3GGFA

Crystal structure of human serine/threonine-protein kinase mst4 in complex with an quinazolin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
284
structure length
275
Chain Sequence
IADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVARNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MST4
publication title Structural comparison of human mammalian ste20-like kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 275
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ggfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ggfA01
3OCGA 2ITVA 4CVAA 4OTWA 4NW6A 2WQEA 4WBOA 5CALA 3KEXA 2VNWA 4PTCA 3ZEPA 4F7SA 5AA8A 1U54B 1FPUA 4FKPA 4QMQA 3OT3A 4O0TA 3O0GA 3MESA 3U9CA 5HEZA 5HORA 4O22A 2WNTA 2YM7A 4EOOA 2VGOA 5E7RA 3U6IA 4X2JA 3DB6A 3GXLA 4BCOA 2JEDA 3L8SA 2C6EA 4I41A 3E8EA 1F3MC 3RINA 4J99A 2H8HA 2DWBA 2CLQA 3Q5ZA 1XBAA 2UZLA 3HL7A 4QMOA 3UMXA 5AV4A 3MI9A 4DBXA 4J96A 1GIIA 1WMKA 2R2PA 3HDNA 5CXHA 4E5BA 2R3HA 2H96A 2OG8A 2PMLX 4QQCA 3VBVA 4EC9A 4TYJA 3ZO2A 4IAFA 3ORZA 3PTGA 3H4JA 4FSWA 4KBCA 4WA9A 2NRYA 3MW1A 3W33A 2JDRA 4DH1A 5D1JA 3F2AA 3GU4A 5DNRA 3D14A 4QMMA 1UU8A 4FT3A 2ZMDA 3CY2A 3KMWA 5DE2A 1RE8A 2JD5A 2WIHA 4PTGA 1DAWA 3ALOA 1YOLA 5LJJA 5EOBA 4DGGA 2BTSA 2PVMA 1YWVA 4G3EA 4D1XA 5CT0A 4ZLYA 4NH1A 4A06A 4CFFA 4FV2A 5CU4A 1J7LA 4BBMA 1W0XC 4D1SA 4ZS0A 3PPKA 3EQRA 3Q32A 3P23A 2X7GA 3OZ6A 4YMJA 5AR5A 3C7QA 5DT4A 2GTNA 5LQFA 3CSVA 2OJGA 3AD4A 4DF3A 4ZJJA 1W98A 4UV0A 3IGGA 4C61A 2HENA 3Q52A 3HV3A 4O91A 5M55A 3ZM9A 3DLZA 2PVYA 3A8WA 4B0GA 1G5SA 5CVGA 4BDDA 3KULB 4N6YA 4QD6A 1MQ4A 4BL1A 5K5NA 2B9HA 4KWPA 1ZMUA 3LCSA 5KHWA 5L4QA 1JOWB 3N9XA 1KE7A 3P7CA 4AA5A 3SOAA 3ALNA 4LOQA 2PMIA 4K1BA 4M15A 5AP6A 1SNUA 3L1SA 2WTWA 4KBKA 4RVTA 3QX2A 4AW1A 2V55A 4D2SA 4QP9A 5AIRA 4D2VA 4ZTHA 1XBBA 3SOCA 2YIYA 2YDIA 3EMGA 3MTLA 5DR6A 3FZOA 5KZIA 3RNYA 4IB0A 4PNIA 2OLCA 1CKIA 2HYYA 3KQ7A 5FBOA 3ZSHA 2RGPA 4EOIA 4W9WA 3BHYA 3HV4A 3QFVA 2B9IA 2W5AA 3OG7A 4F0IA 3RPYA 5E1EA 4F70A 2VU3A 4DE4A 5IQGA 3HA6A 3Q9XA 3HUBA 4QYHA 4FKTA 4PP7A 2ONLA 3UZTA 5BPYA 3ZYAA 2JFLA 2WMVA 3C1XA 1ATPE 2IO6A 4FV9A 4HYSA 4G1WA 4FSUA 4KS8A 4QMVA 4TKSA 5EM6A 4BZOA 5BVNA 2O64A 2UZOA 5AP0A 4UMQA 3WI6A 2HAKA 3RAWA 2PK9A 2FB8A 3R01A 2OIQA 2R3KA 3OWKA 3MFRA 3ETAA 3QRKA 3V6SA 3NUAA 4MQ1A 3R1QA 4NFNA 1KWPA 2I6LA 3QRJA 3WZKA 2YAAA 2X7OA 2XS0A 3HLLA 3NIZA 4IC8A 2OF4A 4FT9A 3C0HA 3SRVA 1M2PA 3O51A 2XZSA 3Q04A 1ZYCA 3MFUA 4WIHA 5CAPA 4GG5A 4MNEB 1BI7A 3ODYX 3LFCA 4LGDA 4UZHA 3S2PA 5J79A 3QTSA 2YFXA 4EH5A 4O0WA 2HCKA 4ZZOA 1GIJA 4EHEA 1UVRA 5HIBA 2CNQA 2XKCA 1XR1A 1Q62A 2E9NA 3BKBA 3R2BA 3GU6A 4M97A 4B4LA 4IADA 3KVWA 2X9EA 3QCXA 4HGEA 4OTRA 3OXTA 3HAVA 3BBWA 4DH5A 4ZLZA 3QD3A 1QL6A 3TWJA 1YHSA 3D94A 4JQ8A 3RHXA 3U87A 3BYVA 4IANA 3COHA 3NX8A 4FKOA 5GJDA 3RI1A 3DFCB 4EC8A 5HX8A 1REJA 3D5XA 4IAZA 3DK3A 4YC3A 3EQCA 1UU9A 1ZAOA 4RVKA 5J87A 3UQFA 3U8WA 4U3YA 1H1PA 3E7OA 1W7HA 1KV1A 3FPQA 5E9EA 5AM6A 3ORPA 4JQEA 3UOLA 4IB3A 4FEUA 2JKOA 3LFAA 1CSNA 5CU3A 4FKJA 3RVGA 4M69B 3OHTA 4O6EA 1Q5KA 3ZO4A 4BYIA 3KREA 3UC4A 2JC6A 4TTHB 3MB7A 1FQ1B 5C03A 3AGLA 3R7UA 4EUTA 3TZ7A 1BL7A 2PWLA 3VJOA 5IDNA 3I4BA 1JKLA 2BIYA 2W0JA 4FIFA 3DBCA 4IWPA 3UVRA 5KNJA 3VULA 4DN5A 2XEZA 2IW9A 2RG6A 3ORIA 4U8ZA 4CZTA 1XKKA 2IG7A 2NP8A 4RMZA 3QL8A 4DTKA 5E8YA 3TKIA 1W82A 2QODA 5JGAA 5KMNA 3CR0A 4EBVA 2XNNA 2YCRA 4FV5A 4KRCA 3ULZA 3WF7A 3MH0A 1JBPE 4HYUA 2V22A 1MRYA 3NUNA 3VIDA 2BUJA 3B8QA 5DBXA 4W4XA 4BC6A 5LARA 2NPQA 2P3GX 4JNWA 3N4UA 3VBYA 4L44A 4UN0C 4NIFA 4U41A 3VJNA 2ETKA 4M13A 1H24A 2QO9A 1YDRE 3IW5A 4HCVA 1JWHA 1YXSA 4OR5A 2NO3A 4XLVA 2B9JA 2VZ6A 4JAJA 4RFZA 2PULA 2BALA 5FXRA 5M4IA 3FV8A 5HNIX 3R8UA 2GS2A 3R9HA 4EHGA 4R78A 2E9UA 5H9BA 4D4VA 4K33A 2ONLC 3QX4A 3TV7A 3DXPA 3Q4ZA 3HKOA 4WHZA 2ITXA 4RFMA 4AN9A 2CKOA 5CAUA 2C5XA 5HG9A 5HO6A 1PYEA 4XG9A 4DG0E 3S0OA 3EH9A 3BU3A 3OBGA 3UQGA 4ACMA 1PMUA 4FZ7A 1J3HA 1XH9A 1NT2A 4AZVA 4EK6A 3NEWA 2OXDA 3MH2A 4FKUA 4FYNA 3OXIA 4O7RA 2J0JA 5J95A 4U79A 1OPJA 4G3CA 3L9NA 2WEVA 2VTHA 3C50A 3DJ5A 1JSTA 3CEKA 4L01A 2W4KA 3BYMA 3PPZA 1DS5A 2ITQA 1NVQA 4QNYA 3NR9A 3HMPA 4D2TA 5HICA 4H58A 3KRRA 3E87A 4L8MA 2EVAA 3U9NA 4ANOA 3AQVA 5LMAA 3WIKA 4IX6A 4TW9A 5IQAA 2C4GA 2G2IA 3NGAA 5CU6A 2GFCA 1SMHA 4CMTA 1YI3A 4I0RA 2JBOA 2HK5A 3C51A 4OBOA 4GL9A 1R0EA 3VHKA 3QTQA 4O6LA 4UWBA 3PSCA 3QRIA 2A19B 3WF8A 4AUAA 5LMBA 4FSYA 4U81A 4C7TA 1YHWA 2F9GA 4O7TA 2J51A 5HI2A 3JPVA 3F3UA 3OVVA 5DEYA 4AOIA 2UZEA 4EH7A 1AQ1A 5HLWA 2R3GA 4CZUA 3SKCA 2QOIA 4X6QC 1TVOA 4WO5A 5ETCA 4IFGA 1H28A 3T9IA 1SYKA 4ZJIA 3PXKA 2VUWA 3A4PA 4FSMA 4EI4A 3PXYA 3PVWA 1XJDA 3IG7A 3V8WA 4Y5HA 2WHBA 4ZSLA 3R7OA 2VNYA 4PMPA 2VO6A 4L52A 2I0VA 3PY0A 1Q97A 2WB8A 4BKYA 4U40A 2XK8A 4O2PA 5CAOA 2E2BA 2W4OA 2J2IB 2XCHA 1YXTA 2W7XA 3CD3A 5M4CA 2WGJA 1QPCA 2VTJA 4NM7A 5CZIA 3ZRMA 4RJ7A 3FLZA 4GT3A 3UBDA 2R0UA 3IW7A 2HZ4A 3M2WA 4TWCA 3WIGA 4AA4A 3NW7A 4F7NA 3FI8A 4NTSA 5FEEA 5HKMA 3GUBA 3KL8A 3R7IA 2IZSA 2QU5A 4PL4A 4TYHA 3DS6A 3MY0A 4NFMA 4FL2A 1S9IA 3M1SA 2ERKA 2VD5A 4EOQA 2XK3A 1OECA 3UYTA 5M08A 1Q4LA 3CTJA 5IA0A 2PVRA 4C59A 