4CTBA

Structure of the human anaplastic lymphoma kinase in complex with the inhibitor (5r)-8-amino-3-fluoro-5,19-dimethyl-20-oxo-5,18,19,20- tetrahydro-7,11-(azeno)pyrido(2',1':2,3)imidazo(4,5-h)(2,5,11) benzoxadiazacyclotetradecine-14-carbonitrile
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
292
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 292
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ctbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ctbA01
4QP3A 1PKDA 4EK5A 3LFSA 3BU3A 1V0BA 4PP7A 4J8NA 2OXDA 2Z60A 4AN2A 4X2KA 1OIQA 2XJ2A 4CMOA 4CKJA 4N70A 2XNEA 4H1MA 4U3ZA 3Q4UA 3NUYA 4L53A 5BUJA 2WTIA 4S30A 4U40A 4F0FA 2QHNA 3IW4A 3PXZA 4TWOA 4G3EA 4ORKA 4MD8E 3NUXA 5IG1A 2NRYA 3NPCA 5AP4A 2J0KA 2CCHA 2F7ZE 3CKXA 4KSQA 4ZSAA 4C3PA 4QD6A 3BHHA 3Q96A 4QMPA 4KKHA 4Q9ZA 2JKOA 4BL1A 1CTPE 3DT1A 3TNPC 3QKKA 2ZV2A 2GTMA 5EFQA 5C26A 4DCAA 4HGEA 2E9NA 5LARA 2WNTA 4GS6A 5HBEA 3M11A 3VAPA 2IJMA 3RNIA 1ZYJA 4I6HA 2BHEA 3PIZA 4MQ2A 3OHTA 3NUAA 3COMA 2NRUA 3PP1A 3MY1A 4O0YA 2OFUA 4Q9SA 1QPEA 4BCMA 4JDHA 4K0YA 2VGOA 2BUJA 4XHKB 4BTJA 4BDBA 3PRFA 3NS9A 4LRJA 5I4NA 1M2QA 2ZM3A 4KIKB 3WF9A 4F0GA 5ITAA 4FBXA 1PJKA 4HGTA 5LMAA 4NIFA 5ANGA 4EOPA 5JGAA 3RALA 5TOZA 5LJJA 4O7TA 4FEVA 1MQ4A 4RA5A 5DR6A 3RK7A 4JDKA 5LVMA 4ZTMA 2OJ9A 3D15A 4ANBA 4AGUA 3TKIA 1FGIA 5HBHA 1H01A 3ZRKA 3PSCA 4DE4A 5FWKK 3ITZA 3OCBA 4I21A 4JT3A 4L46A 4S34A 3ZLXA 2V5QA 2W9ZB 1JKKA 2PVJA 2WO6A 4YHJA 5E92A 3P86A 3RKBA 1WFCA 4IVBA 4YZMA 5JKGA 3TUCA 3G2FA 4ID7A 3QTIA 4QTEA 3QTSA 3KMWA 4DBXA 4EH4A 1R0PA 4KIQA 3PVGA 2XNNA 3EQIA 5GINE 1IG1A 4IACA 4TZRA 5FTQA 4CFVA 2XEYA 3MVHA 5CS6A 4FTQA 3P5KA 5AUYA 3UVRA 2HWOA 5HLNA 3O2MA 4JLCA 5DRBA 1KOBA 3RM6A 2FSTX 1AD5A 3LW0A 3BBTB 5CAOA 3I81A 3FI4A 3LCDA 4HNFA 5AUVA 4J71A 4GYGA 3VIDA 3DXQA 5DH3A 5JFSA 1HOWA 3OFMA 3GU5A 4NTTA 5DNRA 5HNIX 3UZTA 4EI4A 4BCGA 4DFZE 4YHTA 5HNGA 5KMMA 4AX8A 4LUDA 5J87A 4GRBA 5HE2A 2PTKA 3IOPA 4QYGA 1PMUA 5L2SA 2XS0A 1H0VA 3Q5ZA 4XOYA 3N4UA 4CV8A 2XNPA 1XBCA 2JKKA 2RG5A 3R2YA 2XM8A 4CFWA 3AMYA 3Q6UA 1XO2B 4IADA 2HELA 4M84A 1XBBA 3OCSA 4KRDA 2H96A 1YOLA 1H1SA 3V5TA 5LXMA 4IC8A 4ZY4A 5M4IA 3W18A 3KN6A 3A60A 4FZ6A 2W1IA 1YXTA 2WMSA 3MY5A 4G3FA 5CANA 1OIYA 2WD1A 5AX9A 4UMQA 2RFSA 4BZNA 2XH5A 3GU4A 4YTHA 4FL1A 3KK8A 5B7VA 3BYUA 4OW8A 3QD2B 2GFSA 4FEQA 4MVFA 4KB8A 4E4XA 3AC8A 3CJFA 5AV3A 5D7VA 1UV5A 2C6MA 4FNXA 2JIVA 2F7XE 2HIWA 3DBDA 3H0YA 4D2RA 4I5HA 2Y4PA 1YKRA 2PMLX 4K11A 4G16A 4ZLYA 3IGOA 5BYLA 1YWNA 3BYVA 4FZFB 3VS7A 1J7IA 3F7ZA 4EEVA 5CALA 4I0SA 2WTKB 4MXXA 1GZ8A 4QT1A 5DT4A 3W2CA 4GL9A 4BCFA 3CE3A 3ZO1A 3FJQE 3ZO4A 3DAEA 5EYMA 4E5WA 2P3GX 4FTUA 4RC2A 3FKOA 4RIXA 4BCKA 3GVUA 3PWYA 5CQWA 4CV9A 2ITWA 3G33A 3MPAA 3GP0A 1NA7A 4IZ7A 2XCHA 2QOFA 5IEVA 5IKWA 3LFQA 2P4IA 4X3FA 3TV7A 3SVVA 1Q3DA 5ANJA 3TL8A 4FVQA 3PG3A 4EC9A 3PDTA 1GOLA 5I3OA 2WPAA 3GU7A 1JOWB 3QFVA 4EOSA 5FD2A 1WCCA 4EH5A 2B9JA 4OT6A 3HP2A 2X7GA 4CTCA 1J7LA 3ORIA 2C3JA 3F5XA 1PHKA 4IH8A 5HCXA 3REPA 1K2PA 3ANRA 4DEGA 3DU8A 4TYEA 4Y72A 5CNNA 2GS2A 3MVMA 4JS8A 4I4FA 1YDSE 3QHWA 1H0WA 4WSQA 3ETAA 2QOKA 2YITA 4O7YA 2UZDA 4DCEA 3NVKI 2WQOA 3BX5A 5E9EA 5CVFA 2YCSA 2BILB 5I9ZA 3BHTA 2UW3A 5IH6A 2ETRA 3QTRA 3Q9WA 4AFJA 1U54B 4JIKA 4ZTLA 4KAOA 3COKA 4BKJA 1Q5KA 5CEPA 2EUFB 5IA1A 3R1NA 2G2HA 3QTZA 4BGHA 3ZM9A 4YO4A 4AW0A 2OJIA 1PMVA 4H3PA 4NZWB 4FV7A 4AZEA 1R3CA 4BC6A 4F0IA 1YXUA 4Z7GA 4WUAA 3VS3A 2QCSA 1YQJA 3BI6A 4EK8A 3LM0A 1HCKA 2VAGA 4FTNA 4MNFA 4ZTQA 4U7ZA 3R7UA 4DGGA 5ETIA 5E1EA 1VZOA 3HMPA 3ORMA 4M0YA 3SHEA 4AOTA 5ANDA 5CLPA 3FLSA 3W2QA 2X4ZA 4AUAA 1VYWA 4L3LA 4EHGA 2CSNA 4FKPA 4RVMA 3QD4A 3PPZA 4DEIA 2R64A 4M8TA 3BQRA 3E8CA 3LXNA 4CFUA 1CKJA 4C3FA 3HMOA 4KBKA 4IVAA 3TKUA 4JRVA 3CTHA 3AC4A 4FSYA 2ZVAA 5FXQA 1FVTA 4FT0A 3JPVA 3KEXA 5E8YA 4D28A 2HXLA 3NGAA 4KIPA 3NMUF 5EM7A 4RWIA 3RPSA 5EOBA 2R0UA 5A4TA 5CSPA 3QCQA 3UVQA 4XUFA 4II5A 4FTIA 3TV4A 2YM6A 4FV4A 1QPCA 3LKMA 3MDYA 4QP4A 3FI8A 5C27A 3BE2A 4P5ZA 3VBVA 3EQRA 4JVGA 4LOPA 4EQCA 3D5XA 3EQCA 2Z7RA 4IX6A 2FSLX 3I79A 4AT4A 3P7CA 5C9CA 5HTCA 3QZHA 5FEEA 4FICA 3NEWA 3WYYA 4GMYA 2XKDA 1WBSA 3PY0A 3R21A 3VW8A 3TNQB 2YIYA 4ANSA 3FE3A 4QP2A 4FKVA 1VJYA 3F2RA 2OZAB 3VBYA 4APPA 5LMBA 3RK5A 1W98A 4D2PA 4V0GB 3TIYA 4GIHA 2BHHA 3UQGA 2CNVA 1Q8TA 2PE2A 4L3PA 4QQJA 2Q83A 3H0ZA 5HE0A 3TZMA 4MHAA 3FC1X 3WARA 3W16A 5T68A 3A7GA 5A14A 3TM0A 5DN3A 2DQ7X 3IO7A 3PZHA 4R78A 1M2PA 2YCQA 3FAAA 3EN4A 3OP5A 1OUYA 1ZYLA 3IDPA 4M14A 4OTHA 2W1FA 3Q52A 3KVXA 1RE8A 1YXVA 2O3PA 3DY7A 4FV2A 4J95A 2QOQA 4PV0A 2WQBA 5BVFA 2GSFA 3PSDA 5HO8A 5BMMA 4ASZA 1R1WA 4GK4A 4G17A 4O1OA 1OL2A 3PSBA 3ZLSA 4BHNA 3BGZA 2FO0A 1JKTA 3F2NA 1HCLA 3IS5A 5HKMA 4CNHA 2ZMCA 3QL8A 3QTWA 3KRXA 3ZFXA 4C8BA 5K0KA 4G5JA 3AT4A 1F3MC 4FSUA 3R63A 1JSUA 2Z7QA 3NSZA 4R8QA 5DFPA 1RDQE 4EQMA 3U9CA 1SVEA 3B2WA 4LV5A 3K5UA 4AOIA 1UKHA 2G01A 2C0OA 2SRCA 2ZV9A 3CJGA 1E1VA 2ZDUA 2YWPA 2DYLA 4KNBA 2P55A 2CPKE 3LJ1A 1H08A 2Y4IB 4R1VA 4E6CA 5F20A 3GXLA 3D94A 5DVRA 3KXHA 5D1JA 1CKPA 2LGCA 2PZ5A 3CR0A 4I5PA 1WVXA 4JI9A 4DGMA 2XJ0A 3GCQA 3GU6A 3AD4A 3DK7A 2AC5A 3ET7A 