4DITA

Crystal structure of gsk3beta in complex with a imidazopyridine inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
353
structure length
328
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Crystal Structure of GSK3beta in complex with a Imidazolopyridine inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 90
structure length 328
sequence length 353
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ditA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ditA01
2WTIA 1OBGA 4D55A 2BPMA 1U46A 2BRNA 4RX8A 4TYJA 5IG1A 3VBWA 5AR5A 2FSLX 3GC8A 2GPHA 2F2UA 4BI2A 2UZLA 5EW3A 5IQEA 1QCFA 3G5DA 4QP4A 3UIUA 3EQHA 4I41A 3OD6X 1OIQA 4GG7A 1JVPP 4R7IA 2JKKA 4MK0A 3G2FA 4EYJA 3HDNA 3W33A 3NYXA 1VEBA 1UKIA 3F3TA 4RWLA 4WBOA 5TT7A 3R8UA 3EQPA 5FQDC 4FSNA 3F61A 5BUJA 4I1ZA 2BZHB 3NUSA 4L7FA 4OW8A 4ZY4A 5FUTA 3QLGA 2C30A 5IA5A 3ZLWA 4FT0A 3BU6A 3SRVA 5CASA 2JD5A 4GVAA 4E4NA 3II5A 3QUPA 4RX9A 5ANOA 3LQ5A 5EYDA 4GT4A 3IKAA 4YURA 4EH3A 4RIOA 5AUUA 4X2JA 3BYOA 4FKPA 3CD8A 5AR4A 4TRLA 1KE8A 3SKCA 1B38A 5DYJA 4MNEB 1XH9A 5HI2A 3I60A 4AOTA 4CRLA 3PTGA 2WEIA 3O8PA 5TR6A 4Y5QA 3PXRA 3RCJA 4AP7A 3PFQA 4GFOA 3DTCA 3VWAA 4GS6A 2C3KA 3NYNA 3C0IA 3V3VA 2JKMA 4C7TA 5CEKA 4Y5HA 2DWBA 4TYIA 2E9UA 4AZWA 4JL9A 5JGAA 2PZ5A 2XNPA 3S00A 3V5WA 1KWPA 5IEXA 4L46A 4KD1A 4GFMA 4AA4A 4CT2A 2ZV2A 3TDWA 1SM2A 2R3FA 4FT7A 1ZYSA 2XRUA 3KY2A 2P3GX 5K5NA 2PVRA 4F70A 4JDJA 3VUDA 5KBRA 2QOFA 5HD4A 5DBXA 1A06A 1EH4A 1JKLA 4ASDA 4D0XA 1STCE 1FVVA 2VNYA 4XBUA 3QX4A 5EG3A 4AAAA 5DOSA 3MPTA 4O83A 4G6LA 1YI6A 3OS3A 4A9YA 4C4FA 1YW2A 4GL9A 2JAMA 4GSBA 4ZK5A 5DVRA 3PJ2A 4CKRA 4MXCA 5BVEA 2VO7A 4WHZA 4HVIA 3D7ZA 4G6OA 4XX9A 4C3RA 5CF8A 3EQGA 2VO3A 4IWDA 4QMLA 3FC1X 4JR7A 3QTZA 2XK6A 2C1BA 5AMNA 3UBDA 4C34A 4EUTA 1YXUA 2WIHA 4NH1A 4EK4A 4ZSEA 2A27A 3CKXA 4FIIA 3Q60A 2DQ7X 3KVXA 2UW3A 2WTKB 1ZXEA 3BQCA 4RC4A 5LVLA 1OITA 3CLYA 2W1GA 2RFDA 3ZO1A 4E5AX 3BEAA 2E9NA 4OTDA 4FSQA 3A7GA 3PDTA 4O27B 3S95A 5IUHA 3C5UA 4PPBA 3PIYA 3OWPA 4J96A 1MQ4A 4QPSA 3PXKA 2JITA 5IKWA 1W83A 2PTKA 4CFWA 3BYVA 3JS2A 4BCOA 2Y4IC 4BKZA 3DU8A 4OBOA 4HYHA 4DAWA 4ERKA 4K33A 3FZPA 5JFXA 3CXWA 2J7TA 4RBLA 4IAAA 3QX2A 5DA3A 4G3CA 1UU3A 4FI1A 4QNYA 5CXZA 1Y6AA 3ATSA 3I4BA 5IQFA 2B9IA 5HBEA 4AZEA 1ND4A 2X8DA 2YWPA 3FZRA 3LXKA 2VX1A 5JEBA 4IDTA 1W7HA 4MBJA 5FD2A 1R0EA 3GCPA 3E3BX 4YP8A 3VS5A 2BAJA 4G31A 4PV0A 4F0IA 3FMEA 3P79A 4BCKA 1JSVA 4TKSA 3TL8A 4AZFA 4OT6A 4L01A 3UVPA 3RALA 3HA8A 4BICA 4RJ4A 4Q2AA 2VD5A 4X2GA 3L1SA 5FXRA 3FLQA 2PVMA 3WI6A 5IEYA 4QTCA 1FGKA 4EQCA 1YDSE 4YHJA 2BCJA 5B2MA 4ZTHA 2GCDA 4KIPA 3FQHA 3BWJA 5CLPA 3WZKA 3WF8A 1FOTA 3SC1A 5BVWA 5ETCA 2O0UA 2WGJA 4DGLC 3ODYX 4P5ZA 5T68A 3RK9A 3FI3A 5F4NA 2QURA 2QOOA 3A8WA 3KL8A 5FBOA 4BL1A 4GUBA 4DC2A 3HNGA 4QNAA 5DH3A 2OH4A 4UWCA 4X0MA 3F3WA 5K4JA 3ZSIA 4XBRA 2BIYA 3OVVA 1NW1A 1Q8WA 3TDVA 3H4JA 5CU4A 3E93A 5J7HA 1AD5A 5CX9A 3TNQB 3FLNC 2EVAA 5EH0A 3ZCLA 4FV0A 1JAMA 1J7LA 3ZZWA 2QG5A 2VX0A 1BKXA 3F2AA 4K2RA 4BHZA 3IDBA 5EM7A 2HYYA 4BCHA 4WT6A 3LMIA 2XK8A 3B8RA 1H26A 5GZ9A 3SGCA 4LMUA 4CMUA 2ZV9A 4H36A 4U3YA 3WYXA 4O82A 4R77A 4DEDA 4FIHA 4PNIA 3ZUTA 3ERKA 5FDXA 2X4ZA 3R73A 5KKRC 5LVMA 3S0OA 3GB2A 4I0RA 2Y0AA 3BKBA 4GYIA 3FI2A 3R04A 3ORPA 4PDOA 4BCQA 3G0FA 5L6WL 3DZQA 3W2CA 3KK8A 2G15A 2BTSA 5L2TA 1U59A 2R3OA 4EH4A 4A9UA 1WBPA 3PSBA 3RHXA 4M84A 4A4LA 5CF4A 2WMSA 2IZTA 3UE4A 2X9EA 3ZC5A 4J7BA 3QZFA 5CNNA 2GMXA 5DPVA 2PMNX 2WQEA 1G8SA 4FZFB 5HD7A 1Q3WA 5CSHA 5AUXA 4BDIA 4D2VA 5M08A 4H3PA 4ZTSA 4O7YA 2RL5A 3CP9A 4R6VA 4EYMA 4X7QA 4F9CA 3TKUA 2GNHA 3PUPA 5L2QA 4O7LA 3EB0A 5I9VA 4G1WA 4JIKA 4TYHB 2VTSA 1OIYA 1U4DA 1XO2B 2HAKA 1J3HA 2VTHA 1TQIA 3QD2B 4UALA 4XUFA 3C4WA 5EYMA 3TUCA 3R6XA 5DG5A 3OBGA 1PHKA 3A7IA 5CSVA 3GCQA 3F7WA 4YTHA 5GIOE 4C3PA 3R02A 3NVKI 3ZFXA 2GFCA 3PVBA 3UQGA 3BE2A 4FSTA 2HWPA 1H8FA 3NEWA 1LR4A 2OW3A 3PY1A 3QHWA 3ZEWA 4GIIA 5H9BA 3WZJA 1KE6A 5EQEA 5DE2A 3PIZA 3QC4A 1UU7A 2VX3A 2IW6A 5DT3A 5FG8A 5FLFA 2YZLA 3FJQE 3VBYA 2CGXA 2J0JA 3FY0A 5AP4A 3Q9WA 4RIYB 2R7IA 3E64A 3DGKA 1WBOA 1XH8A 2UZTA 4BYIA 1F0QA 1OPLA 2KULA 3HRBA 3SXFA 1IAJA 3N4UA 2I40A 4QTEA 2X2KA 3QA8A 4O0TA 3UOLA 2WO6A 4S31A 4GKIA 1B6CB 3TM0A 3BGQA 5KMIA 5E9EA 4UY9A 3EYGA 4DTBA 3CPBA 3HUCA 4U80A 4C02A 3RVGA 4E6CA 2CJMA 1XH5A 4IQ6A 3VUTA 1M2QA 1NXKA 2EB3A 4GYGA 5F95A 2R3JA 5AV2A 4DFBA 1JOWB 3HMPA 2WKMA 2QC6A 4EJNA 3NSZA 5AAGA 4IZYA 3QBNA 2AUHA 4V05A 5BMMA 3RAIA 5CI7A 2QOIA 2OXYA 5FGKA 2NRUA 3RJCA 5HCXA 3THBA 4FTRA 3PYYA 3FMMA 3MH0A 3UPXA 3V5TA 4ACMA 4CZTA 5F9EA 4MCVA 3VQUA 4MEDA 2IVTA 4H39A 4PF4A 2GNFA 3QF9A 4E93A 4O81A 3F3UA 2XCHA 4IE9A 3VJNA 2PZPA 3ZO3A 1GAGA 4EQMA 1P14A 4NW5A 3QGYA 3ZO2A 3NUAA 4YC8A 3L8VA 3MWUA 4WIHA 3U4UA 4BGQA 3C5IA 5HLPA 3RCDA 4TT7A 4JDKA 4XNEA 4ONAA 2PE0A 4FC0A 3ZSGA 3I7CA 4FKUA 3N51A 4P2KA 2R3LA 2Q83A 2YWVA 4YPSA 3I0QA 4I22A 3MFTA 3FI4A 5I3RA 3AGMA 4KBKA 2OZAB 1BMKA 4FBXA 4RJ7A 4RC3A 3MGYA 4U3ZA 2PUNA 1SVGA 2YIWA 3ATTA 5DNRA 2E9OA 3GENA 3ORLA 3P23A 4BVUA 4BWKA 2XKCA 2RFEA 1JLUE 4BCFA 5HQ0A 4B0GA 4ENYA 4FKTA 1GOLA 3POOA 4L67A 3UDBA 4ITIA 3F7ZA 