3I6UA 5IH6A 4NU1A 1PHKA 5F4NA 4RWLA 3TN8A 2PHKA 5H8GA 3JVRA 4L45A 2UZVA 3UP7A 3QD2B 3OXZA 1YRPA 3OBJA 1BKXA 4MD7E 1KE8A 4UZDA 1B39A 3LXKA 1V0PA 2R5TA 3OUKA 2VRXA 4V0GB 4XJ0A 5ANKA 4UMTA 5CEOA 2F4JA 4YJTA 3PVGA 4A7CA 3KXXA 1PJKA 2YN8A 2YJRA 1H26A 4APCA 2BFYA 4M84A 4CRLA 1Q61A 3FL4A 2BKKA 4QNAA 5GJFA 4MKCA 2A0CX 3ZLXA 4CLIA 3GENA 3VVHA 2BROA 1OZ1A 1YQJA 3BHVA 4B99A 3Q4TA 2H9VA 2RFEA 2XM9A 3I7CA 4JRVA 5F1ZA 4P7EA 4O7ZA 2R3IA 4FKRA 4OBQA 3TNQB 4BDBA 4BDGA 4DYMA 1KSWA 1WBTA 3OMVA 2C6KA 2QR7A 3KFAA 4TNBA 4PL3A 5E8WA 3W10A 4G6OA 2R3LA 3WZJA 2E9PA 4CFWA 3F66A 3PSDA 2OZAA 5I9YA 1JNKA 1U5QA 3TT0A 4MH7A 4ASZA 5IA2A 4QMPA 4ONAA 5HVYA 5EYMA 4FKQA 3RK7A 2XJ2A 3CKWA 4U9AA 5DMZA 2QHNA 3MGYA 4RFYA 4PPCA 1QCFA 4BVUA 1IEPA 4IDTA 1QPEA 2WQBA 3KXZA 2Z7SA 5EYKA 3BPRA 4R8QA 5FM2A 2GSFA 4KA3A 4M68A 2XNMA 5CI6A 4FEXA 5IQBA 3FLWA 2EUFB 2PE0A 3BHTA 3Q9ZA 3O71A 3FAAA 4GUBA 3TTJA 5A6NA 2DS1A 5HCXA 1YI4A 3L9LA 1YKRA 2WQOA 4JX3A 4KUJA 2QOFA 4HNIA 5HTBA 3UVPA 5M53A 3EL8A 3HV6A 2WPAA 2QR8A 5BUIA 1JQHA 1M7QA 3BLHA 2CNVA 4F9CA 4W8EA 2QOQA 1BLXA 4DT9A 3UPXA 3UC3A 2VWYA 3DLSA 2VN9A 4DEGA 4R77A 3UNJA 3K2LA 5IPJA 4YURA 2PZPA 1PXPA 5M4UA 4S33A 4ALVA 4F09A 3RWQA 2O0UA 2WMUA 3R6XA 3GQLA 4QYEA 5ANOA 2QURA 3FC2A 4NK9A 3WE4A 4QQJA 3CS9A 2FVDA 3NSZA 4C33A 2WTVA 1OPLA 4FF8A 4UMPA 4G3DA 1R39A 2C6DA 3V5QA 4JBVA 4PPAA 1OL1A 3SW4A 3OOGA 2C68A 2WAJA 4IM3A 4PUZA 4Y85A 3ULIA 5EKNA 3A7FA 4DTAA 5CENA 3LMHA 2HW7A 1OMWA 2WMRA 4M66A 5IUIA 3BEAA 2G2HA 4FG8A 1ERKA 3LMGA 1H8FA 3C4ZA 3VWAA 3LVPA 2F7XE 3KN5A 5ANIA 5H3QA 3ZRLA 5IUGA 4IAYA 2X4ZA 3Q6WA 3SXFA 5A4EA 5B0XA 1J1BA 3OF0A 3AC1A 3R30A 1XH6A 5ANEA 4B9DA 2C0TA 2PVLA 3KRWA 4QTBA 4FV1A 4R3RA 5E90A 2YWVA 4O7SA 2ZDUA 2GHGA 2QI8A 1STCE 5KMMA 3RM6A 4QP3A 1ZRZA 4J98A 1Z5MA 3H30A 3G9NA 4USDA 5LVPA 1DAYA 2W1IA 5AMNA 3IK3A 3ITZA 3ZOSA 2WQMA 2LGCA 3KGAA 1XBCA 4YNOA 4YBJA 4EOPA 3D2KA 4R5SA 4WOVA 3JXWA 3ROCA 3OW3A 4GIIA 4RX8A 2XYNA 4TY1A 2C3IB 3VS5A 4AGUA 3OWLA 2JIVA 3PG1A 4WBBB 5HO7A 4I3ZA 3P7BA 3TZMA 2H34A 4D2RA 4QO9A 3O8UA 3QQJA 4RJ5A 4YU2A 5KHXA 2GQSA 3LE6A 4R7HA 2IN6A 3GOKA 4BZDA 5HX6A 3KXHA 4C36A 1VZOA 4RQVA 4C4GA 4CD0A 4HW7A 3QRUA 4M0YA 5EM8A 3CTQA 3RWPA 3FLNC 5BUJA 5D11A 2DQ7X 3NVMB 3L8XA 3KXGA 3NWWA 5IA1A 2YWPA 1JKKA 2WMAA 2Z7RA 3G0EA 3HV5A 4IE9A 4ZOGA 4FIEA 4ID7A 3EOCA 2J50A 3BU6A 3PJ1A 3E8NA 2YM3A 3DBFA 4R3CA 3U54A 4OTIA 2R64A 4LGHA 4L53A 3AMYA 3D7TA 4YLJA 5KKRB 2Y4IC 3U4UA 1V0BA 4IB1A 3PJ8A 3UE4A 1E9HA 4A9UA 4L42A 2CGUA 5HIEA 1IAJA 1ZOHA 1UNLA 2VO7A 4QMSA 3C4WA 5D7AA 4KIKA 2JDOA 4U80A 4E8AA 4F6WA 1PXNA 4GVAA 4YHJA 4AP7A 5CYIA 1O6LA 4FT7A 3GOPA 4I6HA 3CIKA 4FG9A 2PUPA 5A4CA 3TKHA 3LFBA 4YUQA 2EXEA 3E8CA 3W2PA 3EL7A 3AC3A 4GCJA 4JBOA 4S2ZA 3W32A 4AGWA 4CFVA 4QTEA 1WFCA 2ETRA 4DFZE 5C4LA 2JFMA 3ZLWA 3Q2MA 2BZHB 3F5PA 4FKVA 4RBLA 3E8DA 3TNPC 2UUEA 3RAIA 3WZDA 4CMUA 1H25A 3PPJA 1GZ8A 3U6JA 2J9MA 3QXPA 3DBQA 3R8LA 4C57A 5CI7A 3QYZA 3V5JA 3IOPA 3RBWA 4OTHA 3Q5IA 3NUYA 3QU0A 3I6WA 4NEUA 4YTIA 4D5KA 4DG2E 5IEVA 4AS0A 3DKGA 2X7FA 4MAOA 3COKA 3THBA 1RJBA 4BGGA 4ZS4A 4FIJA 2XRWA 4F65A 3NLBA 5A4LA 1AGWA 4DHFA 3FZTA 4BCGA 3R1NA 4X3FA 5LWNA 1KE6A 3PIZA 4XV1A 2BDWA 1DM2A 4BR3A 3N4VA 3GC0A 3TXOA 4PMSA 3NNWA 1K9AA 1Q8TA 3KA0A 3NNVA 4TT7A 4JR7A 3ZZEA 4BTFA 4GKIA 4U44A 3RNIA 4ANLA 2CKEA 3IECA 4MNEA 3ORLA 4D55A 5EM7A 3PUPA 3ZS5A 4JXFA 2B0QA 1VR2A 4JG7A 3W16A 2Y0AA 2HWPA 3OOMA 5AUVA 3E5AA 3OTUA 4G6LA 3W1FA 3RCJA 2UZNA 4IAIA 4CV9A 3V3VA 4P2KA 3UJGA 4QQTA 4DFUA 3SX9A 2C6LA 4LOPA 3NUPA 3VS3A 3HECA 2XK6A 1H1WA 3KMMA 4O0YA 2YDJA 2VO3A 3U6HA 4D2WA 5FDPA 3R00A 2XNPA 4X2NA 1ZYDA 2ZM1A 3PY1A 4YJPA 3VW8A 1R78A 5JQ8A 1P5EA 4JOAA 3PP1A 5IUHA 4DEDA 1J7IA 1WAKA 2VTSA 1CKPA 1YDSE 4JBQA 4BI1A 4YSJA 4HVGA 5HQ0A 3GCUA 5TE0A 1NW1A 3SW7A 3LAUA 4ZMEA 5J9YA 4V05A 4APPA 2CSNA 2J4ZA 4M12A 1LUFA 4Y83A 3BU5A 3OCSA 3PLAE 4ZTMA 4GUEA 3DNDA 2W1DA 3A60A 3SGCA 4GYGA 4A9YA 4PRJA 3OWPA 3MBLA 4FV8A 4E20A 5T3QA 4D1ZA 3KN6A 4FUXA 4F9YA 4GG7A 2WTKC 1CTPE 5CU2A 2G2FA 4XV9A 4FTCA 4O82A 4QMYA 5CX9A 3D83A 4EJ7A 2F7EE 2XBJA 2J0KA 4E6AA 5FLFA 5J1WA 3DQWA 3FXXA 5IA4A 5KMOA 1ND4A 2OW3A 4DCEA 5M4FA 2W1HA 4FIHA 3WZUA 1UWJA 2R3QA 4EYMA 4GFGA 5E4HA 3L9MA 2V7AA 4FIGA 5HBHA 4PX6A 2B52A 3G90X 3E7VA 3ET7A 3ZEWA 2B53A 2VTAA 4MWIA 4GK3A 3VHEA 5CY3A 3F82A 4BFMA 1H01A 3JYAA 3QYWA 3KB7A 4JDKA 3Q60A 3L8PA 4FTRA 4YR8A 2F57A 1GZOA 1URWA 2X2MA 2J90A 3FC1X 3AC4A 3LJ2A 3UIUA 2XYUA 5D41A 4BIDA 2F2UA 4M0ZA 4JX7A 3NNUA 4GU6A 4H36A 2EU9A 3F7WA 3LM0A 2VTNA 2XUUA 3H3CA 3MVMA 5HG5A 5HLPA 5CU0A 3LCTA 4X7QA 4H1JA 2OBJA 3ENHA 1L8TA 1CDKA 4RIOA 5IQHA 4KNBA 4L9IA 5EYCA 3CQEA 3HX4A 3GU8A 2WTCA 5EDQA 4XOZA 4D0XA 3V51A 4FKIA 4WNOA 1Y6AA 4EOSA 2R3MA 4DGNA 3VNTA 1P4OA 3OC1A 4X3FC 3TEIA 4JDJA 4G3FA 4CXAA 2OGVA 3DCVA 5KO1A 3ZXTA 1P14A 1PMVA 3T3VA 3MH1A 5DYJA 2JITA 3EKKA 3FZSA 1TQMA 4FV4A 4WRSA 3V5WA 2VTOA 5LVOA 4EZ7A 4RWJA 4ZZNA 2WTJA 4RX7A 3Q6UA 4I23A 5CWZA 4AF3A 4F7LA 3DJ6A 5CEMA 2J5FA 3GGFA 4RWIA 2XRUA 3EJ1A 2WELA 4QMTA 3A7JA 4FGRA 3OEZA 4IW0A 5BQ0A 4RIYB 3FWQA 1Z9XA 5K0KA 4YJNA 3DPKA 2XCKA 5DR2A 3O7LB 1GZNA 3FQSA 5AX3A 5TOZA 3FEGA 