5FEDA 2PUIA 4R77A 2OSCA 4EOOA 2HAKA 3E8EA 4ARKA 2GQSA 2XKFA 4K2RA 3VBWA 5EQPA 4FTLA 3EJ1A 1UVRA 3HGKA 3G6GA 1Q62A 3SD0A 2HW6A 3KY2A 3VS5A 5FUTA 2B7AA 4ENYA 4O83A 2C69A 2PSQA 1PXOA 2BDFA 4JBOA 5FM2A 5HO6A 3ZM4A 3L1SA 3DZQA 3HKOA 3NW7A 1XH6A 4FYOA 4F1MA 4EOQA 1B6CB 4FZ7A 4M67A 3VBTA 3LZBA 4FGBA 3R9DA 3ZHPC 4JQ7A 1WBPA 5IH4A 4MQ1A 2OKRA 5M53A 2C0TA 3BCEA 4X2GA 5KMJA 3UOKA 1JSVA 3G0EA 3BU6A 3MS9A 1IR3A 4ZMFA 4NJ3A 4H58A 1KE7A 2WAJA 2XYUA 4O0UA 4QO9A 2R3FA 3GEQA 4CFNA 1QL6A 3TNWA 2XP2A 4O0TA 5EM6A 3BWFA 3VJOA 5JRQA 3GC0A 3VULA 1OB3A 3HRBA 1LEZA 3MYGA 3A7JA 5FLFA 4DEHA 4FG8A 4PL4A 4FV8A 5HG7A 2ZB0A 4CEGA 3DNDA 5CZIA 2OU7A 1YHWA 4QMYA 5GNKA 4DT9A 4WD5A 5LVOA 3KRJA 3NUUA 2ITUA 4EBVA 3BYOA 4KUJA 4E3CA 3IK3A 2V55A 5HD4A 1SNXA 5JFXA 4B0GA 3VUIA 5K9IA 4BI0A 1UKIA 4A4OA 3ERKA 2C6IA 5KMKA 3U6IA 4QMLA 4CRSA 1G5SA 2QQ7A 3QQUA 4O22A 2YLEA 4EZ7A 2O63A 2PWLA 4XP2A 3ZEWA 3ZUUA 5M4CA 1VYZA 5AP6A 3JYAA 1CM8A 2VWZA 4IWPA 2PYWA 1PMNA 2QONA 3D83A 3SQQA 3I7BA 3Q2MA 3OWPA 4YJTA 3MIAA 5TT7A 2X9FA 3F3ZA 3GOKA 2OBJA 3MA6A 4O21A 5I9UA 4E4NA 2GNGA 3D14A 3P4KA 5EDQA 3UE4A 4ALWA 4YR8A 5GZAA 3SW7A 3S00A 3ZOSA 3KXMA 1ZYCA 3FI3A 5F4NA 4J1RA 2X8IA 5EOLA 3ZXTA 4DA5A 3V8SA 4FOBA 5CX9A 4Y83A 2F7EE 2IWIA 5CXHA 3BZ3A 1U4DA 2BKZA 2CN8A 4F70A 3IQ7A 5JRSA 4C4EA 3FZ1A 2BRHA 2H8HA 2HZ0A 2UW5A 3QA0A 4FNYA 4TY1A 4EK4A 1MRYA 4O7VA 2I1MA 4B99A 2ITQA 2PVYA 4JRNA 1KE8A 1W82A 3P08A 3LIJA 3OF0A 3VQUA 4EHZA 1IAJA 3OTUA 5IA2A 3U8WA 4XNEA 3VUMA 5A3XA 3M2WA 2R9SA 1M7NA 2VO7A 2BAJA 3VS4A 2QOCA 1GAGA 3QX2A 1PXKA 2W1EA 3OY3A 1JQHA 3OXTA 4G31A 5J1WA 3FZTA 5HVKA 2C6TA 4N0SA 5C01A 4E8AA 2YM4A 3D5WA 2X6EA 2XNMA 1W7HA 4QTDA 3RP9A 4A7CA 5FRIA 2YN8A 2Y8OA 3W2PA 1JAMA 4ZZOA 2IW9A 5BNJA 5J79A 3LQ8A 4FTMA 4X0MA 2V7AA 5AR2A 2QOIA 1ZZ2A 1ZMVA 2RF9A 2QVSE 2R0IA 3A7IA 4GUBA 1OKZA 2JD5A 5DOSA 4IBMA 3V04A 2REIA 4J99A 3LFFA 4U0IA 2XNGA 2GHGA 3G51A 2EVAA 3R8LA 2OG8A 1J3HA 1QCFA 4EYMA 1M14A 1AGWA 3FXZA 2Z2WA 4RIWB 3KRRA 1CSNA 2UVZA 2C1AA 5AM6A 2PMOX 3TDVA 3OCTA 4OUCA 1ND4A 1NVQA 4I20A 2EU9A 1WBWA 2R3RA 2X6DA 4MD7E 4DFLA 2R3IA 2JEDA 4O7NA 4BZOA 1T46A 3KL8A 3EB0A 2RL5A 1KE6A 2QD9A 1WVWA 3B8RA 2PPQA 4H36A 2VWVA 5H8GA 2VZ6A 4OTGA 3R8UA 1ZYDA 4KIOA 5AADA 1Q8ZA 4MK0A 1MRVA 4FKRA 2XM9A 4HOKA 3COHA 2J6MA 1GZKA 2W0JA 5CASA 4V05A 1G8AA 3D7TA 4FIEA 2BRMA 3TI1A 3S0OA 4FX3A 3I0OA 4YU2A 1U59A 4X2JA 1PW2A 4WOVA 4QTBA 5J5TA 1A48A 1G8SA 1XQZA 3BWJA 1GZOA 1Z9XA 3RPYA 4A4LA 4C57A 1SYKA 2JBOA 1OL7A 2E9PA 5FDXA 4BCOA 4O81A 1PY5A 3PLSA 4BR3A 3CQUA 3EQBA 5IUIA 2GS7A 4XG4A 2EWAA 3LFNA 4WRGA 2R3PA 4DBNA 4ONAA 3LMHA 2WMTA 5M57A 4ZLOA 4FVRA 3IOKA 2WMAA 5EI6A 2VX1A 3D0EA 4EOLA 3QRJA 3W2SA 4ZLZA 3FMKA 4I93A 3DBQA 3ZONA 2WU6A 3PXRA 4IE9A 2O8YA 4GFOA 4GT4A 2ITTA 1B39A 2ITXA 3HP5A 4L52A 4MWIA 4ZTRA 4BTMA 4D58A 2VD5A 1WZYA 2J5FA 5AWMA 5C1QB 2ERZE 4XP0A 4CCBA 3BKBA 3MTLA 5BUEA 1BI8A 2R3HA 4XEYA 2R3JA 3PY1A 4FV0A 4EH9A 4QQTA 2XA4A 4MF1A 2XRWA 4FSWA 4RX5A 4AT5A 4L8MA 5KCVA 3E7OA 3IG7A 4UXQA 4ZK5A 4F7NA 3LQ3A 1O6LA 3MBLA 4C36A 2R3MA 3QCSA 2WFYA 4PTGA 2XMYA 5DBXA 4DG3E 3E5AA 4WG4A 2UZNA 4GJ2A 4ANLA 4FMQA 5DG5A 4FK6A 4RJ3A 3QQFA 1RQQA 2YERA 3DAJA 2IW6A 2VTMA 2OICA 1ZXEA 4FIGA 4MWHA 3MA3A 4CFXA 3LQ5A 3RNYA 3NNWA 3PPJA 4BI1A 2YZAA 1YI6A 4U3YA 2PU8A 4YTFA 1XH4A 1OPJA 5EQEA 4O0XA 4DG0E 2VTOA 4HVHA 1BI7A 4TN6A 4ITJA 1OBGA 3KQ7A 3ODZX 5FP6A 4ZXTA 3KF4A 1T45A 4IFCA 2QU6A 3LM5A 4UMPA 3UODA 1JVPP 4MBIA 2Q0BA 1PXIA 3EFKA 3DAKA 5EDRA 3SC1A 5IUGA 4QP7A 2GNJA 3IW5A 5K5XA 2XIZA 1IEPA 3F5PA 3K5VA 4PPCA 4XV3A 5C8MA 4A9YA 4KS7A 5L6PA 4QMOA 3UYSA 4AT3A 1SMHA 5CT0A 3P7BA 5IQHA 3KK9A 4ACGA 2WIPA 4IJPA 1OKYA 1PYXA 3WI6A 2WEVA 2C4GA 2WMXA 5KMIA 3QUPA 4HCUA 4LYNA 2BZKB 4LRKA 4C58A 4D5KA 2ZMDA 1KUTA 5I3RA 1JKLA 3FL5A 3O8TA 4MNEB 3DTWA 4OLIA 4CKRA 5IA5A 4MX9A 4GG5A 3BYSA 2RKUA 1SM2A 1UU7A 2RFEA 4F63A 3I1AA 4YO6A 1BLXA 4GW8A 3G6HA 4C38A 3BEGA 3FZPA 3SOCA 3AT2A 4EKLA 4QTAA 5EDPA 2Y7JA 2YLFA 3GC9A 4ERKA 2WMVA 4FV9A 4D2TA 5JFVA 3C4FA 3TUBA 3HA6A 4MXAA 4E6QA 1OM1A 3GBZA 3UJGA 4F7LA 3MJ2A 4AU8A 3OXZA 2CGXA 5ACKA 2IW8A 3SXRA 3VBXA 5KO1A 4NYEA 4N57A 3PVBA 3UP2A 5KZ0A 2X39A 3E8DA 4YJOA 5CI7A 5BUIA 2G9XA 2BMCA 5I9XA 2ZYBA 1S9IA 4DG2E 3GGFA 4PDYA 2VTRA 4XG7A 3ZZWA 3EL7A 3FLWA 1OKVA 1YXSA 2UW7A 5AR7A 4CT2A 2ZAZA 3EZVA 3MH0A 2PVNA 4C7TA 4HVGA 3VJNA 4LGDA 5IQDA 2VWBA 4IEBA 3U4UA 2XBAA 2JC6A 4IVCA 4LM5A 3ZO2A 1OI9A 3K2LA 4ACCA 3BRBA 2WQNA 5T6KA 4YNEA 3TZ8A 4RG0A 4RLLA 3ACJA 3ZSGA 4CMTA 2BZHB 5JMSA 4I23A 3VC4A 3G0FA 2PE0A 1YDTE 2BZIB 2QC6A 3LFCA 4FG9A 4W4YA 1U46A 4FTJA 2UV2A 3TEIA 4DITA 2UZWE 3KXGA 1W84A 4NFMA 4CRLA 5E8SA 2WTKC 1H07A 3F5GA 3LFAA 4NEUA 5KX8A 4FKUA 4FSZA 3KRWA 2GU8A 3LMIA 4JBVA 4QYEA 4RVKA 4H3QA 4EZ5A 4C35A 4WT6A 1MRUA 2WMUA 2PMNX 2QOHA 2X8EA 4IAKA 5AR4A 3I0QA 5CEQA 3CY2A 4W8DA 2HOGA 2PVLA 4A07A 2GMXA 1NY3A 4YP8A 4QMUA 1PXJA 4FSRA 4YLKA 3HLLA 4IVDA 5HU9A 4QPSA 5CT7A 4USFA 5CEIA 3U6JA 2VO0A 5B2MA 3DLZA 4YJPA 5AR8A 4FEWA 2X8DA 3IW7A 3NNUA 2QLQA 4JR7A 4I94A 2X2MA 4JQEA 2GQRA 5IQFA 4O91A 2O5KA 3FWQA 2F9GA 3RPRA 2XIRA 5C8KA 4IB5A 1JPAA 3EYGA 3QRTA 4L3JA 2UZLA 5EHLA 4RWLA 1J1CA 