3H9OA 3IOKA 5T3QA 4BCMA 2UW9A 4DFXE 3O17A 1TKIA 2C4GA 4FL3A 2WTKC 4D9TA 3ZDIA 5CANA 2PMIA 4RLLA 4UZHA 4U43A 3DS6A 3L8XA 3GT8A 3MV5A 4FL1A 3L9MA 1Y8YA 4BDHA 2Z8CA 4FOCA 2C47A 4GMYA 2R3MA 3P1AA 4J99A 3UYTA 2R2PA 2QHMA 4RGJA 3VUHA 3NYVA 4EEVA 2B0QA 3E8EA 3EMGA 3FMJA 3V8TA 2PU8A 4OTGA 3SQQA 3C0HA 4R3RA 4K18A 5C27A 5CALA 4RIXA 4RG0A 4E8AA 2H8HA 5J8IA 2OU7A 3DQXA 4PQNA 2IPXA 3HA6A 3NUXA 3SVVA 5E8XA 3L9LA 2YIXA 1MRUA 2QHNA 2XNNA 3LPBA 4G9CA 5TO8A 4DG0E 2IVUA 3OROA 4R1YA 3MESA 4K77A 4PX6A 4J52A 4EOIA 2PHKA 4F1MA 4JAIA 4QP6A 1XH6A 1QPDA 4G6NA 4YU2A 3QQJA 1NVSA 3DJ7A 3I1AA 4P7EA 4LOQA 3FLSA 3OBJA 3UOKA 4FSUA 2VTQA 4WD5A 5CT0A 5HESA 1HCLA 2FUMA 4U81A 4R7HA 3F3VA 4L8MA 3TJCA 4YZCA 5I3OA 4USEA 2B9HA 2E9PA 2OK1A 1P2AA 2OIQA 3ZLXA 2C3JA 2VGPA 4PMSA 3GOPA 2Y6OA 4I92A 5BUIA 4G5PA 1OZ1A 1YHVA 3KFAA 4EWQA 4X3JA 2JKQA 5CF6A 1PY5A 4QQJA 3LMGA 4NSTA 4ZOGA 5CTPA 3EQFA 2GQRA 2UW7A 3OUKA 4O91A 5JGDA 4ACHA 5IDPA 3ODZX 2VTJA 1SVHA 2VU3A 3EWHA 4I4FA 4O0SA 4O0UA 3ZSHA 3DFCB 5BQ0A 3BHTA 4E7WA 4FEUA 4PDSA 3WF5A 1XKKA 4XCUA 4ALUA 1Q5KA 4QYEA 1Q24A 3RNYA 3C50A 2Z7RA 2HW6A 1YVJA 2OG8A 4R3CA 5EDPA 3PJ8A 2UVXA 3VJOA 4I5CA 3AC5A 3MB7A 4BN1A 4JDIA 2X0GA 3MN3A 2WU6A 1FVRA 4FEVA 3BLHA 3Q6WA 3EN9A 5ETIA 5EOLA 3TG1A 2Q0BA 3KEXA 2OJ9A 3OP5A 2BZJA 2UZNA 4D28A 3Q2JA 4FZ7A 5D41A 2HY0A 1KSWA 1LUFA 4BCNA 4O86A 4IJ9A 3UP2A 1Q97A 4Z55A 5HX6A 1L8TA 4MWHA 2FA2A 5TF9A 2XH5A 3CGFA 3ORKA 4EOLA 3OF0A 4C4EA 4QYYA 5EM5A 2VAGA 4WOVA 4JDHA 5M4CA 3F82A 1YWVA 2GTMA 5GJFA 4BBEA 3LFFA 1H1SA 4U0IA 2ITNA 4HVSA 5IZFA 1OL2A 3BYMA 4TY1A 2A2AA 5AIRA 2ZB1A 1ZOHA 4IAKA 3MA6A 4XG7A 1CM8A 1H01A 1OL6A 1TQMA 2I0EA 3KRXA 3QTIA 3DAKA 2HXQA 1V0OA 3KVWA 4Y72A 4CFXA 4ZLYA 4BDJA 4JXFA 3DPKA 4BI0A 4G3FA 3BYUA 2XYUA 3GCUA 4ANOA 4CZYB 4D5KA 1M17A 1QL6A 4FTOA 4AW0A 1PMNA 3K3IA 3UOHA 4FICA 3MFSA 3VUGA 1UNHA 2GNGA 4CV9A 4I0SA 3EZRA 3WE4A 2XIXA 4EC8A 3PLAE 4YTFA 2OICA 3MH3A 4HCVA 3LHJA 2WMXA 5JFWA 5B2KA 3OUNB 5TE0A 4CKJA 3NNVA 3NDMA 5CEQA 5H8EA 1M52A 2H9VA 2R5TA 2JGZA 2RG5A 3NGAA 3HP5A 3V6RA 3A4PA 3B2TA 3DB8A 3HV4A 2C5XA 2J5FA 3QRJA 4GU9A 3QCXA 4RJ5A 1OBDA 4N6YA 1UWJA 1Q8ZA 5AUTA 3U54A 4EOKA 5FBNC 5IMXA 2WU7A 3WZUA 3C4CA 2OIBA 2XIKA 2PVNA 4QYHA 3R83A 3CD3A 4BGGA 2WTCA 3EZVA 5J1VA 3JY0A 1UNLA 2NRYA 5CQWA 3TIYA 4NJDA 4U8ZA 5HTIA 3NIEA 3KF7A 5JMSA 3VO3A 4ERWA 4D2WA 4E4XA 3ZUUA 3CY3A 5E92A 4QT1A 4ZZOA 2OI4X 4I6FA 5HG8A 5CI6A 4NCTC 1R3CA 3MY5A 3EIDA 4KIKA 1OI9A 3DOGA 4YC6A 3DK6A 4K1BA 5HBHA 3ZO4A 4KS8A 3ZTXA 3G9LX 3G6GA 2P33A 4FT5A 4NYEA 2W7XA 1Q99A 4C62A 1IR3A 4NFNA 2VTAA 5KZIA 3C4FA 5TKDA 2G01A 3ORXA 5IQDA 3SLSA 2UZUE 3HMNA 4FIGA 3BEGA 3E8CA 3L8PA 2WXVA 1G3NA 3EFJA 4D5HA 2YM8A 2X8IA 4FTLA 3Q04A 4M69B 4LV8A 3LLAA 1OGUA 3MFRA 4YR8A 3BBTB 4ZJJA 5ETAA 3VIDA 2XIRA 5CVHA 4ASXA 1MP8A 4F9WA 2XB7A 4KSPA 4Q5EA 4OUCA 1OKVA 3BGPA 4TYHA 3R1SA 2UZOA 1BI8A 3QKMA 1OPJA 4NKAA 5FXSA 3OEZA 4GK2A 4BR3A 5BX0A 3MSSA 4FTNA 4W9WA 3PE2A 2OJJA 3B8QA 4L9IA 5HIEA 5K5XA 5L6PA 2PPQA 4YZMA 4XS2A 3OT3A 4H3BA 2F2CB 4NCTA 1J1CA 3DDQA 4UB7A 4YJOA 4LYNA 5CNOA 1P4FA 1Q41A 3IOPA 4CQGA 3BU3A 4LFIA 5AP1A 4D4RA 3SA0A 2B4SB 1JBPE 2O5KA 4DFYA 2IWIA 4WSQA 4YSMA 2ITUA 4YZ9A 5EDRA 4F9AA 1R1WA 2V7OA 2WD1A 2WFYA 3EL7A 5A4TA 4G2FA 5HU3A 3A62A 3PWYA 3KQ7A 4OBQA 4OTWA 2UVYA 4ZIMA 4FUXA 3MPMA 4UYNA 4AT5A 3R0TA 3POZA 4J1RA 1YRPA 5LVPA 4PNKA 4RX7A 2ZVAA 3PJ3A 4DLIA 4WKQA 4RWIA 4ENXA 4AN9A 2QLUA 4YJPA 4BY9E 5AP2A 4BDFA 4IB1A 4BIBA 1OVEA 1R78A 3SDJA 2OF2A 4RFZA 3VRZA 3FHIA 5IQAA 1YXVA 4DINA 2BDJA 3CQUA 4JLCA 4OAVB 4IJPA 1G8AA 3MDYA 3ZMMA 2HY81 2FGIA 5KX8A 3NAXA 2IG7A 4NJ3A 4IZ7A 4I94A 2XNEA 3KCFA 3KRWA 4FVRA 3QKKA 3MPAA 4HNIA 3PE1A 4PL3A 4U5JA 2QR8A 4Z7HA 3H0YA 5C03A 1BL6A 4H3QA 4IM2A 4M0ZA 4PTGA 4QYFA 5J79A 3GFEA 4GT5A 3ZM9A 2CLQA 4BCPA 4PMPA 3FL4A 3AC2A 5BMSA 4JBOA 5TOZA 3L9NA 2G2IA 4IX6A 4JG7A 3O8UA 3VS1A 4FKVA 2OF4A 2QOQA 4AGWA 3CTQA 2WOTA 4MF1A 4DCEA 3U6JA 4GT3A 3RPYA 2QR7A 2JIIA 5FP5A 3TTIA 5A4LA 1OKYA 4LRJA 2EXMA 4AGCA 5CAOA 3O50A 2WMQA 3A60A 3MJ1A 3VUIA 2VZ6A 4Y8DA 4F0GA 2ZYBA 4LRKA 4N4SA 1A9UA 2GS6A 3QRKA 3ID6C 5AEPA 1BYGA 2OZAA 2QG7A 1I44A 3ZH8A 4F1OA 4DLJA 4HVHA 1UU9A 3BBWA 5IEVA 2BUJA 4FV5A 4L7SA 3FQSA 4AA0A 3QYWA 3CBLA 3Q9ZA 5LMKA 3A99A 4I24A 4BTKA 4M13A 1RW8A 1PXIA 5FP6A 4XHKB 4IAZA 1JKKA 2W9ZB 3H10A 3FC2A 4GCJA 4B4LA 3OXTA 3ANRA 4DF3A 5DR2A 2PL0A 3VS0A 4N6ZA 4DEEA 2XKDA 3RKBA 3UZPA 3WF7A 3KMMA 5HZNA 2W5BA 1H4LA 3G51A 4O1PA 1WMKA 3E3PA 3S4QA 2R3KA 3KC3A 4FK3A 2XKEA 3UMWA 2QOLA 2ZV7A 4R1VA 1O6YA 3PVWA 2JIUA 4A9TA 4NM5A 2I7QA 4HJOA 4OT5A 2PYWA 4FZDB 4OAUC 4XV2A 2WMRA 3FMLA 2CNVA 1JSTA 1PYXA 4A4OA 2X4FA 3QCSA 4BHNA 4ZEGA 3OHTA 2WMBA 3QZGA 4O0YA 3ZBFA 3JR1A 4DA5A 1BI7A 3H0ZA 3R28A 4ARKA 4D1XA 3D7TA 4I5HA 2JC6A 3CQWA 1PW2A 3MVHA 5AV1A 5HCYA 3QKLA 5C8KA 4KKHA 3F2RA 4GG5A 2XBAA 1G5SA 3FZSA 3KN6A 4I4EA 4MXZA 4GVJA 4YJQA 1H27A 3OWLA 4OTHA 4X6RA 3UTOA 3LAUA 4FL2A 2XBJA 5ACKA 2GNLA 5C9CA 1J7IA 4L6QA 4AE9A 4DG3E 2VTRA 5CSWA 4QRCA 2CKOA 4I3ZA 4AZVA 3OOGA 4FOBA 3CPCA 1UVRA 3R8LA 3VW8A 4BKJA 4BZDA 2BAQA 4R3PA 4C2VA 4S30A 5BVOA 3D14A 4O7WA 4CQEA 3LXNA 2FVDA 1BX6A 2QOBA 