4O0RA 5JZNA 4LL5A 2JDVA 3O2MA 3ZH8A 3C9WA 3DXNA 4B6LA 5L2IA 1J7UA 4O7YA 1OUKA 4BCPA 3FZ1A 2YZLA 2HXLA 4IBMA 4EWHA 1ZLTA 3PYYA 2PPQA 1H27A 3KK8A 4ZY5A 3H9FA 5J7HA 5EQEA 1YVJA 4OTGA 5BVKA 3KK9A 2JIUA 4FKLA 4LL0A 1G8SA 3I81A 5CVHA 1SM2A 1ZZ2A 4GK2A 5DT0A 2SRCA 3HP5A 3VRZA 3VN9A 4BWKA 2WU6A 3VF8A 4JR3A 1REKA 3CCNA 3QTRA 3QUEA 3SG8A 3VBTA 2BRGA 3CPBA 1PYXA 4MF0A 4MK0A 5BVOA 4RA5A 5K0XA 4BI0A 1K2PA 4S30A 3DFAA 4BCMA 3PLSA 4LYNA 4OTDA 4IZ7A 4YO4A 2X8EA 4KKGA 4ANQA 2CGVA 4BDKA 3LLAA 4N6ZA 5AEPA 2VTIA 4AU8A 1PXOA 2IZUA 1RW8A 3V01A 3EN4A 3H9RA 3MIAA 4E3CA 2I0EA 1T46A 1UNGA 5E91A 4L6QA 2HELA 3HDMA 1ZXEA 3PSBA 4GS6A 2FSTX 4V0GA 4FTLA 3ZLYA 4AW2A 5FTGA 2IVVA 4JG8A 4IVAA 5HIDA 3A7IA 3HRFA 2X1NA 4IWDA 2HW6A 2CCIA 4QMUA 3LMIA 4YTFA 4QMWA 3DDPA 4RX9A 2REIA 5CF6A 3B2TA 1RDQE 3K54A 1OGUA 1IA9A 2CHLA 2XIYA 4CMOA 3FMMA 3VF9A 3KCFA 5BVWA 3TZ9A 2GQGA 2IZRA 2OWBA 3A2CA 4HNFA 5AJQA 4NJ3A 2WMSA 4AN3A 2HY81 3IDBA 4UB7A 1H07A 4C4FA 1UKHA 3A8XA 4EQCA 3HMIA 5JFVA 4O0SA 4GT5A 3K5VA 3FLYA 4A9RA 3ACKA 4FG7A 2QOKA 3RMFA 2B7AA 2FUMA 3BX5A 4JAIA 2QQ7A 3TUCA 5FP5A 1NVRA 3PE1A 3QALE 1R0PA 4RSSA 5IMEA 3PXRA 5J5TA 2V0DA 4JVGA 5M44A 4ZTRA 4I0SA 4AT3A 3ZC6A 3WF5A 5IMXA 3VW6A 3UPZA 1V1KA 3IDPA 2WFYA 3BE9A 4FKGA 3EQPA 3ZXZA 2OH4A 3ZDIA 4PTEA 1UNHA 3NYXA 1M2RA 4KBAA 4QYFA 2LAVA 2XJ1A 3MFTA 1FINA 2ZDTA 3LPBA 3TV6A 4CNHA 3UQCA 4W9XA 4O0VA 4I22A 3FMKA 3GCSA 1R1WA 5BVEA 5AIKA 4WNKA 4DEBA 3FLSA 5HE0A 3I5ZA 4D2PA 4BY9E 1GIHA 4AT5A 3OS3A 4DFYA 4R1YA 2XVDA 2ZYBA 2C0IA 4U43A 4DT8A 3GCVA 4DG3E 2OXYA 5LMKA 4ANNA 4AOTA 5HGIA 3LXNA 2CN5A 3MWUA 4YJUA 3FYKX 2Z7QA 3G6GA 1DI9A 3VS1A 2IPXA 3P08A 2H6DA 3UG1A 3BI6A 1YWRA 4FZ6A 3I0OA 3QXOA 4P4CA 5IQDA 3CP9A 4F1OA 4CLJA 1H08A 2AC3A 4YTHA 4IX4A 3LFQA 3QAME 2BKZA 4H3QA 4QPAA 4YJVA 4EOMA 4NCTA 5IQCA 5DH3A 1FOTA 3NRMA 4XV2A 2R0IA 1MUOA 2W4JA 3R71A 3GFEA 5AR8A 4BN1A 2BDFA 2Z7LA 4NSTA 2BIKB 5GJGA 2J0IA 3BELA 3GC9A 2BRBA 4GFMA 1L3RE 1OL5A 2HZ0A 2OXXA 3PVUA 4IAAA 4RVMA 1OL7A 3GFWA 4FTTA 3W2QA 4TZRA 3RP9A 1ZY5A 2W1ZA 4EH9A 4KAOA 4TWOA 2CKQA 4UYAA 3DAJA 3QRTA 5TT7A 3UOJA 3ZSGA 3R9RA 3E63A 2X8DA 4FK3A 3ZLSA 3EQDA 5CF5A 4FT0A 5AP4A 1Y6BA 4FL1A 4RLLA 2HIWA 4FV0A 5AV3A 3Q2JA 4O7LA 1UA2A 3FMHA 2GFSA 4ZSJA 4O21A 5HNGA 2IW8A 5HE2A 4YZCA 5C26A 5KE0A 4WNPA 4CZYB 2VWZA 3BQRA 4DGOA 5F95A 4XOYA 3HNGA 3MH3A 2WTDA 3RK5A 3FBVA 1GAGA 1PXLA 4GEOA 3R2YA 1VYZA 1WCCA 4MBJA 3AXWA 5BUEA 3MVJA 4A4XA 1Z57A 3LFNA 3NAXA 4FL3A 4IVCA 4LG4A 4KKHA 4RWKA 3RJCA 2PU8A 3PJ2A 2X9FA 5HVJA 3W18A 4H05A 3F9NA 4HJOA 3II5A 4DTBA 3R9DA 3FKLA 3SD0A 3FI3A 4WT6A 5AP7A 4QOXA 5C27A 4BI2A 4XCUA 5IQEA 4CKJA 2OF2A 3HMNA 4AFJA 2FH9A 2P2IA 3QCQA 4RIXA 1IA8A 2WOUA 3FL5A 3R04A 4XYFA 4XLIA 4AW5A 4AZTA 5B7VA 5B2LA 2G15A 3SVVA 4LV5A 3R8ZA 4GMYA 4G5PA 4WUAA 4B8MA 4ENYA 4LUDA 4YP8A 3WF6A 4LRMA 4JS8A 3RAKA 3GI3A 2OJIA 5K4IA 2VTQA 3C4EA 4CT1A 1PF8A 2X6DA 1JLUE 4PDPA 5GIOE 5DRDA 1OIYA 4AACA 4E6QA 4FE2A 5IH5A 3OFMA 2ZB0A 5AUXA 5ANDA 2I40A 4O1OA 1UU7A 4XUFA 2WZJA 4BCJA 1WBOA 3HUCA 4ACGA 3ERKA 3GC8A 3NUSA 4W8DA 1Y8GA 5C01A 5JGDA 4NTTA 3EQHA 4DLIA 2JDSA 3DBDA 4U5JA 1I44A 5LVMA 4G31A 4BB4A 5LMKC 3G2FA 5EM5A 3JY0A 3NVKI 2XBAA 4HZRA 4I5PA 2QD9A 3EB0A 3CGOA 4CKRA 4JG6A 3Q9YA 3VC4A 5IU2A 1ZYSA 1O9UA 4ANMA 3C4XA 2G9XA 4ACHA 2C6TA 4LQMA 3C5UA 4F9BA 4FBXA 3HZTA 5BVDA 4DINA 4ZMFA 4BHNA 2O65A 2ZJWA 4OW8A 3HA8A 4ZSGA 3R9NA 5AR2A 4NCTC 5AP5A 4QP2A 4E4NA 2E9VA 2A1AB 4RIWA 3BWFA 4Z7GA 3KVXA 3F2RA 2BAQA 4RGJA 2I0HA 3QC9A 5LCJA 5K9IA 4BKZA 2ACXA 4D4SA 4IZYA 4RC3A 5EQYA 2WEIA 3P1AA 1ZWSA 5FM3A 5ICPA 4I6QA 5EKOA 5A4TA 5F9EA 3CY3A 4N0SA 3VBQA 5J9LA 5ACKA 2F7ZE 4WD5A 3A99A 5IISA 4EHVA 3LFSA 1A06A 4FTQA 4YLLA 1ZMWA 3O7LD 5AUZA 4PMMA 3MIYA 2OU7A 1LEWA 4L67A 5F94A 2RG5A 4RRVA 1PRYA 2GNGA 3F3ZA 5KZ0A 5HBEA 4QMNA 1OB3A 1PXMA 4PDYA 1QPDA 2UW3A 4E4LA 3NAYA 3UNKA 3VRYA 3EQIA 3AD6A 4ZJVA 4ITIA 4BCIA 4YGAA 2UZTA 3HEGA 3PZEA 3IONA 3ZMMA 4DH3A 2CGWA 1WVXA 3ZRKA 4RA4A 3IQ7A 3NYOA 4PPBA 3R7EA 4NM3A 1FMKA 4EL9A 3LQ8A 5KBRA 3DTWA 5FRIA 2HOGA 2V62A 2UVYA 3G51A 4PWNA 5T68A 2X0GA 3G6HA 4IEBA 2EXMA 2O8YA 5D10A 3SHEA 3NCZA 3FXWA 3RCDA 3UVQA 4XMOA 5AP1A 1YWNA 3L9PA 4XP2A 3VUMA 2OSCA 4L00A 4NYEA 1B38A 4PP9A 3MTFA 3V6RA 3COMA 4J71A 5D7VA 3OWJA 3MJ2A 1IR3A 3GCPA 2QO7A 5FTOA 2C3JA 5HNBA 3SLSA 5I4NA 2W1EA 4WKQA 1K3AA 1IG1A 2GNJA 4II5A 4C2VA 4BIBA 2C6IA 5AADA 4G6NA 2XKEA 3M42A 4X6RA 4Y73A 3WYXA 4AN2A 2XKDA 2A27A 1YOMA 2BFXA 2QOLA 2YIRA 4M7IA 4YC6A 5KMLA 2BRMA 3GEQA 3BBTB 1XQZA 5T6KA 3DKFA 3LIJA 4MCVA 3R7YA 2ITPA 3R02A 4FZAB 4ASEA 5M57A 3QLGA 5DN3A 4YHFA 4FNXA 3V8SA 2XMYA 3VS7A 1B6CB 2QHMA 4GJ3A 2HZIA 3AT4A 5KCVA 3AG9A 4DFXE 4USEA 2C30A 2OJ9A 2GNFA 3ZDUA 3CQWA 2BRNA 3PWDA 2IW6A 4BDIA 5CF8A 2CKPA 4EQUA 3H0YA 3UOHA 5M56A 1U46A 2VO0A 4FKWA 4K0YA 3TJCA 3IDCA 3MYGA 2QNJA 3PJCA 3ZFYA 4ZAUA 2XK7A 3HYHA 5CASA 4L3PA 3LJ0A 4E6CA 5CAQA 2ZV2A 4FTAA 4H1MA 4EKLA 5IEXA 1PY5A 4FSRA 2VWUA 4I21A 4C38A 2R3JA 2CDZA 5B2KA 2QG5A 3DKOA 4HOKA 4KB8A 5FP6A 3LM5A 2QKWB 5A9UA 1U54A 3DY7A 3R7GA 3ROYA 2OKRA 2BAJA 2QLQA 2C47A 5FG8A 3O23A 5JEBA 1J91A 4F0GA 3R83A 5L2QA 1XH8A 4NW5A 2VWWA 2ESMA 1OKWA 