3I60A 1LUFA 3R04A 4MBJA 4EJ7A 4F4PA 4D4YA 5J9LA 3FXXA 5AAGA 1TVOA 1ZY4A 3PE1A 4J8MA 3QXOA 5AAEA 3SDJA 1H28A 3UC3A 3ZUVA 4AZSA 3EHAA 4RC3A 4FTCA 3AC2A 3BV2A 3OT3A 5GJGA 4B6LA 1LPUA 4JDIA 5DEYA 5CAQA 5HEZA 3K3IA 5E4HA 5D9HA 3HAVA 1PXNA 1PXLA 2O64A 3O0GA 4U6RA 2PVFA 3FL4A 3PJ3A 3R71A 5LWMA 4FTKA 4JOAA 3UQFA 3BEAA 4NH1A 4CG9A 4GJ3A 2YEXA 1KV1A 3SG8A 4L44A 4RIYA 1YVJA 4XJ0A 3ZUTA 4PMSA 4YSJA 3UNKA 5ANOA 3CY3A 3PJ1A 3PVWA 3OEZA 2VTQA 3AQVA 2C6EA 3OEFX 4ANMA 2YCFA 5D10A 5CU0A 3LCTA 5DT3A 4QYYA 3EFLA 2B4SB 4TYHA 2HCKA 4E4MA 2VX3A 3HUBA 4ASXA 4YMJA 4K1BA 4BHZA 4MKCA 3D2KA 3N51A 4QPAA 3C51A 3ZCLA 4CZTA 2W99B 2WMWA 4YURA 4WG3A 4PL3A 2WTCA 3EOCA 4H3BA 3ACKA 5AR3A 4AGWA 3BV3A 4J98A 3PRIA 4JNWA 4GFMA 4YBJA 3DS6A 2WELA 3DXPA 4BDJA 3KN5A 4YJNA 4C4JA 1DAWA 3L9NA 2BPMA 4L7FA 4UN0C 2VX0A 4NM0A 3NYVA 5KBRA 1ZLTA 3E64A 4AXAA 1GZNA 2ITOA 5BQ0A 1UWHA 4UEUA 1OIRA 2ERKA 3GENA 4X21A 4UYAA 5D7AA 4UV0A 5A6OA 5KZIA 3HDMA 2OXXA 3FQSA 4DFNA 2F2UA 2XK3A 4LMUA 4PX6A 5CI6A 2C5NA 4U45A 2OI4X 1Q3WA 1X8BA 2JBPA 3RVGA 3P7AA 4U97A 1B38A 5DIAA 2XK9A 2F49A 3PZEA 4C34A 3EZRA 4UMUA 4FGRA 2EXCX 4Q5EA 2OO8X 1U5QA 4ZIMA 4B4LA 3FHIA 2ACXA 2YCRA 4EBWA 5IF1A 1H1PA 3VRZA 2OK1A 3O71A 3QQJA 3BLHA 3EMGA 2BFXA 1YHSA 3OT8A 4O0VA 3KA0A 4U81A 4BDHA 4FTTA 4OTPA 3B8QA 5I9YA 4RJ5A 2XIXA 4FTAA 4FZDB 4WBOA 3JXWA 3NIZA 5J7HA 5JSMA 2XCKA 4RX7A 3U9NA 4AGCA 3QC9A 4XG2A 2BIYA 2VTJA 2GCDA 3FYKX 4JJRA 3SV0A 4O2ZA 2E9OA 5B2KA 3V5QA 5A4QA 1P2AA 4MXYA 4G34A 4PNIA 4OT5A 5TR6A 3FLNC 2Z8CA 3TWJA 3RINA 3HDNA 3FI2A 3DFCB 4HVIA 2PULA 3E93A 2A19B 2CKOA 2RFDA 3UTOA 1ZY5A 3DKFA 3FSKA 2Y6OA 4M12A 4AFEA 2W1DA 2PUPA 3ORNA 3QX4A 2J9MA 1K3AA 2XUUA 3F3UA 3FDNA 4K9YA 4F09A 2YM8A 4G6LA 2CGVA 5DR9A 2YDKA 3DPKA 4Y85A 4NW6A 4Q2AA 4EUTA 4RA4A 2PUUA 2EB3A 3NUPA 4K77A 4UWBA 4DN5A 4R7BA 3UYTA 4FOCA 4GT3A 4JG6A 4NKAA 4NK9A 4C3RA 4UBAA 4CLJA 2FA2A 5HG8A 3LLTA 3NR9A 5ACBC 2CDZA 4BYJA 3EWHA 2OW3A 3SRVB 5CSVA 5C4LA 3FMLA 1YOMA 1UNHA 4IWQA 4WSYA 4C0TA 3HL7A 3PA4A 2E9UA 4BCQA 5AEPA 4UX9A 2FYSA 2OIBA 2XB7A 4JBPA 4BGGA 3WOWA 2P33A 2VNYA 3WZUA 4PDPA 1SVGA 4RLKA 5FDPA 1YXXA 2I40A 2QOLA 2BIKB 2Y4IC 3KFAA 2J0MB 1XR1A 2X4FA 2B54A 3OW3A 4WA9A 4HYHA 3ZU7A 3E7VA 4IDTA 3R8MA 4DF3A 2QO2A 3QLFA 3O8PA 3QD3A 2C0IA 2VTHA 3QWJA 2QODA 4LGHA 4OAUC 4YZNA 2UZUE 5CNOA 3ROCA 2HYYA 5D11A 4KSPA 2EB2A 4FT5A 4L45A 2PVKA 3HMMA 5HD7A 1ZOEA 3U4WA 3MWUA 4WIHA 4XYFA 3W2OA 3DKCA 5IQBA 3ORLA 2A1AB 3EQPA 4BGQA 2ESMA 2CN5A 4CMUA 4J52A 4FUYA 4KIKA 4M7IA 3MJ1A 3KCKA 4ZJJA 3MN3A 2ZOQA 3UOJA 4KWPA 1H1RA 2V22A 4IZYA 4I6FA 2UZEA 4D9UA 3P9JA 5E91A 3CC6A 4ZY5A 3U6HA 2GNHA 4BDGA 4ACHA 3VUGA 5HG5A 2BCJA 5BVNA 1P4OA 4X3JA 5L2WA 2ITNA 3E8NA 3QWKA 2XVDA 4IWDA 5HIBA 4ENXA 2NNWB 4ACDA 2JDRA 4MD9E 5KE0A 3QTQA 2IPXA 2CMWA 2HENA 1ZWSA 3EN9A 1ERKA 2XKEA 1J1BA 2HXQA 3E3BX 4KKGA 3KRLA 1M2RA 3QQHA 4DGOA 4PWNA 4IZ5A 2BFYA 2WTVA 3C0HA 1KWPA 5L8KA 3R7VA 3QALE 4DH3A 4F65A 3NNVA 4C4IA 4FNWA 5CEKA 4FZAB 4O38A 5M4FA 2WOUA 4FODA 3DLSA 3NCGA 2ONLC 4O27B 3C5IA 4I1ZA 3UIBA 5IQIA 4DH7A 5IDNA 4JQ8A 5DRDA 2C5XA 1H8FA 4JIAA 4Y5HA 5FG8A 4GSBA 2BZJA 1BYGA 3FMJA 5AIKA 3IW6A 4DINA 3OBJA 1Q61A 3BQCA 4HZSA 4K6ZA 5CU6A 3ZRMA 4F1OA 4F9BA 4OBOA 4O1PA 1TQPA 2HY81 3QQGA 4QMVA 1OPLA 4AA4A 3VUTA 3CLYA 2A4LA 4XRLA 5DEWA 5EI8A 3R7YA 3VVHA 4Y73A 2VTAA 4RBLA 4EH3A 4RX9A 2UZOA 4ZAUA 2PUNA 2BDJA 4E5BA 1XH5A 4YHFA 4TTHB 4E7WA 3PJ2A 3ENHA 3HEGA 5IU2A 4IIRA 3JVRA 1QPJA 2PY3A 5A4EA 3SXSA 5IEXA 4M0ZA 3A99A 5T3QA 4H1JA 1TQMA 4A06A 4BWKA 2YACA 5IMEA 5EW8A 4D4RA 4PQNA 5M07A 3CS9A 4EORA 1OBDA 2J50A 3R22A 3ATTA 2EXMA 3HV5A 3LE6A 1Q99A 3OWLA 4S32A 3TJCA 4GH2A 4RFMA 4BCNA 5EI2A 3QC4A 4BBFA 2VTLA 3C13A 3GCPA 2J0IA 4W9XA 3C5UA 4OTFA 4ZMEA 4DAWA 2O0UA 5JQ5A 3OY1A 4LMNA 4O7ZA 2DS1A 2BKKA 1WBOA 4W4WA 4XV1A 4A4XA 4TYJA 2FUMA 2E9VA 4NWMA 2B9FA 3QHRA 5CEMA 4MAOA 5BVEA 4BKZA 5L2TA 4G3DA 4BRXA 3U54A 4RWKA 3UGCA 4D2WA 4U44A 3Q9ZA 4DFBA 5ETFA 5EM8A 4NFNA 5LOHA 4TPTA 5K3YA 4PUZA 2W4KA 3VS0A 4F7JA 5IH5A 1OMWA 3DBFA 1FVRA 1J91A 3ORKA 3TZ9A 1FOTA 2CKQA 3R1SA 3ZZEA 1J7UA 2OF4A 3R9OA 5TE0A 4EUUA 3UQCA 2I7QA 3RCDA 2VTIA 4EOKA 4X6RA 4ZTNA 4F9WA 1FGKA 4A9TA 4QQCA 5FXRA 4S2ZA 1Q97A 2JFLA 2I0HA 4I6BA 3P79A 4DEDA 4IAFA 4KBCA 3C4ZA 1ZAOA 4LFIA 2GNLA 2QKRA 2VV9A 3DTCA 3L8XA 3MVJA 4KS8A 4OTQA 1R78A 1H1QA 4ZSEA 5M44A 5E8TA 2C5YA 3FLZA 3Q4ZA 4C4FA 2X7OA 3RHXA 5AV2A 3DDQA 4AS0A 4WNMA 3KF7A 2QURA 2YM3A 3A4PA 4Z7HA 3QZIA 4FR4A 3TDWA 3FQHA 5F1ZA 3QUEA 3ZH8A 4KBAA 3O50A 3VNTA 4G1WA 3BIZA 3QCXA 2IZUA 4DEAA 4J7BA 2F4JA 3AC5A 1GIIA 3DGKA 4R1YA 4Y5QA 4WNPA 4JAIA 5DT0A 4DHFA 4GFGA 5AUTA 5E8XA 4IFGA 1TQIA 4UXLA 4PP9A 2CCIA 4CXAA 1M7QA 4BZDA 5CAPA 3ID6C 3T3UA 5KMOA 1ZMWA 4M69B 3AC1A 5C4KA 4G3CA 4BF2A 3C0IA 3KULB 3C7QA 5HG9A 4WBBB 2ETKA 3PP0A 5M09A 2CGUA 5J9YA 4IHPA 3WE4A 2UVXA 4ASEA 2CHLA 1Y6AA 1KOAA 4KKEA 2W5HA 3TACA 2OH4A 1U54A 3U87A 5BYYA 3EKNA 3CP9A 5CQUA 3MB7A 3UNJA 1F5QA 4FUXA 4S33A 4N6YA 4Q5HA 4BKYA 4F6UA 2GTNA 4YC8A 5HLPA 3JY9A 2QO9A 1LEWA 1XJDA 4R7HA 5L8JA 4GG7A 4TXCA 4ZTHA 5KKRB 4ZEGA 3VWAA 4AAAA 2ITZA 2NO3A 4R5YA 1NVRA 4R5SA 2GQGA 3TNHA 3LMGA 5AR5A 4ZSLA 1OL6A 