4TW9A 4AE6A 5AAEA 4O83A 2XBJA 2HZNA 3F88A 3NUNA 5LXMA 2G01A 3IGOA 4F0GA 4A06A 4FYOA 3DAEA 4PNKA 3A99A 3GB2A 2QOLA 1AD5A 4UV0A 4F08A 1VR2A 2BHEA 2WMSA 1IAJA 3F6XA 4W4WA 5GHVA 4L45A 4E4XA 2QG7A 5KZ0A 4FOCA 2C6EA 3QXPA 4AN9A 1O6KA 4C2VA 4QP6A 4BCJA 3UQCA 4DFXE 3OD6X 3OEZA 2R3KA 2ERKA 3M2WA 5AWMA 3ORIA 4YPSA 3PIYA 2YIYA 3SOCA 2GNGA 1SZMA 3FMEA 3QALE 3DV3A 5FEDA 1YW2A 4M67A 4YC8A 3Q9YA 5J8IA 5CENA 4IBMA 4K77A 4JG8A 3W33A 3KXMA 3OUNB 4EZ3A 1GZOA 2VWZA 2HAKA 1XWSA 2C6IA 1UU8A 4GFGA 4N57A 3FMMA 5I9ZA 3QZFA 5HD7A 2A4LA 3EB0A 4S2ZA 4MEDA 2IWIA 5E8ZA 4Z7HA 3LXNA 2JD5A 3VF8A 2JGZA 4M7IA 4DG2E 4Y5QA 2XNNA 1OKVA 4DH1A 3CTJA 4FV8A 4MBLA 5DRBA 1QL6A 4G5PA 5BVWA 3PXKA 3RCDA 2PMNX 4OBQA 2SRCA 3UC4A 5C1QB 2B55A 1OPLA 2YIWA 5DLSA 5M4UA 3QU0A 3AC1A 3QA0A 1UV5A 4M14A 2P2IA 3FPMA 5EHOA 2PVRA 2PVFA 2XK9A 4UXLA 2PYWA 2XCKA 2UZNA 3ULIA 3TKUA 5FBNC 4XG3A 2QKRA 5AR4A 3C0GA 2ZMCA 4GFMA 3P1AA 3OW4A 1FBNA 2BHHA 4FT5A 2GNHA 5FTGA 5FRIA 2AUHA 3W2PA 5JSMA 5EM6A 4BTJA 3ZLXA 4A9YA 2BIYA 2VTSA 4FNXA 3VUIA 4QMSA 1E1XA 4BCKA 3NLBA 2GSFA 2NRYA 3MV5A 3IOPA 1S9JA 2W0JA 2VWYA 4FF8A 3VULA 4L9IA 4YJPA 4YZMA 4IQ6A 2EVAA 5AA9A 5JMSA 4F99A 3UGCA 2B9HA 3VS0A 4DN5A 3SG9A 5L2IA 4C02A 4XP2A 5EYCA 4D2SA 4TWCA 3T3VA 2JIVA 3FPQA 2WFYA 3O0GA 4OTQA 3OHTA 3IO7A 4GFOA 3SRVB 5DG5A 4TYIA 5HG5A 5A4CA 4GK3A 3JVSA 2OI4X 1ZMVA 3QXOA 4NSTA 4CV9A 2UUEA 4O2ZA 1IEPA 4RFZA 4BBMA 3TCPA 1XBAA 5E8TA 2PVLA 5CQWA 5CSHA 4ACDA 3DCVA 3LMIA 2PTKA 3OT8A 5KMJA 1YWVA 2WZJA 3IS5A 4M3QA 4FT7A 4FVPA 2Z7QA 2R2PA 3O51A 4IC8A 5IKWA 3JY0A 3R8LA 1H1QA 4IJ9A 3UIXA 3FI2A 4W9WA 4FTOA 3E5AA 4V0GB 4QMWA 3VHKA 2VRXA 5HQ0A 4FEVA 2JDOA 3I6UA 2I40A 4MQ2A 4IAIA 2W1FA 3MY5A 5ETIA 4CEGA 4XEYA 1MRYA 3FWQA 2E9OA 2WQBA 3OOGA 2P0CA 4MNEA 2X1NA 1KE8A 1YQJA 1UKHA 4KBCA 4O21A 3WILA 4BZDA 3ENHA 3GQIA 5J9LA 2ZB1A 4FKGA 5E8XA 1YHSA 5FDPA 3BGQA 3HV3A 2YFXA 2V55A 3NCZA 2ZM3A 4FKLA 2W1DA 4FSNA 4FTQA 3POOA 4UYAA 5HTBA 1PXNA 3NR9A 3ZLWA 2GS2A 3D94A 3E63A 3ORMA 1YI3A 3Q6WA 4LYNA 3QCQA 4A4OA 4U43A 5CSPA 4DTAA 1SVEA 2E9NA 2NO3A 4AW0A 2ETRA 5CF8A 3UO6A 3RALA 2NRUA 3DAKA 4YGAA 4E1ZA 2RSVA 4NUSA 4KKGA 4BKYA 4Z7GA 4FVRA 4CLJA 2ZVAA 5JGAA 2OFVA 1KSWA 1Q62A 3CD3A 4FI1A 5BPYA 3TDWA 2DQ7X 4JAIA 4PX6A 4ALUA 2GMXA 4UMRA 4U8ZA 2KTYA 4ASXA 4X7QA 3C4XA 4RIWB 2J0JA 4U0IA 2XUUA 1KUTA 2W7XA 5IH6A 3OP5A 3VW8A 3PJ8A 4G16A 5DBXA 1WBPA 3FZOA 5IDPA 3R1SA 5HG7A 4RIYB 4L44A 5HE3A 3TACA 4EH3A 3GFEA 2HWOA 3MFRA 5AUWA 5JKGA 5J5SA 2HCKA 5E8WA 5T68A 5HU3A 3LOKA 4RA4A 1STCE 2QOQA 3KRXA 3C50A 4DT8A 3ALOA 3MS9A 5DR2A 3V3VA 2WQOA 3E87A 4H1JA 4FOBA 4PL5A 3RK5A 4LQMA 2J51A 3NZ0A 1Q61A 3ORKA 3ODYX 3K3JA 3KK8A 5EM5A 4AW1A 4BDFA 3C51A 4FTMA 4BTFA 4NFNA 2R3LA 4E5WA 2VD5A 3EYGA 4MAOA 4P2KA 3VS1A 3UYTA 1YWNA 5D12A 3SXRA 5J5TA 4DCAA 2C5VA 2PZIA 3ACJA 2CHLA 4NT4A 4YHJA 5IUHA 3ZUVA 5A4TA 3JS2A 3S0OA 4M0YA 3FSKA 2C69A 2JLDA 2Y7JA 4I23A 4IB5A 4BZOA 4MKCA 4EK3A 4JX3A 5A4LA 1MP8A 2YJSA 4ZS4A 1QPEA 4XG7A 2W99B 5AAGA 2IG7A 3VS4A 3ANQA 4FIGA 4YURA 4ASEA 2Y4PA 2QNJA 4O82A 1YI4A 2Q0BA 3V51A 2GNFA 2ITNA 1XH5A 2R5TA 4IE9A 4AA4A 4IAKA 4FSZA 4V04A 4A9SA 5LCKA 4D0XA 5EI6A 1DS5A 4EKKA 3BELA 2ZB0A 4CLIA 2H8HA 3NNUA 4RZWA 5IEYA 2I0HA 3KF4A 3QWJA 2JAMA 4RRVA 3VHEA 3BLRA 4DG3E 4CZTA 4YR8A 4Q5EA 2VTMA 1R0PA 4QMXA 3HLLA 4FEUA 3QD4A 3TN8A 4AE9A 2CMWA 3DY7A 3LLAA 2IVVA 4O7VA 2JDSA 3TUBA 4WUAA 5IISA 4EC8A 5I9WA 5AIRA 4EOKA 3DBQA 2XKFA 3LIJA 3U87A 1FOTA 3OCGA 3RCJA 4APPA 5EKNA 1MQBA 5TT7A 1H27A 3THBA 3P08A 5CNNA 3BCEA 2XVDA 5JQ8A 2CGVA 4BDAA 2XJ1A 1FGKA 3ROCA 4YZCA 3G6HA 1FVTA 3NVMB 1QCFA 1QPJA 5D7VA 3FLYA 3TEIA 2R0UA 3PP1A 5AMNA 2NNWB 4E93A 3QLGA 