2BHEA 2ITNA 3EN5A 2JAMA 1YHVA 2A2AA 3BGQA 1XHAA 4RC4A 4WG4A 4GJ2A 4BHZA 5JK3A 3R21A 4ASXA 1OVEA 3U55A 2C5NA 4QP1A 3OT8A 1GNGA 4W4YA 5HESA 2YABA 5AAEA 3MDYA 5GINE 1SNXA 3T3UA 3UOKA 3KU2A 5L2WA 4Y8DA 2PUNA 2OH0E 4J97A 4NIFB 4GK4A 2W5HA 4Y5QA 2NNWB 3F5XA 3PY3A 5IEYA 3EHAA 4XG6A 1JSVA 4KRDA 5JH6A 4FIIA 4HGTA 5CAVA 4FSZA 4OUCA 4CRSA 4GW8A 2XNEA 3QHRA 3ORTA 5EHLA 3TTIA 3VBXA 2BVAA 1XO2B 3ORMA 4YPDA 3S95A 3ODZX 2IWIA 5HG7A 2B55A 3QBNA 5AR7A 5ETIA 2PVJA 3LFFA 2R7IA 5DVRA 2OICA 4Q5EA 5FXQA 3LW0A 5JFXA 4CFXA 3V04A 2UW5A 3QGWA 4OAUC 1IASA 5KUPA 4AW0A 3PZHA 4K6ZA 4MF1A 4EKKA 4NL0A 4QT1A 1A48A 5KMIA 3HV7A 4MBIA 3VQUA 1QPJA 3UTOA 3BV2A 4FV7A 5JQ5A 4MEDA 3VUHA 3ELJA 4PQNA 4YZBA 4EH4A 4DEIA 4EWQA 3KULA 4ZEGA 3OUNB 5FWKK 2PVHA 5A6OA 4ZP5A 5DR9A 3WZEA 2CJMA 4M8TA 4C4HA 4RVLA 3QKKA 3MB6A 3A7HA 4MNFA 2EB3A 4MX9A 3P86A 3OD6X 2YDKA 2CCHA 3C4CA 5EG3A 4AT4A 1OKVA 2G01A 4FTMA 2QOCA 5GZAA 4ACCA 5C4KA 2YEXA 3BQCA 3P9JA 4RPVA 3MV5A 4FKSA 4FC0A 5L6WL 4ENXA 2AYPA 4E4MA 4N57A 3UODA 4QTAA 3AT2A 5JSMA 2FA2A 3PIYA 5JT2A 4BF2A 3W2RA 2YERA 3QUPA 3TM0A 2XIZA 3F5UA 3IOKA 3QQHA 4RG0A 4WUNA 3KMUA 2UW0A 2J0MB 2RKUA 3G33A 5CSHA 3MN3A 3UIMA 5CEKA 4MBLA 3I60A 4D4RA 3DBEA 4IQ6A 2QOHA 3ZO1A 2VAGA 4CYIA 3QTIA 3LCOA 4R6VA 5HBJA 4OBPA 3KCKA 5KX8A 4IC7A 4BCFA 5BYLA 3SQQA 5LVLA 4BTKA 4CQGA 3MJ1A 1PMNA 5E92A 3QHWA 4IZAA 1Y8YA 1BX6A 4TXCA 2YACA 5E8SA 3DB8A 4TYHB 1Q99A 1YXXA 1A9UA 2JKKA 3DAEA 3POOA 1ZOEA 4UXLA 4Q9SA 2WD1A 4ORKA 3QTZA 3I79A 4RJ4A 1FBNA 3EN7A 4I5CA 3R8MA 4BDEA 3NPCA 3DGKA 3F3WA 3SC1A 1O6KA 4DH7A 5AP3A 5L8KA 4I92A 3CQUA 4IJ9A 3GC7A 3PA5A 4FMQA 3AC8A 4YHTA 5FEQA 4ZY6A 4XP0A 4R3PA 4YJRA 1CMKE 4U97A 2OJJA 4ASDA 3PJ3A 4E7WA 4Z7HA 3SG9A 3OCBA 2UW4A 3EFWA 3PP0A 3FI2A 3TACA 4TNDA 2PVFA 2G1TA 3LFEA 2C3LA 4C34A 3U4WA 1ZYJA 1KOAA 3CJGA 3QUDA 4C37A 5GZ9A 5CSVA 1GJOA 3IGOA 3S3IA 1M17A 3A4OX 3CC6A 5DA3A 3BYUA 3CJFA 3VUGA 4MD8E 2B1PA 2ITWA 3R8PA 3ZHPC 4AA0A 4BICA 3FPMA 4K77A 4PY1A 2W9ZB 1ZYLA 4DH8A 4N4SA 4TPTA 4RX5A 4IH8A 4M69A 2A4LA 3UO6A 2PE1A 4ZTNA 2VX3A 1FVRA 4G17A 5AV2A 4FEWA 3AOXA 4GVJA 4KIQA 4NUSA 4FSNA 3BLRA 5CXZA 4IM2A 3EIDA 4O83A 4V01A 2YCFA 3S00A 4R5YA 3UG2A 4BCQA 4BDHA 4LV8A 3LQ5A 4O27B 4IWOA 1HCLA 2R7BA 5CSXA 3KRJA 1YI6A 1M2QA 2VTMA 3KRLA 5CEPA 3PXFA 1W83A 5GHVA 5HG8A 5J8IA 5K4JA 2UW7A 2CN8A 2I0YA 3DU8A 3PA4A 2UW6A 3AMAA 3FXZA 4E93A 3HMOA 2ZM4A 4HPTE 3E88A 4Y95A 3TI1A 3QQLA 3OTVA 1OBDA 2Y4IB 4OT5A 1JVPP 1H0VA 4I5MA 3OY3A 1BUHA 2WMQA 5B2MA 3QQFA 5AAFA 3RGFA 4ALUA 4L7SA 4ZK5A 3KF4A 3VUIA 5HD4A 4O7VA 1WBWA 4W4WA 3TG1A 4UX9A 5IZFA 5BMMA 2AC5A 3FKOA 4C02A 1XH7A 3NW5A 5C8KA 4F7JA 3NCGA 3LJ1A 4E73A 2BZIB 3F3VA 3FMEA 3EN6A 2ITOA 5ANJA 2C5VA 4ZTSA 3T9TA 1Q8ZA 5J5SA 4IZ5A 4X2KA 4I4FA 2BMCA 1EH4A 4LM5A 3RAHA 3MVLA 4AZFA 2VWIA 2XNOA 3FMLA 4M14A 1GY3A 3QQGA 5I9UA 2OZOA 1MRVA 2JKMA 3V5LA 3F5GA 5DFPA 4HGSA 4XHKB 5CS6A 4YZ9A 5E1SA 4C3FA 5LXMA 4O7WA 5HHWA 1XH4A 4NJDA 1LR4A 4C4JA 2W1CA 3FJQE 3KRXA 3A62A 3DOGA 4K2RA 4YZNA 4L46A 3T8OA 4E6DA 4F4PA 4UWYA 2YCSA 4EH3A 4CSVA 4U6RA 4F08A 4EYJA 4KD1A 5AR3A 2P0CA 2Y6MA 3QQUA 5L3AA 2I7QA 1PW2A 3BV3A 4XG2A 2VX0A 3CPCA 4RZWA 4OTFA 4IFCA 4LI5A 4LRJA 4BKJA 4OLIA 4K11A 2YA9A 4KIPA 3ZUUA 3QA8A 4EK3A 3QTWA 2O3PA 3EQFA 2BAKA 1BI8A 2Y6OA 1FGIA 2C6MA 3VQHA 2GDOA 2O5KA 1IRKA 4O38A 5E8UA 4A07A 1QMZA 2P33A 4WSYA 2ITTA 4QMLA 3P5KA 5ITAA 2PY3A 3P0MA 3HRCA 3AC2A 1FMOE 3M11A 4OTPA 1OITA 3IKAA 4RJ8A 5DPVA 3G15A 4MXOA 4H3PA 4IX5A 5DHJA 3LKMA 2UVZA 2VTRA 4GU9A 1H4LA 4EOJA 2GHMA 2OJFE 2F2CB 3MPMA 4M67A 3VS6A 3ZFMA 3FDNA 2ZMCA 4X3JA 4JT3A 5L8JA 3EZVA 2R3NA 4MXZA 4DFLA 4A4OA 5EK7A 4FR4A 4FA2A 2E9OA 3RZFA 5TF9A 3QKLA 4ACDA 4EZ3A 4XG7A 3GNIB 3L8VA 4RJ6A 4L3LA 4LFIA 3CTHA 3FSFA 3H0ZA 4QYYA 5C1QB 4IM0A 2X6EA 5CSWA 2BZKB 4CYJA 4NT4A 5HLNA 4O81A 3UGCA 3COIA 2BZJA 5AUUA 4CFNA 2X2KA 3LLTA 3UYSA 4L68A 5JKGA 2O63A 5EQPA 3QWKA 3S4QA 1PXJA 2DYLA 4ALWA 3D7TB 2WTKB 2FSMX 3V5PA 2IZTA 2RF9A 1TKIA 4DEAA 4U45A 2UV2A 2PUUA 3R8VA 3PVBA 3SXRA 1YDTE 4JJRA 4CKIA 2J0LA 2YIWA 4DITA 5IA3A 3TKUA 2B9FA 3BHUA 4KIKB 4HGLA 3VUDA 4NZWB 4I24A 1U4DA 4GRBA 3R0TA 3RK9A 4DFNA 4FI1A 4DGLC 4FVQA 1T45A 3O17A 4DGMA 3UO4A 3KY2A 5G1XA 1HOWA 4IAKA 2ITZA 2Z60A 4XG3A 2JBPA 5EFQA 3REPA 3DZQA 3GVUA 3HAMA 1ZY4A 4G9CA 1OIRA 2ZV7A 3NS9A 2XH5A 4MHAA 4O0XA 4R1VA 4ARKA 4LUEA 3GU5A 5DOSA 4I5HA 1G3NA 3P4KA 1WBNA 3K5UA 2PZIA 4PDSA 5HTCA 1TQIA 4I20A 3WARA 5EI8A 3FHIA 4EK8A 4ZLOA 2GS7A 3CLYA 2W5BA 3Q53A 4AE9A 1ZZLA 2EB2A 1WVWA 2R9SA 5D9HA 2YITA 4C8BA 1XWSA 1JKTA 1KE9A 4O0UA 3DK7A 2HZNA 2WMWA 4DEEA 2QG7A 4UBAA 5FEDA 3D2IA 5CQUA 5FXSA 3RTPA 5CNOA 2V7OA 4I94A 3ATSA 5M07A 1U5RA 3POZA 4V04A 2YCQA 4X3FB 5IQFA 4ERWA 3EYGA 4B8LA 3MY5A 4WG3A 4AG8A 4G2FA 4FEQA 4LMUA 2NRUA 4TYEA 4O86A 4J1RA 3GQIA 4E5AX 5BYZA 3UP2A 4BTJA 4DBNA 2R4BA 1SZMA 2Z2WA 5CQWA 5HU3A 4DCAA 5EW3A 2PE2A 4ZXTA 1OIUA 3DQXA 3OCTA 1R3CA 4BCNA 2X4FA 3Q4CA 2XIRA 4OTQA 2UVXA 5AWMA 4JI9A 3HP2A 4UWCA 3AGMA 5JMSA 1SVHA 3E93A 2F49A 4JBPA 4XBUA 3W8LA 1KV2A 3K3JA 4J95A 5AUWA 3SA0A 3SV0A 3R9OA 5GIPE 3DAKA 2P4IA 4G16A 4RZVA 3Q9WA 5TKDA 1NXKA 3NZ0A 4QMZA 2PVKA 3R22A 3WE8A 3BCEA 