5LWNA 4HJOA 2C6LA 2IZSA 2YISA 3ZEPA 3I4BA 1YI3A 3PJCA 4F7SA 1W8CA 4BCJA 1BMKA 3I5NA 5CTPA 1I44A 1YWVA 4RSSA 5LQFA 4B8MA 2CNQA 2QOBA 5LVNA 2A2AA 5M55A 4FSMA 2WGJA 3NIEA 1CKIA 3ZDUA 4K18A 4D55A 3TJDA 2IVVA 3JUHA 2V0DA 3OZ6A 5J7BA 5HTBA 4YZ9A 2WTWA 3GT8A 4NUSA 3F66A 5HU3A 3FZOA 3WF7A 1KE5A 3GCSA 4C62A 4IAYA 2G15A 4F6SA 4QMQA 4O7WA 4EHEA 5IA0A 2OH0E 4FK3A 2J4ZA 3KREA 2OIDA 3FMNA 3DBCA 5ANEA 5FEQA 4JDJA 5HQ0A 1ZMUA 5BVDA 1TKIA 3OBGA 3ENMA 2QU5A 3ZFYA 2JDVA 4DC2A 4I41A 2WMRA 1OZ1A 5HHWA 3NDMA 2R2PA 2C6KA 1W83A 3UZPA 5K5NA 3ZBFA 4DFYA 5JFWA 4I92A 4M13A 3W1FA 4PPAA 5AFVA 2WMBA 2C3KA 3CCNA 2C30A 1DS5A 3HV7A 4BIBA 3BGPA 5M56A 2QOOA 4FV3A 1OIUA 2PZIA 3F5UA 3Q9XA 4IC7A 4NM5A 4RRVA 2OFVA 3SW4A 3VO3A 3QZFA 3JR1A 2ZB1A 1A9UA 3ALOA 2OZAA 3RPVA 4C37A 3LFDA 4V0GA 4OBQA 4O7RA 5E7RA 4L9IA 3IGGA 4I22A 4IM2A 3ANQA 5JK3A 4KRCA 2I0YA 4QRCA 5D12A 2VNWA 1YDRE 3QRKA 5EYDA 4E20A 3LXPA 2V7OA 4L43A 4YZBA 5CENA 2YAAA 5AP3A 3GC7A 5JGBA 2YIQA 3C4XA 3NYOA 3UOHA 4QMTA 3PIXA 3CD3A 4ANNA 1YHVA 3QU0A 4KD1A 4O7LA 3GCVA 4RJ7A 4YC6A 3POOA 1R39A 4AZFA 1P14A 2NPQA 4UY9A 1IA9A 3Q2JA 3DQWA 3LOKA 3OXIA 4BTKA 2VTPA 2XIYA 1DM2A 3FHRA 2G2FA 3MH1A 3FMEA 4IMYA 4IM0A 3PA3A 3SX9A 2P2IA 3UOLA 4DGLC 5M06A 3CQEA 4G6NA 5GHVA 5LCKA 4E93A 4E5AX 1JKSA 4B9DA 1BKXA 2JLDA 2YAKA 4M97A 4O0WA 1Z57A 4P2KA 1E9HA 4EOIA 2QG5A 1MQBA 4PNKA 1FQ1B 4NIFB 3UPZA 1O6YA 3VF9A 1UU3A 3R7IA 4KA3A 5H2UA 2Z02A 3HZTA 4DEBA 2PVMA 4DLIA 3R9HA 5I0BA 5AP0A 3UVPA 4EH2A 4ZS4A 2WEIA 3ZLWA 5HICA 2HK5A 2YFXA 4MEDA 4PL5A 3L9MA 4B7TA 4DH1A 3DKGA 5AJQA 3BLQA 2HWPA 5A9UA 3V6RA 1KE9A 2ZJWA 4EWQA 4I6QA 3DB6A 4WKQA 2XEZA 3VF8A 4HVDA 2QHMA 4XG9A 2C68A 4DT8A 4FEUA 3LVPA 1WBVA 1V1KA 3PFQA 1FPUA 3EYHA 2R3GA 4AA5A 1G3NA 3DXNA 2OF2A 5FM3A 2QI8A 2R3KA 3H9OA 2JDOA 5BVOA 4TYIA 3G90X 5KNJA 1R0EA 2Q0NA 3JVSA 3C0GA 1XH8A 3VUDA 2BALA 4M68A 3MFRA 2JIUA 3TG1A 5BYZA 4AN9A 3DDPA 3PTGA 3R30A 3UMWA 3ORTA 3E62A 3WZKA 4IJ9A 3AOXA 3EKKA 1UNLA 4FKSA 4GK2A 3UIMA 4CTBA 2OWBA 3EQGA 5KBQA 4LG4A 4DLJA 3TN8A 5IQGA 3SXFA 3H9RA 4RJ6A 5HIDA 2XKCA 4IX3A 3FEGA 3DK6A 3DJ6A 3V5LA 3EN7A 4GKIA 4HZRA 2JITA 3IPHA 4TW9A 4FTOA 4EJNA 2J90A 3AD6A 3M1SA 5LMKC 3O51A 4Z16A 3CKWA 2XK4A 4FKLA 2O2UA 3EN6A 5F95A 3SKCA 3PUPA 3KXXA 3GFWA 1Q8UA 4Z55A 4FA2A 5JZJA 2VN9A 4BI2A 5KHWA 4D9TA 4MTAA 4BVUA 2FVDA 1O6KA 5CAUA 4C2VA 3FV8A 4PMMA 3WILA 5CVHA 3C50A 4JL9A 4FL2A 2W1ZA 5DR2A 1FVVA 3MI9A 4I0TA 3W32A 2DWBA 2ONLA 4BIDA 5AV4A 2QLUA 4NT4A 2RGPA 1OUKA 4LQMA 2BRGA 3R9RA 4EK6A 4HYSA 3PPKA 3E87A 4NSTA 2UW9A 2ZDTA 3BHYA 3CEKA 2W4OA 4L67A 4RWJA 4XG3A 5JT2A 4CG8A 4HPTE 4PMPA 3KVWA 5FTGA 4D2VA 4U80A 2VRXA 3ALNA 3CBLA 3THBA 4RGJA 1WBNA 2H34A 3RK9A 5DHJA 5JH6A 4XG6A 2ZM1A 1XBAA 2I6LA 4PTEA 3R28A 1H1WA 1SZMA 3QA8A 1BL6A 4W9WA 5HE3A 3ZC5A 2WB8A 4FT3A 2X0GA 5AMNA 4PMTA 4X2FA 3E92A 3OUKA 4QNAA 3RGFA 5AUUA 2HZ4A 4IX4A 5A4CA 4J97A 2VUWA 4ZY6A 2YHVA 3UMXA 4AQCA 3BELA 4RIXB 3RCJA 3DCVA 4CQGA 5KMLA 3R0TA 3F88A 4BDIA 2JDTA 4G5PA 3V51A 4X3FB 4OTIA 4D5HA 4EL9A 1WMKA 4EC8A 5FXSA 3TNIA 2VWXA 3O96A 2B1PA 5B0XA 2W1CA 3FPQA 4PTCA 4A9SA 4R7IA 3RAIA 4BIEA 3RAHA 5E8VA 2BAKA 3TKHA 3PG1A 4ZSJA 3W8LA 3T8OA 4V04A 1PRYA 2QO7A 4CCUA 4I24A 4G9CA 4E73A 3WE8A 3ZLYA 4MCVA 2NP8A 1ZARA 5GZ8A 3GB2A 3KMMA 2R7IA 3FKNA 3FMMA 3LPBA 3CQWA 2JKQA 3K54A 3Q9YA 4AZWA 3TV6A 1P4FA 4RQVA 2JIIA 2E2BA 2WXVA 1OKWA 2I0EA 5DMZA 4F64A 5HTIA 2YZLA 2JAMA 4FIIA 4XV9A 4KINA 5JGDA 5EG3A 4IAAA 4LL0A 4DH5A 1LR4A 4RIWA 4BCHA 4ZJIA 1OL5A 4PDSA 4GIIA 2OJJA 3HRCA 1IRKA 5HE1A 5EW9A 2WKMA 1L3RE 5CVGA 5FBOA 2R3LA 3DK3A 3HRFA 4YLJA 3T9TA 4XRJA 4EQUA 1W0XC 1FBNA 3V5JA 2UZTA 3UO6A 4DYMA 3OOMA 4QP9A 4RMZA 1UU8A 4IB3A 4EK3A 4UZDA 3UG2A 4GK3A 2G2IA 3F6XA 2HW7A 3OWJA 3RZBA 5HIEA 2XK6A 3QRIA 3HECA 3TTIA 1M52A 2X9EA 3CD8A 3IECA 4P90A 1O9UA 3FUPA 4TNDA 3RWPA 5CU4A 3N4VA 4O0RA 2JDSA 4QMWA 4DH8A 3IDCA 3FPMA 3ZRLA 2CNUA 3LFEA 2KULA 4GVAA 1Y57A 1PKGA 1VR2A 3ZS5A 3A2CA 3HX4A 4C59A 4UMTA 3C4WA 3I6WA 4GV1A 4N4SA 2J2IB 2IVUA 3HMNA 4ITHA 4QYHA 4RX8A 4YJQA 4UB7A 3G5DA 5AP1A 3RMFA 3I7CA 4PPBA 4WHZA 4WG5A 5FTOA 3R8VA 3W8QA 4EHVA 4LI5A 3ZSHA 2OLCA 3CTQA 2BTRA 5ETAA 1CDKA 4LV8A 4AF3A 5A4LA 5J9ZA 3POZA 2XBJA 1WAKA 3QCYA 3D5UA 4FTRA 2IZTA 4OTRA 4WNKA 4D1SA 2CKEA 4FKTA 4RZVA 3SA0A 3CSVA 3KB7A 2UW8A 4CFMA 4F08A 5TF9A 4YTIA 1YI4A 4DGNA 2XJ1A 1GIJA 3PA5A 5IMXA 4J96A 3S95A 3HAMA 4YPDA 5C8NA 3QF9A 3QTUA 4K33A 3FMHA 3BLRA 4MXOA 4NCTC 2W9FB 2YDJA 1MUOA 4NU1A 2Y6MA 1WBTA 2VWYA 4BICA 5CWZA 2BROA 2UZBA 4CVAA 3S1HA 3HV3A 2KTYA 4AP7A 5AP7A 4WNOA 4RPVA 4NM7A 3U51A 5L8LA 3C4EA 3DJ5A 3AGLA 4P4CA 3DFAA 4O82A 3KXZA 4BDAA 3OROA 1NVSA 4GVJA 3EFWA 3A8WA 3D9VA 4X7QA 3R2BA 3IW8A 4DTKA 3F61A 3VRYA 5AA9A 2OJGA 3O17A 4O84A 3RWQA 4YJSA 3LAUA 3OG7A 5M08A 4AN3A 2VWWA 3VN9A 2R3QA 4BCPA 4PY1A 3CGFA 2PZRA 1H27A 2P0CA 2W05A 4QP8A 4ANQA 2XK8A 4CT1A 2UW4A 4RJ8A 4E4LA 3ULIA 2W4JA 2BDWA 4JX7A 4S31A 5HORA 5IA4A 3VBQA 3T3VA 4EZ3A 5HGIA 3GCUA 1OECA 1OITA 1H24A 3RPOA 4LGGA 3MIYA 3P78A 3TXOA 3WF8A 2ITPA 4L00A 3V5WA 3V01A 4BCIA 4UYNA 1YOJA 4Y95A 2UUEA 3VUHA 1GJOA 3BE9A 4ZJVA 5K0XA 5KMNA 4WRSA 1ATPE 1XH7A 1QPDA 4IXPA 3MV5A 