4DITA

Crystal structure of gsk3beta in complex with a imidazopyridine inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
353
structure length
328
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of GSK3beta in complex with a Imidazolopyridine inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
total genus 90
structure length 328
sequence length 353
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ditA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ditA01
2W0JA 3PLAE 4WNOA 4HGLA 3WIGA 2ETRA 4FTIA 4K6ZA 3LFCA 2W4JA 3NIEA 4KD1A 5AR2A 5CI6A 3DBQA 2QC6A 1GIJA 2P0CA 2QOFA 3U6HA 2W1ZA 5ANDA 4L68A 3PSCA 5KCVA 4L9IA 3ALOA 4GVJA 1PKGA 2FSLX 5BVOA 3ET7A 5HLPA 4YGAA 1BKXA 4PNIA 3E92A 4PPCA 5JH6A 3O50A 3FKLA 3M2WA 5D7VA 1GZ8A 3ORZA 2C6MA 1GOLA 4C2VA 3PXFA 3GNIB 3ZFXA 4FZAB 5DT4A 3QKKA 3DGKA 3LQ3A 4M12A 4GK3A 3W2PA 3Q04A 4RVMA 3SDJA 5K5XA 5AM6A 5E4HA 3UPXA 3R01A 3F3VA 2XS0A 3QXOA 3RAHA 4QD6A 4GK4A 4OT6A 5LARA 5AA8A 4FTCA 4FNYA 4JIAA 1MQBA 4UY9A 1BLXA 4PDPA 4YSMA 2R3MA 4BDCA 3FMEA 3OROA 4CRSA 4B7TA 4RX5A 4ZS4A 4C7TA 2YHVA 3FC1X 4RGJA 1K3AA 4WIHA 3QQJA 5FM3A 3BU5A 4AZVA 1XR1A 2WMUA 2UVZA 2IVUA 3PPKA 3QZHA 3I5NA 3W2OA 3MS9A 4HCUA 4RJ5A 3RHKA 2X9FA 3NX8A 2C5XA 2UW6A 3R02A 4HNFA 5KMNA 2J51A 2PE0A 3F3WA 4ACMA 2I40A 2WOTA 4BN1A 3FI8A 4TXCA 2XNBA 1UV5A 3NUYA 4N6ZA 5H2UA 4BIBA 5A4EA 5CU4A 3PA3A 2O0UA 5J5SA 2WO6A 4JAJA 2QR8A 3CLYA 5HBHA 2V62A 1H1WA 3I4BA 1VEBA 5HKMA 3W16A 1TVOA 4M69B 4QNYA 3JS2A 1Q62A 1U5RA 5KMMA 1FMKA 3OXTA 5DT3A 4FE2A 4QMLA 5GHVA 4Z7GA 2X39A 3I79A 4E5WA 3ZMMA 4O7LA 3QFVA 4G6LA 5DGZA 4AS0A 3PLSA 2QODA 3KA0A 3QQKA 3NUUA 4BCPA 4BL1A 3GU6A 3LCDA 3R71A 1OL1A 2XH5A 3L9LA 4JBPA 4MKCA 4M97A 2VTAA 4OTGA 2Q0NA 5A4CA 1KOBA 2GTNA 5EM5A 1JBPE 2JDSA 3UIXA 4IWOA 2UZNA 3EN9A 4X21A 2J7TA 5GZAA 2HY81 1GAGA 2GNHA 2VTPA 5KBQA 2GNIA 4IZ7A 3UYSA 4BWPA 2W4OA 4ZTMA 4WUNA 4X2GA 4XG2A 3CR0A 1QCFA 3RNIA 4YHTA 3RAKA 4Z55A 3QUEA 3RCJA 5EI6A 4N57A 3FXZA 3CC6A 4G2FA 4AF3A 4FV5A 1QPDA 1B38A 2ZV8A 4JT3A 5GIPE 3Q9ZA 2YN8A 4E73A 5ANIA 4L44A 2W9ZB 3R7GA 4F7JA 5EHYA 2E9VA 5EM8A 3C13A 3S00A 2REIA 4NTTA 3ZUTA 4P2KA 2F2CB 4FIEA 2IW8A 3BWFA 4IVAA 1OIYA 4NJ3A 5CYIA 4C59A 4EWHA 5IA4A 2GQSA 4EZ5A 3DTCA 1O9UA 4TNBA 3ZLXA 1JKLA 3CY3A 3QUPA 3DJ5A 2PUUA 3EYHA 2OIQA 3I81A 3POOA 4Y8DA 1E1VA 5FLFA 3UE4A 3FUPA 4AT5A 4XRJA 3OY3A 4IAZA 4O21A 2JITA 4TL0A 1IEPA 2WQNA 3MN3A 2CHLA 3DBCA 4DG3E 5JRSA 5LCKA 3DAKA 3AC1A 3GCUA 3R00A 4OTPA 4G3DA 4K33A 1ZY4A 1J1BA 2JLDA 3A7IA 3PPZA 4G6OA 4MQ2A 4KINA 5AUTA 1G5SA 4ANQA 1FGIA 2FH9A 3QQGA 2Y4IC 3AT4A 1UKIA 4BICA 3MPAA 5CEOA 3AGLA 5DT0A 1YWRA 1ZARA 2XK3A 3HMNA 5HGIA 4CMOA 5CU2A 1ZYCA 5AR7A 4ZSLA 3H9FA 2X1NA 3TV4A 3CJGA 1H1QA 3DKFA 3ZCLA 3Q5ZA 2YAKA 5J7HA 3FSKA 2OWBA 2OF2A 3Q52A 4CEGA 1F0QA 2HAKA 3V5PA 3HA8A 1YHVA 3I6WA 1PMUA 1ZOEA 5EI8A 4MXYA 4YNEA 3UVRA 4FSTA 5C01A 4U79A 4D4SA 3AC4A 3CQEA 2UZEA 4AW2A 1UWHA 3AMAA 3IDPA 4IB3A 4OGRA 5HG7A 4Y72A 3NUPA 1ZY5A 4JBQA 3SV0A 3EQFA 3NVMB 1YI6A 4O7VA 4FODA 2WB8A 4KIKB 3WF9A 4D28A 2A27A 2VWVA 1H07A 2WTWA 2X2MA 3VBWA 4CV8A 3OEFX 4IWDA 3O51A 3D15A 3QXPA 5L6WL 3UP2A 4AWIA 5A9UA 3PTGA 2JFMA 3DY7A 2JD5A 5JFWA 5HX6A 2B0QA 2J0JA 4KIOA 3WF8A 4DFNA 3BPRA 3UQCA 4ZMFA 5IEVA 4XP3A 3LXPA 1LUFA 2YA9A 4WT6A 1PYXA 5J95A 4MHAA 4F0GA 3QTSA 3ANRA 5L8KA 4HPTE 4E4MA 5HO8A 3WYXA 4DAWA 2OZAA 5CVFA 4EK4A 1KWPA 4C38A 1LPUA 2ETMA 1Y57A 3Q4UA 5JQ5A 4CYJA 4XH6A 2G9XA 3TNPC 4DH7A 4IVBA 2XK8A 1MRYA 3W8LA 5M07A 1H25A 4FKOA 4YPSA 4NW6A 2R4BA 2IVSA 4GT5A 2FA2A 3ORXA 3R9OA 2OJFE 4X6QC 4EKLA 2ZV7A 3PXYA 4G17A 4R8QA 4FTAA 5ETCA 4FA2A 5KBRA 3OP5A 4I0SA 1FINA 3EQGA 2R3NA 2VX1A 4MWIA 4FOBA 4IAAA 4TW9A 1RDQE 4AGWA 3BHUA 3P4KA 5LVLA 4YJUA 5DN3A 4D4YA 5BMMA 3KU2A 4BCOA 1U5QA 3MY1A 2VD5A 1J91A 4QQCA 5CU3A 3V5JA 3VF8A 2XNGA 4F9BA 4F9CA 2B9HA 2WQMA 5DNRA 1G3NA 3MTLA 4GFGA 5A6OA 3GC9A 3OW4A 3PJ3A 4JXFA 4N4SA 5CQUA 3BYSA 4JBOA 5HNBA 4DLJA 5AEPA 2UV2A 5IA5A 4X7QA 4LGHA 4RIOA 4BDBA 3TDVA 4G3EA 3H10A 3DKCA 5FTOA 5I9UA 5EDPA 3D83A 5JSMA 5LVNA 4K0YA 4O82A 1J7LA 4LFIA 3PYYA 4QP1A 2YWVA 2OH0E 2OFVA 3O71A 3UZRA 1XHAA 4FV1A 4I3ZA 4U0IA 4NSTA 4ID7A 4WBBB 4I6FA 5E90A 3C5UA 3Q9XA 4QMVA 1JAMA 2FSTX 4HGTA 5LVMA 4KA3A 2JAVA 4O22A 5FXSA 3UGCA 4F99A 2C0TA 2DS1A 2ESMA 3P7AA 4ENYA 4K1BA 3LMGA 4YMJA 4IBMA 3DLSA 4Y46A 3BYUA 2PVMA 2XJ0A 1KSWA 5EHLA 3UNJA 2YFXA 2QI8A 1Q8ZA 2XRUA 4LYNA 4H1JA 4FR4A 3EFKA 4TNDA 4GU9A 4CZUA 5L6PA 4UMTA 3UZTA 4WSQA 3DK7A 2BRNA 3GU5A 4U80A 2FSMX 2I6LA 4XG9A 1R39A 3PSDA 4BY9E 1WMKA 5I5ZA 2RL5A 4IX5A 1JWHA 4M69A 2IZSA 3VBTA 2IVVA 2XJ1A 4LMUA 4FSWA 2EWAA 3FI3A 3R1SA 3D5VA 4IAKA 2WAJA 4YURA 2PZRA 3W2RA 4LGGA 3ZU7A 4Y5QA 5M4UA 4FSZA 4ALUA 3W2CA 4E4XA 1XO2B 4V01A 4RIYB 4CLJA 2HZ4A 5DI1A 2WNTA 5DMZA 3DA6A 2VWWA 2PVJA 5DWRA 1LR4A 4C0TA 2HYYA 3FL4A 3C4XA 3OCGA 2YM4A 5AUWA 3RPVA 4EKKA 2C6IA 3U55A 4AACA 4HGEA 2HOGA 4F9YA 3C4ZA 3PWYA 2PSQA 3NNWA 3HZTA 4PPAA 4GYGA 4I6HA 4R3PA 4XJ0A 4AAAA 2UZDA 3EL8A 2GNFA 5KKRB 2QONA 4BZNA 4F9WA 5C27A 3P86A 4IZAA 5G1XA 1FVTA 4FF8A 4ZTHA 4ENXA 3HDMA 3RTPA 4DG2E 5GJDA 3CD8A 3VJOA 4ZZNA 3A7JA 3G0EA 4KABA 