4HVDA 4G9RA 5CEIA 3PXZA 4EORA 3UNZA 4RJ3A 1M14A 1PXIA 4FNYA 2PL0A 4IB5A 2YAKA 3O50A 2C5YA 3ZTXA 3KXMA 4ZY4A 2XNBA 3C5IA 4AAAA 4E5WA 5E8TA 3CD8A 5A4QA 3EFKA 3DXQA 4I6BA 4XX9A 1OL6A 2BDJA 2FGIA 3C0GA 4UYNA 5GZ8A 4ZZMA 3ZO3A 2BCJA 3GBZA 5EDPA 3QA0A 1YXUA 2GNIA 2WIPA 3PIXA 3QZGA 3TNHA 2RFNA 3P79A 4PMTA 2OIBA 4Y46A 3RPSA 3VS2A 2YM8A 3MPAA 4QRCA 4XBRA 3NUXA 4IIRA 4IHPA 2PTKA 2IVTA 2GPHA 2GS6A 3I1AA 4FNZA 4XRLA 3RPOA 4HZSA 1OL2A 3EN9A 4EJNA 2Y9QA 3GT8A 4QP4A 5AV0A 3FZRA 3VUTA 2UZBA 5L2SA 3N4TA 4TN6A 3KF7A 4QP6A 3DJ7A 2PMNX 2YHVA 2PSQA 4JIKA 4HVIA 1LP4A 4EQMA 5HE1A 3Q4UA 2VV9A 4A4LA 5AFVA 3MVHA 4MXAA 3ZBFA 2QVSE 4HPUE 1HCKA 2BRHA 2QO2A 3ORKA 4LOOA 4CV8A 4JL9A 5BX0A 3KXNA 5I9ZA 5IH4A 2KULA 3FUPA 3H9OA 4O2ZA 5H8BA 3O8PA 3MY1A 5EW9A 1YW2A 4JDHA 4BBFA 4BYJA 5IDPA 1AD5A 4UALA 1V0OA 5CT7A 1BMKA 1G8AA 3ZU7A 4KS7A 4EH8A 1WZYA 4D9TA 3W2OA 2FYSA 4U0IA 2WMXA 2Y4PA 1WBSA 3QZFA 1F5QA 2WOTA 3VS0A 3R1SA 2QONA 1IAHA 1ZARA 4JLCA 3F88A 4GIHA 1P2AA 1BL6A 4Q9ZA 3PFQA 4ZSEA 4FODA 3EWHA 3HMMA 3DDQA 2GTMA 3NW6A 4W4VA 3AT3A 2XNGA 5BNJA 3O96A 3OROA 3WF9A 2I1MA 4RLKA 4DAWA 3EFLA 4IVDA 2VGPA 4D0WA 4I1ZA 2ITUA 4J52A 4QYGA 3VBWA 4FV3A 4F1MA 3F7ZA 4O1PA 2IVUA 5HCZA 1I09A 1PKGA 4N70A 4XRJA 1UU3A 2XK9A 5KMJA 1JKSA 3R73A 3W8QA 2C69A 4S34A 3MSSA 3FMDA 4P5QA 4F0FA 2PZYA 3DZOA 2QOOA 4IJPA 2O2UA 2R3PA 5DIAA 4FVRA 2ITYA 4WRGA 3FHRA 5ETFA 4DFBA 5KBQA 4YC8A 2W96B 3IW6A 4G5JA 2XP2A 4PL5A 3RALA 5L8LA 2PMOX 3QTUA 1CKJA 3FYJX 3V5TA 3ZCLA 2YZAA 3NMUF 2ZOQA 3ZSIA 1OUYA 3BEGA 4EH6A 4R7IA 5EW8A 5I9XA 3LQ3A 1GOLA 1ZMVA 1FVVA 4GH2A 5CF4A 1KOBA 3JY9A 3LCKA 4FICA 3IS5A 4DA5A 5AX9A 4KABA 3TIZA 4O7NA 3HVCA 1Q3WA 3FQEA 4I93A 4C62A 1GZKA 4YBKA 5AUYA 2OO8X 3GU7A 1J1CA 3FKNA 4AZSA 4FNWA 4GT4A 5BMSA 4FK6A 3BGPA 4BWPA 3OY1A 1URCA 3D5UA 3SXSA 2VTPA 1M52A 3VUKA 3WOWA 5EDRA 3LCDA 2IVSA 3CGFA 3OEFX 4L7FA 4I0TA 4QPMA 4GFOA 4MYGA 1YXVA 4F9WA 4OT6A 2WMBA 3G0FA 3U51A 3SDJA 3WYYA 5I0BA 3QGYA 4H3BA 4FOCA 3VAPA 5BVFA 3BE2A 2X39A 1DI8A 3LFDA 4AX8A 5I3OA 3GCQA 1PKDA 4KIOA 4NWMA 5ETAA 3JR1A 1Q41A 1OKZA 3EFJA 1Q3DA 3QZHA 4CCBA 4GV1A 2XIKA 4X2FA 4YNEA 5I9WA 4AQCA 2WO6A 3FI4A 4QP7A 2RL5A 5CZHA 3QD4A 3CKXA 2YIQA 3W2SA 4BGQA 2UZDA 2WKMA 3NNXA 4YO6A 3JS2A 2C1BA 2W05A 2W1GA 4FGBA 3BYSA 1UV5A 5LCKA 3ZONA 5EI2A 3ZFXA 2HWOA 3C4FA 4C2WA 2B54A 3CBLA 5DG5A 4A9TA 2C5OA 2OFVA 4EOLA 4UEUA 3UMWA 5HU9A 5J1VA 2UW9A 5IG1A 4IX3A 4BIEA 1LPUA 5L2TA 2R3OA 4ANSA 1Y57A 1JSUA 3EZRA 4UMRA 4FUYA 3ORNA 5I3RA 5A3XA 5LOHA 4AZWA 3VS4A 5IKWA 2VX1A 2X81A 4HYIA 4Z16A 4HVSA 2C0OA 2PUIA 1KE5A 2B4SB 5EHOA 4A9SA 4UXQA 3PXQA 5TO8A 3TZ8A 3GP0A 4E1ZA 4HCUA 4K8AA 3SRVB 1S9JA 3B8RA 3QTXA 4M3QA 2QKRA 3BLQA 3WBLA 2ETMA 3MPTA 4USFA 1VEBA 2GNLA 4JQ7A 5LVNA 4OGRA 3NUUA 2XJ0A 4J53A 4NM0A 4PNKA 2X2LA 3LHJA 4BCHA 4EEVA 3RPVA 5HVKA 5KKRC 3A7GA 3BYOA 1PMEA 1YOJA 3P7AA 2GU8A 3FY2A 5DI1A 3TIYA 3ZUTA 4F9AA 3QZIA 4JDIA 3TJDA 4FVPA 4NKSA 4FX3A 4IACA 4D58A 4FEVA 3ZC5A 4CFMA 5I9VA 2WQNA 3RHKA 4YJOA 2UZWE 3D9VA 5D12A 3E64A 4NM5A 4BBEA 1OM1A 3BHHA 5K5XA 4DLJA 3N51A 5CEQA 4CEGA 1CM8A 4CTCA 2QOBA 4TRLA 3B2WA 4S31A 4Q5HA 4AGDA 2VTTA 2IJMA 4YSMA 1M7NA 3QWJA 2C1AA 4EOKA 5M51A 4MQ2A 4OAVB 3BRBA 2XF0A 5IA5A 5C8MA 4G34A 1H1SA 3IW4A 4FV6A 2FSLX 1MRUA 2ZB1A 4AZEA 5DGZA 4C0TA 2GNHA 3R28A 4HCTA 1JAMA 4AGCA 4B7TA 1PXKA 4DEHA 3QKMA 4XV3A 4Y72A 3AD5A 3UDBA 4XP3A 1WBPA 2C3KA 4P5ZA 2Z8CA 3C0IA 3PG3A 4FT5A 4FTUA 4XG8A 3UIBA 3V8TA 2KTYA 2JDTA 4ZIMA 3ENMA 4F1TA 2Q83A 3CE3A 4HVHA 5FQDC 2AUHA 2P2HA 2OFUA 3EQGA 3FSKA 4I6FA 4JRNA 3F69A 5CNNA 5F20A 4LMNA 4FOBA 4ANBA 4QP8A 4C35A 2BTRA 5AV1A 4CQEA 3UO5A 3EKNA 4YJQA 4YZDA 5M06A 4U7ZA 4YLKA 4BDCA 2P55A 3R1YA 2PZ5A 1FGKA 1X8BA 3MFSA 3BGZA 3KC3A 4MXCA 5KMKA 1OI9A 2BR1A 3D5VA 2Q0BA 5AUTA 3NIEA 2R3FA 2YISA 2CPKE 3D7ZA 4G3GA 4RT7A 2R3RA 4U42A 4RC2A 4WSQA 4F99A 5HZNA 2GQRA 5IQIA 2EXCX 1OIQA 3SAYA 3LXLA 1NVSA 5AR4A 5H8EA 4CTBA 3FE3A 4YJSA 5L6PA 3I0QA 3DTCA 5J9ZA 4UY9A 3KKVA 4FTJA 2BHHA 2HY0A 4RIYA 2JLDA 2JIIA 3LXPA 3OW4A 3DT1A 3PWYA 3BIZA 3R7VA 4D28A 3FZPA 2BILB 3DKCA 5FTQA 1OBGA 4LGGA 3HRBA 4F64A 3DA6A 1RQQA 2XK4A 3O8TA 3QC4A 4XS2A 5DT3A 4QMXA 4E4XA 4MXXA 2QC6A 4AE6A 4O84A 2YIXA 2GMXA 2CLXA 3LOKA 3FY0A 1H00A 3ANQA 4FTOA 3UZRA 3ORXA 1E1XA 2DUVA 2RFDA 3ACJA 5E8XA 5ACBC 3DK6A 4TWNA 2V5QA 4QTCA 4FSQA 2RSVA 5CTPA 5FGKA 1H0WA 5H2UA 3ID6C 3PE2A 4TYGA 2W17A 4XG4A 3WILA 4K18A 1VJYA 4D9UA 4EHZA 2Z02A 4R7BA 2VWVA 1XH5A 4K9YA 1NY3A 3MA6A 4AFEA 4BRXA 5CSPA 5AP2A 2QLUA 3TCPA 5DWRA 5C9CA 1MP8A 3NYNA 4RIXB 4L43A 3MS9A 4YPSA 3FMNA 4FSTA 4EBWA 4ZTLA 3RM7A 4ZTQA 4ITHA 3PRIA 5AM7A 3W2CA 4WNMA 4J7BA 1VYWA 3MA3A 4KINA 5HE3A 3QLFA 4U3ZA 4MD9E 2ERZE 2XIXA 4YZMA 4BDFA 4IMYA 1SVGA 2Y7JA 4PV0A 4PDOA 4MXYA 4E26A 5CANA 5IF1A 5JGBA 1TQPA 5AA9A 4IXPA 4D5HA 2W9FB 2ZAZA 5J7BA 4C3RA 3RKBA 4S32A 4BWXA 1E1VA 3TDVA 4D4YA 1UKIA 3E92A 3I7BA 2CMWA 2XA4A 3PDTA 3F3TA 4CG8A 1W8CA 4EUUA 5JRQA 3BWJA 1KUTA 3NDMA 4C4IA 3JUHA 4QQ5A 3IO7A 3D15A 4QTDA 5DEWA 4F6UA 5CVFA 3S1HA 1U59A 4P90A 2FO0A 2YLEA 2OI4X 4F63A 3W55A 5A14A 4CGAA 2JKQA 2VTLA 4EK4A 2JAVA 4IDVA 4NKAA 3VO3A 4ERKA 5HTIA 4UMUA 2BPMA 4ZSAA 1Y91A 