3KCFA 3PIZA 3FY2A 5HG9A 3TIZA 1M2PA 3UQGA 2XIYA 4BHNA 3CP9A 4RC3A 4DLJA 4F9AA 1R1WA 5HO8A 1DAWA 2LGCA 2IVSA 2WMAA 3DQXA 2GPHA 4F9WA 2BDWA 3F2RA 3H4JA 4EHZA 3NW6A 1OKWA 3C1XA 1PHKA 4EZ5A 5LMKA 5GINE 3IGGA 4JRNA 3LCTA 4WSQA 4F65A 3QRTA 4G6OA 2W96B 3Q2JA 4U3YA 2JFMA 2WMTA 1GIIA 2YA9A 3Q9ZA 4JG7A 4UZDA 5AJQA 4O0RA 4EONA 2PU8A 1GIJA 4FKQA 4DEHA 5KHXA 4X3JA 4MVFA 3DPKA 4FODA 3Q60A 4YHTA 3MH2A 2VWIA 3VS7A 4EH4A 4YO4A 2HW6A 4DEBA 5CASA 2RF9A 4DE4A 1ND4A 3FI8A 3TUCA 5IUIA 3ATTA 4QYHA 2J90A 3WZJA 2OSCA 3Q9XA 1M14A 4OT5A 1FPUA 4ZY4A 5CU2A 5ANIA 2X2LA 1ZAOA 5J7HA 1G3NA 2QONA 2OH0E 4S33A 3C4FA 4BI2A 4LG4A 3QKMA 1HCLA 3AXWA 4BGHA 4D2PA 1JVPP 5JT2A 1M7NA 3G5DA 4YZNA 3E8NA 3G2FA 3HUCA 4XH6A 2IJMA 3UOLA 1CKPA 1JSTA 4PY1A 4C38A 4CVAA 4BCNA 4BI1A 4EHGA 4I5CA 1IASA 2GQGA 3R04A 2YM7A 1BUHA 4GYIA 1VEBA 3NNWA 3LZBA 3BHHA 3W8QA 4QMPA 4H3BA 4ZLZA 1OIUA 5ANEA 3I60A 3TTJA 3PXYA 4OAUC 3SXFA 3ORLA 1KV2A 2VGOA 4EOIA 2B54A 4UMUA 3EWHA 4EOPA 2IPXA 4RVLA 2EB3A 2R64A 3DS6A 1W84A 4KIKB 4HPUE 3NNVA 4ZTMA 4YJVA 3LFQA 3PSDA 4YBJA 4F09A 3OBJA 2R3QA 2G1TA 2UZLA 2X7FA 2Z7LA 4IB1A 4DF3A 3AMYA 4NKAA 4DHFA 3A7FA 4ANMA 5AM7A 4BDIA 3MFUA 4O7SA 4XRJA 4D55A 4OLIA 3I79A 5G6VA 1P2AA 2R3HA 1O6LA 3HMIA 3ZTXA 3F3UA 2YIQA 4D4RA 3OWPA 2JKOA 3LMHA 2H96A 4J52A 4G31A 2GDOA 2WHBA 3A7HA 3R28A 4PPAA 4AACA 3KGAA 3PA5A 3RAWA 4EYJA 4UB7A 3ETAA 2JITA 4ZTHA 2Y4IC 4B7TA 2X7OA 3BEGA 4CKRA 1OBGA 3I6WA 3CE3A 3QYWA 2WMRA 5KMKA 3I5ZA 3UP7A 1H1RA 5AADA 5JK3A 4PQNA 2G15A 1BKXA 2BTRA 4FKWA 4M97A 3FY0A 5FGKA 3O23A 4OTHA 2WNTA 4NZWB 5LMAA 3V8TA 2X8IA 3RBWA 1H0WA 2CN8A 2Z7SA 4RFYA 3O7LD 4C8BA 4TYEA 3JVRA 4AXAA 1XHAA 2OG8A 3TZMA 4P5QA 4AZWA 3NYNA 1XO2B 3G6GA 4IZ7A 5EYKA 1H1WA 4QD6A 3GQLA 4D4YA 5J9ZA 2BZHB 4E5AX 3ID6C 3D14A 4M8TA 3BGZA 3U6JA 4EHVA 1JQHA 3D5UA 3CS9A 1WAKA 2VO6A 3C4EA 4ZJVA 4NIFB 3PP0A 2ESMA 3FJQE 4GUEA 1WMKA 5C8NA 4S31A 1WBWA 3RAIA 3KMWA 4MYGA 5CAVA 4ACMA 2OXYA 4G3GA 3RAHA 4HNIA 4C35A 2PWLA 2DUVA 3NIEA 2WD1A 2QQ7A 3QD3A 3TWJA 3II5A 4F7SA 3PIXA 2OIQA 4OBPA 4YJQA 3EIDA 1VJYA 2UVYA 3VVHA 3KN6A 4GW8A 4QYGA 2NPQA 1H0VA 2YJRA 3I0QA 2OZAA 3KULB 4YTHA 5B0XA 4O2PA 3KXHA 4L46A 4DH5A 2GNIA 2OJGA 3DJ5A 3OUKA 1YWRA 4IACA 3WARA 3QTUA 4G9RA 4O0YA 4TYJA 4C4IA 2QURA 2QVSE 2C1BA 3HV7A 1OM1A 3DU8A 5BNJA 3R8UA 3KXNA 2J50A 3S3IA 2G9XA 4ZSLA 3QF9A 3COMA 2WTCA 3NS9A 3NYOA 4Z3VA 3PDTA 3EFKA 1WBTA 4PDOA 2ITUA 3SD0A 1WBNA 3SVVA 4W8EA 5CAPA 3NVKI 3E62A 3GC8A 4I4EA 4C4GA 4PWNA 4UWCA 2OWBA 4FL3A 4C4JA 4U79A 4F9BA 3IK3A 3NAXA 5LARA 2BRGA 5E8UA 3AC3A 3KK9A 4AW2A 4HJOA 2VO3A 4KD1A 2HZ4A 4IC7A 3LAUA 3T9TA 3IW8A 4HVHA 4TPTA 1OIYA 5L6WL 4W9XA 1YRPA 5T6KA 3Q32A 2GNLA 4NCTC 2BDJA 3EZVA 2B9IA 2QC6A 3PLSA 4G5JA 2W06A 4ITHA 4XP0A 5CI6A 4NM0A 3DZOA 4QYEA 3CQWA 3OWJA 4H36A 4USFA 3KRJA 1FMOE 4W4YA 3SHEA 3V01A 4C61A 5KMIA 5IQEA 3LLTA 4LOPA 2GTNA 3QYZA 4OTRA 5AP6A 4JL9A 3FMNA 3RPSA 2W5AA 2OXXA 4BKJA 1NW1A 2ZMDA 5EH0A 3UJGA 5AR8A 4JT3A 3VJNA 5IQDA 5DR6A 1RW8A 1F5QA 1Z9XA 3UG2A 3GCSA 1H4LA 4ZZMA 5ITAA 4O7YA 3FLNC 3C4ZA 4GK2A 3CC6A 4YJOA 3CBLA 4E20A 3PPJA 1J1CA 2BCJA 2FH9A 3C5UA 5IH4A 4EOQA 2H9VA 3LM0A 1UNLA 4QOXA 2I0VA 4U80A 2VZ6A 3N9XA 3F5XA 3G90X 3FZSA 3ZSHA 2C68A 3CGFA 3DT1A 2WTKC 4IJPA 3V6SA 5M44A 2BKKA 5CEMA 2A27A 1FVRA 4K11A 1CM8A 3DDPA 2PUIA 5LMKC 4YMJA 3F5GA 2EUFB 5HCXA 3WZUA 3ZC6A 5I3RA 4OTFA 4F7NA 4J7BA 5IA3A 4WA9A 2UVXA 5HD4A 1CMKE 4QQ5A 4J96A 5ETAA 4HVDA 4FTUA 3EMGA 4N0SA 5LMBA 1PW2A 2J4ZA 4ACHA 2X4ZA 3E8DA 3RWQA 4F7JA 1FINA 4QQJA 3ZZEA 3VUTA 4E8AA 4UWBA 3D83A 3QQFA 3VRZA 1U46A 3PG1A 3L8XA 2XBAA 5LVPA 2OICA 1QPCA 5C4KA 4XBUA 5ANOA 3TZ7A 2B9FA 2P2HA 4BCMA 4RBLA 