3U9CA 4DG2E 5KHXA 5FXQA 4AW1A 4J97A 3PA5A 3OY1A 4RPVA 5ANJA 4AGUA 5AX9A 2GU8A 3SG9A 4O1OA 3QCYA 3FDNA 2CPKE 3FYKX 3V5PA 3AC8A 5AP5A 4YJRA 3KXXA 3DJ5A 3HZTA 3JUHA 3A7JA 3D0EA 4CG9A 1IEPA 2WTWA 2DYLA 3LFBA 3UGCA 4RJ8A 3V04A 4DE4A 4ALVA 1ZYCA 2R3IA 5A6OA 2R0IA 4UEUA 1V0BA 1VR2A 4FEQA 4YBKA 3TN8A 5J87A 3KKVA 3OC1A 4XRLA 3LFDA 3LJ2A 4IH8A 4QP8A 1M14A 3UODA 2C1AA 3ORZA 5EKOA 2JKOA 3LIJA 3QWKA 4CEGA 4C59A 4FVPA 3DQWA 5DEYA 3HMIA 4YGAA 2B53A 3F9NA 4PPCA 5LQFA 5EFQA 5DR6A 4FSZA 3V8SA 4CCBA 4D2TA 3KN5A 2CGWA 3VS3A 2J2IB 2OJFE 4WUAA 4ZXTA 5HNBA 4HVDA 1T46A 2G2HA 4W8EA 3WZDA 5M56A 3D94A 4WBBB 4ZZMA 4RT7A 4IM3A 3KB7A 3OW3A 4TPTA 1Y6BA 4CFUA 3TV4A 4O22A 3UZTA 4ZMFA 4U40A 5AP0A 4FK6A 1KUTA 3WARA 3SD0A 3MTLA 2YISA 4GK4A 2CNQA 5AR8A 4D4YA 2GS2A 2HXLA 2OJIA 2GQGA 3EQCA 3PG1A 1URWA 1WZYA 3GQLA 3HLLA 4FT9A 3NR9A 3U8WA 1PXPA 1RQQA 4MXYA 5EYCA 3E62A 2ZM1A 4YC3A 2UW4A 3R7GA 4U42A 4XP0A 5AADA 2GFSA 4X21A 5AR2A 3QTXA 4BTMA 4YJUA 3CSVA 4O7TA 4AA5A 4M68A 4NM0A 5M4UA 2CKPA 3HL7A 3VUKA 4EZ5A 3VC4A 2HW7A 4CGAA 3IDPA 3BPRA 4EK3A 2GNIA 2XYNA 4UMRA 1E9HA 2XJ2A 2Z7LA 4AGDA 1A48A 4AOIA 4FIJA 1M2RA 2XK3A 3UIXA 4GV1A 4O6EA 2VTPA 2YM5A 5AUZA 4C61A 3W55A 5AV4A 2YM4A 5BYYA 4YJVA 4NIFA 2BDWA 3CIKA 4M12A 4OTIA 3TACA 5A3XA 5DMZA 1H28A 2ERKA 5JQ8A 4J53A 3NUUA 4CFVA 4F99A 3L8SA 3RI1A 4D2PA 4F08A 2OFVA 4EHZA 4JRVA 4MBIA 2GHLA 1R39A 2J0IA 4RFMA 5KNJA 4FT3A 4NT4A 3UQCA 3A8XA 1WVXA 5H3QA 3R63A 3ZLSA 4AW5A 4CTBA 4FV8A 4NFMA 2O8YA 3R1YA 4TYEA 4KS7A 3R22A 2J9MA 2HZ4A 2W1ZA 3D5UA 5HORA 1J7UA 2OIDA 5J5TA 5AP7A 2A4LA 2VWBA 5DHJA 3MI9A 4FNYA 4JBPA 4R5YA 3R7EA 2YLEA 3R7IA 3BELA 2YN8A 4N70A 4FTTA 1LP4A 2R4BA 4FSMA 3HEGA 4QTAA 2RG6A 4FTJA 2Z02A 4M69A 4P90A 4XYFA 2YHVA 4K8AA 5AR7A 2VO6A 3Q6UA 4FNWA 4IADA 2C3LA 3ZXZA 5EHLA 2C6TA 4IVAA 4PY1A 2HZ0A 1ZOGA 4RA5A 5EOBA 2PVYA 3WZEA 4XP2A 4YJTA 2WMAA 2VGOA 3NUNA 2X2LA 3KF4A 4ZLOA 3F66A 2FO0A 5CAVA 4JIAA 3ET7A 3E87A 4BF2A 3AT4A 4KUJA 4YLLA 1QMZA 3C1XA 1XR1A 3LM0A 4S33A 3FXZA 4AG8A 4P4CA 1ZMWA 4EUUA 1GZOA 3OOMA 4HW7A 2VN9A 4O7RA 1YKRA 4FG7A 3KRLA 2W06A 2V7AA 4R5SA 1KE5A 5AV3A 3W10A 3AMYA 4KWPA 3KA0A 4MQ1A 1JNKA 5H2UA 3RK5A 5LARA 3VQHA 1S9IA 1PXNA 2F57A 3ITZA 5J5SA 4RWKA 3DBEA 4UN0C 3LJ0A 2SRCA 3IW6A 5CU3A 4RX5A 4B99A 5BUEA 1SNUA 3MFUA 3OXZA 4FGBA 4ALWA 5KO1A 5DGZA 1JPAA 1XHAA 4OR5A 3PJCA 3EQBA 3QGWA 3OWJA 3GOKA 2PE1A 4LGHA 5GNKA 5H8GA 3PLSA 3PY3A 2OO8X 3UC4A 4AW2A 4II5A 3SAYA 4CXAA 4UX9A 5IQBA 4FIFA 4G16A 2CKEA 3GVUA 1FMKA 4XMOA 4EI4A 3WIGA 4Z16A 2XRWA 2J5EA 5GJDA 4ORKA 4IWOA 2GNJA 2CHLA 3QQLA 1YWRA 3GU4A 3DKOA 2W17A 3P7BA 3UYSA 1Y57A 1GIJA 3PXYA 4HPUE 4IAYA 2QONA 4DHFA 3GI3A 4GK3A 3Q9XA 4NM3A 3RZFA 2RFNA 3MIYA 3K5VA 4EH5A 3RM7A 3DBQA 2QKWB 4FNZA 5BNJA 3UC3A 3VS6A 4MWIA 2VWWA 2Y4PA 2XMYA 3IW7A 2B54A 3LXPA 4KSQA 3VULA 4EBVA 1U5RA 2W4KA 3GU8A 5HGIA 1W82A 3IONA 3FZOA 4D0WA 5AA8A 3VF9A 3ZONA 3VS2A 1ZYLA 4ZTQA 3KRRA 3T3VA 3NNXA 5M4FA 4IHPA 4LUDA 4RC2A 5A14A 4A07A 5JN2A 5ANKA 1Y91A 2X7FA 3GCSA 1KE7A 3LCKA 3V6SA 2O65A 4YMJA 3G33A 1SVEA 3BRBA 2WMVA 4IFGA 5KMJA 1RE8A 4NZWB 2XJ0A 2P55A 4ZSJA 4TL0A 2ACXA 3AXWA 3FL5A 3GP0A 4FKIA 4EHGA 5ANIA 3N4TA 3UIMA 4B6LA 1NVQA 4PDPA 5AM6A 2BIKB 5F20A 5DRDA 3E92A 3PG3A 5J9YA 4LV5A 5FTGA 3A7FA 2JLDA 3QALE 3UNJA 4EC9A 2BMCA 3CE3A 2WMWA 3FZTA 3QRTA 4CFMA 3VF8A 4C4HA 4I20A 4W4YA 2IVSA 4OBPA 1OECA 1SYKA 1OIRA 2YCFA 5HG7A 3V01A 3H3CA 4L44A 1REKA 4FMQA 3FKOA 1E1XA 3ZU7A 3WF6A 4IDVA 5CENA 2X39A 4DTKA 4J71A 4NU1A 4JX3A 4WA9A 4WRGA 5C01A 1MRVA 3FZ1A 4OTPA 4UBAA 4W8DA 5HO7A 1OMWA 3MY1A 5HLNA 5CT7A 3COKA 4MNEA 4Z7GA 4YTIA 4BTJA 4IMYA 4M3QA 4O7NA 1HCKA 4MNFA 2YEXA 3CC6A 3DZOA 3LFAA 5DFPA 5HVYA 5FRIA 4ANLA 3PA3A 4XJ0A 4BBFA 3ROCA 3NAYA 3HRFA 4QMOA 4EZ3A 4HYSA 4LM5A 4EBWA 4QQ5A 3OEFX 3T9IA 3HAVA 4H05A 4YPDA 4YO4A 2RIOA 3Q3BA 4L3PA 5G1XA 2F7EE 4RJ6A 4BI1A 4D9UA 2R3PA 3KMUA 3PVGA 2UW5A 5AIKA 5J9LA 5BYLA 2CKQA 5B2LA 2C5VA 3EQRA 2C68A 3FWQA 4FKQA 2OWBA 3IW4A 2C0OA 4NK9A 5L2IA 2BRBA 1Z5MA 5C8NA 5HICA 3R01A 5GINE 2XNGA 2J0MB 4FV3A 3U55A 1H07A 1ZYJA 2QQ7A 2W0JA 2ZAZA 5DI1A 2C6MA 5CAUA 2OZOA 4BDAA 2ZM3A 3UO4A 1UU8A 5HVJA 3SV0A 4G3EA 1CDKA 2ITXA 5HLWA 4FR4A 2IZRA 1MUOA 3QQKA 4FZ6A 4AT3A 3R7VA 3A2CA 1OKWA 5IA2A 4FG9A 2R7BA 2QO9A 3FLZA 3O96A 2BROA 4FV7A 4JBQA 4IC8A 4PDYA 4L00A 4I5MA 3COMA 2Q0NA 5BYZA 4C33A 4C35A 3BZ3A 4V04A 3RPRA 4EH8A 4JT3A 1GZKA 4BCJA 4AOJA 5E1EA 3KXHA 5EQYA 3K2LA 5KZ0A 2ZJWA 5IH5A 4A9RA 2DS1A 3NW6A 4MVFA 5HO8A 3TTJA 3BHUA 3R71A 4O96A 4FSRA 3F5UA 3ZHPC 2R9SA 4WNOA 3TKHA 3DXNA 4K6ZA 4ASEA 4ZTLA 3HVCA 4WNKA 4IACA 4E1ZA 2JDRA 3TXOA 3U4WA 4AQCA 5EHOA 3UVRA 5CEIA 2HZIA 3NZ0A 2QCSA 2C6LA 2EUFB 4K9YA 4TWNA 5AM7A 5EKNA 1WBTA 3PVUA 4W9XA 4IIRA 3KXMA 5KBQA 3AMAA 1H1PA 3TUDA 1ZAOA 3M2WA 4CT1A 3BGZA 4DGGA 5A4CA 3B2WA 1ZWSA 3UO6A 4TNBA 3DNEA 3E7OA 1DAYA 3HMOA 5KMOA 4MXAA 1O6LA 4ANNA 4RZWA 4IWPA 4BDDA 5AUVA 5KCVA 4GEOA 2LAVA 4H1MA 1P4OA 2OXXA 2Y9QA 3Q4ZA 2W1IA 4AU8A 4B7TA 2BHEA 3AGLA 4XG2A 4YO6A 3DKGA 4NL0A 2BR1A 2J6MA 5HVKA 3EN5A 1ERKA 3TI1A 3WE8A 5GIPE 2F7XE 3UVQA 2VWXA 3NS9A 4RSSA 2JBOA 4JX7A 5D9HA 1F5QA 4AN2A 2FSTX 4Q5HA 1OUYA 3PJ1A 