1APME 3E62A 4EK5A 1FVTA 5GNKA 5ANGA 3G9LX 1Q8YA 4BDJA 2GHLA 3OP5A 4RIWB 1H1QA 2Q0NA 3D4QA 3C13A 5A46A 3TDWA 2XEYA 3G5DA 4X21A 5JFWA 1MQBA 2ZM3A 4H39A 2Y8OA 4IWQA 4MWHA 2WMTA 4C58A 1Q8WA 4Z9LA 4QPSA 2YM6A 3P78A 3D0EA 5FBNC 5JFSA 2CGXA 5L6OA 3EQBA 4X0MA 4X2GA 5CLPA 5E8ZA 2QU6A 3FQHA 4XNEA 3DNEA 5HD7A 1H1RA 3JVSA 2PZRA 5EOLA 2J6MA 2OIDA 3BZ3A 4AXAA 5K3YA 5C8NA 3QCYA 4IVBA 3QD0A 4TWPA 4WG5A 5DLSA 3RPRA 3ATTA 2WTIA 4FTNA 1P4FA 2RIOA 4ITJA 3TL8A 4FYOA 1WBVA 4TL0A 4CT2A 3QCSA 2VWXA 2JGZA 3TNWA 2ZVAA 1O6YA 4J8NA 4F6SA 3NYVA 3Q96A 4KKEA 2XB7A 3ZM4A 5HOAA 4MVFA 2OZAB 1OKYA 5FD2A 4J8MA 3TNIA 4YTCA 2XKFA 5HO8A 5AAGA 4CCUA 4BGHA 2OK1A 1BYGA 3IW8A 4JIAA 4MTAA 4Z3VA 3ANRA 2WXVA 4LRKA 3UZPA 4BCKA 3FMJA 3TUBA 5EHYA 5LWMA 4TYIA 4AOJA 4FTKA 4C3PA 2EWAA 2ZV9A 5EH0A 5JRSA 4BTMA 2QCSA 2UW8A 4FTIA 3ZBXA 2PYWA 2FSOX 4I4EA 5BYYA 3UIXA 3E3BX 4Q2AA 2ZV8A 3E3PA 3H10A 5E8VA 4XH6A 5TR6A 2X8IA 2J7TA 5EYDA 4GKHA 3ZUVA 3Q3BA 1F0QA 1SVEA 3HGKA 3DV3A 1ZOGA 3GB2A 3PA3A 4XEYA 4BZNA 4EH2A 4EZ5A 5G6VA 1W84A 5I5ZA 4CG9A 1UWHA 4EONA 4AWIA 5JN2A 2PVNA 1NA7A 3TUDA 3R63A 4Z55A 1WVYA 1OPKA 3CXWA 2W06A 3QF9A 2WU7A 3A61A 4O96A 3ZZWA 3I5NA 1Q24A 1Q8UA 2GCDA 3AMBA 5JZJA 3PRFA 5DRBA 2W99B 5M09A 2RFSA 4L3JA 3LZBA 4FZDB 4DC2A 3F6XA 2C6OA 4KSQA 5HCYA 1LEZA 4C4EA 2CNUA 4PF4A 4GYIA 1JPAA 2UZUE 4GSBA 5FUTA 4CFUA 2VWBA 2YM5A 3FLQA 4KSPA 5A54A 3RZBA 3K3IA 4HYHA 5FDXA 3TV4A 2YM4A 2YLFA 4FZFB 3F61A 3QQKA 2W1FA 2XM8A 3D5WA 2J5EA 3AC5A 3EYHA 5EI6A 2YJSA 4BDAA 4RQKA 2HXQA 3F2NA 3IPHA
chains in the Genus database with same CATH superfamily
3OCGA 2ITVA 4CVAA 4OTWA 4NW6A 2WQEA 4WBOA 5CALA 3KEXA 2VNWA 4PTCA 3ZEPA 4F7SA 5AA8A 1U54B 1FPUA 4FKPA 4QMQA 3OT3A 4O0TA 3O0GA 3MESA 3U9CA 5HEZA 5HORA 4O22A 2WNTA 2YM7A 4EOOA 2VGOA 5E7RA 3U6IA 4X2JA 3DB6A 3GXLA 4BCOA 2JEDA 3L8SA 2C6EA 4I41A 3E8EA 1F3MC 3RINA 4J99A 2H8HA 2DWBA 2CLQA 3Q5ZA 1XBAA 2UZLA 3HL7A 4QMOA 3UMXA 5AV4A 3MI9A 4DBXA 4J96A 1GIIA 1WMKA 2R2PA 3HDNA 5CXHA 4E5BA 2R3HA 2H96A 2OG8A 2PMLX 4QQCA 3VBVA 4EC9A 4TYJA 3ZO2A 4IAFA 3ORZA 3PTGA 3H4JA 4FSWA 4KBCA 4WA9A 2NRYA 3MW1A 3W33A 2JDRA 4DH1A 5D1JA 3F2AA 3GU4A 5DNRA 3D14A 4QMMA 1UU8A 4FT3A 2ZMDA 3CY2A 3KMWA 5DE2A 1RE8A 2JD5A 2WIHA 3W0QA 4PTGA 1DAWA 3ALOA 1YOLA 5LJJA 5EOBA 4DGGA 2BTSA 2PVMA 1YWVA 4G3EA 4D1XA 5CT0A 4ZLYA 4NH1A 4A06A 4CFFA 4FV2A 5CU4A 1J7LA 4BBMA 1W0XC 4D1SA 4ZS0A 3PPKA 3EQRA 3Q32A 3P23A 2X7GA 3OZ6A 4YMJA 5AR5A 3C7QA 5DT4A 2GTNA 5LQFA 3CSVA 2OJGA 3AD4A 4DF3A 4ZJJA 1W98A 4UV0A 3IGGA 4C61A 2HENA 3Q52A 3HV3A 4O91A 5M55A 3ZM9A 3DLZA 2PVYA 3A8WA 4B0GA 1G5SA 5CVGA 4BDDA 3KULB 4N6YA 4QD6A 1MQ4A 4BL1A 5K5NA 2B9HA 4KWPA 1ZMUA 3LCSA 5KHWA 5L4QA 1JOWB 2XAMA 3N9XA 1KE7A 3P7CA 4AA5A 3SOAA 3ALNA 4LOQA 2PMIA 4K1BA 4M15A 4AXCA 5AP6A 1SNUA 3L1SA 2WTWA 4KBKA 4RVTA 3QX2A 4AW1A 2V55A 4D2SA 4QP9A 5AIRA 4D2VA 4ZTHA 1XBBA 3SOCA 2YIYA 2YDIA 3EMGA 3MTLA 5DR6A 3FZOA 5KZIA 3RNYA 4IB0A 4PNIA 2OLCA 4JMQA 1CKIA 2HYYA 3KQ7A 5FBOA 3ZSHA 2RGPA 4EOIA 4W9WA 3BHYA 3HV4A 3QFVA 2B9IA 2W5AA 3OG7A 4F0IA 3RPYA 5E1EA 4F70A 2VU3A 4DE4A 5IQGA 3HA6A 3Q9XA 3HUBA 4QYHA 4FKTA 4PP7A 2ONLA 3UZTA 5BPYA 3ZYAA 2JFLA 2WMVA 3C1XA 1ATPE 2IO6A 4FV9A 4HYSA 4G1WA 4FSUA 4KS8A 4QMVA 4TKSA 5EM6A 4BZOA 5BVNA 2O64A 2UZOA 5AP0A 4AXFA 4UMQA 3WI6A 2HAKA 3RAWA 2PK9A 2FB8A 3R01A 2OIQA 2R3KA 3OWKA 3MFRA 3ETAA 3QRKA 3V6SA 3NUAA 4MQ1A 3R1QA 4NFNA 1KWPA 2I6LA 3QRJA 3WZKA 2YAAA 2X7OA 2XS0A 3HLLA 3NIZA 4IC8A 2OF4A 4FT9A 3C0HA 3SRVA 1M2PA 3O51A 2XZSA 3Q04A 1ZYCA 3MFUA 4WIHA 5CAPA 4GG5A 4MNEB 1BI7A 3ODYX 3LFCA 4LGDA 4UZHA 3S2PA 5J79A 3QTSA 2YFXA 4EH5A 4O0WA 2HCKA 4ZZOA 3UDSA 1GIJA 4EHEA 1UVRA 5HIBA 2CNQA 2XKCA 1XR1A 1Q62A 2E9NA 3BKBA 3R2BA 3GU6A 4M97A 3PFYA 4QEBA 4B4LA 4IADA 3KVWA 2X9EA 3QCXA 4HGEA 4OTRA 3OXTA 3HAVA 3BBWA 4DH5A 4ZLZA 3QD3A 1QL6A 3TWJA 1YHSA 3D94A 4JQ8A 3RHXA 3U87A 3BYVA 4IANA 3COHA 3NX8A 4FKOA 5GJDA 3RI1A 3DFCB 4EC8A 5HX8A 1REJA 3D5XA 4IAZA 3DK3A 4YC3A 3EQCA 1UU9A 1ZAOA 4RVKA 5J87A 3UQFA 3U8WA 4U3YA 1H1PA 3E7OA 1W7HA 1KV1A 3FPQA 5E9EA 5AM6A 3ORPA 4JQEA 3UOLA 4IB3A 4FEUA 2JKOA 3LFAA 1CSNA 5CU3A 4FKJA 3RVGA 4M69B 3OHTA 4I6LA 4O6EA 1Q5KA 3ZO4A 4BYIA 3KREA 3UC4A 2JC6A 4TTHB 3MB7A 1FQ1B 5C03A 3AGLA 3R7UA 4EUTA 1TFFA 3TZ7A 1BL7A 2PWLA 3VJOA 5IDNA 3I4BA 1JKLA 2BIYA 2W0JA 4FIFA 3DBCA 4IWPA 3UVRA 5KNJA 3VULA 4DN5A 2XEZA 2IW9A 2RG6A 3ORIA 4U8ZA 4CZTA 1XKKA 2IG7A 2NP8A 4RMZA 3QL8A 4DTKA 5E8YA 3TKIA 1W82A 2QODA 5JGAA 5KMNA 3CR0A 4EBVA 2XNNA 2YCRA 4FV5A 4KRCA 3ULZA 3WF7A 3MH0A 1JBPE 4HYUA 2V22A 1MRYA 3NUNA 3VIDA 2BUJA 3B8QA 5DBXA 4W4XA 4BC6A 5LARA 2NPQA 2P3GX 4JNWA 3N4UA 3VBYA 4L44A 4UN0C 4NIFA 4U41A 3VJNA 2ETKA 4M13A 1H24A 2QO9A 1YDRE 3IW5A 4HCVA 1JWHA 1YXSA 4OR5A 2NO3A 4XLVA 2B9JA 2VZ6A 4JAJA 4RFZA 2PULA 2BALA 5FXRA 5M4IA 3FV8A 5HNIX 3R8UA 2GS2A 3R9HA 4EHGA 4R78A 2E9UA 5H9BA 4D4VA 4K33A 2ONLC 4DHZA 3QX4A 3TV7A 3DXPA 3Q4ZA 3HKOA 4WHZA 2ITXA 4RFMA 4AN9A 2CKOA 5CAUA 3BL7A 2C5XA 5HG9A 5HO6A 1PYEA 4XG9A 4DG0E 3S0OA 3EH9A 3BU3A 3OBGA 3UQGA 4ACMA 1PMUA 4FZ7A 1J3HA 1XH9A 1NT2A 4AZVA 4EK6A 3NEWA 2OXDA 3MH2A 4FKUA 4FYNA 3OXIA 4O7RA 2J0JA 5J95A 4U79A 1OPJA 4G3CA 