1H00A 3G2FA 3R6XA 2BILB 2GFCA 4Y5HA 5HCXA 3TV7A 4R6VA 4RZWA 2VGPA 3KULB 4O0RA 3DPKA 2YM8A 5E8YA 4C3RA 3EMGA 3NS9A 2FUMA 3PY1A 4S32A 5JT2A 5M53A 1CKPA 1NY3A 4XX9A 5AUYA 3AMYA 3W33A 4IFGA 3K54A 4O1PA 4ZTSA 2PVNA 4CD0A 4D5KA 4EH2A 3BBTB 2EB3A 4RJ3A 2PYWA 3ZEWA 4CCBA 4Q5EA 2Y6OA 3MIAA 3DK6A 3TUBA 1ZYDA 4I24A 2CMWA 4N70A 5EW8A 3WIKA 3RM7A 1Q24A 3TXOA 5AUZA 3NNUA 1NVRA 4FSNA 1H28A 3C1XA 4EHGA 4EHZA 5AUVA 4DEHA 2ITQA 4X2FA 3I6UA 4I4FA 4QMTA 4FSUA 3E8CA 2WTDA 2X6EA 4GEOA 1TQPA 1OL5A 3PG3A 4DFZE 2YCSA 1P2AA 4A7CA 1ZZ2A 1YWVA 4GUBA 5DFPA 3SXSA 5CSPA 4DTBA 5AFVA 1XH4A 4IH8A 3ERKA 4GUEA 4QMPA 3QTXA 4G3CA 3JVSA 1PMNA 2H96A 2ZAZA 3FI4A 2JKOA 3KXMA 4YNOA 5CX9A 4J99A 4RFYA 4HYSA 2R3IA 5DIAA 2HW7A 3GC7A 4DC2A 4GFOA 5M44A 4JQEA 5HG5A 3QCQA 5I9WA 4BCGA 3UOKA 3EB0A 4KKEA 1Y91A 2E2BA 4AOIA 5HO7A 5D41A 3THBA 3QTQA 3AGMA 2R3JA 4TY1A 4BZOA 3QLGA 4BCMA 3A60A 3P7CA 2IPXA 2Z7RA 2C6OA 2VTIA 1PXPA 2P33A 4DFYA 2YIRA 1BX6A 3F82A 4G34A 1WBTA 3GC0A 4JQ7A 4QTAA 1PMEA 1UKHA 5K3YA 4YZCA 4BRXA 4EH5A 4EI4A 5IA0A 5JZJA 2R3FA 5HU9A 1YVJA 5CF4A 2B55A 2VWXA 2RFDA 3F7WA 5EYKA 3VRZA 3QGYA 3PJ1A 4FG9A 4KNBA 4V0GB 4D2RA 5CQWA 2Y4PA 4W4VA 3AT3A 3C7QA 2C5OA 4U44A 3VF9A 3IGGA 1UNGA 2J50A 3QCXA 4H3QA 3GUBA 1OGUA 2E9UA 2QURA 3R30A 5FTQA 2Z7SA 4FEUA 2FO0A 3QA8A 4XBUA 3C5IA 3QGWA 2WTVA 5A4LA 4PP9A 3BELA 2QOCA 4BKZA 5AP5A 2EXMA 4ZY4A 4FEXA 3AC8A 3GI3A 4UMQA 3UBDA 3P9JA 2NPQA 1XH8A 3FHIA 3LW0A 5C8MA 5AAGA 2YZLA 3QD2B 1NVQA 5C03A 5KMKA 2X0GA 4M84A 3PG1A 4TTHB 2Z8CA 1O6KA 4BDKA 5HVKA 3IW7A 1IR3A 4M13A 4PV0A 4QMNA 5C9CA 4B0GA 3D2KA 4QYHA 4C33A 5IA3A 3N4VA 4NM0A 4G5PA 3BBWA 3FQHA 3FZOA 4KRCA 4RWIA 1Y8GA 4YZNA 5FM2A 5CVGA 2UW3A 3CE3A 4ZTLA 2BPMA 5BVWA 4M0ZA 4CVAA 3H0ZA 5ICPA 1QPEA 3PY3A 3CTQA 2UZUE 3GOPA 4NM5A 3LQ8A 3RPOA 4DGLC 2PE2A 5LVPA 5DA3A 3TTJA 3MVMA 3FMDA 3QC4A 3MGYA 2BZIB 2VTQA 4LRKA 4CMTA 2KTYA 2J9MA 4FKLA 4CQEA 3KCKA 1YRPA 3CPCA 4L3PA 2JC6A 4WG4A 2C30A 4RX8A 1KE8A 4EEVA 2KULA 3DS6A 3TUDA 5T68A 3UYTA 3O17A 3VQHA 4RJ6A 5LJJA 3FZTA 4RC3A 4L7SA 2C0OA 4ZY5A 4GIIA 2R3QA 4FI1A 3W55A 4BB4A 3U9NA 3EYGA 3QTUA 3QX2A 4DYMA 3DBFA 3DNDA 5L2SA 3MFUA 4MF0A 3U6IA 2IG7A 5E8ZA 4NYEA 1Y6BA 2G1TA 5EM6A 2DYLA 1GNGA 4L53A 3RHXA 3HNGA 4U97A 1OMWA 2PVRA 4LRMA 1ERKA 2BALA 5CEQA 3FEGA 4F4PA 3AC5A 3E7VA 3CQWA 1OM1A 1MUOA 3O8PA 4I0TA 3BLQA 4ZSJA 3ORNA 5JFVA 3HX4A 3TI1A 1J7IA 2OO8X 4JL9A 3ZFMA 4ARKA 3NLBA 5JEBA 2GNGA 3LOKA 2VX3A 4WG3A 4RVTA 5EYDA 3QCYA 3DK3A 3R63A 3BEAA 5LWMA 4QTCA 2VAGA 5FP6A 2J0KA 2YERA 1OL7A 3BU6A 3FZPA 3RK9A 4EK6A 2C3JA 2OJ9A 3FPMA 4HYHA 4ANMA 4JR7A 4RQKA 4QYFA 2GFSA 2OICA 2IZUA 3PVWA 3DNEA 4HYUA 1REKA 2ITWA 3SA0A 4WRGA 3QF9A 1DAWA 2B4SB 3S95A 3PDTA 5EQPA 3D5XA 2I7QA 2J5EA 4XOZA 2CGXA 4O0XA 3ZUUA 4ACDA 2CKPA 4BGGA 4I93A 5JZNA 4ANNA 2CJMA 3E63A 2GNLA 2QO9A 4YBJA 3PE2A 1DM2A 2BFXA 3R22A 5CLPA 4MEDA 3NDMA 3KFAA 5B2LA 4TWPA 1MP8A 2XM9A 4O91A 4X6RA 3W8QA 2GS6A 3SLSA 5BQ0A 2ITUA 1XH5A 3O23A 4IEBA 4NEUA 2ITZA 4GMYA 3SAYA 1WBNA 4H1MA 3WOWA 3ZC5A 5M08A 4FG7A 3GC8A 2C1BA 3EIDA 4RC4A 4YPDA 4HVSA 4GT4A 3ZSHA 3U54A 5EK7A 2UVXA 2XMYA 4FSQA 3QLFA 4L45A 1GJOA 3BE2A 4MCVA 4DFLA 4WKQA 3Q32A 3NUSA 1FMOE 3NW7A 3PRIA 4RPVA 3V3VA 5IZFA 2V22A 3FBVA 3OEZA 5HE2A 3OMVA 3GCSA 5IQIA 3NUXA 3QAME 5M4FA 2QO7A 2R7IA 1FPUA 2WU6A 3II5A 4YSJA 4QPSA 5H9BA 5B7VA 4HVGA 2UW4A 3NCGA 1JSVA 3RALA 2XB7A 4MXZA 3TL8A 3QZFA 5C4KA 3FMLA 4QOXA 4FKVA 4G16A 3MW1A 5L2QA 3KRWA 2VNWA 2J5FA 2X81A 3FY0A 1Q8WA 3FMNA 2XKEA 3LQ5A 2UZVA 3O96A 3OD6X 4P5QA 4U41A 3QUDA 5D9HA 5IPJA 4GJ2A 1XH7A 3TWJA 1H0VA 5M4IA 4YTHA 4A9RA 4MYGA 4O7RA 2C6TA 4D1ZA 4IAIA 3R7UA 4PNKA 1R1WA 2WU7A 3G9NA 4O0WA 4PMTA 5H8BA 5HD4A 4EQMA 5HLNA 3ID6C 3L8VA 4F7NA 4IJ9A 1YDRE 4I5PA 5CSXA 5ETFA 2OU7A 4U3YA 3EJ1A 5K0XA 4L01A 4M67A 3DDQA 4I6BA 4F65A 4TWNA 4IVCA 2R64A 2CLXA 3A99A 2VU3A 2R3OA 3ULZA 4KUJA 5HX8A 4C3PA 3C0IA 3QKMA 4BZDA 3Q6WA 3WYYA 2EB2A 2P4IA 2WMTA 3MJ1A 2WELA 3T3VA 4CCUA 1U59A 1W84A 2HIWA 5K4IA 4J8MA 4AZFA 4BF2A 3C4FA 4LGDA 4FEVA 3D5UA 2WTJA 2LGCA 1OPJA 2C0IA 2XNNA 1APME 1OBDA 2RG5A 4EHEA 5KZ0A 4S30A 3BI6A 2W1GA 5IEXA 3K3IA 3D0EA 3ORLA 4HJOA 4PMMA 4F64A 3RAIA 3QTZA 3BCEA 4E6DA 4D1SA 2JEDA 4D2SA 1Z9XA 3PJ8A 5BYLA 1I09A 5I9ZA 4FTKA 2PMIA 3L9NA 2ZV9A 3FL5A 2CCIA 3A7GA 4JAIA 3D4QA 2WMSA 5ANKA 1FVRA 4BWKA 3DKOA 2OK1A 1PXLA 3ODZX 4F09A 1T46A 4LUDA 4FKRA 4NZWB 5GINE 5CF6A 1BMKA 3CJFA 4OAVB 1V0OA 3SVVA 4M3QA 5EKOA 4CYIA 2R0UA 4EK5A 2Z02A 2A1AB 3OWPA 3PXQA 4MD7E 3S0OA 4ANSA 2PY3A 3G0FA 2HY0A 2BDJA 3P5KA 3BX5A 5AP7A 3TJCA 4BCNA 3E64A 3UOJA 4FV4A 1V0BA 1ZYSA 5TKDA 5J1WA 5DHJA 3D14A 4ERWA 5BUIA 3VC4A 2CPKE 4NKAA 4A9SA 1QL6A 5AA9A 3FMHA 3KXNA 4QMZA 4FK6A 3MSSA 3LM5A 2BRMA 2XIKA 2YACA 2XNOA 3UNKA 4RA4A 2R5TA 1DI8A 4IX4A 3DXQA 3ZO1A 1MQ4A 3UZPA 3UG2A 4UYNA 2C69A 4AA0A 5CAVA 4G9CA 4R5SA 1IG1A 2F9GA 1H4LA 1S9IA 3FHRA 2ZDTA 5DR9A 4NIFA 3F6XA 1PF8A 5GJGA 3U8WA 4LG4A 2QOOA 4FNXA 4RWLA 4XOYA 2XIYA 4EOKA 4EL9A 3KEXA 3AC2A 4XG7A 3R8ZA 4G5JA 4B6LA 4C58A 4UWYA 3A4PA 5ACKA 3A7HA 3VUGA 2WXVA 4ZIMA 2P55A 3QQHA 2X9EA 2QU5A 3GBZA 4FBXA 3TACA 2I0YA 3DV3A 4ITJA 2X7GA 2YEXA 5F9EA 4BI2A 4WSYA 