4WG3A 5A46A 4C37A 1REJA 4MH7A 5D12A 1JSUA 3QQGA 4FSWA 2VO0A 3NWWA 1LPUA 4UZDA 3RPVA 3O71A 5IA4A 2Y8OA 3NUPA 4L52A 4RVTA 3H30A 2BZKB 4GIHA 1Q62A 2RFSA 5K0KA 4QMNA 4F6WA 4KRCA 4YZBA 3JYAA 1H1WA 1K9AA 1VYZA 2KTYA 2I6LA 1ZY5A 3EN7A 4YTCA 3DK7A 4JQ7A 3PA4A 1PMVA 3FPQA 4E73A 4WG4A 2PVKA 5E8VA 5BVKA 2HWOA 2XIZA 3PPKA 3R2YA 3RZBA 4QMSA 3UIBA 3V5LA 4DITA 3MIAA 3ZZEA 4AN3A 3DDPA 4BIEA 3MYGA 2X8EA 3FQEA 4RA4A 3TV7A 3NCZA 3ZEPA 4M66A 4IAFA 3EL8A 4CLJA 5AR3A 2UZEA 2P2IA 4UMPA 5C4LA 5D10A 2O2UA 2YACA 3BX5A 4DH7A 2ZV8A 2XF0A 4X3FB 2JAVA 3LCTA 4B8MA 4W4XA 5I5ZA 2PE2A 1ZZLA 3LW0A 4CMTA 4FNXA 4QMWA 1APME 3DCVA 5HOAA 3DV3A 3M42A 3P08A 4ITJA 4QMPA 2WQBA 1OIUA 4ANQA 2YM6A 2YDKA 3FUPA 4GJ3A 4FTQA 3F88A 4YZDA 4F7SA 3A4OX 4NEUA 2I1MA 5CXHA 4U79A 4XOZA 4GUEA 2XS0A 3DBCA 4LRMA 1CTPE 4R7BA 2BZIB 3E8DA 4ANMA 1GZ8A 5EW9A 4IBMA 3LVPA 2RSVA 3KXNA 3EFWA 3E8NA 2I0YA 2XVDA 2WMTA 1W84A 4HVGA 1TVOA 3QXOA 4LUEA 4Z3VA 4FEWA 5ANDA 2ITZA 5JFVA 2A1AB 1DS5A 2IJMA 3Q2MA 2R64A 2UV2A 2YDIA 5EQPA 2ITVA 3FLYA 3RBWA 4MYGA 1XQZA 4Y73A 3RPSA 3FAAA 4ZZNA 3DBFA 1DM2A 1ZARA 5EI6A 5HIBA 3NCGA 2E2BA 1BUHA 1P5EA 3R9HA 3UNKA 4DH1A 4PP9A 3NW5A 5CZIA 5AUYA 3MBLA 5AJQA 5E4HA 4XP3A 4DEHA 1O6KA 2A0CX 1DAWA 4KINA 4N0SA 1M7NA 5K4IA 5J1WA 3VW6A 2UZWE 4IM0A 2OBJA 4QMYA 2WHBA 4I21A 2PZRA 2W4OA 3R00A 1W0XC 4IXPA 4QP7A 3R8VA 2QOCA 1Q4LA 2YIQA 3KULB 3QTQA 5BVNA 3TNHA 5IISA 1XH7A 3TZ8A 4OTFA 4QQTA 1YXTA 3WILA 4FV4A 3ZRMA 3WYYA 5I9ZA 1IA9A 3TEIA 4O2ZA 2WQNA 4EH7A 5JSMA 4EOJA 2FB8A 3P4KA 3I5ZA 4RLKA 4QYGA 4PMMA 5AWMA 1FINA 3CJFA 2BFYA 5CWZA 4ITHA 4RIYA 3K3JA 3WF9A 3OXIA 3I6WA 3FEGA 5LXMA 3FSKA 3GFWA 2GHGA 3QAME 2QKRA 5L8KA 1YOMA 3QHRA 4I5PA 1S9JA 3D15A 4DT8A 2YIRA 3OMVA 3OW4A 3H9FA 4C4GA 5EDQA 3P86A 1NT2A 1GIHA 3ALOA 4O38A 2OH0E 2ERZE 3EH9A 4IEBA 2AYPA 2B55A 3OCGA 2YDJA 3RAWA 1JKTA 3ZOSA 3BHVA 3BLQA 3CJGA 3D4QA 3F2NA 3NLBA 4XG4A 2R3NA 4V0GB 2GHMA 2WIPA 5AUWA 5I9WA 3MY0A 4J95A 4G34A 4BZNA 3W32A 4IAIA 3EJ1A 4TWPA 3HV7A 2ONLC 1YDRE 3W2SA 5L6OA 5LWNA 4WRSA 4F1TA 4BRXA 3QUDA 3GU7A 3JVSA 3SG8A 4WNPA 5KUPA 4HGSA 2WAJA 1LEWA 4IX5A 4KBCA 4MXOA 3IS5A 3GU6A 3KU2A 4JVGA 5DT0A 4AXAA 4CCUA 4EJ7A 5IPJA 3C7QA 3CGOA 5JZJA 4APPA 2UZDA 3F3ZA 5B7VA 1YI3A 2NP8A 5GZAA 4RIWB 3ETAA 4ANBA 4C8BA 1O9UA 3R7UA 2ESMA 3BHYA 3FHRA 3SXRA 4F6SA 2Z2WA 3DNDA 3A7HA 1OL1A 2PVHA 4K0YA 3U6HA 5J95A 5IQGA 1QPCA 4DFNA 3IGGA 4RQKA 2QLQA 2VWZA 5FEEA 3QTUA 4EOPA 3D83A 2ZMDA 4I6QA 4UV0A 3NPCA 5K3YA 3R8PA 2PZYA 4M15A 4YUQA 3ENMA 4UMUA 1VZOA 4FE2A 4O84A 2F4JA 3R30A 4M14A 3ULZA 5M09A 1Q8YA 3Q9YA 3PWDA 3DAEA 4XG3A 5JRSA 3TT0A 4E5WA 3R1NA 3A61A 1FGIA 3QXPA 3UO5A 5JT2A 1OB3A 1UNGA 3FXWA 4ZP5A 2ITTA 3KRJA 2BRGA 1LEZA 2PVJA 2VTLA 3HYHA 3FY2A 3FMHA 4LG4A 5HU9A 3L9PA 3KGAA 5CQUA 3RP9A 5AX3A 4D2SA 4DEAA 5I9YA 5JH6A 5JRQA 3K5UA 3HUBA 2Y6MA 3ORIA 3I6UA 4S32A 2JFLA 2YITA 5IMEA 4IX4A 5FTOA 3OCBA 2CMWA 2RGPA 4MTAA 4IANA 3E63A 4O0WA 3E7VA 5EHYA 2UZBA 4Y46A 1VJYA 4L45A 4BDEA 3QL8A 3CEKA 4IB0A 4O7ZA 3UNZA 4C36A 3QQUA 2VTOA 4J8MA 3EQIA 1YHSA 3ORMA 3LCSA 2Y7JA 3P7CA 3FMNA 3FKNA 3OZ6A 3LCOA 2XNOA 3LQ3A 3RWPA 5AA9A 3R9NA 4PP7A 3VN9A 4DGNA 2BDFA 1Y8GA 2C6OA 2YERA 3C9WA 4FKSA 1Q8TA 4DH8A 3IECA 1JQHA 2YCQA 4JOAA 4RMZA 4MQ2A 4FYOA 4AZSA 3QQFA 3I79A 3E5AA 3EKNA 5HE3A 3T3UA 2PWLA 3U51A 4QMQA 4XOYA 4BZOA 2C6DA 2AC5A 1L3RE 3CQEA 4NW6A 2B52A 5CYIA 4NTSA 4F7LA 4U7ZA 3LM5A 5KHWA 1KOAA 3NVMB 1AQ1A 3BCEA 4ZJVA 4BYJA 3LCDA 1YXSA 1Z57A 1BLXA 5M07A 2I0VA 4NTTA 4ZTNA 5IDNA 5E1SA 5E90A 2BRHA 4CRSA 1KOBA 3HRCA 1YXXA 3EHAA 4U97A 3U9NA 3HV5A 4LL5A 4EH2A 5H8BA 4GKHA 3I7BA 4X2NA 2H96A 4GH2A 1PRYA 4FTMA 5A6NA 3C0GA 3O2MA 5ANEA 4KIOA 4HGLA 4YJNA 2QU6A 1SNXA 5LMBA 3AT3A 4XEYA 2WZJA 2IN6A 4G9RA 3PIXA 4RIXB 4PL4A 2XNBA 2WEVA 4LMNA 5LVOA 4BFMA 2A19B 4HGEA 2CNUA 2X6DA 2ZMCA 3GU5A 4JRNA 1QPJA 2PUUA 2UVZA 3I5NA 3S1HA 2BKKA 1ZLTA 3U6IA 3PPJA 3WOWA 4X3FC 4DGMA 2W5HA 5E91A 2CGVA 4XV9A 4QMXA 2EXEA 1WBSA 2W96B 4R8QA 3RPOA 3CTJA 1U54B 3DJ6A 4LI5A 5DIAA 4AT4A 3IQ7A 4MXXA 4BDBA 3LQ8A 5IU2A 3ANQA 3MH2A 5HE0A 2REIA 3ZC6A 3P0MA 1YWNA 2X1NA 3OTUA 3OG7A 4BCGA 1ZRZA 2G1TA 2AC3A 4CZUA 2CN8A 3FMKA 3LXLA 2X7GA 3W8LA 1HOWA 2VUWA 4D1ZA 3GNIB 2XK9A 4C3FA 5J9ZA 3HAMA 2YCRA 1XWSA 4U44A 3V8WA 2CLXA 4O2PA 3CY2A 2UW6A 2PMOX 3EYHA 3SOAA 5A9UA 4XLVA 2C69A 3OCSA 2YAAA 3Q96A 3JPVA 4FTCA 3OFMA 5M57A 4X3FA 3IK3A 4YNEA 1XBCA 3AD5A 3TV6A 2J4ZA 2X81A 4F9YA 3I81A 5C8MA 3R8ZA 5LJJA 2ITPA 3O8TA 3MS9A 1FQ1B 4CFNA 4CSVA 2H34A 2R3HA 2IO6A 4PL5A 1Z9XA 2BALA 4I93A 4QTBA 3PRFA 2QVSE 2UZVA 3DTWA 2P2HA 2QI8A 2PUPA 2W4JA 4FTIA 4H1JA 5DT4A 1RJBA 2WQOA 1BL7A 2WQMA 1M7QA 1YI4A 2R3QA 5DN3A 2XKFA 2VTMA 4EONA 3BLRA 2VRXA 2C3IB 4H58A 4RFYA 2ETMA 3U87A 2CN5A 1PMEA 3QD3A 4UMQA 3SHEA 4S34A 5IF1A 4ZSGA 4EOSA 5HKMA 3WIKA 2NNWB 3CCNA 3QZIA 4L42A 4HNFA 2DUVA 5HG9A 3ORTA 3RWQA 1SMHA 2EXCX 5CF5A 1K3AA 3MVJA 4PMTA 4WO5A 3BWFA 3TNWA 4EQUA 5JGBA 5JFSA 4FSYA 2XK4A 1OPKA 1Q61A 4FVQA 3D2KA 5EI8A 1JKSA 4F4PA 4LOPA 5M06A 2HCKA 4MD9E 2C0IA 1IRKA 4AACA 4DYMA 4E6QA 4F6UA 2QO7A 3R8MA 2XK7A 4IB3A 4JS8A 4YHTA 4ID7A 4M0YA 3TZ7A 5J7BA 4ANSA 4BWXA 4BKYA 2IVVA 5KMKA 