3BIZA 3LJ1A 4IADA 3MW1A 4YO6A 3GFWA 2WTIA 1YOJA 3IW7A 4MF1A 4X3FC 3RKBA 4E6AA 4OTIA 4G3FA 2HXQA 3IW4A 4NJDA 1OUKA 4D1XA 5GZ9A 3ZSGA 4DFZE 3V5WA 3FKNA 3PY1A 5CEIA 5HKMA 2VO0A 4DYMA 5AUTA 3GVUA 4G3CA 5ANDA 3VIDA 4RA5A 5IPJA 2Q83A 2R3IA 3REPA 2C1AA 4C3RA 3AMBA 4BCPA 3K2LA 2E9PA 3NIZA 3NCGA 3IW6A 4FIJA 5AP3A 3VUKA 2YM8A 4KUJA 4GYGA 3QTQA 5KMOA 3ZSIA 4C0TA 1JKLA 3UIBA 3EYHA 4CMOA 3FLSA 4UALA 4FV5A 4WO5A 2XJ2A 3MJ1A 4DGMA 3OROA 4BF2A 3HX4A 3GT8A 4ZY6A 3TT0A 1PYEA 3PE2A 3FUPA 4ACGA 4AS0A 3NUXA 2HY81 4C7TA 5FP6A 4GG7A 1MUOA 1P4OA 3KXZA 5HHWA 3RMFA 4FKRA 4QP8A 5FDXA 4BGQA 3EQBA 3HP5A 4PPBA 4KSPA 4QNYA 3A4OX 2PMIA 5GZ8A 1Q24A 5HEZA 4FA2A 2JKMA 1YXTA 3PE1A 4LL5A 4FIFA 3ZFYA 4BC6A 4DEEA 2V7AA 4K33A 1K2PA 3DB6A 1Y6AA 4W4XA 5DVRA 4AT4A 2VTLA 3PUPA 4H05A 3NNXA 2R7IA 4DBNA 3R9OA 5JFSA 3O50A 3UYSA 3W2QA 3UQFA 1OZ1A 4MNFA 2R3OA 3COKA 5DI1A 3DNDA 3MJ2A 3R1QA 3TKHA 1XBCA 5FLFA 4YC3A 1QPDA 2J2IB 5HZNA 3SW7A 4FKOA 4FK3A 4V0GA 1H24A 5JEBA 1Q8WA 3DTWA 2VTAA 5ACKA 3UO5A 2YISA 4TYGA 2XZSA 2IW8A 1Y91A 5HIBA 3QCYA 3FSFA 4H1MA 3BLHA 3KA0A 4J95A 1J7IA 4I4FA 5BYLA 2BZIB 3SC1A 2JFLA 3SA0A 4M69B 4XP3A 4NFMA 4O81A 4D1ZA 3O8PA 3HEGA 4FV6A 4YP8A 3SGCA 4FTTA 2Z02A 2YM5A 4J71A 1RJBA 3BYMA 1V0BA 2WB8A 4E73A 5K5NA 3WF9A 1PRYA 5CANA 2C0TA 1YOMA 1JKKA 5JH6A 3PY3A 4WG3A 3R9HA 4DFLA 5BUJA 3K54A 4KNBA 5LCJA 3I7BA 3FL5A 4CG9A 3ACKA 4LV8A 4XLIA 4E4MA 4YZ9A 1PF8A 2OF4A 3DXQA 4NW5A 5IH5A 2W1GA 1A48A 5GIOE 3A7GA 4JBOA 2XK8A 4II5A 4TNBA 1GIHA 3UTOA 4F1TA 4S32A 3HV5A 5AUYA 4FEQA 4MXZA 3V8WA 1PMUA 5ANKA 3OY1A 1BI8A 2I0EA 4I5HA 4XLVA 3D15A 4BCIA 3CPCA 4USEA 3WI6A 4KS7A 2XM9A 1XQZA 4JG6A 4PRJA 5JFVA 3JY9A 5E1SA 2VX0A 5HLNA 3R7IA 4EQUA 4ZAUA 5AUXA 4YTIA 4I6QA 3R83A 5HVKA 2R7BA 3DGKA 2DYLA 3AGMA 4DEAA 1PXOA 5M09A 3D7TA 4RIYA 2VTRA 3EQIA 3P7AA 3V5JA 2ZDUA 4UMTA 1UWHA 2R3RA 3RJCA 5EYDA 3ZBFA 1WVXA 4O7WA 2GS6A 2ZV9A 4YNEA 2HY0A 3R7OA 2ITTA 5LVLA 3PTGA 2V0DA 5DH3A 3U4WA 2PZPA 4CT1A 2PUPA 2BKZA 1APME 4G6NA 3BX5A 2YDJA 3VS6A 4BRXA 2JDTA 2WMWA 3RI1A 3KQ7A 3COIA 1UNGA 2JAVA 2WO6A 1VYZA 3FYKX 4FL2A 4JAJA 4IM3A 4YTFA 1NT2A 1ZMWA 2UZEA 5KO1A 2CGWA 5E4HA 4YLKA 2BALA 5F95A 4Y73A 3KVWA 2XYUA 5A3XA 3CIKA 4N6ZA 2E2BA 4C34A 5CZIA 4C37A 4O1OA 4RIXB 5TF9A 3QZHA 4OW8A 4L43A 5TKDA 4UMQA 3F2AA 4ANNA 3LQ3A 4R5YA 3QKKA 1KV1A 2R3GA 5EI2A 3HECA 4A9UA 3DZQA 4KKEA 2XCHA 4GMYA 3RP9A 4BHZA 3ZHPC 3TUDA 4ENXA 4R7IA 4U81A 3ULZA 5CF6A 2I1MA 4ZK5A 5J9YA 3U55A 3A2CA 1RE8A 1SM2A 4HOKA 4OTWA 5HX6A 3JXWA 2QOCA 4WKQA 4O7ZA 4AU8A 3V5TA 3GENA 4R5SA 4WOVA 4TN6A 1CDKA 4CXAA 2UV2A 3QD2B 3QTZA 4BVUA 3UNZA 5KHWA 1IRKA 3BBWA 4X6QC 3DFCB 2QHMA 4XV1A 3R02A 1NVQA 4G1WA 4BDJA 5K9IA 4ZEGA 4ANOA 1JPAA 2RIOA 5K0XA 3BU3A 3UG1A 4ERKA 5IQGA 2ZYBA 2JC6A 2W4KA 5AR5A 5CSVA 5DNRA 3JYAA 1JLUE 3SW4A 4FG8A 2UZBA 1G8AA 3FYJX 3TNHA 4MCVA 5KKRC 2PPQA 2CDZA 5DA3A 3HAMA 3KRRA 2O63A 1UWJA 2VWUA 4ITJA 5CSWA 3DJ6A 2IO6A 2UW0A 2Z2WA 3LM5A 2QU5A 3ZLYA 4C36A 3WIGA 4ZTQA 4CTCA 3VBXA 3LFSA 3ATSA 2PZ5A 3LJ2A 3KCKA 4B8MA 4BCHA 5LOHA 1Y6BA 3PLAE 3QCXA 4AX8A 3D9VA 4FG9A 3E7VA 1LP4A 3OW3A 3MBLA 4FNYA 2JKQA 5I9YA 3D0EA 3PRIA 5A6NA 2XNGA 3HMNA 5FG8A 4C4FA 4CSVA 5F9EA 4TWOA 3PZHA 4DCEA 3GU5A 3BYSA 3U9CA 4AGDA 2UZWE 4FTNA 4MQ1A 5JN2A 3LQ8A 4PL3A 1UVRA 4KRCA 5FM2A 2PHKA 1NXKA 3D5WA 3AC2A 2HIWA 3JUHA 3BHYA 5DFPA 2P3GX 3WOWA 4DFNA 3N4UA 5JZNA 3TV4A 5LQFA 3AT4A 3H0ZA 4FSYA 4ZTNA 4RVKA 3DNEA 3R7GA 3AD4A 2VWXA 2XKCA 3FZPA 2OU7A 2XJ0A 3E8CA 5A9UA 1OL1A 2ITVA 5BUEA 4UXQA 3EN6A 1OMWA 5CS6A 4P7EA 2FA2A 4FSMA 4M15A 3T3UA 2IVTA 2FVDA 3SV0A 3W16A 3ZOSA 4F9CA 4CFWA 5KUPA 2ACXA 3MVLA 3RVGA 2OBJA 2WMBA 4FE2A 4OTDA 3DA6A 