5JQ8A 3L8PA 3HAMA 4PTEA 2RSVA 3U4UA 1XKKA 5JKGA 5IQFA 1IRKA 5M55A 1OKYA 4EYJA 4EC8A 4UN0C 4F0IA 3R8LA 4FX3A 3U87A 2ITTA 1A06A 3QHWA 1Z5MA 3BHVA 3QU0A 4TWOA 3COKA 4IJPA 4DEDA 5TR6A 5E92A 3V5QA 4IC7A 1SYKA 4V05A 3MVHA 3CGFA 2YDIA 2PZPA 3LFAA 5AV4A 3Q96A 4ZAUA 4E4LA 3HUBA 4GH2A 3R7VA 4U7ZA 5ANOA 2UW0A 4J95A 1XBBA 4YP8A 2W1DA 5K5NA 3S3IA 2XYUA 1WFCA 1R0EA 4ANLA 4BGHA 5JGAA 5BVNA 3NUAA 3G90X 5DR2A 4PTGA 4ZY6A 4AA5A 5DE2A 3LFQA 4PMPA 1ZZLA 5BVFA 4A06A 3FAAA 3KB7A 3HP5A 5CF8A 4RJ4A 2AUHA 3FQEA 4PWNA 3G6GA 5CS6A 1PXNA 5EFQA 5HVJA 3QWJA 2ITOA 4F0FA 2PZIA 4FL2A 4FGRA 2XCHA 4IVDA 4WD5A 1ND4A 2O5KA 2P2IA 4M68A 4YJNA 2OLCA 3F7ZA 3W18A 2Y0AA 4TYJA 5HBEA 5HVYA 4BBFA 5IMXA 2GHGA 4QMMA 3R04A 5IG1A 1PJKA 2WMWA 4I94A 1UU3A 5LMAA 5HNIX 1ZYJA 5GJFA 3GCVA 4QT1A 2PUPA 2P3GX 4UZDA 3HA6A 3KF4A 1L3RE 3P78A 3VS6A 3KRRA 3F69A 3ACKA 5A4TA 4E7WA 3EFJA 3PA4A 4IHPA 4X2JA 2R3KA 4QYEA 4BIDA 1Q99A 3TNWA 4WNMA 3KXGA 1UA2A 4AZWA 1IAJA 4R1YA 4CXAA 3MI9A 4XEYA 3TTIA 4FT0A 4L3LA 4OTHA 5FD2A 4IIRA 3DZQA 2OXYA 3KULA 1VR2A 3EQCA 3FLYA 3W1FA 1DS5A 4YZBA 2BIYA 4D9TA 3E3PA 3L1SA 4EONA 3UIMA 3ZXTA 4C61A 5LCJA 3C4CA 4NUSA 5AP6A 4RT7A 1W7HA 5L2IA 3P79A 2FYSA 2CKEA 5EOLA 2VTSA 4QTDA 4Z9LA 2Y7JA 4FYNA 2F4JA 4W8EA 4EZ7A 3BQRA 3FSFA 5KKRC 2WMAA 4U45A 4GFMA 4M14A 4BDEA 2Z2WA 4QPAA 3VUDA 2R3GA 3MFSA 2ZVAA 1YXSA 4MWHA 4XV2A 3VS3A 1P14A 4QP3A 3HYHA 4JDIA 3WBLA 3NNXA 1CTPE 2W7XA 3EKKA 3P08A 3EN7A 4S31A 4A9YA 3UC3A 2BTSA 4BFMA 5HD7A 3G6HA 4ZJIA 3IQ7A 3LJ0A 2ACXA 4QPMA 5H3QA 4QMSA 1LEWA 1PRYA 3TUCA 2I0VA 4ANOA 2H8HA 3B2WA 3NZ0A 3VUKA 2QG7A 3OOGA 2OXDA 4XP0A 4O7NA 4FT9A 5EH0A 4YLLA 3OT8A 2WEIA 2OZAB 3F5GA 5AV2A 4HW7A 4MAOA 4R78A 4RQVA 4KS8A 4IDTA 5FWKK 3TN8A 1YOJA 2NP8A 2WKMA 5AV0A 2BRHA 3UVPA 4MXOA 4ZK5A 3R8VA 4EJ7A 2YM7A 3HV3A 5BUJA 3F2AA 3H3CA 3KMMA 3R2YA 1U46A 2UW7A 3FXXA 3V51A 2W06A 1FVVA 4BIEA 3BQCA 3QWKA 3QYWA 5CSWA 1YI4A 5A6NA 4O0UA 3BGPA 3TNHA 2GCDA 2FB8A 5K9IA 5CASA 2EUFB 2J90A 4WNKA 1NXKA 4IQ6A 2PK9A 3RJCA 4D2WA 4EOPA 1TQMA 4A4OA 3KF7A 2G2HA 3TEIA 5CEPA 3BGQA 3R7EA 3JPVA 4H3BA 2G01A 3UC4A 3AXWA 5EW9A 2OIBA 3BYVA 3PUPA 2ITVA 4GT3A 1DI9A 3UO6A 3LM0A 4GW8A 5CWZA 3HUCA 4HZSA 1WCCA 4XYFA 2GPHA 5DRBA 4BCFA 5KHXA 2VX0A 2QR7A 1ZOHA 4O83A 5EW3A 1CKIA 2GMXA 2QOIA 4FC0A 4FV3A 3I0OA 3NAXA 4J71A 3KRXA 4ZS0A 3SOCA 4JS8A 5DEYA 3ZO3A 4ALWA 2V7AA 5CU0A 4KB8A 5AX9A 4CV9A 1XWSA 3NW5A 4FGBA 1YXXA 4FTTA 4USFA 1NA7A 3QQLA 4FTUA 4FZDB 1L8TA 2QOQA 4OAUC 5EQEA 3OUNB 1BUHA 1VYZA 3VVHA 3UO5A 4YHJA 2C68A 5TT7A 3UO4A 3KQ7A 1REJA 2W1FA 3K5UA 4YTIA 4RWJA 5LMKA 5BX0A 3ZHPC 2YCFA 1UU7A 4AQCA 3I7BA 3ENMA 2NO3A 4DH5A 1OECA 4FT3A 3QALE 3RPRA 5HTBA 2YDKA 3RWPA 4AZSA 4YR8A 2XK7A 3EFWA 5ANEA 2BZKB 4Q9SA 3M1SA 3Q3BA 4RIYA 4PDOA 3CP9A 3MFRA 5CXHA 5G6VA 4TYGA 1OIRA 1H27A 2R2PA 3CPBA 5FQDC 5BUEA 2YZAA 1FOTA 3KMUA 3H30A 3QRJA 4DFBA 4MTAA 3RNYA 4NIFB 2XKDA 2F7EE 4OTIA 3HRFA 2B54A 4JRNA 3R7IA 4RX7A 3RPYA 1OZ1A 4I23A 3HKOA 1Q5KA 3C4WA 3ANQA 4APCA 3V8SA 3U4WA 4IX3A 3LVPA 4RVLA 4BHNA 3CTHA 3O0GA 4IXPA 2PULA 3ZRKA 2BZJA 4AE9A 1JNKA 3MVLA 4FEQA 3UOLA 4OTWA 4AOTA 3BHHA 4XUFA 4YO6A 2VO7A 4C4EA 2C5VA 2W1HA 4IWPA 3ZZWA 4IFCA 5D1JA 2WTIA 4D9UA 5IISA 3CXWA 5CVHA 4H05A 3ELJA 3LKMA 2QLUA 4DN5A 4EORA 4R7BA 4JG7A 3R7OA 4L52A 2VO0A 1WBWA 4K8AA 4XG3A 3VRYA 3HMIA 4CTCA 2DUVA 3GXLA 2QHMA 2H34A 3ZS5A 4CLIA 4CQGA 3FYJX 5CTPA 3CBLA 2QQ7A 4O0TA 4R7HA 5DLSA 3TZ9A 5AR4A 4DEGA 3ZZEA 5FP5A 1PY5A 4C37A 3EL7A 4EOQA 3KMWA 2PPQA 4K18A 3UVQA 4TT7A 3TDWA 1PMVA 1UNHA 2VUWA 1W82A 2OSCA 3EQDA 4H39A 4ERKA 3QTWA 5A14A 5BMSA 4CKRA 5HLWA 4QMQA 2UZWE 2BDWA 5F4NA 5B0XA 3VHEA 3HP2A 5AIRA 4X3FB 2WMBA 2J0MB 4WO5A 4HPUE 4DGOA 1CSNA 2E9OA 4FIGA 5IH6A 4D55A 5IQDA 2C4GA 4E20A 2YIWA 3ITZA 4ZLOA 2GS2A 3A8WA 3ORTA 2XNEA 2VWYA 1B39A 2PL0A 4O2ZA 3ZRLA 2Q83A 4QP7A 2ZV2A 5IKWA 3I60A 5F94A 2ITPA 1Q4LA 3F3ZA 3PXRA 2W5BA 3CSVA 1WVYA 3FPQA 4EYMA 3IDCA 5M51A 4DA5A 5HICA 4MNEB 4QP8A 5HORA 1YXUA 3UQGA 4EUTA 2OZOA 5IUGA 2XP2A 3OTUA 3FYKX 2OG8A 2QNJA 2XBAA 4NM7A 3KVWA 4LOPA 4EC9A 3GQLA 4YC3A 3F2NA 4DTKA 2ZYBA 3KXZA 4RX9A 2Z7QA 5CXZA 3UG1A 2XKCA 3EZRA 3JY9A 3MYGA 4L42A 5J9ZA 3NW6A 2JAMA 1HCLA 3HVCA 3FMMA 2QKRA 3FMKA 3JYAA 5HOAA 3TIZA 2PVYA 3BHYA 3PWDA 3ZC6A 4ANBA 4EH9A 4UV0A 3VWAA 3JVRA 4CSVA 2PZ5A 2VTLA 4QNAA 2ZB1A 3R9NA 3KL8A 2ZDUA 3DKGA 4YLKA 5JGBA 3OG7A 1A9UA 2GS7A 3D7ZA 5EDQA 4ZJJA 4KSPA 5IQAA 4UXLA 3G51A 3ORIA 4TPTA 2Y4IB 4KAOA 2F7XE 3DQXA 2IWIA 2UZTA 2Y8OA 1S9JA 2OH4A 3HL7A 5AP4A 4RFZA 3LMHA 3FLQA 4DGGA 1G8SA 4LOOA 3I5ZA 1PXMA 2VRXA 4N0SA 4E4NA 4QQJA 1U4DA 2H6DA 1H26A 3DU8A 4ZTQA 5AUXA 4O81A 3RK7A 2DWBA 4FVRA 1Y6AA 3BU3A 4D4VA 1LEZA 4DFUA 3LCOA 2JBPA 3IOKA 3MB6A 2UW9A 4I4EA 4FL3A 3IO7A 5CI7A 4DFXE 3F2RA 4L67A 3M11A 2WTCA 4C4GA 4M7IA 3TCPA 5E9EA 4I5HA 4I1ZA 4PL3A 4W9WA 2ZMDA 4FNZA 5BVEA 2ONLA 1AD5A 4IM2A 2ITNA 4U8ZA 3LFEA 4HCTA 4KIKA 4QRCA 3KK8A 4CFMA 2F2UA 4G31A 3VUHA 4NL0A 5HHWA 3NUNA 4JVGA 3MTFA 1OI9A 2YM5A 3BWJA 3K5VA 4OTQA 2CGVA 4UBAA 5FDXA 4BBEA 4JNWA 3WZDA 3EQIA 4DEAA 4OBPA 4B4LA 2Z7LA 5KNJA 3IOPA 4FKTA 3KXXA 1ZAOA 1Q61A 4YUQA 4ZTRA 3E87A 2OJJA 4E6QA 3D9VA 2HWPA 