3L9NA 2WEVA 2VTHA 3C50A 3DJ5A 1JSTA 3CEKA 4L01A 2W4KA 3BYMA 3PPZA 1DS5A 2ITQA 1NVQA 4QNYA 3NR9A 3HMPA 4D2TA 5HICA 4H58A 3KRRA 3E87A 4L8MA 2EVAA 3U9NA 4ANOA 3AQVA 5LMAA 3WIKA 4IX6A 4TW9A 5IQAA 2C4GA 2G2IA 3NGAA 5CU6A 2GFCA 1SMHA 4CMTA 1YI3A 4I0RA 2JBOA 2HK5A 3C51A 4OBOA 4GL9A 1R0EA 3VHKA 3QTQA 4O6LA 4UWBA 3PSCA 3QRIA 2A19B 3WF8A 4AUAA 5LMBA 4FSYA 4U81A 4C7TA 1YHWA 2F9GA 4O7TA 2J51A 5HI2A 3JPVA 3F3UA 3OVVA 5DEYA 4AOIA 2UZEA 4EH7A 1AQ1A 5HLWA 2R3GA 4CZUA 3SKCA 2QOIA 4X6QC 1TVOA 4WO5A 5ETCA 4IFGA 1H28A 3T9IA 1SYKA 4ZJIA 3PXKA 2VUWA 3A4PA 4FSMA 4EI4A 3PXYA 3PVWA 1XJDA 3IG7A 3V8WA 4Y5HA 2WHBA 4ZSLA 3R7OA 2VNYA 4PMPA 2VO6A 4L52A 2I0VA 3PY0A 1Q97A 2WB8A 4BKYA 4U40A 2XK8A 4O2PA 5CAOA 2E2BA 2W4OA 2J2IB 2XCHA 1YXTA 2W7XA 3CD3A 5M4CA 2WGJA 1QPCA 2VTJA 4NM7A 5CZIA 3ZRMA 4RJ7A 3FLZA 4GT3A 3UBDA 2R0UA 3IW7A 2HZ4A 3M2WA 4TWCA 3WIGA 4AA4A 3NW7A 4F7NA 3FI8A 4NTSA 5FEEA 5HKMA 3GUBA 3KL8A 3R7IA 2IZSA 2QU5A 4PL4A 4TYHA 3DS6A 3MY0A 4NFMA 4FL2A 1S9IA 3M1SA 2ERKA 2VD5A 4EOQA 2XK3A 1OECA 3UYTA 5M08A 1Q4LA 3CTJA 5IA0A 2PVRA 4C59A 3I6UA 5IH6A 4NU1A 1PHKA 5F4NA 4RWLA 3TN8A 2PHKA 5H8GA 3JVRA 4L45A 2UZVA 3UP7A 3QD2B 3OXZA 1YRPA 3OBJA 1BKXA 4MD7E 1KE8A 4UZDA 1B39A 3LXKA 1V0PA 2R5TA 3OUKA 2VRXA 4V0GB 4XJ0A 5ANKA 4UMTA 5CEOA 4BJJA 2F4JA 4YJTA 3PVGA 4A7CA 3KXXA 1PJKA 2YN8A 2YJRA 1H26A 4APCA 2BFYA 4M84A 4CRLA 1Q61A 3FL4A 2BKKA 4QNAA 5GJFA 4MKCA 2A0CX 3ZLXA 4CLIA 3GENA 3VVHA 2BROA 1OZ1A 1YQJA 3BHVA 4B99A 3Q4TA 2H9VA 2RFEA 2XM9A 3I7CA 4JRVA 5F1ZA 4P7EA 4O7ZA 2R3IA 4FKRA 4OBQA 3TNQB 4BDBA 4BDGA 4DYMA 1KSWA 1WBTA 3OMVA 2C6KA 2QR7A 3KFAA 4TNBA 4PL3A 5E8WA 3W10A 4G6OA 4O4EA 2R3LA 3WZJA 2E9PA 4CFWA 3F66A 3PSDA 2OZAA 5I9YA 1JNKA 1U5QA 3TT0A 4MH7A 4ASZA 5IA2A 4QMPA 4ONAA 5HVYA 5EYMA 4FKQA 3RK7A 2XJ2A 3CKWA 4U9AA 5DMZA 2QHNA 3MGYA 4RFYA 4PPCA 1QCFA 4BVUA 1IEPA 4IDTA 1QPEA 2WQBA 3KXZA 2Z7SA 5EYKA 3BPRA 4R8QA 5FM2A 2GSFA 4KA3A 4M68A 2XNMA 5CI6A 2AEGA 4FEXA 5IQBA 3FLWA 2EUFB 2PE0A 3BHTA 3Q9ZA 3O71A 3TMOA 3FAAA 4GUBA 3TTJA 5A6NA 2DS1A 5HCXA 1YI4A 3L9LA 1YKRA 2WQOA 4JX3A 4KUJA 2QOFA 4HNIA 5HTBA 3UVPA 5M53A 3EL8A 3HV6A 2WPAA 2QR8A 5BUIA 1JQHA 1M7QA 3BLHA 2CNVA 4F9CA 4W8EA 2QOQA 1BLXA 4DT9A 3UPXA 3UC3A 2VWYA 3DLSA 2VN9A 4DEGA 1W2FA 4R77A 3UNJA 3K2LA 5IPJA 4MUQA 4YURA 2PZPA 1PXPA 5M4UA 4S33A 4ALVA 4F09A 3RWQA 2O0UA 2WMUA 3R6XA 3GQLA 4QYEA 5ANOA 2QURA 3FC2A 4NK9A 3W0PA 3WE4A 4QQJA 3CS9A 2FVDA 3NSZA 4C33A 2WTVA 1OPLA 4FF8A 4UMPA 4G3DA 1R39A 2C6DA 3V5QA 4JBVA 4PPAA 1OL1A 3SW4A 5BV3A 3OOGA 2C68A 2WAJA 4IM3A 4PUZA 4Y85A 3ULIA 5EKNA 3A7FA 4DTAA 5CENA 3LMHA 2HW7A 1OMWA 2WMRA 4M66A 5IUIA 3BEAA 2G2HA 4DDIA 4FG8A 1ERKA 3LMGA 1H8FA 3C4ZA 3VWAA 3LVPA 2F7XE 3KN5A 5ANIA 5H3QA 3ZRLA 5IUGA 4IAYA 2X4ZA 3Q6WA 3SXFA 5A4EA 5B0XA 1J1BA 3OF0A 3AC1A 3R30A 1XH6A 5ANEA 4B9DA 2C0TA 2PVLA 3KRWA 4QTBA 4FV1A 4R3RA 5E90A 2YWVA 4O7SA 2ZDUA 2GHGA 2QI8A 1STCE 1XMLA 5KMMA 3RM6A 4QP3A 1ZRZA 4J98A 1Z5MA 3H30A 3G9NA 4USDA 5LVPA 1DAYA 2W1IA 5AMNA 3IK3A 3ITZA 3ZOSA 2WQMA 2LGCA 3KGAA 1XBCA 4YNOA 4YBJA 4EOPA 3D2KA 4R5SA 4WOVA 3JXWA 3ROCA 3OW3A 4GIIA 4RX8A 2XYNA 4TY1A 2C3IB 3VS5A 4AGUA 3OWLA 2JIVA 3PG1A 4WBBB 5HO7A 4I3ZA 3P7BA 3TZMA 2H34A 4D2RA 4QO9A 3O8UA 3QQJA 4RJ5A 4YU2A 5KHXA 2GQSA 3LE6A 4R7HA 2IN6A 3GOKA 4BZDA 5HX6A 3KXHA 4C36A 1VZOA 4RQVA 4C4GA 4CD0A 4HW7A 3QRUA 4M0YA 5EM8A 3CTQA 3RWPA 3FLNC 5BUJA 5D11A 2DQ7X 3NVMB 3L8XA 3KXGA 3NWWA 5IA1A 2YWPA 1JKKA 2WMAA 2Z7RA 3G0EA 3HV5A 4IE9A 4ZOGA 4FIEA 4ID7A 3EOCA 2J50A 3BU6A 3PJ1A 3E8NA 2YM3A 3DBFA 4R3CA 3U54A 4OTIA 2R64A 4LGHA 4L53A 3AMYA 3D7TA 4YLJA 5KKRB 2Y4IC 3U4UA 1V0BA 4IB1A 3PJ8A 3UE4A 1E9HA 4A9UA 4L42A 2CGUA 5HIEA 1IAJA 1ZOHA 1UNLA 2VO7A 4QMSA 4DHIB 3C4WA 5D7AA 4KIKA 3NFGB 2JDOA 4U80A 4E8AA 4F6WA 1PXNA 4GVAA 4YHJA 4AP7A 5CYIA 1O6LA 4FT7A 3GOPA 4I6HA 3CIKA 4FG9A 2PUPA 5A4CA 3TKHA 3LFBA 4YUQA 2EXEA 3E8CA 3W2PA 3EL7A 3AC3A 4GCJA 4JBOA 4S2ZA 3W32A 4AGWA 4CFVA 4QTEA 1WFCA 2ETRA 4DFZE 5C4LA 2JFMA 3ZLWA 3Q2MA 2BZHB 3F5PA 4FKVA 4RBLA 3E8DA 3TNPC 2UUEA 3RAIA 3WZDA 4CMUA 1H25A 3PPJA 1XMMA 1GZ8A 3U6JA 2J9MA 3QXPA 3DBQA 3R8LA 4C57A 5CI7A 3QYZA 3V5JA 3IOPA 3RBWA 4OTHA 3Q5IA 3NUYA 3QU0A 3I6WA 4NEUA 4YTIA 4D5KA 4DG2E 5IEVA 4AS0A 3DKGA 2X7FA 4MAOA 3COKA 3THBA 1RJBA 4BGGA 4ZS4A 4FIJA 2XRWA 4F65A 3NLBA 5A4LA 1AGWA 4DHFA 3FZTA 4BCGA 3R1NA 4X3FA 5LWNA 1KE6A 2XARA 3PIZA 4XV1A 2BDWA 1DM2A 4BR3A 3N4VA 3GC0A 3TXOA 4PMSA 3NNWA 1K9AA 1Q8TA 3KA0A 3NNVA 4TT7A 4JR7A 3ZZEA 4BTFA 4GKIA 4U44A 3RNIA 4ANLA 2CKEA 3IECA 4MNEA 3ORLA 4D55A 5EM7A 3PUPA 3ZS5A 4JXFA 2B0QA 1VR2A 4JG7A 3W16A 2Y0AA 2HWPA 3OOMA 5AUVA 3E5AA 3OTUA 4G6LA 3W1FA 3RCJA 2UZNA 4IAIA 4CV9A 3V3VA 4P2KA 3UJGA 4QQTA 4DFUA 3SX9A 2C6LA 4LOPA 3NUPA 3VS3A 3HECA 2XK6A 1H1WA 3KMMA 4O0YA 2YDJA 2VO3A 3U6HA 1ST4A 4D2WA 5FDPA 3R00A 2XNPA 4X2NA 1ZYDA 2ZM1A 3PY1A 4YJPA 3VW8A 1R78A 5JQ8A 1P5EA 4JOAA 3PP1A 5IUHA 4DEDA 1J7IA 1WAKA 2VTSA 1CKPA 1YDSE 4JBQA 4BI1A 4YSJA 4HVGA 5HQ0A 3GCUA 5TE0A 1NW1A 3SW7A 3LAUA 4ZMEA 5J9YA 4V05A 4APPA 2CSNA 2J4ZA 4M12A 1LUFA 4Y83A 3BU5A 3OCSA 3PLAE 4ZTMA 4GUEA 3DNDA 2W1DA 3A60A 3SGCA 4GYGA 4A9YA 4PRJA 3OWPA 3MBLA 4FV8A 