4HGEA 2BMCA 5CF4A 2YCSA 2VTJA 4FEWA 3C0IA 4JDJA 4PUZA 1GNGA 4BDHA 3I0OA 2HENA 4PDSA 3PVUA 2ONLA 2YLEA 3MTLA 2OGVA 4FZDB 3UPZA 4JNWA 2A2AA 2WXVA 4Q9ZA 4M13A 5J1VA 3RINA 3BYOA 1G8SA 4CFFA 3VJOA 4R77A 3C4CA 3QTXA 4FG7A 4KIKA 4XX9A 4CFNA 3OY3A 4LOOA 3G9LX 2PULA 4CMTA 4RVMA 3QGWA 4RX8A 3QA8A 4LMNA 3DBCA 3LPBA 2R0IA 1R39A 4X0MA 5LVNA 4CCBA 2OO8X 4NYEA 3LXLA 4M66A 5CU3A 4O7NA 2RGPA 3U51A 4P4CA 2RKUA 2R3JA 4BDDA 3P5KA 4QTBA 3BHUA 2VV9A 3ZO1A 4EQMA 4DC2A 5A4QA 4C3PA 3LFCA 2EU9A 1M2RA 3MA3A 3QQKA 5CSXA 2FGIA 3NWWA 4ACCA 4R3RA 4DINA 1PXLA 5DWRA 3O96A 5IF1A 3DAJA 4QTAA 2AC5A 4Y95A 2WKMA 5CTPA 3EN4A 4TL0A 5IQAA 1MQ4A 3FBVA 3QZGA 5AA8A 4RWJA 3ORNA 3P0MA 4MXAA 5AP7A 1E9HA 3W2SA 5GNKA 5HLWA 4FUXA 4QPAA 3O8UA 4PNIA 4EZ7A 3G0FA 5BQ0A 2WAJA 3KRLA 5FQDC 4DT9A 4EJ7A 3E3BX 3WZDA 4HCUA 3SQQA 4B8LA 2YCFA 3GC7A 4PTGA 3MFSA 3OXTA 2VTNA 3E64A 3FXXA 3F3VA 3QLFA 4QMMA 4NIFA 4WG4A 1DAYA 3FLWA 5TR6A 1OIQA 3CQEA 3EQRA 4HYUA 3HDNA 3OWKA 3W2CA 2E9VA 3E8EA 3FLZA 1REKA 4FZFB 4UWYA 4CD0A 1IA9A 4QT1A 1GOLA 3QL8A 1XKKA 2REIA 3R6XA 3ZDIA 1LR4A 4DLIA 3C7QA 3HV6A 5EW8A 3QUDA 4I92A 4L3LA 2RFEA 1BL7A 4X21A 2VTHA 5AV0A 4C3FA 2WTDA 4EUTA 3UPXA 3DOGA 5GJDA 4E6QA 2J0LA 3OCBA 4IANA 2J7TA 2ITQA 4IX3A 4IXPA 3TI1A 4HVIA 3GEQA 4OR5A 5CALA 4FNZA 1J3HA 1Q8TA 5AFVA 4DGLC 3KULA 3LFFA 4AZTA 4EOJA 4F6WA 3DLSA 3MFTA 2BAJA 4ANQA 3FHRA 5EYMA 3R73A 4ANSA 4EH6A 5K4JA 4ANLA 2AC3A 5E91A 4BKZA 5IUGA 2OJ9A 2B4SB 4BDCA 3FZRA 4CZUA 4PMMA 2XIZA 4O0UA 3GC0A 2Y9QA 5DHJA 3UNJA 2C3KA 3G15A 2R3MA 4TZRA 3V6RA 3WIKA 3RZFA 4D2VA 4RT7A 4I0TA 1V0PA 4FX3A 4MX9A 4WIHA 1ZWSA 1DI9A 4R3CA 4GT5A 2F9GA 1WVYA 2OIDA 3VQUA 5JRSA 3ZEPA 4B9DA 4BYIA 2GCDA 2V62A 2X2MA 5B2KA 3OF0A 3CCNA 2OW3A 3Q4CA 2A19B 3HZTA 3QGYA 4ZZNA 4HVGA 4UBAA 4O86A 3DKOA 3PRFA 4LMUA 3W18A 3H30A 1XH8A 2ZV2A 4QMUA 5J1WA 3GU6A 3QTIA 4UEUA 5C03A 4IZAA 2W1CA 3GNIB 2WQEA 3C13A 5C8MA 3BWJA 3CKXA 5HBEA 2R9SA 5M51A 4CGAA 3BU6A 2RG5A 2WMXA 4MBJA 4R1YA 4N6YA 3A4PA 2C6LA 1JWHA 2CNUA 3BV2A 4HZSA 4I6BA 2WIPA 4JQ8A 4G34A 5ETFA 2C47A 2OXDA 3F82A 4FV9A 2G2HA 2VTIA 5KCVA 3BQRA 4BBEA 1Z57A 1SMHA 2NP8A 2XA4A 2X9EA 3G33A 4R3PA 3TDVA 2CCIA 3L9PA 2RFNA 3H9FA 4B99A 4QP4A 4J8NA 4RLKA 5B2LA 2BFXA 3V8SA 4EI4A 4KIPA 3MWUA 3ZRLA 4OUCA 4FICA 4GIHA 4EK8A 4ZTLA 3KMMA 4OAVB 1URWA 1IR3A 5KMLA 5KBRA 2FSOX 3S1HA 2PMOX 4CQEA 2W4JA 3ZH8A 2UW4A 4CKIA 2QR7A 2QOFA 1F0QA 2J0KA 4IWOA 5HO7A 3WE8A 3HA8A 2IVUA 3W8LA 4NW6A 2ITPA 4ZMEA 5CAUA 5KBQA 1XH7A 4DFUA 1VYWA 4MD8E 4HGLA 4KRDA 3CTHA 4YZBA 4GJ2A 4IAZA 1ZYCA 4ZSEA 4G2FA 4CZYB 4E6DA 5LVMA 4C4EA 3FE3A 4J98A 3BWFA 1ZOHA 2B0QA 2CKQA 3EJ1A 4KBKA 1Q8ZA 3HMOA 4U44A 4I1ZA 4FV2A 4ALVA 4DTBA 4I24A 4I5MA 4JVGA 4NWMA 3LXPA 4PMSA 4A7CA 3S2PA 4D1SA 4IWDA 4BWKA 4NTTA 3B2WA 2OZOA 4XOYA 4KA3A 4DEGA 2A0CX 1DI8A 4PTCA 3HRCA 4F6SA 2QCSA 2ZJWA 1W98A 1YDTE 2QI8A 3ZUTA 1PXMA 2YEXA 3AC5A 4D4VA 4BI0A 5FBOA 1W0XC 4Y8DA 5AP0A 2UZVA 3VBYA 1H8FA 2O65A 4YZDA 1O6YA 4RX7A 4TYHA 4BGGA 2XNOA 3DK7A 4BIBA 3F3TA 2F2UA 1Y8GA 1UU3A 3W2RA 3DKFA 2IZRA 4LV5A 5CAQA 1ZZ2A 4JBPA 3ZUUA 3UZRA 4XS2A 1G5SA 4PF4A 2VTPA 4IH8A 3ZO3A 4QRCA 4IHPA 3ZDUA 3K5VA 4RJ8A 4WNOA 3U4UA 1T45A 4R7HA 4I22A 1DM2A 3UDBA 4WRSA 5KZIA 5EDRA 3TNWA 1ZYDA 4IFCA 4GKIA 4JX7A 5CU0A 3PWDA 4Q2AA 4IVCA 5KMMA 1OI9A 5EW9A 4WBBB 2PE1A 5DR9A 3WBLA 3N4VA 3F69A 4HYSA 4YLLA 4IVDA 2QHNA 3NUPA 3FQSA 4RFMA 1H1PA 3VRYA 2X39A 4AF3A 3MESA 4L52A 3LJ0A 4WNPA 1LEWA 3BKBA 4BZNA 3CLYA 3V5LA 4HZRA 1ZYSA 3F2NA 4LGHA 4XG9A 3WZKA 5I3OA 4YSJA 5M4IA 2Z7RA 2JIIA 3DKCA 4P90A 4YHFA 3EZRA 1RDQE 2BFYA 3PA3A 4FKJA 1UKIA 3HVCA 3MPAA 2Y6OA 4DGGA 3CQUA 2VAGA 4U41A 3MB7A 5E92A 3RTPA 