3OFMA 5KX8A 1BI7A 1KE9A 3W2QA 5CZIA 1J1CA 3E93A 3NRMA 4EBVA 1OKWA 3Q4CA 4I41A 3N4TA 3RVGA 3TKUA 5JRQA 3LAUA 1CMKE 1HOWA 3W2SA 5KHWA 5HTCA 4CGAA 3IONA 4YJRA 4FKGA 4ASEA 2P2HA 1H1PA 1OPKA 1W98A 2VTNA 2BUJA 4KKGA 3F9NA 4OLIA 3NSZA 3VBQA 4WOVA 4NCTA 4JBVA 4YJTA 2RIOA 2ZMCA 3IS5A 3DAEA 3DDPA 5CAOA 4FV9A 4A9UA 3C0GA 4JQ8A 1EH4A 2IW9A 2YITA 5ITAA 1KE6A 4LUEA 4BCKA 4DH3A 3HV7A 4W9XA 3C4EA 2OJGA 2YAAA 4AN3A 4F6UA 3QQUA 5C1QB 5HIBA 2JIIA 2XK4A 3L8SA 3OT3A 1V0PA 4FTJA 5ANJA 4OBOA 2IW6A 1YDTE 5HG8A 4LOQA 2ZOQA 3VW6A 4EOSA 3LXKA 3ZLYA 3EKNA 3FZ1A 4FSYA 4FV8A 4HCVA 4Y73A 4MQ1A 3VS5A 3FJQE 4LQMA 3LXLA 5JFSA 1JKKA 3FI2A 5BYYA 2C1AA 3DBEA 3GU8A 3LHJA 2EVAA 4X2NA 3FC2A 1R0PA 5HZNA 4QTEA 4FL1A 4JDJA 3M42A 2I0HA 4MVFA 1DAYA 4DH8A 4D0WA 5AR3A 2HCKA 2XK6A 4GSBA 3K2LA 3BV2A 4BI0A 2XM8A 5M09A 4IZYA 3BV3A 4B8LA 4YO4A 3DAJA 2XVDA 2CKOA 4NM3A 3OBJA 3ZXZA 4O96A 4JLCA 2W5AA 4CG9A 4Q2AA 4IADA 3Q60A 3IGOA 3NYVA 3GB2A 4K77A 4S34A 3LXNA 4JIKA 3EQHA 2QVSE 4C4HA 5FEQA 5CENA 4FTLA 5L2TA 4C4IA 4XG6A 4HGSA 4AFEA 2VTHA 4B99A 3S4QA 4G1WA 2JKQA 4NFMA 4BTFA 4AZEA 1KE7A 3KKVA 3OY1A 4JG6A 2XUUA 2X2KA 1KE5A 2C6KA 3QRKA 3R7YA 4BDJA 1RQQA 4O7SA 4DH1A 2CCHA 4XMOA 1YWNA 2OXXA 4YJOA 4J98A 1GIIA 3SC1A 1I44A 3HEGA 4LV8A 4D1XA 4IZ5A 2BRBA 2WMXA 2B9FA 2JBOA 4FKSA 4NKSA 2W4KA 3OC1A 4XRLA 4TN6A 2BTRA 5DOSA 2C6DA 3RWQA 2F49A 1WZYA 2PZYA 3MA6A 5AV1A 2VO6A 4BKJA 4K2RA 5B2MA 5J5TA 4E5BA 2R3LA 3SRVA 2V0DA 2X6DA 2YCQA 3UJGA 3KY2A 4CG8A 2VO3A 2ETKA 4ITHA 4QMYA 3LFBA 1HCKA 3EQRA 4FOCA 3GCPA 4WBOA 3NPCA 4XV9A 3MVJA 4MNEA 4UMPA 5TOZA 3WI6A 5LOHA 2BFYA 2C6EA 3VUTA 4A4XA 2ZM4A 4C57A 4ZSAA 5KO1A 5IQEA 5KUPA 2W5HA 3HV4A 4JX7A 4CKIA 3F61A 3HAVA 5HEZA 2YWPA 4P4CA 4FV2A 3E8EA 2DQ7X 2O64A 3FWQA 4ZZMA 4BDHA 4Y83A 4RSSA 4UMUA 4ZEGA 1YQJA 1YHWA 2VTTA 3SW7A 4EOIA 3IPHA 5GIOE 2JKMA 2QD9A 4X3FA 5CU6A 3QRTA 1UU9A 3DJ6A 3TV6A 5GNKA 3ULIA 4EH7A 3R1NA 4F1OA 3WILA 2PVFA 5IH5A 1T45A 3KGAA 4C4FA 1IA9A 4F1MA 3RP9A 5F1ZA 3W32A 5FXQA 2J4ZA 3EQBA 3MH1A 2WQEA 3L9PA 4IB5A 4GCJA 4WUAA 4A9TA 4YTCA 4QQ5A 5AMNA 3VULA 2XK9A 5IEYA 2XYNA 1Q8UA 2FGIA 3GOKA 2J6MA 4AZTA 4EK3A 3PZEA 1GIHA 4BTJA 4BR3A 4QMUA 3H9RA 2PU8A 4I92A 3NR9A 4RJ8A 2QOHA 2VWBA 5AIKA 4AG8A 4ZZOA 3DTWA 4EH8A 2RFEA 4E8AA 2JDRA 4E3CA 4YZDA 5AM7A 4CZYB 3LLAA 4DE4A 3VS2A 5DRDA 3LFNA 1W0XC 2BAQA 2QHNA 3BLHA 4UALA 2Q0BA 1PXKA 4FVQA 4IAYA 4YZ9A 1CDKA 5CNNA 4I5CA 3R21A 4V04A 5C8KA 1A48A 4D2TA 4B9DA 4I0RA 4C35A 3QBNA 4OT5A 1ZYLA 4JG8A 4W4YA 4D0XA 4E6AA 2R0IA 1FGKA 3REPA 2YJRA 2WMQA 4MNFA 3WE4A 2BKKA 2VWUA 3QA0A 3SQQA 5C26A 3PXZA 3A2CA 3LMIA 4BYJA 4GK2A 1CKJA 3LE6A 4L46A 5HBJA 3BKBA 1WBSA 4ACCA 4O27B 2AYPA 2J0LA 3IK3A 4LM5A 3LLTA 3OXZA 4AGCA 4NFNA 5BNJA 5BVKA 4QMXA 4EJNA 4RLLA 3MH0A 4BVUA 2WTKB 4C4JA 4O0YA 3EOCA 4EOOA 5LVOA 5I3RA 3Q6UA 3T9TA 4W4XA 4S2ZA 5DEWA 3NYOA 3RZBA 2OGVA 4FKIA 5A3XA 3PVUA 3RM6A 2OW3A 2CGWA 5M57A 3NVKI 5B2KA 4O7YA 3WZUA 4U6RA 3O8TA 1YXVA 2E9PA 3QQFA 4U40A 5ANGA 4BDGA 5JK3A 5EYCA 4J1RA 3U51A 2O8YA 5TF9A 2F57A 3UP7A 1OB3A 5DG5A 3HMMA 3D7TA 1SNXA 4BI1A 2XKFA 3PIZA 2PVHA 4MBIA 4E26A 3MJ2A 3VUMA 4CNHA 5GZ9A 4GS6A 5EYMA 4P90A 3SXRA 3MH2A 4CFVA 4FVPA 4XG8A 4FUYA 4C2WA 3LCKA 1M2RA 5CSHA 3P0MA 3GT8A 4FTNA 5AR5A 3VS4A 5CY3A 2UZBA 3OCTA 4C36A 3JR1A 3TNIA 5C4LA 3ZH8A 1SNUA 2YM3A 1XH9A 2I0EA 3QC9A 5T3QA 3UPZA 1AGWA 3RCDA 3BE9A 2YJSA 4UWBA 3TJDA 4BTKA 5AWMA 3N9XA 2QO2A 3A61A 4YJPA 1BL7A 2BHHA 3AC3A 3UOHA 2B7AA 4CFUA 5I9XA 4RRVA 3ZOSA 3DFCB 4UMRA 5BVDA 4DLIA 3FMJA 3I7CA 4J96A 5E8TA 3Q9WA 3TNQB 3TZ7A 3R1QA 3UTOA 4DCAA 4JI9A 5AP1A 4I6QA 5FGKA 2PVKA 2RG6A 4R1VA 4H3PA 3SX9A 4Z7HA 2JDVA 4UXQA 4YJVA 1GZOA 5E8WA 5AADA 4IM3A 1YOLA 3ZO4A 3ZONA 2O63A 1O6YA 3EH9A 3FKOA 4KKHA 2W96B 2VZ6A 1OUKA 4QYGA 4BHZA 4RVKA 4IE9A 3COMA 4MF1A 5LMKC 4IDVA 4JDKA 2CN8A 3T9IA 4KIQA 4X3JA 4YLJA 1YOMA 4OUCA 4RA5A 2IZTA 1H0WA 3WF7A 2RFNA 1SVHA 3Q4ZA 3RGFA 5CALA 3R73A 3O2MA 4NWMA 3R83A 5CT0A 1OBGA 2GSFA 3IDBA 4EQCA 5IA1A 1YHSA 1KV1A 4P5ZA 3RK5A 2BRGA 2FVDA 5FBOA 3MPMA 1ZLTA 3WZKA 3C0HA 2UW5A 1H1RA 5TO8A 4MBLA 4I5MA 1XQZA 4UEUA 4PQNA 5IDNA 3QD0A 1R78A 3QD3A 3E88A 2XIZA 3EHAA 3L9MA 1H01A 5LQFA 5CZHA 5EQYA 1URCA 1YKRA 2C3IB 3EWHA 3OF0A 5CAQA 1IASA 3OZ6A 3QKLA 2HXQA 2QKWB 4GL9A 3HGKA 4M66A 3V5LA 3ZLWA 4AGUA 4USEA 1KOAA 1OIQA 2OFUA 3NAYA 4G3FA 5J87A 3RBWA 3ZM9A 5E8UA 5KMLA 1ZMVA 4HVDA 1WVWA 3LCSA 3Q4TA 1KV2A 3QYZA 4BYIA 1JPAA 4F08A 4E6CA 3UQFA 2WD1A 5CEKA 1P4OA 2X4FA 2B52A 3VS1A 3ATTA 3FLNC 2VNYA 3FKNA 5HO6A 1M2PA 2B53A 3R28A 4D2VA 4U42A 2W1CA 1Q8YA 2XNPA 2J2IB 2GDOA 4PMSA 1JOWB 2CSNA 3ODYX 4NK9A 4BDDA 2V5QA 1NVSA 3MY0A 5HCYA 3WARA 4XBRA 2QOLA 4TYEA 3IW8A 3LFSA 5FG8A 2BR1A 1SVGA 1M7QA 1WBOA 3DJ7A 1OITA 4KRDA 4R3RA 3MPTA 4G3GA 4DEBA 4GV1A 3ZDUA 3DOGA 3FZSA 3EN5A 3KCFA 4QP4A 4AT3A 4J97A 3ETAA 3GQIA 3ZM4A 4PUZA 3B2TA 3QCSA 5KZIA 4PRJA 4IWQA 2WZJA 1O6LA 2X8EA 3NEWA 4ORKA 4LL5A 3FY2A 2VGOA 1PYEA 4L7FA 5IA2A 4BWXA 2EXCX 3PRFA 4WHZA 3R9DA 3BHTA 3MWUA 4ACHA 4DCEA 3GVUA 3LJ1A 5DVRA 5HIDA 4JDHA 2YABA 4KBCA 4C3FA 5AX3A 2JDOA 5CSVA 4R3CA 3EQPA 3MB7A 4FT7A 3F66A 4I22A 4AA4A 4QP9A 2R7BA 5J8IA 3ZFYA 5I9VA 4EUUA 