4E20A 5T3QA 4D1ZA 3KN6A 4FUXA 4F9YA 4GG7A 2WTKC 1CTPE 5CU2A 2G2FA 4XV9A 4FTCA 4O82A 4QMYA 5CX9A 3D83A 4EJ7A 2F7EE 2XBJA 2J0KA 4E6AA 5FLFA 5J1WA 3DQWA 3FXXA 5IA4A 5KMOA 1ND4A 2OW3A 4DCEA 5M4FA 2W1HA 4FIHA 3WZUA 1UWJA 2R3QA 4EYMA 4GFGA 3VONA 5E4HA 3L9MA 2V7AA 4FIGA 5HBHA 4PX6A 2B52A 3G90X 3E7VA 3ET7A 3ZEWA 2B53A 2VTAA 4MWIA 4GK3A 3VHEA 5CY3A 3F82A 4BFMA 1H01A 3JYAA 3QYWA 3KB7A 4JDKA 3Q60A 3L8PA 4FTRA 4YR8A 2F57A 1GZOA 1URWA 2X2MA 2J90A 3FC1X 3AC4A 3LJ2A 3UIUA 2XYUA 5D41A 4BIDA 2F2UA 4M0ZA 4JX7A 3NNUA 4GU6A 4H36A 2EU9A 3F7WA 3LM0A 2VTNA 2XUUA 3H3CA 3MVMA 5HG5A 5HLPA 5CU0A 3LCTA 4X7QA 4H1JA 2OBJA 3ENHA 1L8TA 1CDKA 4RIOA 3W0SA 5IQHA 4KNBA 4L9IA 5EYCA 3CQEA 3HX4A 3GU8A 2WTCA 5EDQA 4XOZA 4D0XA 3V51A 4FKIA 4WNOA 1Y6AA 4EOSA 2R3MA 4DGNA 3VNTA 1P4OA 3OC1A 4X3FC 3TEIA 4JDJA 4G3FA 4CXAA 2OGVA 3DCVA 5KO1A 3ZXTA 1P14A 1PMVA 3T3VA 3MH1A 5DYJA 2JITA 3EKKA 3FZSA 1TQMA 4FV4A 4WRSA 3V5WA 2VTOA 5LVOA 3TYKA 4EZ7A 4RWJA 4ZZNA 2WTJA 4RX7A 3Q6UA 4I23A 5CWZA 4AF3A 4F7LA 3DJ6A 5CEMA 2J5FA 3GGFA 4RWIA 2XRUA 3EJ1A 2WELA 4QMTA 3A7JA 4FGRA 3OEZA 4IW0A 5BQ0A 4RIYB 3FWQA 1Z9XA 5K0KA 4YJNA 3DPKA 2XCKA 5DR2A 3O7LB 1GZNA 3FQSA 5AX3A 5TOZA 3FEGA 4O0RA 5JZNA 4LL5A 2JDVA 3O2MA 3ZH8A 3C9WA 3DXNA 4B6LA 5L2IA 1J7UA 4O7YA 1OUKA 4BCPA 3FZ1A 2YZLA 2HXLA 4IBMA 4EWHA 1ZLTA 3PYYA 2PPQA 1H27A 3KK8A 4ZY5A 3H9FA 5J7HA 5EQEA 1YVJA 4OTGA 5BVKA 3KK9A 2JIUA 4FKLA 4LL0A 1G8SA 3I81A 5CVHA 1SM2A 1ZZ2A 4GK2A 5DT0A 2SRCA 3HP5A 3VRZA 3VN9A 4BWKA 2WU6A 3VF8A 4JR3A 1REKA 3CCNA 3QTRA 3QUEA 3SG8A 3VBTA 2BRGA 3CPBA 2ZFYA 1PYXA 4MF0A 4MK0A 5BVOA 4RA5A 5K0XA 4BI0A 1K2PA 4S30A 3DFAA 4BCMA 3PLSA 4LYNA 4OTDA 4IZ7A 4YO4A 2X8EA 4KKGA 4ANQA 2CGVA 4BDKA 3LLAA 4N6ZA 5AEPA 2VTIA 4AU8A 1PXOA 2IZUA 1RW8A 3V01A 3EN4A 3H9RA 3MIAA 4E3CA 2I0EA 1T46A 1UNGA 5E91A 3AKJA 4L6QA 2HELA 3HDMA 1ZXEA 3PSBA 4GS6A 2FSTX 4V0GA 4FTLA 3ZLYA 4AW2A 5FTGA 2IVVA 4JG8A 4IVAA 5HIDA 3A7IA 3HRFA 2X1NA 4IWDA 2HW6A 2CCIA 4QMUA 3LMIA 4YTFA 4QMWA 3DDPA 4RX9A 2REIA 5CF6A 3B2TA 1RDQE 3K54A 1OGUA 1IA9A 2CHLA 2XIYA 4CMOA 3FMMA 3VF9A 3KCFA 5BVWA 3TZ9A 2GQGA 2IZRA 2OWBA 3A2CA 4HNFA 5AJQA 4NJ3A 2WMSA 4AN3A 2HY81 3IDBA 4UB7A 1H07A 4C4FA 1UKHA 3A8XA 4EQCA 3HMIA 5JFVA 4O0SA 4GT5A 3K5VA 3FLYA 4A9RA 3ACKA 4FG7A 2QOKA 3RMFA 1VLRA 2B7AA 2FUMA 3BX5A 4JAIA 2QQ7A 3TUCA 5FP5A 1NVRA 3PE1A 3QALE 1R0PA 4RSSA 5IMEA 3PXRA 5J5TA 2V0DA 4JVGA 5M44A 4ZTRA 4I0SA 4AT3A 3ZC6A 3WF5A 5IMXA 3VW6A 3UPZA 1V1KA 3IDPA 2WFYA 3BE9A 4FKGA 3EQPA 3ZXZA 2OH4A 3ZDIA 4PTEA 1UNHA 3NYXA 1M2RA 4KBAA 4QYFA 2LAVA 2XJ1A 3MFTA 1FINA 2ZDTA 3LPBA 3TV6A 4CNHA 3UQCA 4W9XA 4O0VA 4I22A 3FMKA 3GCSA 1R1WA 5BVEA 5AIKA 4WNKA 4DEBA 3FLSA 5HE0A 3I5ZA 4D2PA 4BY9E 1GIHA 4AT5A 3OS3A 4DFYA 4R1YA 2XVDA 2ZYBA 2C0IA 4U43A 4DT8A 3GCVA 4DG3E 2OXYA 5LMKA 4ANNA 4AOTA 5HGIA 3LXNA 2CN5A 3MWUA 4YJUA 3FYKX 2Z7QA 3G6GA 1DI9A 3VS1A 2IPXA 3P08A 2H6DA 3UG1A 3BI6A 1YWRA 4FZ6A 3I0OA 3QXOA 4P4CA 5IQDA 3CP9A 4F1OA 4CLJA 1H08A 2AC3A 4YTHA 4IX4A 3LFQA 3QAME 2BKZA 4H3QA 4QPAA 4YJVA 4EOMA 4NCTA 5IQCA 5DH3A 1FOTA 3NRMA 4XV2A 2R0IA 1MUOA 2W4JA 3R71A 3GFEA 5AR8A 4BN1A 2BDFA 2Z7LA 4NSTA 2BIKB 5GJGA 2J0IA 3BELA 3GC9A 2BRBA 4GFMA 1L3RE 1OL5A 2HZ0A 2OXXA 3PVUA 4IAAA 4RVMA 1OL7A 3GFWA 4FTTA 3W2QA 4TZRA 3RP9A 1ZY5A 2W1ZA 4EH9A 4KAOA 4TWOA 2CKQA 4UYAA 3DAJA 3QRTA 5TT7A 3UOJA 3ZSGA 3R9RA 3E63A 2X8DA 4FK3A 3ZLSA 3EQDA 5CF5A 4FT0A 5AP4A 1Y6BA 4FL1A 4RLLA 2HIWA 4FV0A 5AV3A 3Q2JA 4O7LA 1UA2A 3FMHA 2GFSA 4ZSJA 4O21A 5HNGA 2IW8A 5HE2A 4YZCA 5C26A 5KE0A 4WNPA 4CZYB 2VWZA 3BQRA 4DGOA 5F95A 4XOYA 3HNGA 3MH3A 2WTDA 3RK5A 3FBVA 1GAGA 1PXLA 4GEOA 3R2YA 1VYZA 1WCCA 4MBJA 4AXDA 3AXWA 5BUEA 3MVJA 4A4XA 1Z57A 3LFNA 3NAXA 4FL3A 4IVCA 4LG4A 4KKHA 4RWKA 3RJCA 2PU8A 3PJ2A 2X9FA 5HVJA 3W18A 4H05A 3F9NA 4HJOA 3II5A 4DTBA 3R9DA 3FKLA 3SD0A 3FI3A 4WT6A 5AP7A 4QOXA 5C27A 4BI2A 4XCUA 5IQEA 4CKJA 2OF2A 3HMNA 4AFJA 2FH9A 2P2IA 1G8KA 3QCQA 4RIXA 1IA8A 2WOUA 3FL5A 3R04A 4XYFA 4XLIA 4AW5A 4AZTA 5B7VA 5B2LA 2G15A 3SVVA 4LV5A 3R8ZA 4GMYA 4G5PA 4WUAA 4B8MA 4ENYA 4LUDA 4YP8A 3WF6A 4LRMA 4JS8A 3RAKA 3GI3A 2OJIA 5K4IA 2VTQA 3C4EA 4CT1A 1PF8A 2X6DA 1JLUE 4PDPA 5GIOE 5DRDA 1OIYA 4AACA 4E6QA 4FE2A 5IH5A 3OFMA 2ZB0A 4DDGA 5AUXA 4O4DA 2I40A 4O1OA 5ANDA 1UU7A 4XUFA 2WZJA 4BCJA 1WBOA 3HUCA 4ACGA 3ERKA 3GC8A 3NUSA 4W8DA 1Y8GA 5C01A 5JGDA 4NTTA 3EQHA 4DLIA 2JDSA 3DBDA 4U5JA 1I44A 5LVMA 4G31A 4BB4A 5LMKC 2X0OA 3G2FA 3JY0A 5EM5A 3NVKI 2XBAA 4HZRA 4I5PA 2QD9A 3EB0A 3CGOA 4CKRA 4JG6A 3Q9YA 3VC4A 5IU2A 1ZYSA 1O9UA 4ANMA 3C4XA 3W0NA 2G9XA 4ACHA 2C6TA 4LQMA 3C5UA 4F9BA 4FBXA 3HZTA 5BVDA 4DINA 4ZMFA 4BHNA 2O65A 2ZJWA 4OW8A 3HA8A 4ZSGA 3R9NA 5AR2A 4NCTC 5AP5A 4QP2A 4E4NA 2E9VA 2A1AB 4RIWA 3BWFA 4Z7GA 3KVXA 3F2RA 2BAQA 4RGJA 2I0HA 3QC9A 5LCJA 5K9IA 4BKZA 2ACXA 4D4SA 4IZYA 4RC3A 5EQYA 2WEIA 3P1AA 1ZWSA 5FM3A 5ICPA 2XAOA 4I6QA 5EKOA 5A4TA 5F9EA 3CY3A 4N0SA 3VBQA 5J9LA 5ACKA 2F7ZE 4WD5A 3A99A 5IISA 4EHVA 3LFSA 1A06A 4FTQA 4YLLA 1ZMWA 3O7LD 5AUZA 4PMMA 3MIYA 2OU7A 1LEWA 4L67A 5F94A 2RG5A 4RRVA 1PRYA 2GNGA 3F3ZA 5KZ0A 5HBEA 4QMNA 1OB3A 1PXMA 4PDYA 1QPDA 2UW3A 4E4LA 3NAYA 3UNKA 3VRYA 3EQIA 3AD6A