4ORKA 2C30A 3A61A 4IAFA 4TWPA 5M4CA 3MPMA 4A4LA 4HGSA 5CVGA 3LQ5A 2UW5A 5BMMA 4QQTA 2IZTA 3DQWA 2EB2A 3CTQA 1MRVA 3M11A 1YXXA 5E8VA 4MHAA 2UW7A 4TNDA 5K4IA 3R7VA 3OG7A 4ITIA 4Y72A 4O38A 4BCQA 4QP7A 1ZXEA 2VNYA 1A06A 3G9NA 2ITYA 3WZEA 2DS1A 1GZNA 4WG5A 4YJNA 5EFQA 5A54A 3NUSA 4JBVA 2WMUA 3VS3A 2BRBA 1CKIA 2WQNA 2R3PA 4RWKA 4YBKA 3T9IA 3QQUA 5IDNA 5H8BA 2YAKA 4BIDA 2W9ZB 4YU2A 3Q4UA 4U7ZA 2CJMA 3AGLA 4YUQA 3RZBA 3LMGA 1A9UA 3R9RA 4FIEA 5AIKA 3ZM9A 3BGPA 4LL0A 4CYJA 1UU7A 1YVJA 4C4HA 2YCQA 3KXXA 4X6RA 2UZOA 3F5PA 5HESA 4DH7A 1W8CA 4G9CA 2WTKB 4DEDA 2P4IA 3BYUA 2ZM1A 2OFUA 5EDQA 3L9LA 2X8DA 1SVGA 1OB3A 3EOCA 1OL2A 1PMNA 3GC9A 3QUEA 5CLPA 2BZJA 2CPKE 4X2KA 4CV8A 3KEXA 4PMTA 4Y46A 4YPDA 2GFCA 1ERKA 4FKSA 3LKMA
chains in the Genus database with same CATH superfamily
4O27B 2WU7A 2IW6A 3E93A 4KSQA 2WMVA 1KWPA 3P78A 4HYHA 4O6EA 3ZRMA 4MWHA 4AZVA 5HVJA 3R7EA 3GCPA 3FZ1A 2XRWA 4EK5A 2CN5A 3KU2A 4WRGA 1BMKA 1VLRA 4J53A 2ITXA 2YDKA 2ZAZA 2GFSA 3B8RA 2BPMA 3PPZA 1CKJA 4AGCA 3NW7A 4ASDA 4O7RA 2CNQA 1YKRA 4XG6A 2YIRA 3O17A 4MWIA 3NAYA 4OBOA 3ZBXA 5F20A 4L68A 3TZ9A 4EBWA 3MYGA 4ZXTA 5C27A 5KMNA 1AGWA 4F4PA 3FL4A 4X2NA 3QHWA 5CI7A 2PSQA 4W8DA 4PP7A 1LEZA 3NYVA 5I9UA 4F64A 3P7CA 5CAOA 4NM3A 4X3FB 5HTIA 2HYYA 4CYIA 4AOTA 3ODZX 4BTKA 4U45A 1CSNA 1Q4LA 4DGNA 3ZLSA 2GHMA 5EKOA 4TT7A 2XIKA 4R7BA 4O0VA 3QRKA 5I9XA 1GY3A 5ANGA 2EXCX 1KE9A 3CEKA 2BZKB 4EUUA 3POZA 4MK0A 5CVFA 3M42A 3BZ3A 3UDSA 4FKVA 4O0TA 3ZC5A 1H00A 4CMUA 5IQHA 3HRBA 3UP2A 1ZMUA 3ORPA 2WPAA 4FKPA 3VUDA 2W1IA 5FTOA 2VTTA 4C57A 4IWPA 5AUUA 2J0IA 5I5ZA 4QDEA 5M56A 2GTMA 4BFMA 2PVKA 3LXKA 2WTJA 2X0OA 2C6OA 3OCTA 4LFIA 3R1NA 3VQHA 4YJUA 5H2UA 4Z16A 4DH3A 4D2WA 4EYMA 4XV3A 1ZY5A 4WNMA 5BYYA 3RPVA 4GG5A 4Y85A 4L67A 4C59A 2JDVA 4X2GA 3FMHA 3VUHA 4F7LA 5L4QA 1YOLA 3TNQB 2QD9A 3AQVA 4KIOA 1PKDA 4QTEA 3EL7A 4EK4A 3OTVA 3TM0A 1JKSA 3HAVA 3R8PA 3CY3A 2IZSA 5A4EA 4A07A 2UZUE 1OL5A 1OPKA 2WQMA 3ZO4A 4EOMA 4A9RA 2IF8A 4F1MA 4G17A 5BVOA 3R2BA 3TJDA 4ZJIA 3F61A 2CLXA 2HZIA 5AM6A 3W2OA 1PXKA 4IZYA 2VN9A 1PMVA 3BEAA 4OGRA 3TG1A 3NW5A 1L8TA 3NUAA 2RL5A 1XJDA 3OS3A 4BDEA 4D5KA 4KKHA 4FV0A 2G2FA 2QODA 4NU1A 4U3ZA 4UX9A 3RM6A 4GU9A 4AZSA 3AD5A 5HX8A 3OC1A 2W1HA 4WBOA 2BAKA 4AA0A 4I20A 5JGDA 3U8WA 3MB6A 5AUZA 5LWMA 3SRVA 4APCA 3GI3A 2XNMA 3ZO2A 5LJJA 4BJJA 4LRMA 2ZOQA 1M17A 1E1VA 3QTSA 5AR3A 1WBSA 5AR2A 4GV1A 2YZLA 4KABA 3QQGA 4EQCA 2O64A 2QR8A 3PFQA 3R2YA 4YLJA 5M06A 1H08A 4FTLA 5AX9A 3Q4TA 4O96A 4BR3A 1Y8YA 5DRDA 3CSVA 2XK3A 3DJ7A 3Q52A 3DFAA 3Q5IA 4IDTA 3OWLA 2OJIA 5CU4A 1P14A 4YJSA 3W55A 4FBXA 2BROA 3F7ZA 1T46A 3LFNA 4PMPA 3RK9A 3RPYA 5IU2A 3SG8A 2WIHA 2OZAB 4FIHA 3KF7A 4CG8A 3L8SA 1TQPA 2ITZA 4NKSA 4JOAA 4UMPA 5HTCA 1H01A 3QCSA 4ERWA 2PE0A 3PG3A 5CXHA 5DE2A 2HXLA 3NEWA 4EHEA 1VZOA 4ZOGA 5GIPE 5J95A 5AAFA 1GZKA 3Q53A 4FK6A 5J79A 4I0SA 1ZOEA 4ONAA 4IX6A 4QPSA 4PDPA 4RQVA 4ZLYA 4BDKA 3ALNA 1UA2A 5C9CA 4M0ZA 4EH7A 5M57A 4O7TA 1WZYA 4FZ6A 4D5HA 1XBBA 3FMDA 4M12A 4NH1A 4V01A 3ORXA 1U4DA 1KE7A 4H3QA 3V5PA 4LM5A 3W10A 3L1SA 5DGZA 4AZFA 2C5XA 3KREA 4M68A 5AR7A 3TZ8A 1PXPA 2CKEA 5EQPA 4ZTRA 3MTFA 4FR4A 3RHKA 2VUWA 3W1FA 3BI6A 3O71A 5C8KA 5EOLA 5IZFA 3R8ZA 2CKPA 3R9DA 4FEXA 3FMLA 5GJFA 3H0YA 4IZ5A 4RIWA 4RVTA 5HIDA 4IDVA 4E7WA 5IA0A 2XRUA 4O22A 5HE2A 2BVAA 4H39A 4DFBA 1U54B 5EQYA 3SXSA 3DLZA 4FTCA 5FP5A 1TZDA 3D5XA 3MY1A 2CGXA 4GSBA 4NM5A 4NM7A 1Q8UA 3ORZA 4ALWA 4U42A 4YNOA 3GXLA 5FD2A 3UZTA 3FEGA 3KXGA 2CLQA 5KX8A 4RJ6A 4EK6A 3R22A 3AG9A 3UOKA 4EWQA 3LFAA 4AP7A 1TKIA 1AQ1A 4FUYA 3AOXA 5DT0A 4HVSA 3UODA 1H26A 3DBDA 5KNJA 3VNTA 1ZRZA 3ZXZA 5L2QA 4WNKA 4EBVA 