1ZWSA 2OI4X 3O8UA 1UNLA 4O7TA 4C02A 4GG7A 2WIPA 3O7LB 5E1EA 1PXIA 4PP7A 5J9YA 2GU8A 5FEEA 4YTFA 3N4UA 4BCJA 3RPSA 3F5PA 1K2PA 1OL6A 3CIKA 4Y95A 5IF1A 1OUYA 3PP0A 4NW5A 3F3TA 5A46A 1B6CB 4II5A 2H9VA 3QHRA 3U9CA 5LXMA 2XBJA 3V8WA 3IG7A 3KRLA 3SW4A 2V7OA 3VAPA 1QMZA 3HDNA 3OWJA 4I20A 2WTKC 5K0KA 3AD6A 3UIUA 1X8BA 4EWQA 1JLUE 2HZ0A 3KN5A 3MFTA 4UZHA 2BAKA 4FICA 4EH4A 3LFDA 4GKIA 3H4JA 3QZIA 1Q3WA 4RC2A 2RFSA 5CEMA 2NRYA 4W8DA 4D4RA 4KBAA 4AU8A 2C47A 3GP0A 4TYIA 2X8DA 4O86A 2BDFA 2QU6A 3AG9A 4FTRA 4QMWA 4YZMA 4ZLYA 4NTSA 4BC6A 5IDPA 3GCQA 4CT2A 1NT2A 4MXXA 5AV3A 3NIZA 2XEZA 2FSOX 4RIWA 4F63A 1NW1A 4R77A 3DZOA 4PDYA 3ACJA 2B1PA 4MXCA 1SVEA 3CEKA 5CF5A 5IQGA 3JUHA 3LFFA 3KRJA 3BZ3A 4R5YA 4XCUA 4CTBA 3CQUA 4ALVA 4DBXA 1UWJA 5D12A 3PIXA 3R8MA 3ATSA 3JY0A 4USDA 3OBGA 1J7UA 5FUTA 1ZOGA 2C5NA 2IZRA 4GYIA 4U43A 2GTMA 1K9AA 2HW6A 2VTOA 3P23A 4XHKB 5AJQA 5ACBC 3MESA 1ZXEA 1WBVA 3V01A 4Q9ZA 2YDJA 3DLZA 2WMVA 5L8JA 3U6JA 1AQ1A 5FBNC 5AP2A 3HMPA 1URWA 3GU7A 4IX6A 3HRCA 2WMRA 4ASZA 4HNIA 2BVAA 2WGJA 2AC5A 4OTDA 4M8TA 4ZSEA 5CEIA 4C62A 3BEGA 4EOMA 3OTVA 2YLFA 2R3PA 2XIRA 3P1AA 4BDFA 3OHTA 1Q41A 3OXIA 1E9HA 2CN5A 4YC6A 4DGNA 2WQBA 4IACA 2W17A 5BYZA 4ONAA 1XJDA 3L8XA 2XF0A 3ZYAA 1M14A 2ITXA 4HVHA 1XBAA 2GHLA 4O0SA 4MH7A 4IAFA 3LCTA 4RMZA 2PWLA 1PW2A 3NNVA 5LWNA 2UW8A 4O0VA 4OTFA 4S33A 5H8EA 3H0YA 5DYJA 2EU9A 2BROA 3VNTA 4CMUA 3PY0A 5CANA 4PL4A 2RKUA 3KXHA 3PA5A 3UDBA 1P4FA 4ACGA 2VTJA 4KIPA 4Z16A 3C50A 5IUHA 3A8XA 5GZ8A 4FKJA 4JX3A 1E1XA 1V1KA 4FTOA 3DQWA 4DEIA 4QO9A 1XH6A 4LL0A 5E91A 4FIFA 3DB6A 3V6RA 4GIHA 5IU2A 3GGFA 5M06A 2W05A 2PMOX 4IM0A 1FBNA 3G15A 3NMUF 4TYHB 5EM7A 4QP6A 4E1ZA 3MIYA 1SMHA 2JKKA 4Z3VA 5BPYA 1TKIA 2VWZA 3HMOA 1JKTA 3PP1A 4AN9A 3SD0A 2A0CX 4DINA 3ZUVA 3D5WA 1QPCA 1M17A 3CY2A 5HCZA 3VW8A 4NCTC 2CGUA 2PE1A 4FZ6A 4GU6A 4YU2A 5HI2A 4IB1A 4FMQA 2C6LA 4U9AA 3SXFA 4AN2A 1BL6A 5J9LA 1W8CA 2YISA 5E7RA 3A7FA 4PF4A 2G2FA 3VS0A 3D94A 1Q8TA 4GVAA 5EG3A 2O2UA 5HTIA 2IN6A 4BGQA 2BCJA 4IB0A 1PXJA 3PZHA 3S1HA 3NWWA 2Y6MA 3G33A 2W9FB 4X3FC 3ZSGA 3EZVA 5HU3A 2ONLC 3OS3A 2OJIA 3TT0A 3IECA 5L3AA 1Y8YA 3KK9A 3TKIA 5DPVA 4FEWA 3E8DA 5I9YA 4JRVA 5HE1A 4R7IA 5DR6A 4F70A 4IMYA 3UIBA 5FEDA 2C3KA 3Q2MA 4FV7A 4LI5A 4XV1A 5JMSA 3SG9A 5IQHA 3S2PA 4HZRA 2HZIA 4ZLZA 5ETIA 5L8LA 3PVGA 3VO3A 3V6SA 1Z57A 3A62A 4XS2A 4CZTA 4H58A 2IVTA 3AMBA 4PDSA 5HNGA 4L00A 3RMFA 4EQUA 4L6QA 4AP7A 3I0QA 4J53A 2GHMA 1MRVA 5HIEA 3C9WA 4U5JA 4CFFA 2XJ2A 4H36A 2SRCA 5A54A 4B8MA 1ZMUA 4DITA 3ENHA 3GFWA 1W83A 4HOKA 2WOUA 1JSTA 3EN4A 2ITYA 1QPJA 4KSQA 2PHKA 3ZTXA 3ZSIA 1PHKA 4EOLA 3D2IA 4NU1A 4BDIA 3KVXA 3NYNA 2YM6A 4BCIA 4PPBA 5AP3A 4W4WA 4IW0A 3PPJA 2X7OA 3MH3A 4WRSA 4XG4A 4J52A 3VQUA 4FIHA 3QX4A 2C5YA 3TG1A 1OVEA 2CDZA 2LAVA 1ZRZA 4RZVA 3RZFA 1H24A 3G9LX 4MXAA 4F1TA 1KUTA 3F3UA 5FRIA 2X7FA 4BBMA 4XLIA 3DBDA 4AW1A 3CD3A 4DEEA 4ITIA 2Y9QA 1Q97A 2VV9A 2X4ZA 4DT9A 1H8FA 2UZLA 3PJ2A 3HV5A 3OWKA 3ROCA 4FV0A 1SZMA 5IMEA 2YCRA 4OTRA 1M52A 2XNMA 4IC8A 4MK0A 3CCNA 2AC3A 3DT1A 4NT4A 2QCSA 4D58A 1IAHA 3QTRA 2OBJA 4CT1A 3F5XA 4TRLA 4DBNA 2B9JA 4MD8E 3IKAA 2HZNA 2JIUA 3QRUA 2YIYA 4EH6A 2I1MA 4NJDA 5DH3A 4DGMA 1R3CA 5J79A 3PVBA 5CT7A 3LPBA 4DT8A 4JOAA 4F6SA 1STCE 2UVYA 4AGDA 5J7BA 4PX6A 2QLQA 2B9IA 2ZM1A 5IUIA 3VJNA 5IH4A 2ERKA 2GQGA 4APPA 5TE0A 1G8AA 4Y85A 4O6EA 4PTCA 4FG8A 4JR3A 4XV3A 4X2KA 2OIDA 1H1SA 3TKHA 3MBLA 4FT5A 4BTMA 2JFLA 5KE0A 4RIXB 2QOBA 2WQOA 4D5HA 3EN6A 3POZA 4QQTA 4O7WA 4TWCA 4MBJA 5I0BA 4AW0A 4I21A 2PVLA 2O3PA 4CRLA 5D11A 2JDTA 2XA4A 5CAUA 1ATPE 2CKQA 4L43A 5AP0A 3GEQA 4YHFA 2W1EA 4AT4A 4AOJA 4FSMA 5IQBA 3RINA 5E8VA 4A07A 3Q53A 2XEYA 4HYIA 4F9AA 4GKHA 1Q3DA 3LZBA 3MA3A 4WNPA 4E93A 4L8MA 5K4JA 3V8TA 4AFJA 1RJBA 4QMOA 5L4QA 4G9RA 3CKWA 1PKDA 4WA9A 5CNOA 2VN9A 1JKSA 4XLVA 2R3HA 3RKBA 4UYAA 3VS7A 5ETAA 3E5AA 4X0MA 4RG0A 2JGZA 4C34A 2A19B 4PY1A 1JSUA 3I1AA 1BI8A 4RBLA 2QG5A 4U81A 5T6KA 3V5WA 2W1IA 3AD5A 2WIHA 3FZRA 1OIUA 3PIYA 4BCHA 3Q9YA 4OW8A 4RFMA 3NYXA 3PSBA 4LRJA 3N51A 4O7ZA 1WAKA 5EI2A 3UODA 4K9YA 3VN9A 1MRUA 1WVXA 3B8RA 4F7SA 3G5DA 5EDRA 3T3UA 1WBPA 2J0IA 2VTMA 4J7BA 4QP2A 3SG8A 4OR5A 2HELA 3SKCA 4LMNA 2V55A 2O65A 2YIXA 5M56A 2QOKA 2BIKB 3IW4A 2A4LA 3CKXA 3OUKA 4BKYA 4TZRA 4PL5A 2WEVA 3VHKA 3R9RA 3VIDA 5HQ0A 1YDSE 2PMNX 4ZSGA 2JIVA 4DHFA 1XBCA 2BMCA 3V04A 5L2WA 4AE6A 3COIA 3AD4A 2VWIA 4C8BA 1OKZA 3AQVA 3VBXA 2BKZA 3E3BX 4FKWA 3QD4A 4FIIA 3WF6A 2HXLA 2CNVA 4V0GA 2C3LA 4FV6A 4YJSA 3RI1A 2ZB0A 3KN6A 2IO6A 2YIQA 3CGOA 5JGDA 3OW3A 2CLQA 3BGZA 3GFEA 4GG5A 1J3HA 3WE8A 3SRVB 4BCQA 3BRBA 4O84A 4FKQA 3OCBA 4FZ7A 1OL2A 2PMLX 3HRBA 3OVVA 3R1YA 4EZ3A 2YLEA 5E1SA 5KMOA 4F6WA 1YXTA 4HVIA 4ZJVA 2BHEA 2WFYA 4XNEA 4KBKA 4QTBA 4RWKA 3E7OA 1FQ1B 3JXWA 2HENA 3SGCA 4O1OA 3HV6A 1VZOA 4EBWA 3E62A 4TKSA 3H9OA 4YJQA 3PFQA 1U54A 2Z60A 4L3JA 2OKRA 4ASXA 5HG9A 1TQIA 4M0YA 3R0TA 4TYHA 5EOBA 4O6LA 4GJ3A 3ORMA 4FK3A 1RE8A 3FLZA 3HLLA 3SHEA 3BLRA 4CFWA 4ZP5A 5F20A 2XIXA 3MY5A 3MDYA 3ZDIA 5J1VA 3ZBFA 4U3ZA 3R2BA 3QTIA 3BYOA 5E8SA 3QZGA 5IQCA 3NGAA 4DG0E 3CTJA 4FTQA 5HESA 3COHA 1H08A 3VUIA 3FE3A 2F7ZE 