3ZFMA 3C4XA 3AT2A 3TWJA 3MW1A 3CS9A 3QWJA 2EWAA 3HECA 4A4XA 1M2PA 5ITAA 2ZOQA 3F5XA 4QMVA 4NWMA 5DWRA 1IASA 2GSFA 3CKWA 3AMBA 5E8SA 3QU0A 2V0DA 4KA3A 2CGUA 3F69A 4YBJA 3W16A 4EOQA 3QRIA 4M7IA 1YHWA 2IW8A 2NPQA 2X7OA 1WBVA 5EK7A 3KULA 4KKEA 2UUEA 4JQ8A 5CSXA 3E88A 5ETFA 4HCTA 2B1PA 4QO9A 4BGHA 5HTBA 5AAEA 3D5VA 4YJSA 2PK9A 4ZSLA 1PXLA 2W05A 3BIZA 4X2KA 3TKIA 2XEZA 1PF8A 2W1DA 3ZM4A 4JNWA 4F65A 1KE9A 3ALNA 4WNMA 5HG5A 1R0PA 4OLIA 4WSYA 4CTCA 4L43A 2W1HA 4S2ZA 4B9DA 2C5OA 3KMWA 3HV3A 4FKJA 3Q4TA 2YFXA 4ZAUA 4FKOA 4C4JA 3SXSA 4PWNA 3UQFA 3AG9A 2QU5A 3IO7A 3F6XA 4GFGA 1CKIA 4Y95A 4C58A 2W99B 4PRJA 3EN6A 5LCKA 3LMHA 4KIKB 4BBMA 3EKKA 2WTVA 3HGKA 4GRBA 4O7SA 3NNUA 1YOJA 4G3GA 4IX3A 1YOLA 2IZSA 2XEYA 3PY0A 3ZFYA 5CAQA 2H6DA 4J8NA 5L3AA 1IG1A 2FSOX 4QMUA 5FM2A 4CYJA 4EHVA 3NUYA 2HENA 3GUBA 4N57A 3DFAA 4ZS4A 2PUIA 3BV3A 3QRUA 4IVCA 3VAPA 2X6EA 4V0GA 3FV8A 3W2RA 2NO3A 2BRMA 1PXMA 4QQCA 4ZMEA 4U6RA 4DFZE 4FTAA 5EW8A 4KB8A 1NA7A 5FM3A 5HX8A 4TN6A 3G0EA 3JY9A 5KMLA 4DTAA 4HOKA 4XV1A 4DEBA 3S3IA 4E26A 4FKWA 2YA9A 3BQRA 3GEQA 3IG7A 3DK3A 2O3PA 3IW5A 5AV0A 4FV6A 4M8TA 5IH4A 4XG9A 5L2WA 4FA2A 4DBXA 1V0PA 2XM8A 4JG6A 4RIWA 4WUNA 4E4MA 4HYIA 4USDA 4ZLZA 4ACGA 3PRIA 2HELA 4TWCA 2V55A 3H9RA 3TNIA 3WBLA 2PSQA 3IDCA 4Q9ZA 5C26A 4QP1A 5HNIX 5HTCA 3DY7A 3DB6A 3CTHA 4G3DA 4HPTE 4D58A 4Y85A 4YHFA 1X8BA 4JQEA 2YAKA 5BVDA 2QODA 2ETKA 3NW7A 3O0GA 2ITYA 4EK8A 3W2QA 1MRYA 3PXQA 2F49A 3GGFA 3QUEA 4O0RA 5GZ8A 5JKGA 2BFXA 2ZDUA 1PJKA 4USFA 3PXFA 1NVRA 4BCIA 3BU5A 1FPUA 1H0WA 3GXLA 3ENHA 5C1QB 4CFFA 2WOUA 4I23A 2YJRA 2PMLX 4DT9A 3RNIA 5FWKK 4A7CA 3AC3A 3N9XA 4CMOA 5GHVA 2R0UA 1W98A 2W1FA 4EK5A 3GQIA 2P0CA 2QOKA 3V5QA 4CNHA 2V22A 3NX8A 2V62A 3F5PA 2ZB0A 4E20A 3PZEA 4EKKA 4CLIA 4ZY5A 5IH6A 3BHHA 5E8ZA 1GIIA 5LOHA 4MX9A 2X2MA 2X9FA 3VRYA 3IW8A 2VNWA 2G9XA 3RAKA 3VHEA 4ZJIA 2ITOA 4FEXA 1XBBA 4E3CA 1F3MC 3O7LB 3FLWA 1FBNA 4MD8E 4ZSAA 5AFVA 5C4KA 1IAHA 4IW0A 4GJ2A 3GCVA 2RKUA 3PXZA 3VBVA 2GQSA 2WTDA 3HDMA 5CEMA 3QLFA 3SX9A 5M55A 5F1ZA 3VS7A 2P4IA 4M67A 4EH6A 2ETRA 3MB6A 2BILB 2WPAA 1W8CA 3QZHA 4L53A 2C6KA 4QTDA 4CD0A 4CKIA 2WNTA 2O64A 3ZUVA 4BDGA 4DEGA 4IVBA 4HCUA 2GDOA 4FX3A 4PUZA 4PPAA 4FGRA 3FPMA 4WG5A 4QMMA 2W1EA 1GZNA 5LWMA 1PYEA 1CKPA 1H1RA 2RF9A 3HX4A 5L2SA 3Q4UA 3RAHA 2XIYA 2ZM4A 5LMAA 2OFUA 2Z7SA 5HE2A 3S2PA 1ZMUA 3VBXA 1GJOA 3RTPA 3VBQA 2CSNA 5CU6A 3QD4A 3W2PA 4TXCA 4UMTA 4AE6A 3OTVA 1AGWA 3C4ZA 3O7LD 1I09A 4L3JA 4UXLA 5FDPA 2QNJA 3ELJA 5CU2A 3LLTA 3O23A 5GJGA 5HCZA 1WVWA 2Z60A 1UV5A 1TQPA 4QOXA 4RVMA 1SZMA 4HZRA 4BWPA 3TIZA 2VWYA 2YJSA 4NUSA 4OTQA 5M4IA 2YIYA 1XJDA 1GNGA 2ITWA 3QTSA 4YNOA 5D7AA 4DBNA 2B9JA 3UG1A 3FXXA 3RM6A 2B7AA 2CCHA 2J50A 3HKOA 3QC9A 3OCTA 4DFUA 3G90X 4X2FA 1PKGA 1PXJA 3CR0A 4IB5A 3LKMA 1H0VA 3N4VA 3P78A 3TNPC 2R3GA 1V1KA 2FH9A 1UKHA 3RHKA 3SRVB 4BIDA 4XRJA 5HEZA 4KKGA 4UWBA 3G15A 4KRDA 2PVFA 3MJ2A 4M97A 4TTHB 4L3LA 4FF8A 4DN5A 4JG8A 5CS6A 4TYGA 1T45A 3P7AA 4XG8A 3NRMA 4CG8A 2VV9A 1KV1A 5EYKA 2B9FA 5FEQA 2HIWA 3RGFA 3FI8A 3PP0A 4QP9A 3BE9A 5AP3A 5IUIA 3D7TB 5I9UA 1FVTA 4EOMA 4O0VA 2WB8A 2ZDTA 5CVGA 3UJGA 2C6IA 3AD6A 4QP2A 4TWOA 4IZAA 3DLZA 3O51A 3R21A 4E6DA 4JBVA 3AD4A 4FG8A 4FIEA 3OT8A 5CEOA 3UG2A 5CSPA 4ACDA 3PP1A 4UYAA 3LFSA 4FKLA 2J51A 1DI8A 5ICPA 1U54A 2C5YA 3W8QA 1WAKA 4DEIA 4FV1A 5D11A 1WFCA 4BB4A 4C0TA 5IA1A 4FZAB 2BVAA 3OWKA 5IA0A 4IC7A 3VNTA 3M1SA 3IGOA 4HGTA 2GS7A 4MF0A 3AC1A 3EFLA 5ACBC 1Q8UA 3NNWA 3IPHA 2IZUA 2XA4A 1JWHA 4ACCA 4QP3A 4ZTRA 3PPZA 3SOCA 2EB2A 1U5QA 1WBWA 5D7VA 4UWYA 4O21A 4D4VA 4RVKA 4DGOA 1DI9A 1OM1A 4KIQA 5IQIA 3COIA 4MBLA 4JI9A 3UP7A 3MTFA 4J98A 3VHKA 1OL7A 4E4LA 2PY3A 2YCSA 4LOOA 4X6QC 2W1CA 3R7YA 3TUBA 2JDSA 3UOJA 4KAOA 3F5GA 4IWQA 4QD6A 4YZNA 4F7NA 5K0XA 2XUUA 3ACJA 3G9NA 4AFEA 3DBDA 3SW4A 5KE0A 3FBVA 5DLSA 3SW7A 1ATPE 2OXDA 4FUYA 5HNGA 3V5JA 5CAPA 2VWVA 3ZRKA 1MQBA 5FTQA 3GC9A 4O0XA 2W5AA 3LZBA 4ZTMA 2OKRA 3QYZA 3ZRLA 5JZNA 5E8TA 2BTRA 3DLSA 3LOKA 3QTWA 5K9IA 3C51A 3DT1A 4U41A 4W4VA 2C0TA 4O6LA 2W9FB 2HOGA 2ITQA 2J0KA 3Q5ZA 4Y83A 4W4WA 3VBTA 4EKLA 4AX8A 5E8YA 3NYOA 2WMUA 3HV6A 4IZ5A 3ZDUA 2VTTA 3K54A 4C2WA 4MAOA 4NM7A 3COHA 1ZMVA 5BVFA 4FODA 1IA8A 3PZHA 2XJ1A 3MVMA 3HMMA 3BYSA 5AAFA 3W2OA 2OLCA 2J0LA 3C4EA 5E8WA 3ZLYA 3VUMA 4CVAA 3W18A 3PSDA 3JXWA 3KCKA 2JDVA 5AP6A 2G2FA 3HP2A 1URCA 1B39A 4I6HA 4I0TA 3MA3A 1ZY4A 2OSCA 4XLIA 4F63A 4MHAA 4QMZA 2XNMA 1PXOA 5L8JA 1QPEA 3LFNA 2PULA 2Z7QA 1OKZA 5KMNA 3R7OA 4E5BA 2BAKA 3EOCA 4IVDA 4LGGA 4B8LA 3D2IA 3Q53A 4RQVA 3AC4A 5EM6A 5I4NA 4AS0A 3RINA 3R9DA 3EFKA 4HZSA 4JJRA 4DH3A 3BV2A 4QPAA 2IW9A 2QO2A 2UW8A 5L4QA 3GC7A 4AFJA 5D1JA 2F9GA 4XG6A 3FMDA 2YM3A 3FYJX 1E1VA 5IUGA 1NY3A 5I0BA 4NIFB 5A4QA 4OGRA 4TZRA 1GY3A 4PTEA 4Z9LA 3RK7A 1H25A 2WELA 2LGCA 4A9SA 2Y4IB 4XH6A 1J1BA 2C5NA 2R3RA 4D1SA 4DFLA 3QA0A 4OTRA 3LFQA 3QTRA 4MD7E 5L8LA 4MKCA 2BKZA 2CDZA 3R9OA 1K2PA 1XH4A 4FYNA 1YDTE 3TJDA 4L68A 2UW0A 3FSFA 3NMUF 1PMUA 3D5XA 2BHHA 5IQCA 3UMXA 4ASZA 3VVHA 4XV3A 2QD9A 3KK9A 4YLJA 3V51A 3REPA 2I0HA 2O63A 3KXGA 5EI2A 3QQHA 3QFVA 5CU0A 3DKFA 3RMFA 4RRVA 4EOOA 4KABA 4U45A 4Q9SA 