4IVAA 3TTIA 3EQPA 2FB8A 3N51A 3BV3A 4O7LA 2YZAA 3EQDA 3MVJA 4D2TA 4BY9E 3Q4ZA 1ZYLA 2DWBA 5HNGA 5L8JA 5EQEA 5AV3A 4BYJA 5A6OA 2BAQA 2JIUA 4P5ZA 2PZYA 1ZZLA 5HIEA 5FUTA 2J0MB 2GHGA 1FMKA 5I9VA 2P55A 4XCUA 5D9HA 3MI9A 1G8KA 5L6PA 1V1KA 4CQGA 3T8OA 2XAMA 5HORA 4QP2A 3E92A 4GH2A 3UVQA 4EOOA 3I5NA 2XEYA 3U54A 2GQRA 4ZTSA 4XG4A 5D41A 4B6LA 2BRHA 3MH0A 3IDBA 3CJGA 2B52A 4L3JA 1J91A 4IX5A 2PVHA 5CWZA 5AUVA 4GT4A 2X6DA 5EHLA 5KKRB 3P79A 4S30A 2QO7A 4B0GA 4TY1A 3KY2A 3HL7A 4GK4A 4HYIA 4EOSA 4YSMA 2WELA 3OEFX 2IZUA 3R30A 4IAAA 3U6HA 3IW5A 3UOJA 2PZRA 3R1YA 4EEVA 1YHVA 5HCYA 3OT3A 4AGUA 4BB4A 3VBWA 4EJNA 1H25A 5TE0A 4IMYA 2YHVA 5L3AA 1OL6A 2ETMA 3MH1A 3BRBA 3BU5A 4GS6A 4JRVA 4L7SA 5HE1A 5BX0A 4XRLA 2QKWB 3FI3A 4MD7E 3CKWA 4WD5A 3R21A 4XNEA 4BCOA 3F9NA 1MRUA 3AT2A 4MXOA 3FLQA 3EQFA 4ZZOA 5EOBA 1M52A 3R0TA 3HDMA 5EM8A 3MPTA 4XJ0A 5CQUA 1IAHA 4ZSJA 3CY2A 4G3DA 3P9JA 3PPKA 3HRFA 2WTVA 5DIAA 4QMOA 3E7OA 4XOZA 2WEIA 3EQCA 1OL7A 2E9UA 3Q5ZA 2YWVA 3NYXA 3HP2A 3UZPA 3ZONA 3EHAA 1B39A 4HW7A 3RNIA 3LW0A 1JKTA 4O1PA 3EFWA 4ZLOA 3MSSA 3DB8A 3ZCLA 5C4LA 1R3CA 4ZSGA 3V04A 2HW7A 2XKDA 3KB7A 4V05A 2OIBA 3BHVA 4FTKA 3H3CA 4AQCA 5BV3A 4RC4A 4IM0A 3CGOA 5HGIA 4QMQA 3TV6A 4FV7A 4L8MA 4XG8A 1W83A 3FZTA 4CT2A 4JDHA 4GIIA 3KFAA 4FV4A 5EM7A 1YXSA 2PE2A 2PUUA 4FIIA 4BCGA 2OKRA 4WT6A 4YJTA 3VBVA 1U5QA 5FXSA 3VO3A 1IA8A 2IEWA 5AP1A 3A8XA 4UZHA 4D9TA 2JBPA 5EI8A 4I21A 4JQ7A 5AX3A 4TRLA 3V5QA 2W1EA 4JIKA 3UBDA 2QOHA 2C6KA 3W0MA 2C3JA 2WOUA 2C5YA 1OECA 4AXFA 5FXRA 2YLFA 1J1BA 3GCUA 3FC1X 2BILB 3BQCA 3GCVA 3LE6A 5E7RA 3QAME 5HE0A 3GBZA 3HUBA 4TXCA 3L8VA 4C2WA 3A8WA 4K8AA 2C3LA 2XMYA 3BYVA 1U59A 4L42A 4F78A 5CU6A 4RJ4A 5M4FA 4QPMA 2HELA 3NUYA 3QC4A 4G6LA 3QTWA 4GT3A 3PXRA 4K6ZA 3OZ6A 4TTHB 4FMQA 4GVAA 3P7BA 4FTRA 3Q9WA 2HK5A 5FWKK 3PYYA 4FSUA 4EL9A 3FAAA 3H9RA 3PXFA 2C6TA 4K9YA 3WE4A 2OJFE 3PFYA 3OVVA 3VW6A 1ZARA 1SYKA 3GGFA 4O0WA 5D7AA 1BL6A 3BLQA 2CSNA 3GU4A 4PDYA 3FV8A 5CZHA 4DHZA 5L8LA 3AD6A 2VU3A 3P4KA 1TQMA 4XG2A 2VWVA 2C5OA 4E3CA 3MGYA 5K0KA 5DPVA 2GQSA 2UW6A 1K3AA 3HYHA 4D28A 4D58A 4XHKB 3IDPA 1V0OA 3JPVA 2X7GA 4TWNA 3I7CA 3O7LB 3CD8A 2VGPA 3FQEA 3GUBA 3RWPA 2FYSA 3HNGA 2WEVA 2WTWA 4BIEA 5K5XA 3VS2A 4RX9A 3H10A 3QX4A 3VUGA 1WBOA 4F9YA 5F1ZA 4FT0A 3D7TB 1OITA 3EKKA 5D10A 2QLUA 2QU6A 2C6DA 4AUAA 3FMKA 2YIXA 5EK7A 4YTCA 2W5BA 2YACA 3QQJA 2A98A 4GCJA 4C62A 4ID7A 1Q3WA 3EH9A 4C33A 1PXIA 2HOGA 5BVNA 3MVHA 3R01A 2PY3A 2C6MA 2WOTA 3VS5A 4PL4A 4Z9LA 2BR1A 1OPJA 4JLCA 4FTAA 1I09A 2XH5A 1R78A 3NPCA 1EH4A 5FM3A 2G2IA 2J9MA 4E6CA 2XAOA 5J87A 4FKUA 2V5QA 4QTDA 2F49A 3LHJA 3PJ1A 3VWAA 2VNWA 2OF2A 1JAMA 4AZEA 5DYJA 1WVWA 2BDFA 4CNHA 4GEOA 5IG1A 5CEQA 2ETKA 2X4FA 3I4BA 5B2MA 5IQCA 4I41A 5L8KA 2CNVA 3GU7A 2BRMA 3C4WA 3D7ZA 4NL0A 2CGUA 5L2WA 3Q3BA 2UZDA 3ENMA 3DXNA 3LFDA 5AP2A 2XKEA 5C01A 4U5JA 2Y6MA 3QX2A 2W9FB 4ENYA 2V7OA 4RX5A 4NCTA 3IOKA 1RQQA 4LRJA 1Q97A 1UNHA 5E9EA 3AT3A 4IWQA 1CTPE 4RMZA 2XALA 3O8TA 1F3MC 3EFLA 3SKCA 4OTPA 4BICA 4JR3A 5BYZA 4EC9A 1S9IA 3PJ2A 5BMSA 5JZJA 3TIYA 4GVJA 5JQ5A 4Z55A 4DA5A 3RPOA 5HG8A 2XIRA 1FGIA 2YDIA 3QQHA 2UW8A 3D2KA 4I6FA 2I0YA 5CYIA 4DTKA 5DMZA 4BDGA 4D4SA 3DBEA 5DEYA 5H8EA 5CEPA 4EH8A 1OBDA 4RG0A 5E8SA 2XB7A 4DEIA 3H9OA 3UNKA 2JBOA 3NMUF 3QQLA 1LUFA 4Y83A 5G1XA 4ARKA 3W32A 1GAGA 4CFXA 1PYXA 5CVHA 3P86A 3N4TA 4PPCA 4F63A 2O3PA 4FZ7A 2O5KA 4FYNA 4BN1A 4BTMA 4CRLA 5IMEA 5IQIA 2EXMA 1FQ1B 2F57A 3MIYA 5FEQA 1SNUA 3ZYAA 2GNJA 1Z5MA 3UIMA 1OKYA 3UVRA 1W82A 4TKSA 3RM7A 3CJFA 3PVBA 2H34A 3DDQA 5AV4A 1ZYJA 4DITA 3HKOA 2W5HA 4GUBA 4ANBA 4CKJA 5HCZA 1GZ8A 2XK6A 4DHJA 1WCCA 2YM3A 3A60A 2ZV7A 