3F88A 5JN2A 3UMXA 2RF9A 5FDPA 4OBQA 2R3RA 3TM0A 1GY3A 5EKNA 3PXKA 4DF3A 4DTAA 2R9SA 5LMBA 1F3MC 2HWOA 3B8QA 2GNJA 3BYMA 3F5UA 3EFLA 3GU4A 4N6YA 5L6OA 4UB7A 3AT2A 3FXWA 3RAWA 4IANA 3IW6A 1M2QA 5CAPA 4AX8A 1P5EA 4MX9A 3FLWA 5D7AA 3OOMA 3GENA 4ZMEA 2W99B 4FIJA 4FNWA 3ROYA 4GRBA 2ZM3A 3VBVA 4EHVA 1LP4A 4KS7A 3ZBXA 3ORKA 3QL8A 3DB8A 4FKPA 3TZMA 2PUNA 1ZMWA 1VJYA 3V5TA 4J8NA 3FQSA 5HE0A 2VTRA 1JVPP 1SM2A 2XZSA 4K11A 3SOAA 4AXAA 3DXNA 3NCZA 2GQRA 1VYWA 4O2PA 5FXRA 3D7TB 4QYYA 2WHBA 2IJMA 3AOXA 5M4CA 1M7NA 3LJ2A 3UMWA 5F95A 3WF5A 3R8PA 3P7BA 2NRUA 5JFXA 1PXOA 3C51A 3ZLSA 3HECA 4Q5HA 4ZOGA 2UUEA 3T8OA 2ERZE 4BDAA 4M15A 2G2IA 5AAFA 5AAEA 2PUIA 1OKVA 4LV5A 5D10A 3ZO2A 2NNWB 3WZEA 3R9HA 3QRIA 2X8IA 3BIZA 3LIJA 3PJCA 4RJ7A 3KC3A 4FKUA 2CNQA 1UU8A 1CM8A 5C8NA 3IW5A 3E8NA 3MV5A 1F5QA 1JQHA 4NH1A 5EHOA 3Q2JA 5AR8A 4CKJA 2PTKA 3DXPA 1GZNA 1BYGA 5KMIA 2E9NA 2HK5A 2OF4A 2XRWA 3UNZA 3W10A 4CFXA 1YW2A 3OWLA 5I3OA 3ZEPA 2ZJWA 3WZJA 5KMJA 3R8UA 3Q5IA 4EOJA 4RIXA 4O38A 2X2LA 4FYOA 2A2AA 3TZ8A 4ZXTA 3ALNA 5AUUA 4ASDA 2UZOA 4RIWB 3TIYA 4ZTNA 5E8XA 3ZRMA 4XP2A 1IA8A 2XCKA 4EK8A 3A4OX 5I4NA 4EH3A 4A4LA 3PE1A 5FTGA 3FLSA 4UX9A 2BAJA 4KWPA 1YI3A 4D2PA 4AUAA 5DBXA 2RGPA 1OPLA 4FUXA 4UWCA 1UVRA 2G15A 4FSRA 3OCSA 4JJRA 3VBYA 3CS9A 2CNUA 4YC8A 4MD9E 3DFAA 4F7LA 4CFNA 4RLKA 5H8GA 4E5AX 4WG5A 1U54B 3KREA 3O7LD 4YBKA 3K3JA 2WPAA 3DCVA 2EXEA 4FTMA 5HE3A 2BZHB 4G6NA 4FZFB 1RW8A 3FDNA 3FV8A 4AW5A 1GZKA 3ORPA 5A4QA 4P7EA
chains in the Genus database with same CATH superfamily
2W0JA 3PLAE 4WNOA 4HGLA 3WIGA 2ETRA 4FTIA 4K6ZA 3LFCA 2W4JA 3NIEA 4KD1A 5AR2A 5CI6A 3DBQA 2QC6A 1GIJA 2P0CA 2QOFA 3U6HA 2W1ZA 5ANDA 4L68A 3PSCA 5KCVA 4L9IA 3ALOA 4GVJA 1PKGA 2FSLX 5BVOA 3ET7A 5HLPA 4YGAA 1BKXA 4PNIA 3E92A 4PPCA 5JH6A 3O50A 3FKLA 3M2WA 5D7VA 1GZ8A 3ORZA 2C6MA 1GOLA 4C2VA 3PXFA 3GNIB 3ZFXA 4FZAB 5DT4A 3QKKA 3DGKA 3LQ3A 4M12A 4GK3A 3W2PA 3Q04A 4RVMA 3SDJA 5K5XA 5AM6A 5E4HA 3UPXA 3W0MA 3R01A 3F3VA 2XS0A 3QXOA 3RAHA 4QD6A 4GK4A 4OT6A 5LARA 5AA8A 3VONA 4FTCA 4FNYA 4JIAA 1MQBA 4UY9A 1BLXA 4PDPA 4YSMA 2R3MA 4BDCA 3FMEA 3OROA 4CRSA 4B7TA 4RX5A 4ZS4A 4C7TA 2YHVA 3FC1X 4RGJA 1K3AA 4WIHA 3QQJA 5FM3A 3BU5A 4AZVA 1XR1A 2WMUA 2UVZA 2IVUA 3PPKA 3QZHA 3I5NA 3W2OA 3MS9A 4HCUA 4RJ5A 3RHKA 2X9FA 3NX8A 2C5XA 2UW6A 3R02A 4HNFA 5KMNA 2J51A 2PE0A 3F3WA 4ACMA 2I40A 2WOTA 4BN1A 3FI8A 4TXCA 2XNBA 1UV5A 3NUYA 4N6ZA 5H2UA 4BIBA 5A4EA 5CU4A 3PA3A 2O0UA 5J5SA 2WO6A 4JAJA 2QR8A 3CLYA 5HBHA 2V62A 1H1WA 3I4BA 1VEBA 5HKMA 3W16A 1TVOA 4M69B 4QNYA 3JS2A 1Q62A 1U5RA 5KMMA 1FMKA 3OXTA 5DT3A 4FE2A 4QMLA 5GHVA 4Z7GA 2X39A 3I79A 4E5WA 3ZMMA 4O7LA 3QFVA 4G6LA 5DGZA 4AS0A 3PLSA 2QODA 3KA0A 3QQKA 3NUUA 4BCPA 4BL1A 3GU6A 3LCDA 3R71A 1OL1A 2XH5A 3L9LA 4JBPA 4MKCA 4M97A 2VTAA 4OTGA 2Q0NA 5A4CA 1KOBA 2GTNA 5EM5A 1JBPE 2JDSA 3UIXA 4IWOA 2UZNA 3EN9A 4X21A 2J7TA 5GZAA 2HY81 3TYKA 1ST4A 1GAGA 2GNHA 2VTPA 5KBQA 2GNIA 4IZ7A 3UYSA 4BWPA 2W4OA 4ZTMA 4WUNA 4X2GA 4XG2A 3CR0A 1QCFA 3RNIA 4YHTA 3RAKA 4Z55A 3QUEA 3RCJA 5EI6A 4N57A 3FXZA 3CC6A 4G2FA 4AF3A 4FV5A 1QPDA 1B38A 2ZV8A 4JT3A 5GIPE 3Q9ZA 2YN8A 4E73A 5ANIA 4L44A 2W9ZB 3R7GA 4F7JA 5EHYA 2E9VA 5EM8A 3C13A 3S00A 2REIA 4NTTA 3ZUTA 4P2KA 2F2CB 4FIEA 2IW8A 3BWFA 4IVAA 1OIYA 4NJ3A 5CYIA 4C59A 4EWHA 5IA4A 2GQSA 4EZ5A 3DTCA 1O9UA 4TNBA 3ZLXA 1JKLA 3CY3A 3QUPA 3DJ5A 2PUUA 3EYHA 2OIQA 3I81A 3POOA 4Y8DA 1E1VA 5FLFA 3UE4A 3FUPA 4AT5A 4XRJA 3OY3A 4IAZA 4O21A 2JITA 4TL0A 1IEPA 2WQNA 3MN3A 2CHLA 3DBCA 4DG3E 5JRSA 5LCKA 3DAKA 3AC1A 3GCUA 3R00A 4OTPA 4G3DA 4K33A 4AXFA 1ZY4A 1J1BA 2JLDA 3A7IA 3PPZA 4G6OA 4MQ2A 4KINA 5AUTA 1G5SA 4ANQA 1FGIA 2FH9A 3QQGA 2Y4IC 3AT4A 1UKIA 4BICA 3MPAA 4FRFA 5CEOA 3AGLA 5DT0A 1YWRA 1ZARA 2XK3A 3HMNA 5HGIA 4CMOA 5CU2A 1ZYCA 5AR7A 4ZSLA 3H9FA 2X1NA 3TV4A 3CJGA 1H1QA 3DKFA 3ZCLA 3Q5ZA 2YAKA 5J7HA 3FSKA 2OWBA 2OF2A 3Q52A 4CEGA 1F0QA 2HAKA 3V5PA 3HA8A 1YHVA 3I6WA 1PMUA 1ZOEA 5EI8A 4MXYA 4YNEA 3UVRA 4FSTA 5C01A 4U79A 4D4SA 3AC4A 3CQEA 2UZEA 4AW2A 1UWHA 3AMAA 3IDPA 4IB3A 4OGRA 5HG7A 4Y72A 3NUPA 1ZY5A 4JBQA 3UDZA 3SV0A 3EQFA 3NVMB 1YI6A 4O7VA 4FODA 2WB8A 4KIKB 3WF9A 4D28A 2A27A 2VWVA 1H07A 2WTWA 2X2MA 3VBWA 4CV8A 3OEFX 4IWDA 1OGYA 3O51A 3D15A 3QXPA 5L6WL 3UP2A 4AWIA 5A9UA 3PTGA 2JFMA 3DY7A 2JD5A 5JFWA 5HX6A 2B0QA 2J0JA 4KIOA 3WF8A 4DFNA 3BPRA 3UQCA 4ZMFA 5IEVA 4XP3A 3LXPA 1LUFA 2YA9A 4WT6A 1PYXA 5J95A 4MHAA 4F0GA 3QTSA 3ANRA 5L8KA 4HPTE 4E4MA 5HO8A 3WYXA 4DAWA 2OZAA 5CVFA 4EK4A 1KWPA 4C38A 1LPUA 2ETMA 1Y57A 3Q4UA 5JQ5A 4CYJA 4XH6A 2G9XA 3TNPC 4DH7A 4IVBA 2XK8A 1MRYA 3W8LA 5M07A 1H25A 4FKOA 4YPSA 4NW6A 2R4BA 2IVSA 4GT5A 2FA2A 3ORXA 4LV7A 3R9OA 2OJFE 4X6QC 4EKLA 2ZV7A 3PXYA 4G17A 4R8QA 4FTAA 5ETCA 4FA2A 5KBRA 3OP5A 4I0SA 1FINA 3EQGA 2R3NA 2VX1A 4MWIA 4FOBA 4IAAA 4TW9A 1RDQE 4AGWA 3BHUA 3P4KA 5LVLA 4YJUA 5DN3A 4D4YA 5BMMA 3KU2A 4BCOA 1U5QA 3MY1A 2VD5A 1J91A 4QQCA 5CU3A 3V5JA 3VF8A 2XNGA 4F9BA 4F9CA 2B9HA 2WQMA 5DNRA 1G3NA 3MTLA 4GFGA 5A6OA 3GC9A 3OW4A 3PJ3A 4JXFA 4N4SA 5CQUA 3BYSA 4JBOA 5HNBA 4DLJA 5AEPA 2UV2A 5IA5A 4X7QA 4LGHA 4RIOA 4BDBA 3TDVA 4G3EA 3H10A 3DKCA 5FTOA 5I9UA 5EDPA 