2JFMA 1J91A 2J90A 4E6AA 5CZHA 4RZVA 3ULIA 2VWIA 4BC6A 3LFEA 1Q3DA 3EQDA 4GW8A 4A06A 3OY3A 3TCPA 4O7VA 2VTIA 4YSJA 4D4SA 2OJGA 2VTNA 3PSCA 4C38A 2OGVA 4BDCA 4HYUA 2JIVA 2XM9A 2YABA 3P5KA 1OUKA 4G5JA 3D5WA 3GBZA 4R78A 4APCA 2WTJA 3QD0A 5HBJA 3R9RA 3FE3A 4BDKA 1CKJA 2GTNA 5DEWA 1PXKA 4ZS0A 3DAJA 2JDTA 4QPMA 4BTFA 4DH5A 1H00A 3TZ9A 5CEPA 3T8OA 4LQMA 3T9TA 4KNBA 2XCKA 3GC0A 3DA6A 3LE6A 3C13A 5HO6A 5A4EA 5M53A 3D9VA 5CY3A 3LFCA 3ZXTA 5LVNA 2VWUA 3KREA 2JBPA 4KBAA 5M51A 4TW9A 4UXQA 3M11A 3W1FA 4AWIA 2YZAA 4CYIA 5F94A 4EZ7A 5JK3A 3JVRA 2F7ZE 3R2BA 3Q5IA 5ANGA 3UPZA 1PKDA 3LJ1A 3G6HA 2HZNA 4AUAA 5HHWA 3ORNA 2XP2A 3AOXA 1ZZ2A 4NKSA 2JDOA 5B0XA 4EK6A 1YQJA 4QMTA 5HE1A 4DCAA 3UZRA 5T6KA 1ZYDA 2XZSA 3I0OA 3EN4A 5HIDA 4F0FA 1CSNA 4F09A 1RDQE 3NIZA 1H08A 4YLKA 1WBNA 1ZOEA 2EU9A 4CV8A 4EORA 2CCIA 4EL9A 4LL0A 5DRBA 5KMMA 1H24A 4AF3A 5FEDA 1OL5A 2YM7A 5E7RA 1KV2A 3MVLA 4C57A 4FV9A 3ZYAA 1WCCA 4FV2A 4F7JA 5KKRB 5LCJA 5IQHA 5DR9A 4FKGA 4AZTA 3P9JA 4ZY6A 3TZMA 4FTKA 5LMKC 3VS4A 4EHEA 2FSMX 4FTUA 4C4IA 3ZS5A 1WVYA 4RWJA 4F9BA 5G6VA 3QCQA 5I9XA 2V5QA 3DXPA 3ZBXA 2PZIA 4K11A 3Q4CA 4EWHA 1UWHA 3AQVA 3ROYA 3BI6A 3FKLA 3MH1A 2QOHA 4V01A 2E9VA 5CVFA 4D2RA 1UA2A 4RVLA 5EM8A 5JQ5A 4JR3A 2YLFA 5IA3A 3KXZA 3Q52A 3ACKA 4FKRA 3R1QA 4I6BA 2ONLA 2HK5A 1H1QA 2JEDA 4LGDA 3DXQA 4RJ3A 5E8UA 1FMOE 1VYWA 1CMKE 2C6EA 4JAJA 4G17A 4P5QA 4PTCA 4F64A 4GU6A 5M44A 4U9AA 3Q32A 2FYSA 1XBAA 4TNDA 4EH9A 4IFCA 3DKCA 2PVLA 5BPYA 5A54A
chains in the Genus database with same CATH superfamily
2WTIA 1OBGA 4D55A 2BPMA 1U46A 2BRNA 4RX8A 4TYJA 5IG1A 3VBWA 5AR5A 2FSLX 3GC8A 2GPHA 2F2UA 4BI2A 2UZLA 5EW3A 5IQEA 1QCFA 3G5DA 4QP4A 3UIUA 3EQHA 4I41A 3OD6X 1OIQA 4GG7A 1JVPP 4R7IA 2JKKA 4MK0A 3G2FA 4EYJA 3HDNA 3W33A 3NYXA 1VEBA 1UKIA 3F3TA 4RWLA 4WBOA 5TT7A 1ST0A 3R8UA 3EQPA 5FQDC 4FSNA 3F61A 5BUJA 4I1ZA 2BZHB 3NUSA 4L7FA 4OW8A 4ZY4A 5FUTA 3AKLA 3QLGA 2C30A 4O4EA 5IA5A 3ZLWA 4FT0A 3BU6A 3SRVA 5CASA 2JD5A 4GVAA 4E4NA 3II5A 3QUPA 4RX9A 5ANOA 4AAYA 3LQ5A 5EYDA 4GT4A 3IKAA 4YURA 4EH3A 4RIOA 5AUUA 4X2JA 3BYOA 4FKPA 3CD8A 5AR4A 4TRLA 1KE8A 3SKCA 1B38A 5DYJA 4MNEB 1XH9A 5HI2A 3I60A 4AOTA 4CRLA 3PTGA 2WEIA 3O8PA 5TR6A 2XAMA 4Y5QA 3PXRA 3RCJA 4AP7A 3PFQA 4AXDA 4GFOA 3DTCA 3VWAA 4GS6A 2C3KA 3NYNA 3C0IA 3V3VA 2JKMA 4C7TA 5CEKA 4Y5HA 2DWBA 4DDGA 4TYIA 2E9UA 4AZWA 4JL9A 5JGAA 2PZ5A 2XNPA 3S00A 3V5WA 1KWPA 5IEXA 4L46A 4KD1A 4GFMA 4AA4A 4CT2A 2ZV2A 3TDWA 1SM2A 2R3FA 4FT7A 1ZYSA 2XRUA 3KY2A 2P3GX 5K5NA 2PVRA 4F70A 4JDJA 3VUDA 5KBRA 2QOFA 5HD4A 5DBXA 1A06A 1EH4A 1JKLA 4ASDA 4D0XA 1STCE 1FVVA 2VNYA 4XBUA 3QX4A 5EG3A 4AAAA 5DOSA 3MPTA 4O83A 4G6LA 1YI6A 3OS3A 4A9YA 4C4FA 1YW2A 4GL9A 2JAMA 4GSBA 4ZK5A 5DVRA 3PJ2A 4CKRA 4MXCA 5BVEA 2VO7A 4WHZA 4HVIA 3D7ZA 4G6OA 4XX9A 4C3RA 5CF8A 3EQGA 2VO3A 4IWDA 4QMLA 3FC1X 4JR7A 3QTZA 2XK6A 2C1BA 5AMNA 3UBDA 4C34A 4EUTA 1YXUA 2WIHA 4NH1A 4AXCA 4EK4A 4ZSEA 2A27A 3CKXA 4FIIA 3Q60A 2DQ7X 3KVXA 2UW3A 2WTKB 1ZXEA 3BQCA 4RC4A 5LVLA 1OITA 3CLYA 2W1GA 2RFDA 3ZO1A 4E5AX 3BEAA 2E9NA 4OTDA 4FSQA 3A7GA 3PDTA 4O27B 3S95A 1ST4A 5IUHA 3C5UA 4PPBA 3PIYA 3OWPA 2XANA 4J96A 1MQ4A 4QPSA 3PXKA 2JITA 5IKWA 1W83A 2PTKA 4CFWA 3BYVA 3JS2A 4BCOA 2Y4IC 4BKZA 3AKKA 3DU8A 4OBOA 4HYHA 4DAWA 4ERKA 4AQKA 4K33A 3FZPA 5JFXA 3CXWA 2J7TA 4RBLA 4IAAA 3QX2A 5DA3A 4G3CA 1UU3A 4FI1A 4QNYA 5CXZA 1Y6AA 3ATSA 3I4BA 5IQFA 2B9IA 5HBEA 4AZEA 1ND4A 2X8DA 2YWPA 3FZRA 3LXKA 2VX1A 5JEBA 4IDTA 1W7HA 4MBJA 5FD2A 1R0EA 3GCPA 3E3BX 4YP8A 3TYKA 3VS5A 2BAJA 4G31A 4PV0A 4F0IA 3FMEA 3P79A 4BCKA 1JSVA 4TKSA 3TL8A 4AZFA 4OT6A 4L01A 3UVPA 3RALA 3HA8A 4BICA 4RJ4A 4Q2AA 2VD5A 4X2GA 3L1SA 5FXRA 3FLQA 2PVMA 3WI6A 5IEYA 4QTCA 1FGKA 4EQCA 1YDSE 4YHJA 2BCJA 5B2MA 4ZTHA 2GCDA 4KIPA 3FQHA 3BWJA 5CLPA 3WZKA 3WF8A 1FOTA 3SC1A 5BVWA 2AEGA 5ETCA 2O0UA 2WGJA 4DGLC 3ODYX 4P5ZA 5T68A 3RK9A 3FI3A 5F4NA 2QURA 2QOOA 3A8WA 3KL8A 5FBOA 4BL1A 4GUBA 4DC2A 3HNGA 4QNAA 5DH3A 2OH4A 4UWCA 4X0MA 3F3WA 5K4JA 3ZSIA 4XBRA 2BIYA 3OVVA 1NW1A 1Q8WA 3TDVA 3H4JA 5CU4A 3E93A 5J7HA 1AD5A 5CX9A 3TNQB 3FLNC 2EVAA 5EH0A 3ZCLA 4FV0A 1JAMA 1J7LA 3ZZWA 2QG5A 2VX0A 1BKXA 3F2AA 4K2RA 4BHZA 3IDBA 5EM7A 2HYYA 4BCHA 4WT6A 3LMIA 2XK8A 3B8RA 1H26A 5GZ9A 3SGCA 4LMUA 4CMUA 2ZV9A 4H36A 4U3YA 3WYXA 4O82A 4R77A 4DEDA 4FIHA 4PNIA 3ZUTA 3ERKA 5FDXA 2X4ZA 3R73A 5KKRC 5LVMA 3S0OA 3GB2A 4I0RA 2Y0AA 3BKBA 4GYIA 3FI2A 3R04A 3ORPA 4PDOA 4BCQA 3G0FA 5L6WL 3DZQA 3W2CA 3KK8A 2G15A 2BTSA 5L2TA 1U59A 2R3OA 4EH4A 4A9UA 1WBPA 3PSBA 3RHXA 4M84A 4A4LA 5CF4A 2WMSA 2IZTA 3UE4A 2X9EA 3ZC5A 4J7BA 3QZFA 5CNNA 2GMXA 5DPVA 2PMNX 2WQEA 1G8SA 4FZFB 5HD7A 1Q3WA 5CSHA 5AUXA 4BDIA 4D2VA 5M08A 4H3PA 4ZTSA 4O7YA 2RL5A 3CP9A 4R6VA 4EYMA 4X7QA 4FRFA 4F9CA 3TKUA 2GNHA 3PUPA 5L2QA 4O7LA 3EB0A 5I9VA 4G1WA 4JIKA 4TYHB 2VTSA 1OIYA 1U4DA 1XO2B 2HAKA 1J3HA 2VTHA 1TQIA 3QD2B 4UALA 4XUFA 3C4WA 5EYMA 3TUCA 3R6XA 5DG5A 3OBGA 1PHKA 3A7IA 5CSVA 3GCQA 3F7WA 4YTHA 5GIOE 4C3PA 3R02A 3NVKI 3ZFXA 2GFCA 3PVBA 3UQGA 3BE2A 4FSTA 2HWPA 1H8FA 3NEWA 1LR4A 2OW3A 3PY1A 3QHWA 3ZEWA 4GIIA 5H9BA 3WZJA 1KE6A 5EQEA 5DE2A 3PIZA 3QC4A 1UU7A 2VX3A 2IW6A 