3QRJA 5H9BA 3UVPA 4CFMA 4C58A 2YM6A 2FSLX 3R63A 3RPRA 4A9TA 4AN3A 3IONA 1KOAA 2C0IA 3ITZA 1HOWA 5I4NA 3C0HA 2GHLA 3HGKA 1K9AA 4NJ3A 1UU9A 3OCSA 5HI2A 4AAAA 1NVRA 3FMJA 4IX4A 1JSUA 3RGFA 5CF5A 5IQBA 3K5UA 4I3ZA 4QO9A 3GU8A 3AC4A 3PY0A 1ZOGA 4FGBA 2VX3A 1YDSE 5BVFA 4MNEB 5KE0A 3HMMA 5BVEA 4FGRA 2Y0AA 3PSBA 4ASZA 1JNKA 3LCDA 4NEUA 4BL1A 2XNPA 3IG7A 4U97A 2Y4IB 2XNEA 2C5NA 3ZMMA 5D11A 5HU9A 5AV1A 3OBGA 4BDBA 3OTUA 4JJRA 1BYGA 3GCQA 5CY3A 3COHA 5A46A 3DKGA 4X3FA 3LCKA 1OIRA 3OXIA 4FT9A 3F66A 3ROYA 3L8PA 4IB0A 4LRKA 5JGBA 5JRQA 4EORA 5F4NA 4L3PA 5JFXA 4I94A 1H1SA 4IM2A 4D0WA 2XK4A 4X2FA 1J7UA 2Z60A 3VBTA 4AOJA 2VTOA 5IA5A 1YI6A 3NGAA 2IN6A 4I93A 1WBVA 4QMVA 4Q5HA 3MVMA 3QBNA 4FNWA 3TL8A 2FUMA 4EH2A 4HGTA 2OK1A 2PK9A 3FKLA 3KKVA 4O91A 4E4NA 4CFUA 2ZDTA 4FKIA 1JSVA 4M84A 4NK9A 5HICA 4L01A 5L6OA 1YHWA 3LFEA 3AC8A 4JDKA 3U9NA 4IFGA 5IEXA 2RFSA 4DBXA 3ET7A 3QRUA 4YC6A 3DK3A 2RFDA 3KN5A 2GS7A 5DOSA 4RJ7A 4O0SA 4ZP5A 2HWPA 4F0FA 4FSQA 2ONLC 2VX1A 2W1ZA 3BBTB 4J1RA 2F4JA 3WF8A 5M08A 4IIRA 4KINA 5CEKA 3P5JC 2PMLX 3NSZA 4FTJA 4Y5HA 1X8BA 4QP9A 3D5VA 1YXVA 4LI5A 4WUNA 4QMNA 1LPUA 4O0XA 2ITOA 2JKKA 4U6RA 1KE5A 4HCTA 3FI4A 4GL9A 4RLLA 3TJCA 1IG1A 4AN2A 2OJJA 1PY5A 3ZFMA 5IA2A 3BL9A 4J8MA 2C3IB 1ZLTA 4F70A 2R3NA 2W17A 3B8QA 4AW5A 2I7QA 4AT5A 2IW9A 4FSWA 4KAOA 1B38A 3MDYA 1OVEA 1XR1A 4R8QA 2F2CB 3SLSA 4E26A 4U40A 4LOQA 4A4XA 5CXZA 2XP2A 4GJ3A 2QO2A 2B1PA 4FTIA 4GU6A 5FTQA 3SDJA 4MH7A 3U6IA 3M1SA 4IB3A 3MH3A 3L9NA 4BWPA 4JBQA 1PMEA 3FXZA 3D2IA 4AG8A 4NTSA 1JBPE 4I6HA 4RPVA 5AEPA 5HBHA 4IVBA 5HLPA 4AA5A 5HNBA 2WGJA 3EL8A 3PVWA 4DG0E 3SX9A 2BTSA 3RNYA 4D2RA 4RWIA 5CNOA 5FXQA 1HCKA 3R7UA 3F3WA 2XEZA 3I81A 3ORTA 3QWKA 2H6DA 4QQCA 1Q99A 3ZS5A 3DBFA 3OMVA 2KULA 3R00A 4FSTA 3PJ3A 2LAVA 5ETCA 2X9FA 4ZS0A 5M53A 2PVNA 4M69A 4G3EA 4Q9SA 3IQ7A 1OGUA 5LWNA 5EG3A 3OOMA 4FKTA 1Q41A 2Q0NA 3MA6A 2OLCA 1FVVA 1YDRE 3DXPA 2PVMA 3ERKA 3HMPA 2PVJA 2PUNA 3RK7A 2YABA 2XIXA 3ZZWA 4HNFA 2YM4A 4QTCA 4USDA 4WSYA 5TO8A 2X6EA 1NVSA 3ELJA 4L00A 2XANA 1OUYA 1KE6A 1XH4A 2V22A 4R1VA 5DT4A 4EH5A 3DTCA 1P4FA 4DFYA 5AP4A 4H3PA 4LUDA 4FZAB 3WYYA 3VUMA 1I44A 4AFJA 3WF7A 2AYPA 4S34A 4PV0A 4KB8A 3G0EA 3NX8A 2C4GA 3JR1A 5ICPA 5CT7A 3F5UA 2BIKB 3QFVA 5DT3A 3QHRA 3LFBA 1TVOA 5BVDA 4QNAA 1Q8YA 3KL8A 4N4SA 4E4LA 4LGDA 3ZRKA 3PXZA 2WU6A 1U54A 4ZSAA 1SNXA 2X0GA 4UN0C 5B7VA 3QC9A 3E88A 5EHYA 4DGOA 3LVPA 3P23A 4JIAA 3QUPA 4L53A 4L7FA 3EFJA 1R0EA 2O2UA 3PZEA 4RJ3A 2YWPA 4JS8A 1M2QA 4RWLA 3IPHA 4BCFA 3GP0A 2XYNA 4F0IA 4QYFA 3NRMA 2VTQA 3TXOA 4JR7A 3EQGA 1XH6A 3A7IA 5H3QA 2F7ZE 2ERZE 5L2SA 2VO7A 5GJGA 3SAYA 2F7XE 3PUFC 2VWBA 3GOKA 2B53A 5GZAA 3S00A 3EN9A 2FSMX 4CRSA 4BWXA 4HCVA 3F3ZA 4GRBA 1QMZA 1JOWB 3IKAA 4RIXA 1L3RE 5HO6A 4ZY5A 4K1BA 5IEVA 4DDGA 5IQFA 2QLQA 3FXWA 3C9WA 4FV3A 5HBJA 3NDMA 4QMLA 3DK6A 4XV9A 3R7YA 4DAWA 3BHTA 4AGWA 4MBIA 4CTBA 3KMUA 3ZXTA 3VC4A 4MTAA 5T3QA 4FV1A 3HV4A 3R71A 4U9AA 3MN3A 3PXQA 2FO0A 4L6QA 4FVQA 4UY9A 4XBRA 3ZEWA 5AV2A 3BE9A 3VF9A 4N70A 2F7EE 4JI9A 2ZM4A 4AFEA 4KIQA 4O84A 3FQHA 5EDPA 2YERA 2P33A 5M55A 2ZV8A 4D9UA 3C5IA 2X81A 4H58A 5BUIA 3A62A 2JEDA 4EWHA 3HA6A 4RJ5A 3B2TA 4XMOA 2PL0A 1P5EA 2CCHA 3Q2MA 4MF0A 2GU8A 3NUUA 3BPRA 3PWYA 4WHZA 5HNIX 4X2JA 5D1JA 5E90A 4RQKA 3K3IA 1XMLA 3QKLA 5TOZA 4K0YA 5K3YA 3L9MA 4EKLA 1J7LA 4QP3A 4TYHB 3ZM4A 2YN8A 1YXUA 2QO9A 2XK7A 3AKLA 4RIOA 3VAPA 3Q04A 2A1AB 3AMAA 5CX9A 3F7WA 4XUFA 1BLXA 4JDIA 3PSCA 1PJKA 4O6LA 4W4VA 4LDTA 4R78A 3Q96A 2VWWA 1BI7A 3EN7A 5I0BA 4FT3A 4FSRA 4RSSA 4FL1A 3FDNA 2XNBA 2X8EA 5E8YA 3UO4A 1O9UA 4QP1A 3VN9A 2WMQA 3ANRA 4I5PA 3WF6A 3TNIA 4AT3A 2EXEA 3PJCA 