3UNZA 3WBLA 4XBRA 4QYFA 5CZHA 4RQKA 4RT7A 3VW6A 2VO3A 4YUQA 1PMEA 2GPHA 2O65A 1APME 2W96B 3EQFA 3Q5IA 4XS2A 2VWUA 3FYJX 3OUNB 4MNEA 4G9RA 2YIXA 4QMSA 4GU9A 4IX5A 4ANOA 2B55A 4TNBA 2HY0A 3LCSA 3PLAE 1FMKA 2J5EA 4GT5A 3MTFA 2WZJA 3EQDA 3GNIB 1ZRZA 2B53A 4C2WA 2HZIA 2PZPA 3AG9A 4HCVA 3BU5A 5HX8A 3OVVA 2X2LA 4EH7A 2C6DA 5H8EA 4W8EA 4DFXE 4BB4A 3GQIA 2ZV7A 3FLYA 3VHKA 4ALVA 4NJDA 3AT3A 1P5EA 2WMQA 4HGSA 4AW5A 2FH9A 4I5MA 4QPMA 5HX6A 5A46A 3DA6A 1E1XA 4U8ZA 4EYJA 5IQAA 3PIYA 4AZTA 4HVSA 5BMSA 4QOXA 3P23A 4QMNA 4RIOA 2XK7A 3NW6A 4FG7A 5EHYA 4ACMA 4RFZA 1DAYA 3NNXA 4O2PA 4BWXA 3V8TA 4OBPA 3RTPA 3CTJA 3FY0A 3A7FA 5D41A 2HZNA 3LCKA 4E1ZA 3DJ7A 3FBVA 4XH6A 4IM3A 2GHMA 2F2CB 4IQ6A 3AMBA 3PXFA 4YJUA 1KV2A 4CYJA 1OL1A 3R1YA 3BBWA 4IW0A 2IZRA 5L2IA 3A7HA 5B2LA 3R01A 5JZNA 4ZTSA 4MBLA 3LLAA 3MESA 3CPCA 3MPTA 1JBPE 3F3WA 4EOJA 2F57A 3MB6A 2C3LA 3PE2A 5CYIA 1H26A 1OVEA 5KUPA 3EFJA 4YZCA 3M42A 4YNOA 1DI9A 4JBQA 4O7SA 2IVTA 4O86A 4IAZA 3WF6A 1IA8A 1ZOHA 2Y9QA 5CU2A 3QUDA 1S9JA 4BDFA 1PXMA 5CAVA 5GIOE 3L8VA 5AUZA 5AV0A 4TWPA 3F9NA 2YDIA 3T9IA 4YGAA 2QG7A 2ITVA 3NW5A 3D2IA 4FL3A 5AUXA 2AC3A 5EH0A 3GU8A 3HV4A 5DPVA 3MFTA 3RAWA 4U5JA 3EN5A 3II5A 1STCE 4I3ZA 4F99A 4AW2A 5BX0A 2QR8A 3R7OA 3AC3A 5K4IA 3P1AA 3Q32A 1IAHA 4MF0A 3KGAA 4UALA 5AA8A 3C9WA 3DV3A 4FV6A 4XG8A 4V01A 3L8SA 4GKHA 3AMAA 2W1GA 4IZAA 1GIHA 1ZZLA 5J8IA 4ZSGA 1ZOGA 3MH2A 5LMKA 3NWWA 3VS2A 5FP5A 5AUWA 3WZDA 3DOGA 5CY3A 4FT9A 4D1XA 4OGRA 3LJ2A 4XLVA 3RM7A 3GOPA 3W55A 4BWPA 5KKRC 2VTTA 3LCOA 1REKA 5K4JA 3G15A 4FKOA 3ZSIA 3QD0A 4LOQA 3LFBA 5TO8A 2R3OA 4LL5A 4DFUA 4EH8A 2A0CX 2YIRA 2C47A 2FB8A 1CMKE 3MVLA 3DNEA 4ZZNA 3ZBXA 3ZYAA 1ZYSA 1Q4LA 3GQLA 3BHVA 4BBEA 4M15A 2PE1A 4XOZA 3E63A 1JSTA 2W5AA 4L42A 4EWHA 4D1ZA 2RIOA 3LXKA 5H3QA 3Q53A 3QKMA 5HVJA 3NVMB 4BDEA 3VS6A 4WO5A 4M3QA 4QMZA 1PXPA 3G9NA 2VWIA 4UMRA 3I6UA 2X2KA 3MH3A 2C5VA 2B0QA 1WVYA 3BYMA 1Y91A 3BPRA 2YABA 3R7EA 5L3AA 4CYIA 3PJ8A 4XX9A 3AGMA 4JR3A 4Y46A 5AIRA 5L4QA 1KSWA 4FSNA 1AQ1A 3FZRA 2Z7SA 1YRPA 3QBNA 4NL0A 1V0OA 4XLIA 4YTCA 4CZUA 5A54A 4JAJA 4GEOA 4IANA 3MSSA 3QLGA 3R6XA 4G3GA 4QTCA 4MH7A 3QGWA 2LAVA 4O96A 4BTFA 4AA0A 2C3IB 5HOAA 3W33A 2ZV8A 3H9FA 5CF6A 3UZRA 5HESA 5JN2A 5FQDC 4ITIA 5H9BA 4OTDA 5ICPA 2OGVA 2WTJA 5E8WA 3V3VA 2EXEA 5AX3A 4BFMA 3UIXA 3F7WA 4APCA 4RVLA 1Q8WA 2R7BA 3KMUA 4W4XA 2YM5A 4OR5A 5TKDA 2X81A 4X2NA 4CSVA 2PVRA 3D7TB 2W7XA 5I5ZA 3O8UA 3V5PA 3F82A 5IQEA 3A62A 5ANIA 2PL0A 4WUNA 3R00A 5HI2A 1M17A 3ORPA 5DE2A 3DZOA 2OIQA 3GFEA 3G9LX 2PK9A 4R3RA 3R7GA 3FXWA 5J95A 1JNKA 2V62A 3DB8A 3OS3A 4QMXA 3DBEA 4QP6A 4LOOA 1A06A 1K9AA 4EKKA 3QYZA 4R6VA 4IWOA 1BX6A 4AACA 3EL8A 3UPXA 3SLSA 2XF0A 4YPSA 4YBKA 5CSHA 5EHOA 3R8PA 5AP2A 2YM7A 2BVAA 3HV6A 2FGIA 1PF8A 5CEOA 2WOTA 4IDVA 5F9EA 3O7LB 3Q4CA 4UWCA 3UO4A 5I9VA 4AE9A 3ZXZA 3L8PA 3UBDA 4B8LA 3CXWA 5FGKA 5HVYA 3D4QA 3L9LA 3SRVA 2W17A 3F69A 1YW2A 3S3IA 2QNJA 2UW6A 2R4BA 2CGWA 4C4HA 2BRBA 1FMOE 3ODYX 5HCZA 1XKKA 2W1HA 1Q8YA 2WQEA 4FKJA 1REJA 4BDCA 1Y8GA 3SGCA 3Q6WA 3W10A 3UDBA 2GNFA 3FQEA 2UVYA 4L01A 3WYXA 5IDPA 3QAME 3QQKA 4XCUA 3FC2A 3R9NA 3MPMA 5M4UA 1XHAA 4CZYB 3A8XA 4JX3A 4GYIA 4AOJA 4D2SA 2IG7A 3SG9A 3BGQA 5E90A 4FKIA 4ZOGA 4EOMA 1H4LA 2WQMA 4FKWA 3U55A 3KKVA 3QXPA 4RFYA 4TWCA 2PZYA 3OW4A 4PRJA 2IVSA 2JGZA 4CD0A 3OWKA 3UC4A 4RC4A 2BR1A 3GC8A 4K8AA 5AM7A 5IEYA 5BVWA 3OC1A 2C5OA 2YJSA 3DKOA 3UG1A 3SOAA 2XNOA 3H3CA 5L6OA 5EQYA 5CF5A 3F2AA 4ERWA 3ELJA 4BYIA 3ROYA 2XRUA 3EH9A 3RAKA 4P5QA 5DA3A 3RJCA 3ZDIA 4F9CA 3WF5A 3ATSA 4FVPA 3NAYA 3N4TA 4Z9LA 2Y0AA 4NCTA 4USDA 4W4VA 2ITYA 4BN1A 2OZOA 4G6OA 3RZFA 3WIGA 2YA9A 4L7SA 1UA2A 2GNIA 3L9PA 3OTVA 4IB0A 3VQHA 3AXWA 2VTSA 2XZSA 2VGPA 3CPBA 5M51A 2CLQA 2UZVA 1YWRA 1OPKA 4F1TA 3ORXA 3VUKA 3TZ7A 2YWVA 3TT0A 4R3PA 4I4EA 2BAQA 5E8ZA 3HVCA 4QP1A 4XBUA 4FKGA 4HNIA 5FBNC 4NTSA 5I9WA 3R02A 4LUEA 5EW3A 4BBMA 4BDKA 3PXYA 4EONA 5L2QA 5CSXA 5LVPA 4U41A 5IPJA 4FIHA 4PF4A 4RZWA 5AV1A 4F9YA 1XWSA 3P0MA 4U79A 4G2FA 4D0WA 1QMZA 3Q04A 4ASDA 4CLIA 3R8ZA 2GFCA 2VU3A 4U9AA 4Z3VA 3OMVA 3QQLA 3A4OX 3QKLA 4RJ4A 3RHKA 3WZJA 1IASA 3VHEA 4E26A 2IO6A 5DYJA 4MXZA 3ZFMA 2C1BA 3WZEA 3DQXA 1NW1A 4YZDA 3HNGA 5HLWA 2PHKA 3H30A 3FLQA 5CU3A 4FE2A 2W06A 4QQ5A 4JG8A 1URCA 4HGLA 2WU7A 1Y6BA 4X6QC 2PMIA 2QKWB 4H39A 4XV2A 5DI1A 3QRUA 4D0XA 4ZZMA 3CIKA 4N6ZA 2X1NA 2AYPA 2GS6A 1GNGA 3OOGA 3QGYA 1NXKA 2R5TA 3K3JA 4GU6A 3RI1A 3C4CA 1SNUA 4YJVA 1Q41A 2RFNA 2FSOX 2GHLA 2Z7LA 3KC3A 5C03A 4F6WA 3NZ0A 5BPYA 4A9RA 3R83A 3I5ZA 5J1VA 2VO6A 5EYKA 3GI3A 4AW1A 5IUHA 3W2RA 4CKIA 3TCPA 2JFMA 5G1XA 4IAIA 3KXNA 3RBWA 2YIWA 4DTAA 5HZNA 2OXYA 3AD5A 4DEEA 2A27A 4FV1A 2J7TA 5GJDA 4CFFA 3UO5A 3LHJA 4TT7A 5G6VA 2P2HA 4AZVA 3EQHA 3HYHA 4X3FC 4KABA 4YLLA 4O6EA 3HA8A 2B9HA 3FKLA 4IB1A 4RVTA 3NCZA 4TL0A 4P7EA 1UU9A 3MFUA 4R3CA 4TKSA 4U42A 5JQ8A 3UP7A 3UIUA 1BL7A 2WTDA 2FSMX 3PWDA 3PY3A 4HCTA 4M66A 4TRLA 1I09A 3Q3BA 5EKNA 3V8WA 4AGDA 3LXLA 5L6WL 5EM5A 2IN6A 4I0RA 2AUHA 2G1TA 4CQEA 4DTBA 1JWHA 3WIKA 3KU2A 5ANKA 1VEBA 3ORZA 2GDOA 4FYNA 1F0QA 5LCJA 4J53A 4ZS0A 4AWIA 1NT2A 3R1QA 3ZC6A 4OTWA 3NYXA 5IISA 1Q24A 3A61A 