3D83A 5JSMA 5LVNA 4K0YA 4O82A 1J7LA 4LFIA 3PYYA 4QP1A 2YWVA 2OH0E 2OFVA 3O71A 3UZRA 1XHAA 4FV1A 4JMQA 4I3ZA 4U0IA 4NSTA 4ID7A 4WBBB 4I6FA 5E90A 3BL9A 3C5UA 3Q9XA 4QMVA 1JAMA 2FSTX 4HGTA 5LVMA 4KA3A 2JAVA 4O22A 5FXSA 3UGCA 4F99A 2C0TA 2DS1A 2ESMA 3P7AA 4ENYA 4K1BA 3LMGA 4YMJA 4IBMA 3DLSA 4Y46A 3BYUA 2PVMA 2XJ0A 1KSWA 5EHLA 3UNJA 2YFXA 2QI8A 4DDGA 1Q8ZA 2XRUA 4LYNA 4H1JA 4FR4A 3EFKA 4TNDA 4GU9A 4CZUA 5L6PA 4UMTA 3UZTA 4WSQA 3DK7A 2BRNA 3GU5A 4U80A 2FSMX 2I6LA 4XG9A 1R39A 3PSDA 4BY9E 1WMKA 5I5ZA 2RL5A 4IX5A 1JWHA 4M69A 2IZSA 3VBTA 2IVVA 2XJ1A 4LMUA 4DDIA 4FSWA 2EWAA 3FI3A 3R1SA 3D5VA 4IAKA 2WAJA 4YURA 2PZRA 3W2RA 4LGGA 4QDEA 3ZU7A 4Y5QA 5M4UA 4FSZA 4ALUA 3W2CA 4E4XA 1XO2B 4V01A 4RIYB 4CLJA 2HZ4A 5DI1A 2WNTA 5DMZA 3DA6A 2VWWA 2PVJA 5DWRA 1LR4A 4C0TA 2HYYA 3FL4A 3C4XA 3OCGA 2YM4A 5AUWA 3RPVA 4EKKA 2C6IA 3U55A 4AACA 4HGEA 2HOGA 4F9YA 3C4ZA 3PWYA 2PSQA 3NNWA 3HZTA 4PPAA 4GYGA 4I6HA 4AXCA 4R3PA 4XJ0A 4AAAA 2UZDA 3EL8A 2GNFA 5KKRB 2QONA 4BZNA 4F9WA 5C27A 3P86A 4IZAA 5G1XA 1FVTA 4FF8A 4ZTHA 4ENXA 3HDMA 3RTPA 4DG2E 5GJDA 3CD8A 3VJOA 4O4FA 4ZZNA 3A7JA 3G0EA 4KABA 1H00A 3G2FA 3R6XA 2BILB 2GFCA 4Y5HA 5HCXA 3TV7A 4R6VA 4RZWA 2VGPA 3KULB 4O0RA 3DPKA 2YM8A 5E8YA 4C3RA 2AQXA 3EMGA 3NS9A 2FUMA 2X0PA 3PY1A 4S32A 5JT2A 5M53A 1CKPA 1NY3A 4XX9A 5AUYA 3AMYA 3W33A 4IFGA 3K54A 4O1PA 4ZTSA 2PVNA 4CD0A 4D5KA 4EH2A 3BBTB 2EB3A 4RJ3A 2PYWA 3ZEWA 4CCBA 4Q5EA 2Y6OA 3MIAA 3DK6A 3TUBA 1ZYDA 4I24A 2CMWA 4N70A 5EW8A 3WIKA 3RM7A 1Q24A 3TXOA 5AUZA 3NNUA 1NVRA 4FSNA 1H28A 3C1XA 4EHGA 4EHZA 5AUVA 4DEHA 2ITQA 4X2FA 3I6UA 4I4FA 4QMTA 4FSUA 3E8CA 2WTDA 2X6EA 4GEOA 1TQPA 1OL5A 3PG3A 4DFZE 2YCSA 1P2AA 4A7CA 4AQKA 1W2FA 1ZZ2A 1YWVA 4GUBA 5DFPA 3SXSA 5CSPA 4DTBA 5AFVA 1XH4A 4IH8A 3ERKA 4GUEA 4QMPA 3QTXA 4G3CA 3JVSA 1PMNA 2H96A 2ZAZA 3FI4A 2JKOA 3KXMA 4YNOA 5CX9A 4J99A 4RFYA 4HYSA 2R3IA 5DIAA 2HW7A 3GC7A 4DC2A 4GFOA 5M44A 4JQEA 5HG5A 3QCQA 5I9WA 4BCGA 3UDSA 3UOKA 3EB0A 4KKEA 1Y91A 2E2BA 4AOIA 5HO7A 5D41A 3THBA 3QTQA 3AGMA 2R3JA 4TY1A 4BZOA 3QLGA 4BCMA 3A60A 3P7CA 2IPXA 2Z7RA 2C6OA 2VTIA 1PXPA 2P33A 4DFYA 2YIRA 1BX6A 3F82A 4G34A 1WBTA 3GC0A 4JQ7A 4QTAA 1PMEA 1UKHA 5K3YA 4YZCA 4BRXA 4EH5A 4EI4A 5IA0A 5JZJA 2R3FA 5HU9A 1YVJA 5CF4A 2B55A 2VWXA 2RFDA 3F7WA 5EYKA 3VRZA 3QGYA 3PJ1A 4FG9A 4KNBA 4V0GB 4D2RA 5CQWA 2Y4PA 4W4VA 3AT3A 3C7QA 2C5OA 4U44A 3VF9A 3IGGA 1UNGA 2J50A 3QCXA 4H3QA 3GUBA 1OGUA 2E9UA 2QURA 3R30A 5FTQA 2Z7SA 4FEUA 2FO0A 3QA8A 4XBUA 3C5IA 3QGWA 2WTVA 5A4LA 4PP9A 3BELA 2QOCA 4BKZA 5AP5A 2EXMA 4ZY4A 4FEXA 3AC8A 3GI3A 4UMQA 3UBDA 3P9JA 3UDTA 2NPQA 1XH8A 3FHIA 3LW0A 5C8MA 5AAGA 2YZLA 3QD2B 1NVQA 5C03A 5KMKA 2X0GA 4M84A 3PG1A 4TTHB 2Z8CA 1O6KA 4BDKA 5HVKA 3IW7A 1IR3A 4M13A 4PV0A 4QMNA 5C9CA 4B0GA 3D2KA 4QYHA 4C33A 5IA3A 3N4VA 4NM0A 4G5PA 4O4EA 3BBWA 3FQHA 3FZOA 4KRCA 4RWIA 1Y8GA 4YZNA 5FM2A 5CVGA 2UW3A 3CE3A 4ZTLA 2BPMA 5BVWA 4M0ZA 4CVAA 3H0ZA 5ICPA 1QPEA 3PY3A 3CTQA 2UZUE 3GOPA 4NM5A 3LQ8A 3RPOA 4DGLC 2PE2A 5LVPA 5DA3A 3TTJA 3MVMA 3FMDA 3QC4A 3MGYA 2X0QA 2BZIB 2VTQA 4LRKA 4CMTA 2KTYA 2J9MA 4FKLA 4CQEA 3KCKA 1YRPA 3CPCA 4L3PA 2JC6A 4WG4A 2C30A 4RX8A 1KE8A 4EEVA 2KULA 3DS6A 3TUDA 5T68A 3UYTA 3O17A 3VQHA 4RJ6A 5LJJA 3FZTA 4RC3A 4L7SA 2C0OA 4ZY5A 4GIIA 2R3QA 4FI1A 3W55A 4BB4A 3U9NA 3EYGA 3QTUA 3QX2A 4DYMA 3DBFA 3DNDA 5L2SA 3MFUA 4MF0A 3U6IA 2IG7A 5E8ZA 4NYEA 1Y6BA 2G1TA 2XARA 5EM6A 2DYLA 1GNGA 4L53A 3RHXA 3HNGA 4U97A 1OMWA 2PVRA 4LRMA 1ERKA 2BALA 5CEQA 3FEGA 4F4PA 3AC5A 3E7VA 3CQWA 1OM1A 1MUOA 3O8PA 4I0TA 3BLQA 4ZSJA 3ORNA 5JFVA 2X0OA 3HX4A 3TI1A 1J7IA 2OO8X 4JL9A 3ZFMA 4ARKA 3NLBA 5JEBA 2GNGA 3LOKA 2VX3A 4WG3A 4RVTA 5EYDA 3QCYA 3DK3A 3R63A 3BEAA 5LWMA 4QTCA 2VAGA 5FP6A 2J0KA 2YERA 1OL7A 3BU6A 3FZPA 3RK9A 4EK6A 2C3JA 2OJ9A 3FPMA 4HYHA 4ANMA 4JR7A 4RQKA 4QYFA 2GFSA 2OICA 2IZUA 3PVWA 3DNEA 4HYUA 1REKA 2ITWA 3SA0A 1XMLA 3W0NA 4WRGA 3QF9A 1DAWA 2B4SB 3S95A 3PDTA 5EQPA 3D5XA 2I7QA 2J5EA 4XOZA 2CGXA 4O0XA 3ZUUA 4ACDA 2CKPA 4BGGA 4I93A 5JZNA 4ANNA 2CJMA 3E63A 2GNLA 2QO9A 4YBJA 3PE2A 1DM2A 2BFXA 3R22A 5CLPA 4MEDA 3NDMA 3KFAA 5B2LA 4TWPA 1MP8A 2XM9A 4O91A 4X6RA 3W8QA 2GS6A 3SLSA 5BQ0A 2ITUA 1XH5A 3O23A 4IEBA 4NEUA 2ITZA 4GMYA 3SAYA 1WBNA 4H1MA 3WOWA 3ZC5A 5M08A 4FG7A 3GC8A 2C1BA 3EIDA 4RC4A 4YPDA 4HVSA 4GT4A 3ZSHA 3U54A 5EK7A 2UVXA 2XMYA 4FSQA 3QLFA 4L45A 1GJOA 3BE2A 4MCVA 4DFLA 4WKQA 3Q32A 3NUSA 1FMOE 3NW7A 3PRIA 4RPVA 3V3VA 5IZFA 2V22A 3FBVA 3OEZA 5HE2A 3OMVA 3GCSA 5IQIA 3NUXA 3QAME 5M4FA 2QO7A 2R7IA 1FPUA 2WU6A 3II5A 4YSJA 4QPSA 5H9BA 5B7VA 4HVGA 2UW4A 3NCGA 1JSVA 3RALA 2XB7A 4MXZA 3TL8A 3QZFA 5C4KA 3FMLA 4QOXA 4FKVA 4G16A 3MW1A 5L2QA 3KRWA 2VNWA 2J5FA 2X81A 3FY0A 1Q8WA 3FMNA 2XKEA 3LQ5A 2UZVA 3O96A 3OD6X 4P5QA 4U41A 3QUDA 5D9HA 5IPJA 4GJ2A 1XH7A 3TWJA 1H0VA 5M4IA 4YTHA 4A9RA 4MYGA 4O7RA 2C6TA 4D1ZA 4IAIA 3R7UA 4PNKA 1R1WA 2WU7A 3G9NA 4O0WA 4PMTA 5H8BA 5HD4A 4EQMA 5HLNA 3ID6C 3L8VA 4F7NA 4IJ9A 1YDRE 4I5PA 5CSXA 5ETFA 2OU7A 4U3YA 3EJ1A 5K0XA 4L01A 4M67A 3DDQA 4I6BA 4F65A 4TWNA 4IVCA 2R64A 2CLXA 3A99A 2VU3A 2R3OA 3ULZA 4KUJA 5HX8A 4C3PA 3C0IA 3QKMA 4BZDA 3Q6WA 3WYYA 2EB2A 