5DT3A 5FG8A 5FLFA 2YZLA 3FJQE 3VBYA 2CGXA 2J0JA 3FY0A 5AP4A 3Q9WA 4RIYB 2R7IA 3E64A 3DGKA 1WBOA 1XH8A 2UZTA 4BYIA 1F0QA 1OPLA 2KULA 3HRBA 3SXFA 1IAJA 3N4UA 2I40A 4QTEA 2X2KA 3QA8A 4O0TA 3UOLA 2WO6A 4S31A 4GKIA 1B6CB 3TM0A 3BGQA 5KMIA 5E9EA 4UY9A 3EYGA 4DTBA 3CPBA 3HUCA 4U80A 4C02A 3RVGA 4E6CA 2CJMA 1XH5A 4IQ6A 3VUTA 1M2QA 1NXKA 2EB3A 4GYGA 5F95A 2R3JA 5AV2A 4DFBA 1JOWB 3HMPA 2WKMA 2QC6A 4EJNA 3NSZA 5AAGA 4IZYA 3QBNA 2AUHA 4V05A 5BMMA 3RAIA 5CI7A 2QOIA 2OXYA 5FGKA 2NRUA 3RJCA 5HCXA 3THBA 4FTRA 3PYYA 3FMMA 3MH0A 3UPXA 3V5TA 4ACMA 4CZTA 5F9EA 4MCVA 3VQUA 4MEDA 2IVTA 4H39A 4PF4A 2GNFA 3QF9A 4E93A 4O81A 3F3UA 2XCHA 4IE9A 3VJNA 2PZPA 3ZO3A 1GAGA 4EQMA 1P14A 4NW5A 3QGYA 3ZO2A 3NUAA 4YC8A 3L8VA 3MWUA 4WIHA 3U4UA 4BGQA 3C5IA 5HLPA 3RCDA 4TT7A 4JDKA 4XNEA 4ONAA 2PE0A 4FC0A 3ZSGA 3I7CA 4FKUA 3N51A 4P2KA 2R3LA 4I6LA 2X0OA 2Q83A 2YWVA 4YPSA 3I0QA 4I22A 3MFTA 3FI4A 5I3RA 3AGMA 4KBKA 2OZAB 1BMKA 4FBXA 4RJ7A 4RC3A 3MGYA 4U3ZA 2PUNA 1SVGA 2YIWA 3ATTA 5DNRA 2E9OA 3GENA 3ORLA 3P23A 4BVUA 4BWKA 2XKCA 2RFEA 1JLUE 4BCFA 5HQ0A 4B0GA 4ENYA 4FKTA 1GOLA 3POOA 4L67A 3UDBA 4ITIA 3F7ZA 3H9OA 3IOKA 5T3QA 4BCMA 2UW9A 4DFXE 3O17A 1TKIA 2C4GA 4FL3A 2WTKC 4D9TA 3ZDIA 5CANA 2PMIA 4RLLA 4UZHA 4U43A 3DS6A 3L8XA 3GT8A 3MV5A 4FL1A 3L9MA 1Y8YA 4BDHA 2Z8CA 4AXEA 4FOCA 2C47A 4GMYA 2R3MA 3P1AA 4J99A 3UYTA 2R2PA 2QHMA 4RGJA 3VUHA 3NYVA 4EEVA 2B0QA 3E8EA 3EMGA 3FMJA 3V8TA 2PU8A 4OTGA 3SQQA 3ML1A 3C0HA 4R3RA 4K18A 5C27A 5CALA 4RIXA 4RG0A 4E8AA 2H8HA 5J8IA 2OU7A 3DQXA 4PQNA 2IPXA 3HA6A 2AQXA 3NUXA 3SVVA 5E8XA 3L9LA 2YIXA 1MRUA 2QHNA 2XNNA 3LPBA 4G9CA 5TO8A 4DG0E 2IVUA 3OROA 4R1YA 3MESA 4K77A 4PX6A 4J52A 4EOIA 2PHKA 4F1MA 4JAIA 4QP6A 1XH6A 1QPDA 4G6NA 4YU2A 3QQJA 1NVSA 3DJ7A 3I1AA 4P7EA 4LOQA 3FLSA 3OBJA 3UOKA 4FSUA 2VTQA 4WD5A 5CT0A 5HESA 1HCLA 2FUMA 4U81A 4R7HA 3F3VA 4L8MA 3TJCA 4YZCA 5I3OA 4USEA 2B9HA 2E9PA 2OK1A 1P2AA 2OIQA 3BL9A 3ZLXA 2C3JA 2VGPA 4PMSA 3GOPA 2Y6OA 4I92A 5BUIA 4G5PA 1OZ1A 1YHVA 3KFAA 4EWQA 4X3JA 2JKQA 5CF6A 1PY5A 4QQJA 3LMGA 4NSTA 4ZOGA 5CTPA 3EQFA 2GQRA 2UW7A 3OUKA 4O91A 5JGDA 4ACHA 5IDPA 3ODZX 2VTJA 1SVHA 2VU3A 3EWHA 4I4FA 4O0SA 4O0UA 3ZSHA 3DFCB 5BQ0A 3BHTA 4E7WA 4FEUA 4PDSA 3WF5A 1XKKA 4XCUA 4ALUA 1Q5KA 4QYEA 1Q24A 3RNYA 3C50A 2Z7RA 2HW6A 1YVJA 2OG8A 4R3CA 5EDPA 3PJ8A 2UVXA 3VJOA 4I5CA 3AC5A 3MB7A 4BN1A 4JDIA 2X0GA 3MN3A 2WU6A 1FVRA 4FEVA 3BLHA 3Q6WA 3EN9A 5ETIA 5EOLA 3TG1A 2Q0BA 3KEXA 2OJ9A 3OP5A 2BZJA 2UZNA 4D28A 3Q2JA 4FZ7A 5D41A 2HY0A 1KSWA 1LUFA 4BCNA 4O86A 4IJ9A 3UP2A 1Q97A 4Z55A 5HX6A 1L8TA 4MWHA 2FA2A 5TF9A 2XH5A 3CGFA 3ORKA 4EOLA 3OF0A 4C4EA 4QYYA 5EM5A 2VAGA 4WOVA 4JDHA 5M4CA 3F82A 1YWVA 2GTMA 5GJFA 4BBEA 3LFFA 1H1SA 4U0IA 2ITNA 4HVSA 5IZFA 1OL2A 3BYMA 4TY1A 2A2AA 5AIRA 2ZB1A 1ZOHA 4IAKA 3MA6A 4XG7A 1CM8A 1H01A 1OL6A 1TQMA 2I0EA 3KRXA 3QTIA 3DAKA 2HXQA 1V0OA 3KVWA 4Y72A 4CFXA 4ZLYA 4BDJA 4JXFA 3DPKA 4BI0A 4G3FA 3BYUA 2XYUA 3GCUA 4ANOA 4CZYB 4D5KA 1M17A 1QL6A 4FTOA 4AW0A 1PMNA 3K3IA 3UOHA 4FICA 3MFSA 3VUGA 1UNHA 2GNGA 4CV9A 4I0SA 3EZRA 3WE4A 2XIXA 4EC8A 3PLAE 4YTFA 2OICA 3MH3A 4HCVA 3LHJA 2WMXA 5JFWA 5B2KA 3OUNB 5TE0A 4CKJA 3NNVA 3NDMA 5CEQA 5H8EA 1M52A 2H9VA 2R5TA 2JGZA 2RG5A 3NGAA 3HP5A 3V6RA 3A4PA 3B2TA 3DB8A 3HV4A 2C5XA 2J5FA 3QRJA 4GU9A 3QCXA 4RJ5A 1OBDA 4N6YA 1UWJA 1Q8ZA 5AUTA 3U54A 4EOKA 5FBNC 5IMXA 2WU7A 3WZUA 3C4CA 2OIBA 2XIKA 2PVNA 4QYHA 3R83A 3CD3A 4BGGA 2WTCA 3EZVA 5J1VA 3JY0A 1UNLA 2NRYA 5CQWA 3TIYA 4NJDA 4U8ZA 5HTIA 3NIEA 3KF7A 5JMSA 3VO3A 4ERWA 4D2WA 4E4XA 3ZUUA 3CY3A 5E92A 4QT1A 4ZZOA 2OI4X 4I6FA 5HG8A 5CI6A 4NCTC 1R3CA 3MY5A 3EIDA 4KIKA 1OI9A 3DOGA 4YC6A 3DK6A 4K1BA 5HBHA 3ZO4A 4KS8A 4DHZA 3ZTXA 3G9LX 3G6GA 2P33A 4FT5A 4NYEA 2W7XA 1Q99A 4C62A 1IR3A 4NFNA 2VTAA 5KZIA 3C4FA 5TKDA 2G01A 3ORXA 5IQDA 3SLSA 2UZUE 3HMNA 4FIGA 3BEGA 3E8CA 3L8PA 3UDSA 2WXVA 1G3NA 3EFJA 4D5HA 2YM8A 2X8IA 4FTLA 3Q04A 4M69B 4QEBA 4LV8A 4F78A 3LLAA 1OGUA 3MFRA 4YR8A 3BBTB 4ZJJA 5ETAA 3VIDA 2XIRA 5CVHA 4ASXA 4BJJB 1MP8A 4F9WA 2XB7A 4KSPA 4Q5EA 4OUCA 1OKVA 3BGPA 4TYHA 3R1SA 2UZOA 1BI8A 3QKMA 3NFFB 1OPJA 4NKAA 5FXSA 3OEZA 4GK2A 4BR3A 5BX0A 3MSSA 4FTNA 4W9WA 3PE2A 2OJJA 3B8QA 4L9IA 5HIEA 5K5XA 5L6PA 2PPQA 4YZMA 4XS2A 3OT3A 4H3BA 2F2CB 4NCTA 1J1CA 3DDQA 4UB7A 4YJOA 4LYNA 5CNOA 1P4FA 1Q41A 3IOPA 4CQGA 3BU3A 4LFIA 5AP1A 4D4RA 3SA0A 2B4SB 1JBPE 2O5KA 4DFYA 2IWIA 4WSQA 3BLAA 4YSMA 2ITUA 4YZ9A 5EDRA 4F9AA 1R1WA 2V7OA 2WD1A 2WFYA 3EL7A 5A4TA 4G2FA 5HU3A 3A62A 3PWYA 3KQ7A 4OBQA 4OTWA 2UVYA 4ZIMA 4FUXA 3MPMA 4UYNA 4AT5A 3R0TA 3POZA 4J1RA 4FJVA 1YRPA 5LVPA 4PNKA 4RX7A 2ZVAA 3PJ3A 4DLIA 4WKQA 4RWIA 4ENXA 4AN9A 2QLUA 4YJPA 4BY9E 5AP2A 4BDFA 4IB1A 4BIBA 1OVEA 1R78A 3SDJA 2OF2A 4RFZA 3VRZA 3FHIA 5IQAA 1YXVA 4DINA 2BDJA 3CQUA 4JLCA 4OAVB 4IJPA 1G8AA 3MDYA 3ZMMA 2HY81 2FGIA 5KX8A 3NAXA 2IG7A 4NJ3A 4IZ7A 4I94A 2XNEA 3KCFA 3KRWA 4FVRA 3QKKA 3MPAA 4HNIA 3PE1A 4PL3A 4U5JA 2QR8A 4Z7HA 3H0YA 5C03A 1BL6A 4H3QA 4IM2A 4M0ZA 4PTGA 4QYFA 5J79A 3GFEA 4GT5A 3ZM9A 2CLQA 4BCPA 4PMPA 3FL4A 3AC2A 5BMSA 4JBOA 5TOZA 3L9NA 2G2IA 4IX6A 4JG7A 3O8UA 3VS1A 4FKVA 2OF4A 2QOQA 4AGWA 3CTQA 2WOTA 