3E3PA 3LJ0A 3PYYA 3IONA 4JG7A 4FF8A 1LP4A 3TIZA 2RG6A 3FZSA 3NAXA 1UWJA 5EK7A 3H10A 4O0SA 5BVKA 4D4SA 3MY0A 3EIDA 5DWRA 5LVLA 1FINA 4HW7A 3HUCA 5ETCA 4FSQA 3F3VA 3N9XA 5CF8A 3JY0A 1Z5MA 4E6DA 3COIA 4F9AA 5CXZA 5HBJA 2XNBA 4U43A 2H9VA 4FT7A 4QNYA 3C1XA 2VTNA 4RIYB 4YJRA 5HCYA 2CKPA 4AE6A 4BDDA 3SAYA 4FIFA 1BUHA 2ZM4A 4NKSA 5E8UA 3JS2A 3D5VA 4H05A 4TYHB 4FIJA 4L68A 4AG8A 4YSMA 3NX8A 5CF4A 5IQCA 5E1SA 3MW1A 3BHUA 3OD6X 4FI1A 3H4JA 1RW8A 4LRMA 1L8TA 3OCGA 1H25A 3HMIA 4M69A 1JLUE 2BRNA 4TWNA 4JXFA 4BY9E 3QTXA 5AP5A 1MP8A 3KULA 3NYNA 3PXKA 2JAVA 1RJBA 4FC0A 1SVHA 3NUSA 2I0VA 2WHBA 3MFSA 4HPUE 3NUNA 2BTSA 5KHXA 1Y8YA 3ULZA 3ZTXA 4QMMA 5DGZA 4CGAA 4XP3A 4TYGA 4FV5A 4GUEA 1V0PA 4I5CA 5JEBA 1URWA 2J0JA 4HYIA 3VS1A 3D7ZA 4C4GA 5IA3A 2PVHA 2QR7A 3IDBA 2B52A 2XYNA 3S2PA 3ZO3A 4UZHA 5EKOA 2C6OA 3F3TA 4GCJA 5HNBA 5EYCA 4C33A 3TTJA 3CGOA 3IKAA 5GZ9A 1OGUA 3ZMMA 3QYWA 4E6AA 3FY2A 5IZFA 2RSVA 1XH9A 2CLXA 3NRMA 4O6LA 5AAFA 1GY3A 4A9UA 1UNGA 2ETMA 4ZP5A 1U5RA 4C61A 1DI8A 3GUBA 5DLSA 3R73A 4USEA 2J51A 2XIKA 4NM3A 4FKQA 4FEXA 3O7LD 2UW0A 3E88A 4XMOA 3O23A 1EH4A 3NLBA 2DUVA 2X7FA 5GIPE 4EH6A 1H00A 3FSFA 4C02A 2R3NA 3TUDA 4NW5A 3QZGA 2B9IA 2OJFE 4D4VA 2W5BA 4ALUA 4Y8DA 2H6DA 3B2TA 3FMDA 5CSWA 4MYGA 3PVUA 4HYUA 5GJFA 4L6QA 5J5SA 2WIHA 4YC3A 5HO7A 4OAVB 3MGYA 3PXQA 3KCFA 5F94A 4UWYA 3Q4TA 2J0LA 4MXCA 4FSTA 4FNZA 2YJRA 2CJMA 5H8BA 4PDOA 3V6SA 1PYEA 5A6NA 3Q60A 2JKMA 3S4QA
chains in the Genus database with same CATH superfamily
4QP3A 1PKDA 4EK5A 3LFSA 3BU3A 1V0BA 4PP7A 4J8NA 2OXDA 2Z60A 4AN2A 4X2KA 1OIQA 2XJ2A 4CMOA 4CKJA 4N70A 2XNEA 4H1MA 4U3ZA 3Q4UA 3NUYA 4L53A 5BUJA 4FRFA 2WTIA 4S30A 4U40A 4F0FA 2QHNA 3IW4A 3PXZA 4TWOA 4G3EA 4ORKA 4MD8E 3NUXA 5IG1A 2NRYA 3NPCA 5AP4A 2J0KA 2CCHA 2F7ZE 3CKXA 4KSQA 4ZSAA 4C3PA 4QD6A 3BHHA 3Q96A 4QMPA 4KKHA 4Q9ZA 2JKOA 4BL1A 1CTPE 3DT1A 3TNPC 3QKKA 2ZV2A 2GTMA 5EFQA 5C26A 4DCAA 4HGEA 2E9NA 5LARA 2WNTA 4GS6A 5HBEA 3M11A 3VAPA 2IJMA 3RNIA 1ZYJA 4I6HA 2BHEA 3PIZA 4MQ2A 3OHTA 3NUAA 1G8KA 3COMA 2NRUA 3PP1A 3MY1A 4O0YA 2OFUA 4Q9SA 1QPEA 4BCMA 4JDHA 4K0YA 2VGOA 2BUJA 4XHKB 4BTJA 4BDBA 3PRFA 3NS9A 4LRJA 5I4NA 1M2QA 2ZM3A 4KIKB 3WF9A 4F0GA 5ITAA 4FBXA 1PJKA 4HGTA 5LMAA 4NIFA 5ANGA 4EOPA 5JGAA 3RALA 5TOZA 5LJJA 4O7TA 4FEVA 1MQ4A 4RA5A 5DR6A 3RK7A 4JDKA 5LVMA 4ZTMA 2OJ9A 3D15A 4ANBA 4AGUA 3TKIA 1FGIA 5HBHA 1H01A 3ZRKA 3PSCA 4DE4A 5FWKK 3ITZA 3OCBA 4I21A 4JT3A 4L46A 4S34A 3ZLXA 2V5QA 2W9ZB 1JKKA 2PVJA 2WO6A 4YHJA 5E92A 3P86A 3RKBA 1WFCA 4IVBA 4YZMA 5JKGA 3TUCA 3G2FA 4ID7A 4AQKA 3QTIA 4QTEA 3QTSA 3KMWA 4DBXA 4EH4A 1R0PA 4KIQA 3PVGA 2XNNA 3EQIA 5GINE 1IG1A 4IACA 4TZRA 5FTQA 3W0RA 4CFVA 2XEYA 3MVHA 5CS6A 4FTQA 3P5KA 5AUYA 3UVRA 2XAOA 2HWOA 5HLNA 3O2MA 4JLCA 5DRBA 1KOBA 3RM6A 2FSTX 1AD5A 3LW0A 3BBTB 5CAOA 3I81A 3FI4A 3LCDA 4HNFA 5AUVA 4J71A 4GYGA 3VIDA 3DXQA 5DH3A 5JFSA 1HOWA 3OFMA 3GU5A 4NTTA 5DNRA 5HNIX 3UZTA 4EI4A 4BCGA 4DFZE 4YHTA 5HNGA 5KMMA 4AX8A 4LUDA 5J87A 4GRBA 5HE2A 1W2CA 2PTKA 1OGYA 3IOPA 4QYGA 1PMUA 5L2SA 2XS0A 1H0VA 3Q5ZA 4XOYA 3N4UA 4CV8A 2XNPA 1XBCA 2JKKA 2RG5A 3R2YA 2XM8A 4CFWA 3AMYA 3Q6UA 1XO2B 4IADA 2HELA 4M84A 1XBBA 3OCSA 4KRDA 2H96A 1YOLA 1H1SA 3V5TA 5LXMA 4IC8A 4ZY4A 5M4IA 3W18A 3KN6A 3A60A 4FZ6A 4BJJB 2W1IA 1YXTA 2WMSA 3MY5A 4G3FA 5CANA 1OIYA 2WD1A 5AX9A 4UMQA 2RFSA 4BZNA 2XH5A 3GU4A 4YTHA 4FL1A 3KK8A 5B7VA 3BYUA 4OW8A 3QD2B 2GFSA 4FEQA 4MVFA 4KB8A 4E4XA 3AC8A 3CJFA 5AV3A 5D7VA 1UV5A 4FJVA 2C6MA 4FNXA 2JIVA 2F7XE 2HIWA 3DBDA 3H0YA 4D2RA 4I5HA 2Y4PA 3UDZA 1YKRA 2PMLX 4K11A 4G16A 4ZLYA 3IGOA 5BYLA 1YWNA 3BYVA 4FZFB 3VS7A 1J7IA 3F7ZA 4EEVA 5CALA 4I0SA 2WTKB 4MXXA 1GZ8A 4QT1A 5DT4A 3W2CA 4GL9A 4BCFA 3CE3A 3ZO1A 3FJQE 3ZO4A 3DAEA 5EYMA 4E5WA 2P3GX 4FTUA 4RC2A 2XANA 3FKOA 4RIXA 4BCKA 3GVUA 3PWYA 5CQWA 4CV9A 2ITWA 3G33A 3MPAA 3GP0A 1NA7A 4IZ7A 2XCHA 2QOFA 5IEVA 5IKWA 3LFQA 2P4IA 4X3FA 3TV7A 3SVVA 1Q3DA 5ANJA 3TL8A 4FVQA 3PG3A 4EC9A 3PDTA 1GOLA 5I3OA 2WPAA 3GU7A 1JOWB 3QFVA 4EOSA 5FD2A 1WCCA 4EH5A 2B9JA 4OT6A 3HP2A 2X7GA 4CTCA 1J7LA 3ORIA 2C3JA 3F5XA 1PHKA 4IH8A 5HCXA 3REPA 1K2PA 3ANRA 4DEGA 3DU8A 4TYEA 4Y72A 5CNNA 2GS2A 3MVMA 4JS8A 4I4FA 1YDSE 3QHWA 1H0WA 4WSQA 3ETAA 2QOKA 2YITA 4O7YA 2UZDA 4DCEA 3NVKI 2WQOA 3BX5A 5E9EA 5CVFA 2YCSA 2BILB 5I9ZA 3BHTA 2UW3A 5IH6A 2ETRA 3QTRA 3Q9WA 4AFJA 1U54B 4JIKA 4ZTLA 4KAOA 3COKA 4BKJA 1Q5KA 5CEPA 2EUFB 5IA1A 3R1NA 2G2HA 3QTZA 4BGHA 3ZM9A 4YO4A 4AW0A 2OJIA 1PMVA 4H3PA 4NZWB 4FV7A 4AZEA 1R3CA 4BC6A 4F0IA 1YXUA 4Z7GA 4WUAA 3VS3A 2QCSA 1YQJA 3BI6A 4EK8A 3LM0A 1HCKA 2VAGA 4FTNA 4MNFA 4ZTQA 4U7ZA 3R7UA 4DGGA 5ETIA 5E1EA 1VZOA 3HMPA 3ORMA 4M0YA 3SHEA 4AOTA 5ANDA 5CLPA 3FLSA 3W2QA 2X4ZA 4AUAA 1VYWA 4L3LA 4EHGA 2CSNA 4CG8A 4FKPA 4RVMA 3QD4A 3PPZA 4DEIA 3W0PA 2R64A 4M8TA 3BQRA 3E8CA 3LXNA 4CFUA 1CKJA 4C3FA 3HMOA 4KBKA 4IVAA 3TKUA 4JRVA 3CTHA 3AC4A 4FSYA 2ZVAA 5FXQA 1FVTA 4FT0A 3JPVA 3KEXA 5E8YA 4D28A 2HXLA 3NGAA 4KIPA 3NMUF 5EM7A 4RWIA 3RPSA 5EOBA 2R0UA 5A4TA 5CSPA 3QCQA 3UVQA 4XUFA 4II5A 4FTIA 3TV4A 2YM6A 4FV4A 3BL7A 1QPCA 3LKMA 3MDYA 4QP4A 3FI8A 5C27A 3BE2A 4P5ZA 3VBVA 3EQRA 4JVGA 4LOPA 4EQCA 