3FKOA 1SVHA 4J97A 3ZU7A 3G51A 4IEBA 1B6CB 3LCSA 4BBFA 4EOLA 4RC2A 2J6MA 3QRIA 2J5EA 3NFFB 2BUJA 2HZ0A 3E3PA 5F94A 2UW9A 3MY0A 1M7QA 4ZMFA 4JQEA 5HOAA 3CXWA 3QD0A 2QOKA 1ZY4A 1OKZA 3BE2A 3EQHA 3OXZA 3ZFXA 3R9NA 3CR0A 4R6VA 5C26A 3RAKA 3RHXA 4CFVA 4PTEA 5IA4A 5HVYA 4GKHA 4B4LA 5IA1A 4LV7A 4EH9A 2QOBA 4E5BA 4QMTA 2W4OA 4IAYA 4MXCA 1URCA 2XM8A 3EKNA 5BVKA 2R3FA 5DEWA 3R8VA 2UVZA 4KBAA 2Y8OA 3S4QA 3IDCA 5JFWA 4KS8A 2XF0A 4OTGA 1W7HA 1PXJA 4J99A 2X2KA 3CPBA 5FEEA 3FC2A 2B7AA 2O8YA 3A7JA 3KC3A 4MXXA 2UZTA 3VBQA 3WYXA 4FC0A 3LCOA 2YAAA 4IW0A 1KOBA 4ZJJA 4OT6A 3TNPC 3TV7A 2ITWA 4MXYA 2CKOA 3GOPA 4QMZA 3WF5A 2XARA 5CEOA 4JMQA 2C0OA 2FSTX 3IECA 4KWPA 4CCUA 3UMXA 2XS0A 5IMXA 4XYFA 5LVOA 2YITA 2R4BA 3QZIA 1NY3A 4HPTE 5ANJA 3R8MA 1H28A 5A14A 3O2MA 2O0UA 4AOIA 4PP9A 4AWIA 4QYYA 4I6LA 4YJRA 2QOOA 2W05A 4F6UA 3KIOC 2YCRA 3KVXA 2EWAA 2QG5A 4K18A 3UOHA 3FHIA 4ZIMA 5EW3A 1TQIA 4RGJA 2BRNA 4JXFA 4DH8A 2QOIA 4UYNA 1WFCA 1ATPE 3MIAA 3OFMA 1GJOA 4K2RA 3PA4A 3UC3A 1ST0A 1Q5KA 5M07A 5DN3A 4QMYA 5H8GA 3Q6UA 3QTRA 1REJA 4LGGA 3TKIA 4MD9E 4RZVA 1NA7A 2I6LA 2J5FA 1PKGA 2RG6A 5ACBC 5E1EA 3PVGA 2UW3A 4XV2A 1Q3DA 2B9JA 1U5RA 5L2TA 4LUEA 2OH4A 3UE4A 3UMWA 4F1OA 3UIUA 3D4QA 3EN5A 5CT0A 1H07A 2NYAA 4I0RA 3SOAA 2PVYA 2JDRA 5J7BA 3KRWA 3I1AA 2Z8CA 1BX6A 1Y57A 1XH9A 5AP5A 3S95A 4TW9A 4AE6A 5AAEA 4O83A 2XBJA 2HZNA 3F88A 3NUNA 5LXMA 2G01A 3IGOA 4F0GA 4A06A 4FYOA 3DAEA 4PNKA 3A99A 3GB2A 2QOLA 1AD5A 4UV0A 4F08A 1VR2A 2BHEA 2WMSA 1IAJA 3F6XA 4W4WA 5GHVA 4L45A 4E4XA 2QG7A 5KZ0A 4FOCA 2C6EA 3QXPA 4AN9A 1O6KA 4C2VA 4QP6A 4BCJA 3UQCA 4DFXE 3OD6X 3OEZA 2R3KA 2ERKA 3M2WA 5AWMA 3ORIA 4YPSA 3PIYA 2YIYA 3SOCA 2GNGA 1SZMA 3FMEA 3QALE 3DV3A 5FEDA 1YW2A 4M67A 4YC8A 3Q9YA 5J8IA 5CENA 4IBMA 4K77A 4JG8A 3W33A 3KXMA 3OUNB 4EZ3A 1GZOA 2VWZA 3BL7A 2HAKA 1XWSA 2C6IA 1UU8A 4GFGA 4N57A 3FMMA 5I9ZA 3QZFA 5HD7A 2A4LA 3EB0A 4S2ZA 4MEDA 2IWIA 5E8ZA 4Z7HA 3LXNA 2JD5A 3VF8A 2JGZA 4M7IA 4DG2E 4Y5QA 2XNNA 1OKVA 4DH1A 3CTJA 4FV8A 4MBLA 5DRBA 1QL6A 4G5PA 5BVWA 3PXKA 3RCDA 2PMNX 4OBQA 2SRCA 3UC4A 5C1QB 2B55A 1OPLA 2YIWA 5DLSA 5M4UA 3QU0A 3AC1A 3QA0A 1UV5A 4M14A 2P2IA 3FPMA 5EHOA 2PVRA 2PVFA 2XK9A 4UXLA 2PYWA 2XCKA 2UZNA 3ULIA 3TKUA 5FBNC 4XG3A 2QKRA 5AR4A 3C0GA 2ZMCA 4GFMA 3P1AA 3OW4A 1FBNA 2BHHA 4FT5A 2GNHA 5FTGA 5FRIA 2AUHA 3W2PA 5JSMA 5EM6A 4BTJA 3ZLXA 4A9YA 2BIYA 2VTSA 4FNXA 2X0QA 4QMSA 1E1XA 3VUIA 3NLBA 2GSFA 2NRYA 4BCKA 3MV5A 3IOPA 1S9JA 2W0JA 2VWYA 4FF8A 3VULA 4L9IA 4YJPA 4YZMA 4AXDA 4IQ6A 2EVAA 5AA9A 5JMSA 4F99A 3UGCA 2B9HA 3VS0A 4DN5A 3SG9A 5L2IA 4C02A 4XP2A 5EYCA 4D2SA 4TWCA 3T3VA 2JIVA 3FPQA 2WFYA 3O0GA 4OTQA 3OHTA 3IO7A 4GFOA 3SRVB 5DG5A 4TYIA 5HG5A 5A4CA 4GK3A 1G8JA 3JVSA 2OI4X 1ZMVA 3QXOA 4NSTA 4CV9A 2UUEA 4O2ZA 1IEPA 4RFZA 4BBMA 3TCPA 1XBAA 5E8TA 2PVLA 5CQWA 5CSHA 4ACDA 3DCVA 3LMIA 2PTKA 3OT8A 5KMJA 1YWVA 2WZJA 3IS5A 4M3QA 4FT7A 4FVPA 2Z7QA 2R2PA 3O51A 4IC8A 5IKWA 3JY0A 3R8LA 1H1QA 4IJ9A 3UIXA 3FI2A 4W9WA 2AEGA 4FTOA 3E5AA 4V0GB 4QMWA 3VHKA 2VRXA 5HQ0A 4FEVA 2JDOA 3I6UA 2I40A 4MQ2A 4IAIA 2W1FA 3MY5A 5ETIA 4CEGA 4XEYA 1MRYA 3FWQA 2E9OA 2WQBA 3OOGA 2P0CA 4MNEA 2X1NA 1KE8A 1YQJA 1UKHA 4KBCA 4O21A 3WILA 4BZDA 3ENHA 3GQIA 5J9LA 2ZB1A 4FKGA 5E8XA 1YHSA 5FDPA 3BGQA 3HV3A 2YFXA 2V55A 3NCZA 2ZM3A 4FKLA 2W1DA 4FSNA 4FTQA 3POOA 4UYAA 5HTBA 1PXNA 3NR9A 3ZLWA 2GS2A 3D94A 3E63A 3ORMA 1YI3A 3Q6WA 4LYNA 3QCQA 4A4OA 4U43A 5CSPA 4DTAA 1SVEA 2E9NA 2NO3A 4AW0A 2ETRA 5CF8A 3UO6A 3RALA 2NRUA 3DAKA 4YGAA 4E1ZA 2RSVA 4NUSA 4KKGA 4BKYA 4Z7GA 4FVRA 4CLJA 2ZVAA 5JGAA 2OFVA 1KSWA 1Q62A 3CD3A 4FI1A 5BPYA 3TDWA 2DQ7X 4JAIA 4PX6A 4ALUA 2GMXA 4UMRA 4U8Z