2P4IA 2WMTA 3MJ1A 2WELA 3T3VA 4CCUA 1U59A 1W84A 2HIWA 5K4IA 4J8MA 4AZFA 4BF2A 3C4FA 4LGDA 4FEVA 3D5UA 2WTJA 2LGCA 1OPJA 2C0IA 2XNNA 1APME 1OBDA 2RG5A 4EHEA 5KZ0A 4S30A 3BI6A 2W1GA 5IEXA 3AKLA 3K3IA 3D0EA 3ORLA 4HJOA 4PMMA 4F64A 3RAIA 3BL7A 3QTZA 3BCEA 4E6DA 4D1SA 2JEDA 4D2SA 1Z9XA 3PJ8A 5BYLA 1I09A 5I9ZA 4FTKA 2PMIA 3L9NA 2ZV9A 3FL5A 2CCIA 3A7GA 4JAIA 3D4QA 2WMSA 5ANKA 1FVRA 4BWKA 3DKOA 2OK1A 1PXLA 3ODZX 4F09A 1T46A 4LUDA 4FKRA 4NZWB 5GINE 5CF6A 1BMKA 3CJFA 4OAVB 1V0OA 3SVVA 4M3QA 5EKOA 4CYIA 2R0UA 4EK5A 2Z02A 2A1AB 3OWPA 3PXQA 4MD7E 3S0OA 4ANSA 2PY3A 3G0FA 2HY0A 2BDJA 3P5KA 3BX5A 5AP7A 3TJCA 4BCNA 3E64A 3UOJA 4FV4A 1V0BA 1ZYSA 5TKDA 5J1WA 5DHJA 3D14A 4ERWA 5BUIA 3VC4A 2CPKE 4NKAA 4A9SA 1QL6A 5AA9A 3FMHA 3KXNA 4QMZA 3W0SA 4FK6A 3MSSA 3LM5A 2BRMA 2XIKA 2YACA 2XNOA 3UNKA 4RA4A 2R5TA 1DI8A 4IX4A 3DXQA 3ZO1A 1MQ4A 3UZPA 3UG2A 4UYNA 2C69A 4AA0A 5CAVA 4G9CA 4R5SA 1IG1A 2F9GA 1H4LA 1S9IA 3FHRA 2ZDTA 5DR9A 4NIFA 3F6XA 1PF8A 5GJGA 3U8WA 4LG4A 2QOOA 4FNXA 4RWLA 4XOYA 2XIYA 4EOKA 4EL9A 3KEXA 3AC2A 4XG7A 3R8ZA 4G5JA 4B6LA 4C58A 3W0QA 4UWYA 3A4PA 5ACKA 3A7HA 3VUGA 2WXVA 4ZIMA 2P55A 3QQHA 2X9EA 2QU5A 3GBZA 4FBXA 3TACA 2I0YA 3DV3A 4ITJA 2X7GA 2YEXA 5F9EA 3KIOC 4BI2A 4WSYA 5JQ8A 3L8PA 3HAMA 4PTEA 2RSVA 3U4UA 2NYAA 1XKKA 5JKGA 5IQFA 1IRKA 5M55A 1OKYA 4EYJA 4EC8A 4UN0C 4F0IA 3R8LA 4FX3A 3U87A 2ITTA 1A06A 3QHWA 1Z5MA 3BHVA 3QU0A 4TWOA 3COKA 4IJPA 4DEDA 5TR6A 5E92A 3V5QA 4IC7A 1SYKA 4V05A 3MVHA 3CGFA 2YDIA 2PZPA 3LFAA 5AV4A 3Q96A 4ZAUA 4E4LA 3HUBA 4GH2A 3R7VA 4U7ZA 5ANOA 2UW0A 4J95A 1XBBA 4YP8A 2W1DA 5K5NA 3S3IA 2XYUA 1WFCA 1R0EA 4ANLA 4BGHA 5JGAA 5BVNA 3NUAA 3G90X 5DR2A 4PTGA 4ZY6A 4AA5A 5DE2A 3LFQA 4PMPA 1ZZLA 5BVFA 4A06A 3FAAA 3KB7A 3HP5A 5CF8A 4RJ4A 2AUHA 3FQEA 4PWNA 3G6GA 5CS6A 1PXNA 5EFQA 5HVJA 1W2DA 3QWJA 2ITOA 4F0FA 2PZIA 4FL2A 4FGRA 2XCHA 4IVDA 4WD5A 1ND4A 2O5KA 2P2IA 4M68A 4YJNA 2OLCA 3F7ZA 3W18A 2Y0AA 4TYJA 5HBEA 5HVYA 4BBFA 5IMXA 2GHGA 4QMMA 3R04A 5IG1A 1PJKA 2WMWA 4I94A 1UU3A 5LMAA 5HNIX 1ZYJA 5GJFA 3GCVA 4QT1A 2PUPA 2P3GX 4UZDA 3HA6A 3KF4A 1L3RE 3P78A 3VS6A 3KRRA 3F69A 3ACKA 5A4TA 4E7WA 3NFGB 3EFJA 3PA4A 4IHPA 4X2JA 4I6LA 2R3KA 4QYEA 4BIDA 1Q99A 3TNWA 4WNMA 3KXGA 1UA2A 4AZWA 1IAJA 4R1YA 4CXAA 3MI9A 4XEYA 3TTIA 4FT0A 4L3LA 4OTHA 5FD2A 4IIRA 3DZQA 2OXYA 3KULA 1VR2A 3EQCA 3FLYA 3W1FA 1DS5A 4YZBA 2BIYA 4D9TA 3E3PA 3L1SA 4EONA 3UIMA 3ZXTA 4C61A 5LCJA 3C4CA 4NUSA 5AP6A 4RT7A 1W7HA 5L2IA 3P79A 2FYSA 2CKEA 5EOLA 2VTSA 4QTDA 4Z9LA 2Y7JA 4FYNA 2F4JA 4W8EA 4EZ7A 3BQRA 3FSFA 5KKRC 2WMAA 4U45A 4GFMA 4M14A 4BDEA 2Z2WA 4QPAA 3VUDA 2R3GA 3MFSA 2ZVAA 1YXSA 4MWHA 4XV2A 3VS3A 1P14A 4QP3A 3HYHA 4JDIA 3WBLA 3NNXA 1CTPE 2W7XA 3EKKA 3P08A 3EN7A 4S31A 4A9YA 3UC3A 2BTSA 4BFMA 5HD7A 3G6HA 4ZJIA 3IQ7A 3LJ0A 2ACXA 4QPMA 5H3QA 4QMSA 1LEWA 1PRYA 3TUCA 2I0VA 4ANOA 2H8HA 3B2WA 3NZ0A 3VUKA 2QG7A 3OOGA 2OXDA 4XP0A 2IEWA 4O7NA 4FT9A 5EH0A 4YLLA 3OT8A 2WEIA 2OZAB 3F5GA 5AV2A 4HW7A 4MAOA 4R78A 4RQVA 4KS8A 4IDTA 5FWKK 3TN8A 3AKKA 1YOJA 2NP8A 2WKMA 5AV0A 4LDTA 2BRHA 3UVPA 4MXOA 4ZK5A 3R8VA 4EJ7A 2YM7A 3HV3A 5BUJA 3F2AA 3H3CA 3KMMA 3R2YA 1U46A 2UW7A 3FXXA 3V51A 2W06A 1FVVA 4BIEA 3BQCA 3QWKA 3QYWA 5CSWA 1YI4A 5A6NA 4O0UA 3BGPA 3TNHA 2GCDA 2FB8A 5K9IA 5CASA 2EUFB 2J90A 4WNKA 1NXKA 4IQ6A 2PK9A 3RJCA 4D2WA 4EOPA 1TQMA 4A4OA 3KF7A 5BV3A 2G2HA 3TEIA 5CEPA 3BGQA 4DHZA 3R7EA 3JPVA 4H3BA 2G01A 3AKJA 3UC4A 3AXWA 5EW9A 2OIBA 3BYVA 3PUPA 2ITVA 4GT3A 1DI9A 3UO6A 3LM0A 4GW8A 5CWZA 3HUCA 4HZSA 1WCCA 4XYFA 2GPHA 5DRBA 4BCFA 5KHXA 2VX0A 2QR7A 1ZOHA 4O83A 5EW3A 1CKIA 2GMXA 2QOIA 4FC0A 4FV3A 3I0OA 3NAXA 4J71A 3KRXA 4ZS0A 3SOCA 4JS8A 5DEYA 3ZO3A 4ALWA 2V7AA 5CU0A 4KB8A 5AX9A 4CV9A 1XWSA 3NW5A 4FGBA 1YXXA 4FTTA 4USFA 1NA7A 3QQLA 4FTUA 4FZDB 1L8TA 2QOQA 4OAUC 5EQEA 3OUNB 1BUHA 1VYZA 3VVHA 3UO5A 4YHJA 2C68A 5TT7A 3UO4A 3KQ7A 1REJA 2W1FA 3K5UA 4YTIA 4RWJA 5LMKA 5BX0A 3ZHPC 2YCFA 1UU7A 2IF8A 4AQCA 3I7BA 1G8JA 3ENMA 2NO3A 4DH5A 1OECA 4FT3A 3QALE 3RPRA 5HTBA 2YDKA 3RWPA 4AZSA 4YR8A 2XK7A 3EFWA 5ANEA 4QEBA 2BZKB 4Q9SA 3M1SA 3Q3BA 4O4BB 4PDOA 3CP9A 4RIYA 3MFRA 5CXHA 5G6VA 4TYGA 1OIRA 1H27A 2R2PA 3CPBA 5FQDC 5BUEA 2YZAA 1FOTA 3KMUA 3H30A 3QRJA 4DFBA 4MTAA 3RNYA 4NIFB 2XKDA 2F7EE 4OTIA 3HRFA 2B54A 4JRNA 2AEGA 3R7IA 4RX7A 3RPYA 1OZ1A 4I23A 3HKOA 1Q5KA 3C4WA 3ANQA 4APCA 3V8SA 3U4WA 4IX3A 3LVPA 4RVLA 4BHNA 3CTHA 3O0GA 4IXPA 2PULA 3ZRKA 2BZJA 4AE9A 1JNKA 3MVLA 4FEQA 3UOLA 4OTWA 4AOTA 3BHHA 4XUFA 4YO6A 2VO7A 4C4EA 2C5VA 2W1HA 4IWPA 3ZZWA 4IFCA 1G8KA 5D1JA 2WTIA 4D9UA 5IISA 3CXWA 5CVHA 4H05A 3ELJA 3LKMA 2QLUA 4DN5A 4EORA 4R7BA 4JG7A 3R7OA 4L52A 2VO0A 1WBWA 4K8AA 4XG3A 3VRYA 3HMIA 4CTCA 2DUVA 3GXLA 2QHMA 2H34A 3ZS5A 4CLIA 4CQGA 3FYJX 5CTPA 3CBLA 2QQ7A 4O0TA 4R7HA 5DLSA 3TZ9A 5AR4A 4DEGA 3ZZEA 5FP5A 1PY5A 4C37A 3EL7A 4EOQA 3KMWA 2PPQA 4K18A 3UVQA 4TT7A 3TDWA 1PMVA 3TMOA 1UNHA 2VUWA 1W82A 2OSCA 3EQDA 4H39A 4ERKA 3QTWA 5A14A 5BMSA 4CKRA 5HLWA 4QMQA 2UZWE 2BDWA 5F4NA 5B0XA 3VHEA 3HP2A 5AIRA 4X3FB 2WMBA 2J0MB 4WO5A 4HPUE 4DGOA 1CSNA 2E9OA 4FIGA 1TFFA 5IH6A 4D55A 5IQDA 2C4GA 4E20A 2YIWA 3ITZA 4ZLOA 2GS2A 3A8WA