4MF1A 4DCEA 3U6JA 4GT3A 3RPYA 2QR7A 2JIIA 5FP5A 3TTIA 5A4LA 1OKYA 4LRJA 2EXMA 4AGCA 5CAOA 3O50A 2WMQA 3A60A 3MJ1A 3VUIA 2VZ6A 4Y8DA 4F0GA 2ZYBA 4LRKA 3NFGB 4N4SA 1A9UA 2GS6A 3QRKA 3ID6C 5AEPA 1BYGA 2OZAA 2QG7A 1I44A 3ZH8A 4F1OA 4DLJA 4HVHA 1UU9A 3BBWA 5IEVA 2BUJA 4FV5A 4L7SA 3FQSA 4AA0A 3QYWA 2ZFYA 3CBLA 3Q9ZA 5LMKA 3A99A 4I24A 4BTKA 4M13A 1RW8A 1PXIA 5FP6A 4XHKB 4IAZA 1JKKA 2W9ZB 3H10A 3FC2A 4GCJA 4B4LA 3OXTA 3ANRA 4DF3A 5DR2A 2PL0A 3VS0A 4N6ZA 4DEEA 2XKDA 3RKBA 3UZPA 3WF7A 3KMMA 5HZNA 2W5BA 1H4LA 3G51A 4O1PA 1WMKA 3E3PA 3S4QA 2R3KA 2XARA 3KC3A 4FK3A 2XKEA 3UMWA 2QOLA 2ZV7A 4R1VA 1O6YA 3PVWA 2JIUA 4A9TA 4NM5A 2I7QA 4HJOA 4OT5A 2PYWA 4FZDB 4OAUC 4XV2A 2WMRA 3FMLA 2CNVA 1JSTA 1PYXA 4A4OA 2X4FA 3QCSA 4BHNA 4ZEGA 3OHTA 2WMBA 3QZGA 4O0YA 3ZBFA 3JR1A 4DA5A 1BI7A 3H0ZA 3R28A 4ARKA 4D1XA 3D7TA 4I5HA 2JC6A 3CQWA 1PW2A 3MVHA 5AV1A 5HCYA 3QKLA 5C8KA 4KKHA 3F2RA 4GG5A 2XBAA 1G5SA 3FZSA 3KN6A 4I4EA 4MXZA 4GVJA 4YJQA 1H27A 3OWLA 4OTHA 4X6RA 3UTOA 3LAUA 4FL2A 2XBJA 5ACKA 2GNLA 5C9CA 1J7IA 3W0MA 4L6QA 4AE9A 4DG3E 2VTRA 5CSWA 4QRCA 2CKOA 4I3ZA 4AZVA 3OOGA 4FOBA 3CPCA 1G8JA 1UVRA 3R8LA 3VW8A 4BKJA 4BZDA 2BAQA 4R3PA 4C2VA 4S30A 5BVOA 3D14A 4O7WA 4CQEA 3LXNA 2FVDA 1BX6A 2QOBA 3U9CA 4DG2E 5KHXA 5FXQA 4AW1A 4J97A 3PA5A 3OY1A 4RPVA 5ANJA 4AGUA 5AX9A 2GU8A 3SG9A 4O1OA 3QCYA 3FDNA 2CPKE 3FYKX 3V5PA 3AC8A 5AP5A 4YJRA 3KXXA 3DJ5A 3HZTA 3JUHA 3A7JA 3D0EA 4CG9A 1IEPA 2WTWA 2DYLA 3LFBA 3UGCA 4RJ8A 3V04A 4DE4A 4ALVA 1ZYCA 2R3IA 5A6OA 2R0IA 4UEUA 1V0BA 1VR2A 4FEQA 4YBKA 3TN8A 5J87A 3KKVA 3OC1A 4XRLA 3LFDA 3LJ2A 4IH8A 4QP8A 1M14A 3UODA 2C1AA 3ORZA 5EKOA 2JKOA 3LIJA 3QWKA 4CEGA 4C59A 4FVPA 3DQWA 5DEYA 3HMIA 4YGAA 2B53A 3F9NA 4PPCA 5LQFA 5EFQA 5DR6A 4FSZA 3V8SA 4CCBA 4D2TA 3KN5A 2CGWA 3VS3A 2J2IB 2OJFE 4WUAA 4ZXTA 5HNBA 4HVDA 1T46A 2G2HA 4W8EA 3WZDA 5M56A 3D94A 4WBBB 4ZZMA 4RT7A 4IM3A 3KB7A 3OW3A 4TPTA 1Y6BA 4CFUA 3TV4A 4O22A 3UZTA 4ZMFA 4U40A 4O4CA 4FK6A 5AP0A 3WARA 3SD0A 3MTLA 1KUTA 2YISA 4GK4A 2CNQA 5AR8A 4D4YA 2GS2A 2HXLA 2OJIA 2GQGA 3EQCA 3PG1A 1URWA 1WZYA 3GQLA 3HLLA 4FT9A 3NR9A 3U8WA 1PXPA 1RQQA 4MXYA 5EYCA 3E62A 2ZM1A 4YC3A 2UW4A 3R7GA 4U42A 4XP0A 5AADA 2GFSA 4X21A 5AR2A 3QTXA 4BTMA 4YJUA 3CSVA 4O7TA 4AA5A 4M68A 4NM0A 5M4UA 2CKPA 3HL7A 3VUKA 4EZ5A 3VC4A 2HW7A 4CGAA 3IDPA 3BPRA 4EK3A 2GNIA 2XYNA 4UMRA 1E9HA 2XJ2A 2Z7LA 4AGDA 1A48A 4AOIA 4FIJA 1M2RA 2XK3A 3UIXA 4GV1A 4O6EA 2VTPA 2YM5A 5AUZA 4C61A 3W55A 5AV4A 2YM4A 5BYYA 4YJVA 4NIFA 2BDWA 3CIKA 4M12A 4OTIA 3TACA 5A3XA 5DMZA 1H28A 2ERKA 5JQ8A 4J53A 3NUUA 4CFVA 4F99A 3L8SA 3RI1A 4D2PA 4F08A 3VONA 2OFVA 4EHZA 4JRVA 4MBIA 2GHLA 1R39A 2J0IA 4RFMA 5KNJA 4FT3A 4NT4A 3UQCA 3A8XA 1WVXA 5H3QA 3R63A 3ZLSA 4AW5A 4CTBA 4FV8A 4NFMA 2O8YA 3W0OA 3R1YA 4TYEA 4KS7A 3R22A 2J9MA 2HZ4A 2W1ZA 3D5UA 5HORA 1J7UA 2OIDA 5J5TA 5AP7A 2A4LA 2VWBA 5DHJA 3MI9A 4FNYA 4JBPA 4R5YA 3R7EA 2YLEA 3R7IA 3BELA 2YN8A 4N70A 4FTTA 1LP4A 2R4BA 4FSMA 3HEGA 4QTAA 2RG6A 4FTJA 2Z02A 4M69A 4P90A 4XYFA 2YHVA 4K8AA 5AR7A 2VO6A 3Q6UA 4FNWA 4BJJA 4IADA 2C3LA 3ZXZA 5EHLA 2C6TA 4IVAA 4PY1A 2HZ0A 1ZOGA 4RA5A 5EOBA 2PVYA 3WZEA 4XP2A 4YJTA 2WMAA 2VGOA 3NUNA 2X2LA 3KF4A 4ZLOA 3F66A 2FO0A 5CAVA 4JIAA 3ET7A 3E87A 4BF2A 3AT4A 4KUJA 4YLLA 1QMZA 3C1XA 1XR1A 3LM0A 4S33A 3FXZA 4AG8A 4P4CA 1ZMWA 4EUUA 1GZOA 3OOMA 4HW7A 2VN9A 4O7RA 1YKRA 4FG7A 3KRLA 2W06A 2V7AA 4R5SA 1KE5A 5AV3A 3W10A 3AMYA 4KWPA 3KA0A 4MQ1A 1JNKA 5H2UA 3RK5A 5LARA 3VQHA 1S9IA 1PXNA 2F57A 3ITZA 5J5SA 4RWKA 3DBEA 4UN0C 3LJ0A 2SRCA 3IW6A 5CU3A 4RX5A 4B99A 5BUEA 1SNUA 3MFUA 3OXZA 4FGBA 4ALWA 5KO1A 5DGZA 1JPAA 1XHAA 4OR5A 3PJCA 3EQBA 3QGWA 3OWJA 3GOKA 2PE1A 4LGHA 5GNKA 5H8GA 3PLSA 3PY3A 2OO8X 3UC4A 4AW2A 4II5A 3SAYA 4CXAA 4UX9A 5IQBA 4FIFA 4G16A 2CKEA 3GVUA 1FMKA 4XMOA 4EI4A 3WIGA 4Z16A 2XRWA 2J5EA 5GJDA 4ORKA 4IWOA 2GNJA 2CHLA 3QQLA 1YWRA 3GU4A 3DKOA 2W17A 3P7BA 3UYSA 1Y57A 1GIJA 3PXYA 4HPUE 4IAYA 2QONA 4DHFA 3GI3A 4GK3A 3Q9XA 4NM3A 3RZFA 2RFNA 3MIYA 3K5VA 4EH5A 3RM7A 3DBQA 2QKWB 4FNZA 5BNJA 3UC3A 3VS6A 4MWIA 2VWWA 2Y4PA 2XMYA 3IW7A 2B54A 3LXPA 4KSQA 3VULA 4EBVA 1U5RA 2W4KA 3GU8A 5HGIA 1W82A 3IONA 3FZOA 4D0WA 5AA8A 3VF9A 3ZONA 3VS2A 1ZYLA 4ZTQA 3KRRA 4DHIB 3T3VA 3NNXA 5M4FA 4IHPA 4LUDA 4RC2A 5A14A 4A07A 5JN2A 5ANKA 1Y91A 2X7FA 3GCSA 1KE7A 3LCKA 3V6SA 2O65A 4YMJA 3G33A 1SVEA 3BRBA 2WMVA 4IFGA 5KMJA 1RE8A 4NZWB 2XJ0A 2P55A 4ZSJA 4TL0A 2ACXA 3AXWA 3FL5A 3GP0A 4FKIA 4EHGA 5ANIA 3N4TA 3UIMA 4B6LA 1NVQA 4PDPA 5AM6A 2BIKB 5F20A 5DRDA 3E92A 3PG3A 5J9YA 4LV5A 5FTGA 3A7FA 2JLDA 3QALE 3UNJA 4EC9A 3W0QA 2BMCA 3CE3A 2WMWA 3FZTA 3QRTA 4CFMA 3VF8A 4C4HA 4I20A 4W4YA 2IVSA 4OBPA 1OECA 1SYKA 1OIRA 2YCFA 5HG7A 3V01A 3H3CA 4L44A 1REKA 4FMQA 3FKOA 1E1XA 3ZU7A 3WF6A 4IDVA 5CENA 2X39A 4DTKA 4J71A 4NU1A 4JX3A 4WA9A 4WRGA 5C01A 1MRVA 3FZ1A 4OTPA 4UBAA 4W8DA 5HO7A 1OMWA 3MY1A 5HLNA 5CT7A 3COKA 4MNEA 3BL7A 4Z7GA 4YTIA 4BTJA 4IMYA 4M3QA 4O7NA 1HCKA 4MNFA 2YEXA 3CC6A 3DZOA 3LFAA 5DFPA 5HVYA 5FRIA 4ANLA 3PA3A 4XJ0A 4BBFA 3ROCA 2X0QA 3NAYA 3HRFA 4QMOA 4EZ3A 4HYSA 4LM5A 4EBWA 4QQ5A 3OEFX 3T9IA 3HAVA 4H05A 4YPDA 4YO4A 2RIOA 3Q3BA 4L3PA