3D5XA 3EQCA 2Z7RA 4IX6A 2FSLX 3I79A 4AT4A 4AXEA 3P7CA 5C9CA 5HTCA 3QZHA 5FEEA 4FICA 3NEWA 3WYYA 4GMYA 2XKDA 1WBSA 3PY0A 3R21A 3VW8A 3TNQB 2YIYA 4ANSA 3FE3A 4QP2A 4FKVA 1VJYA 3F2RA 2OZAB 3VBYA 4APPA 5LMBA 3RK5A 1W98A 4D2PA 4V0GB 3TIYA 4GIHA 2BHHA 3UQGA 2CNVA 1Q8TA 2PE2A 4L3PA 4QQJA 2Q83A 3H0ZA 5HE0A 3TZMA 4MHAA 3FC1X 3WARA 3W16A 5T68A 3A7GA 5A14A 3AKLA 3TM0A 5DN3A 2DQ7X 3IO7A 3PZHA 4R78A 1M2PA 2YCQA 3FAAA 3EN4A 3OP5A 1OUYA 1ZYLA 3IDPA 4M14A 4OTHA 2W1FA 3Q52A 3KVXA 1RE8A 1YXVA 2O3PA 3DY7A 4FV2A 4J95A 2QOQA 4PV0A 2WQBA 5BVFA 2GSFA 3PSDA 5HO8A 5BMMA 4ASZA 1R1WA 4GK4A 4G17A 4O1OA 1OL2A 3PSBA 3ZLSA 4BHNA 3BGZA 2FO0A 1JKTA 3F2NA 1HCLA 3IS5A 5HKMA 4CNHA 2ZMCA 3QL8A 4AXFA 3QTWA 3KRXA 3ZFXA 4C8BA 5K0KA 4G5JA 3AT4A 1F3MC 4FSUA 3R63A 1JSUA 2Z7QA 3NSZA 4R8QA 5DFPA 1RDQE 4EQMA 3U9CA 1SVEA 3B2WA 4LV5A 3K5UA 4AOIA 1UKHA 2G01A 2C0OA 2SRCA 4QDVA 2ZV9A 3CJGA 1E1VA 2ZDUA 2YWPA 2DYLA 4KNBA 2P55A 2CPKE 3LJ1A 1H08A 2Y4IB 4R1VA 4E6CA 5F20A 3GXLA 3D94A 5DVRA 3KXHA 5D1JA 1CKPA 2LGCA 2PZ5A 3CR0A 4I5PA 1WVXA 4JI9A 4DGMA 2XJ0A 3GCQA 3GU6A 3AD4A 3DK7A 2AC5A 3ET7A 5FEDA 2PUIA 4R77A 2OSCA 4EOOA 2HAKA 3E8EA 4ARKA 2GQSA 2XKFA 4K2RA 3VBWA 5EQPA 4FTLA 3EJ1A 1UVRA 3HGKA 3G6GA 1Q62A 3SD0A 2HW6A 3KY2A 3VS5A 5FUTA 2B7AA 4ENYA 4O83A 2C69A 2PSQA 1PXOA 2BDFA 4JBOA 5FM2A 5HO6A 3ZM4A 3L1SA 3DZQA 3HKOA 3NW7A 1XH6A 4FYOA 4F1MA 4EOQA 1B6CB 4FZ7A 4M67A 3VBTA 3LZBA 4FGBA 3R9DA 3ZHPC 4JQ7A 1WBPA 5IH4A 4MQ1A 2OKRA 5M53A 2C0TA 3BCEA 4X2GA 5KMJA 3UOKA 1JSVA 3G0EA 3BU6A 3MS9A 1IR3A 4ZMFA 4NJ3A 4H58A 1KE7A 2WAJA 2XYUA 4O0UA 4QO9A 2R3FA 3GEQA 4CFNA 1QL6A 3TNWA 2XP2A 4O0TA 5EM6A 3BWFA 3VJOA 5JRQA 3GC0A 3VULA 1OB3A 3HRBA 1LEZA 3MYGA 3A7JA 5FLFA 4DEHA 4FG8A 4PL4A 4FV8A 5HG7A 2ZB0A 4CEGA 3DNDA 5CZIA 2OU7A 1YHWA 3NFGB 4QMYA 5GNKA 4DT9A 4WD5A 5LVOA 3KRJA 3NUUA 2ITUA 4EBVA 3BYOA 4KUJA 4E3CA 3IK3A 2V55A 5HD4A 1SNXA 5JFXA 4B0GA 3VUIA 5K9IA 4BI0A 1UKIA 4A4OA 3ERKA 2C6IA 5KMKA 3U6IA 4QMLA 4CRSA 1G5SA 2QQ7A 3QQUA 4O22A 2YLEA 4EZ7A 2O63A 2PWLA 4XP2A 3ZEWA 3ZUUA 5M4CA 1VYZA 5AP6A 3JYAA 1CM8A 2VWZA 4IWPA 2PYWA 1PMNA 2QONA 3D83A 3SQQA 3I7BA 3Q2MA 3OWPA 4YJTA 3MIAA 5TT7A 2X9FA 3F3ZA 3GOKA 2OBJA 3MA6A 4O21A 5I9UA 4E4NA 2GNGA 3D14A 3P4KA 5EDQA 3UE4A 4ALWA 4YR8A 5GZAA 3SW7A 3S00A 3ZOSA 3KXMA 1ZYCA 3FI3A 5F4NA 4J1RA 2X8IA 5EOLA 3ZXTA 4DA5A 3V8SA 4FOBA 5CX9A 4Y83A 2F7EE 2IWIA 5CXHA 3BZ3A 4AXCA 1U4DA 2BKZA 2CN8A 4F70A 3IQ7A 5JRSA 4C4EA 3FZ1A 2BRHA 2H8HA 2HZ0A 2UW5A 3QA0A 4FNYA 4TY1A 4EK4A 1MRYA 3BLAA 4O7VA 2I1MA 4B99A 2ITQA 2PVYA 4JRNA 1KE8A 1W82A 3P08A 3LIJA 3OF0A 3VQUA 4EHZA 1IAJA 3OTUA 5IA2A 3U8WA 4XNEA 3VUMA 5A3XA 3M2WA 2R9SA 1M7NA 2VO7A 2BAJA 3VS4A 2QOCA 1GAGA 3QX2A 1PXKA 2W1EA 3OY3A 1JQHA 3OXTA 4G31A 5J1WA 3FZTA 5HVKA 2C6TA 4N0SA 5C01A 4E8AA 2YM4A 3D5WA 2X6EA 4O4CA 2XNMA 1W7HA 4QTDA 3RP9A 4A7CA 5FRIA 2YN8A 2Y8OA 3W2PA 1JAMA 4ZZOA 2IW9A 5BNJA 5J79A 3LQ8A 4FTMA 4X0MA 2V7AA 5AR2A 2QOIA 1ZZ2A 1ZMVA 2RF9A 2QVSE 2R0IA 3A7IA 4GUBA 1OKZA 2JD5A 5DOSA 4IBMA 3V04A 2REIA 4J99A 3LFFA 4U0IA 2ZFYA 2XNGA 2GHGA 3G51A 2EVAA 3R8LA 2OG8A 1J3HA 1QCFA 4EYMA 1M14A 1AGWA 3FXZA 2Z2WA 4RIWB 3KRRA 1CSNA 2UVZA 2C1AA 5AM6A 2PMOX 3TDVA 3OCTA 4OUCA 1ND4A 1NVQA 4I20A 2EU9A 1WBWA 2R3RA 2X6DA 4MD7E 4DFLA 2R3IA 2JEDA 4O7NA 4BZOA 1T46A 3KL8A 3EB0A 2RL5A 1KE6A 2QD9A 1WVWA 3B8RA 2PPQA 4H36A 2VWVA 5H8GA 2VZ6A 4OTGA 3R8UA 1ZYDA 4KIOA 5AADA 1Q8ZA 4MK0A 3VONA 1MRVA 4FKRA 2XM9A 4HOKA 3COHA 2J6MA 1GZKA 2W0JA 5CASA 4V05A 1G8AA 3D7TA 4FIEA 2BRMA 3TI1A 3S0OA 4FX3A 3I0OA 4YU2A 1U59A 4X2JA 1PW2A 4WOVA 4QTBA 5J5TA 1A48A 1G8SA 1XQZA 3BWJA 1GZOA 1Z9XA 3RPYA 4A4LA 4C57A 1SYKA 2JBOA 3AKKA 1OL7A 2E9PA 5FDXA 4BCOA 4O81A 1PY5A 3PLSA 4BR3A 3CQUA 3EQBA 5IUIA 2GS7A 4XG4A 2EWAA 3LFNA 4WRGA 2R3PA 4DBNA 4ONAA 3LMHA 2WMTA 5M57A 4ZLOA 4FVRA 3IOKA 2WMAA 5EI6A 2VX1A 3D0EA 4EOLA 3QRJA 3W2SA 4ZLZA 3FMKA 4I93A 3DBQA 3ZONA 2WU6A 3PXRA 4IE9A 2O8YA 4GFOA 4GT4A 2ITTA 1B39A 2ITXA 3HP5A 4L52A 4MWIA 4ZTRA 4BTMA 4D58A 2VD5A 1WZYA 2J5FA 5AWMA 5C1QB 2ERZE 4XP0A 4CCBA 3BKBA 3MTLA 5BUEA 1BI8A 2R3HA 4XEYA 2R3JA 3PY1A 4FV0A 4EH9A 4QQTA 2XA4A 4MF1A 2XRWA 4FSWA 4RX5A 4AT5A 4L8MA 5KCVA 3E7OA 3IG7A 4UXQA 4ZK5A 4F7NA 3LQ3A 1O6LA 3MBLA 4C36A 2R3MA 3QCSA 2WFYA 4PTGA 2XMYA 5DBXA 4DG3E 3E5AA 4WG4A 2UZNA 4GJ2A 4ANLA 4FMQA 5DG5A 4FK6A 4RJ3A 3QQFA 1RQQA 2YERA 3DAJA 2IW6A 2VTMA 2OICA 1ZXEA 4FIGA 4MWHA 3MA3A 4CFXA 3LQ5A 3RNYA 3NNWA 3PPJA 4BI1A 2YZAA 1YI6A 4U3YA 2PU8A 4YTFA 1XH4A 1OPJA 5EQEA 4O0XA 4DG0E 2VTOA 4HVHA 1BI7A 4TN6A 4ITJA 1OBGA 3KQ7A 3ODZX 5FP6A 4ZXTA 3KF4A 1T45A 4IFCA 2QU6A 3LM5A 4UMPA 3UODA 1JVPP 4MBIA 2Q0BA 1PXIA 3EFKA 3DAKA 5EDRA 3SC1A 5IUGA 4QP7A 2GNJA 3IW5A 5K5XA 2XIZA 1IEPA 3F5PA 3K5VA 4PPCA 4XV3A 5C8MA 4A9YA 4KS7A 5L6PA 4QMOA 3UYSA 4AT3A 1SMHA 5CT0A 3P7BA 5IQHA 3KK9A 4ACGA 2WIPA 4IJPA 1OKYA 1PYXA 4O4FA 3WI6A 2WEVA 2C4GA 2WMXA 5KMIA 3QUPA 4HCUA 4LYNA 2BZKB 4LRKA 4C58A 4D5KA 2ZMDA 1KUTA 5I3RA 1JKLA 3FL5A 3O8TA 4MNEB 3DTWA 4OLIA 4CKRA 5IA5A 4MX9A 4GG5A 3BYSA 2RKUA 1SM2A 1UU7A 2RFEA 4F63A 3I1AA 4YO6A 1BLXA 4GW8A 3G6HA 4C38A 3BEGA 3FZPA 3SOCA 3AT2A 4EKLA 4QTAA 5EDPA 2Y7JA 2YLFA 3GC9A 4ERKA 2WMVA 4FV9A 4D2TA 5JFVA 3C4FA 3TUBA 3HA6A 4MXAA 4E6QA 1OM1A 3GBZA 3UJGA 4F7LA 3MJ2A 4AU8A 3OXZA 2CGXA 5ACKA 2IW8A 3SXRA 3VBXA 5KO1A 4NYEA 4N57A 3PVBA 3UP2A 5KZ0A 2X39A 3E8DA 4YJOA 5CI7A 5BUIA 2G9XA 2BMCA 5I9XA 2ZYBA 1S9IA 4DG2E 3GGFA 4PDYA 2VTRA 4XG7A 3ZZWA 3EL7A 3FLWA 1OKVA 1YXSA 2UW7A 5AR7A 4CT2A 2ZAZA 3EZVA 3MH0A 2PVNA 4C7TA 4HVGA 3VJNA 4LGDA 5IQDA 2VWBA 4IEBA 3U4UA 2XBAA 2JC6A 4IVCA 4LM5A 3ZO2A 1OI9A 3K2LA 4ACCA 3BRBA 2WQNA 5T6KA 4YNEA 3TZ8A 4RG0A 4RLLA 3ACJA 3ZSGA 4CMTA 2BZHB 5JMSA 4I23A 3VC4A 3G0FA 2PE0A 1YDTE 2BZIB 2QC6A 3LFCA 4FG9A 4W4YA 1U46A 4FTJA 2UV2A 3TEIA 4DITA 2UZWE 3KXGA 1W84A 4NFMA 4CRLA 5E8SA 2WTKC 1H07A 3F5GA 3LFAA 4NEUA 5KX8A 4FKUA 4FSZA 3KRWA 2GU8A 3LMIA 4JBVA 4QYEA 4RVKA 4H3QA 4EZ5A 4C35A 4WT6A 1MRUA 2WMUA 2PMNX 2QOHA 2X8EA 4IAKA 5AR4A 3I0QA 5CEQA 3CY2A 4W8DA 2HOGA 2PVLA 4A07A 1VLRA 2GMXA 1NY3A 4YP8A 4QMUA 3KIOC 1PXJA 4FSRA 4YLKA 3HLLA 4IVDA 5HU9A 4QPSA 5CT7A 4USFA 5CEIA 3U6JA 2VO0A 5B2MA 3DLZA 4YJPA 5AR8A 4FEWA 2X8DA 3IW7A 3NNUA 2QLQA 4JR7A 4I94A 2X2MA 4JQEA 2GQRA 5IQFA 4O91A 2O5KA 3FWQA 2F9GA 3RPRA 2XIRA 5C8KA 4IB5A 1JPAA 3EYGA 3QRTA 4L3JA 2UZLA 5EHLA 4RWLA 1J1CA 3I60A 1LUFA 3R04A 4MBJA 4EJ7A 4F4PA 4D4YA 5J9LA 3FXXA 5AAGA 1TVOA 1ZY4A 3PE1A 4J8MA 3QXOA 5AAEA 3SDJA 1H28A 3UC3A 3ZUVA 4AZSA 3EHAA 4RC3A 4FTCA 3AC2A 3BV2A 3OT3A 5GJGA 4B6LA 1LPUA 4JDIA 5DEYA 5CAQA 5HEZA 3K3IA 5E4HA 5D9HA 3HAVA 1PXNA 1PXLA 2O64A 3O0GA 4U6RA 2PVFA 3FL4A 3PJ3A 3R71A 5LWMA 4FTKA 4JOAA 3UQFA 3BEAA 4NH1A 4CG9A 4GJ3A 2YEXA 1KV1A 3SG8A 4L44A 4RIYA 1YVJA 4XJ0A 3ZUTA 4PMSA 4YSJA 3UNKA 5ANOA 3CY3A 3PJ1A 3PVWA 3OEZA 2VTQA 3AQVA 2C6EA 3OEFX 4ANMA 2YCFA 5D10A 5CU0A 3LCTA 5DT3A 4QYYA 3EFLA 2B4SB 4TYHA 2HCKA 4E4MA 2VX3A 3HUBA 4ASXA 4YMJA 4K1BA 4BHZA 4MKCA 3D2KA 3N51A 4QPAA 3C51A 3ZCLA 4CZTA 2W99B 2WMWA 4YURA 4WG3A 2NYAA 4PL3A 2WTCA 3EOCA 4H3BA 3ACKA 5AR3A 4AGWA 3BV3A 4J98A 3PRIA 4JNWA 4GFMA 4YBJA 3DS6A 2WELA 3DXPA 4BDJA 3KN5A 4YJNA 4C4JA 1DAWA 3L9NA 2BPMA 4L7FA 4UN0C 2VX0A 4NM0A 3NYVA 5KBRA 1ZLTA 3E64A 4AXAA 1GZNA 2ITOA 5BQ0A 1UWHA 4UEUA 1OIRA 2ERKA 3GENA 4X21A 4UYAA 5D7AA 4UV0A 5A6OA 5KZIA 3HDMA 2OXXA 3FQSA 4DFNA 2F2UA 2XK3A 4LMUA 4PX6A 5CI6A 2C5NA 4U45A 4DHJA 2OI4X 1Q3WA 1X8BA 2JBPA 3RVGA 3P7AA 4U97A 1B38A 5DIAA 2XK9A 2F49A 3PZEA 4C34A 3EZRA 4UMUA 4FGRA 2EXCX 4Q5EA 2OO8X 1U5QA 4ZIMA 4B4LA 3FHIA 2ACXA 2YCRA 4EBWA 5IF1A 1H1PA 4AXDA 3VRZA 2OK1A 3O71A 3QQJA 3BLHA 3EMGA 2BFXA 1YHSA 3OT8A 4O0VA 3KA0A 4U81A 4BDHA 4FTTA 1TZDA 3B8QA 4OTPA 5I9YA 4RJ5A 2XIXA 4FTAA 4FZDB 4WBOA 3JXWA 3NIZA 5J7HA 5JSMA 2XCKA 4RX7A 3U9NA 4AGCA 3QC9A 4XG2A 2BIYA 2VTJA 2GCDA 3FYKX 4JJRA 3SV0A 4O2ZA 2E9OA 5B2KA 3V5QA 5A4QA 1P2AA 4MXYA 4G34A 4PNIA 4OT5A 5TR6A 3FLNC 2Z8CA 3TWJA 1W2FA 3RINA 3HDNA 3FI2A 3DFCB 4HVIA 2PULA 3E93A 2A19B 2CKOA 2RFDA 3UTOA 1ZY5A 3DKFA 3FSKA 2Y6OA 4M12A 4AFEA 2W1DA 2PUPA 3ORNA 3QX4A 2J9MA 1K3AA 2XUUA 3F3UA 3FDNA 4K9YA 4F09A 2YM8A 4G6LA 2CGVA 5DR9A 2YDKA 3DPKA 4Y85A 4NW6A 4Q2AA 4EUTA 4RA4A 2PUUA 2EB3A 3NUPA 4K77A 4UWBA 4DN5A 4R7BA 3UYTA 4FOCA 4GT3A 4JG6A 4NKAA 4NK9A 4C3RA 4UBAA 4CLJA 2FA2A 5HG8A 3LLTA 3NR9A 5ACBC 2CDZA 4BYJA 3EWHA 2OW3A 3SRVB 5CSVA 5C4LA 3FMLA 1YOMA 1UNHA 4IWQA 4WSYA 4C0TA 3HL7A 3PA4A 2E9UA 4BCQA 5AEPA 4UX9A 2FYSA 2OIBA 2XB7A 4JBPA 4BGGA 3WOWA 2P33A 2VNYA 3WZUA 4PDPA 1SVGA 4RLKA 5FDPA 1YXXA 4DDIA 2I40A 2QOLA 2BIKB 2Y4IC 3KFAA 2J0MB 1XR1A 2X4FA 2B54A 3OW3A 4WA9A 2AQXA 4HYHA 3ZU7A 3E7VA 4IDTA 3R8MA 4DF3A 2QO2A 3QLFA 3O8PA 3QD3A 2C0IA 2VTHA 3QWJA 2QODA 4LGHA 4OAUC 4YZNA 2UZUE 5CNOA 3ROCA 2HYYA 5D11A 4KSPA 2EB2A 4FT5A 4L45A 2PVKA 3HMMA 5HD7A 1ZOEA 3U4WA 3MWUA 4WIHA 4XYFA 3W2OA 3DKCA 5IQBA 3ORLA 1ST4A 2A1AB 3EQPA 4BGQA 2ESMA 3TYKA 2CN5A 4CMUA 4J52A 4FUYA 4KIKA 4M7IA 3MJ1A 3KCKA 4ZJJA 3MN3A 2ZOQA 3UOJA 4KWPA 1H1RA 2V22A 4IZYA 4I6FA 2UZEA 4D9UA 3P9JA 5E91A 3CC6A 4ZY5A 3U6HA 2GNHA 4BDGA 4ACHA 3VUGA 5HG5A 2BCJA 5BVNA 1P4OA 4X3JA 5L2WA 2ITNA 3E8NA 3QWKA 2XVDA 4IWDA 5HIBA 4ENXA 2NNWB 4ACDA 2JDRA 4MD9E 5KE0A 3QTQA 2IPXA 2CMWA 2HENA 1ZWSA 3EN9A 1ERKA 2XKEA 1J1BA 4DHZA 2HXQA 3E3BX 4KKGA 3KRLA 1M2RA 3QQHA 4DGOA 4PWNA 4IZ5A 2BFYA 2WTVA 3C0HA 1KWPA 5L8KA 3R7VA 3QALE 4DH3A 4F65A 3NNVA 4C4IA 4I6LA 4FNWA 5CEKA 4FZAB 4O38A 5M4FA 2WOUA 4FODA 3DLSA 3NCGA 2ONLC 4O27B 3C5IA 4I1ZA 3UIBA 5IQIA 4DH7A 5IDNA 4JQ8A 5DRDA 2C5XA 1H8FA 4JIAA 4Y5HA 5FG8A 4GSBA 2BZJA 1BYGA 3FMJA 5AIKA 3IW6A 2XAMA 4DINA 3OBJA 1Q61A 3BQCA 4HZSA 4K6ZA 5CU6A 3ZRMA 4F1OA 4F9BA 4OBOA 4O1PA 1TQPA 2HY81 3QQGA 4QMVA 1OPLA 4AA4A 3VUTA 3CLYA 2A4LA 4XRLA 5DEWA 5EI8A 3R7YA 3VVHA 4Y73A 2VTAA 4RBLA 4EH3A 4RX9A 2UZOA 4ZAUA 2PUNA 2BDJA 4E5BA 1XH5A 4YHFA 4TTHB 4E7WA 3PJ2A 3ENHA 3HEGA 5IU2A 4IIRA 3JVRA 1QPJA 2PY3A 5A4EA 3SXSA 5IEXA 4M0ZA 3UDTA 3A99A 5T3QA 4H1JA 1TQMA 4A06A 4BWKA 2YACA 5IMEA 5EW8A 4D4RA 4PQNA 5M07A 3CS9A 4EORA 1OBDA 4O4BB 2J50A 3R22A 3ATTA 2EXMA 3HV5A 3LE6A 1Q99A 3OWLA 4S32A 3TJCA 4GH2A 4RFMA 4BCNA 5EI2A 3QC4A 4BJJA 4BBFA 2VTLA 3C13A 3GCPA 3O5AA 2J0IA 4W9XA 3C5UA 4OTFA 4ZMEA 4DAWA 2O0UA 5JQ5A 3OY1A 4LMNA 4O7ZA 2DS1A 2BKKA 1WBOA 4W4WA 4XV1A 4A4XA 4TYJA 2FUMA 2E9VA 4NWMA 2B9FA 3QHRA 5CEM