3GGFA

Crystal structure of human serine/threonine-protein kinase mst4 in complex with an quinazolin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
284
structure length
275
Chain Sequence
IADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVARNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MST4
publication title Structural comparison of human mammalian ste20-like kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 275
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ggfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ggfA01
3BV3A 3I7BA 2VRXA 3D0EA 5E8ZA 1KE7A 3UYSA 3LE6A 2VWVA 4C2WA 4XLIA 4KD1A 3PE2A 2H96A 3R1YA 3Q04A 1ZARA 3G15A 2YFXA 3Q9ZA 2NPQA 4M14A 2WQEA 4PTEA 4XBRA 4OTDA 3OXTA 2HW7A 4C7TA 3KFAA 4FVQA 5LARA 1XKKA 2I0EA 3MFUA 5DA3A 4KKGA 4ZJVA 3O71A 4ACCA 4L8MA 5C9CA 5LWMA 3KXMA 5EYCA 3ACKA 3QZGA 1XH6A 3PFQA 3EJ1A 3ELJA 4YLKA 4FSUA 2GFCA 4R78A 3ZZEA 4TT7A 3OXIA 4GIIA 4N0SA 4WUNA 4C59A 4ANSA 3GP0A 3OW4A 4JQ7A 4C33A 4Z16A 1AGWA 3RK9A 1XH7A 4FTMA 3ZSIA 2J9MA 1J7UA 2O8YA 4UEUA 2DS1A 2ONLA 2G01A 3UBDA 4FV3A 2CCHA 2JD5A 1OPJA 1FOTA 1CM8A 2BAKA 4UXQA 3OP5A 4WNMA 4G5JA 1GZ8A 2YDIA 4MF1A 2Z7RA 1VEBA 4DTAA 4U45A 4PV0A 2XK4A 3CSVA 1XH4A 2C6DA 3P5KA 3PE1A 4EHEA 1WBOA 5KMNA 4CG8A 3RPYA 4ENXA 4HYSA 5EOLA 5FD2A 5FM2A 2R0IA 4D4VA 2O64A 1ZAOA 3PIXA 5F94A 1G8SA 3JXWA 4HYHA 3QRIA 2REIA 4IACA 2CNQA 2Z60A 3MB6A 3DBCA 4M15A 3U4UA 3V8SA 4CZUA 2Y0AA 4L9IA 1M52A 1A48A 1JNKA 3FKLA 4MXOA 2R3PA 4A9SA 4EBVA 3MYGA 3KXGA 4FTOA 2R4BA 5C8MA 3EIDA 3LCSA 1O6KA 4GT4A 3RPVA 3PA3A 3VBXA 5EM8A 2BRBA 5G1XA 4BWPA 3PRFA 5AV2A 4RBLA 2V62A 2F4JA 2ZYBA 1CMKE 3JYAA 3KULB 3R1SA 2FYSA 4IJ9A 1CKIA 3WI6A 4DG2E 2YM6A 5A6NA 3U54A 5EH0A 3OCTA 4ITJA 3OY1A 3SW7A 1I44A 4MNEB 5CASA 5I9XA 3AOXA 4NCTC 4HPTE 2IW9A 3SVVA 1FQ1B 4UWBA 1UV5A 4BRXA 2ETMA 4Z9LA 2VO3A 3GC8A 4RIWA 3BE9A 4FTKA 2IVTA 1UNLA 5DOSA 5AX9A 4CNHA 5IISA 3ZH8A 5AM6A 3KVWA 3NNWA 3C13A 5HIDA 2XS0A 3IQ7A 1UNGA 4UZDA 2QVSE 3C7QA 5FDPA 4UMPA 4F4PA 2O3PA 4HZSA 3A4PA 3QTRA 1Z9XA 4FIGA 5HX8A 5D7VA 3VS5A 2G2HA 2JIVA 3TWJA 4C35A 5CSPA 3HMIA 3K54A 3O8TA 4ERWA 3FZOA 5BVKA 4IB0A 2W99B 4XS2A 5K0KA 2HW6A 4M8TA 2ZM3A 2EU9A 3QZHA 4JXFA 4M7IA 1UU7A 1OI9A 2AYPA 3QTXA 3VS7A 4BCJA 2W96B 2C1BA 5GIOE 2XRUA 2NNWB 4FX3A 5L3AA 3F2RA 4A9TA 1O6LA 4E6DA 2BFXA 3D15A 4TW9A 3OCBA 3H0YA 3OD6X 1YVJA 2AC3A 4EQCA 3CPCA 5AMNA 5F9EA 4ACDA 4BC6A 3CCNA 2B53A 4FEQA 2UW9A 5HI2A 4EOQA 3TDVA 3VUKA 1I09A 2R3QA 5CU6A 4L53A 2WMUA 4P5QA 4LL5A 4X6RA 4FSQA 5I9YA 4H3PA 4PMSA 4F70A 3UJGA 4FKWA 5ANIA 2JIIA 2X8IA 3NGAA 3QYWA 4EWHA 3FL4A 4I5HA 4FVPA 1LEWA 4QYEA 5EDQA 4PDPA 2XYUA 4R7HA 3HMOA 3GCUA 3QA8A 2X0GA 4ZSAA 4FG9A 2PZPA 4W8DA 4UMUA 4IX4A 4K0YA 4L52A 3KRJA 5HTIA 3HUCA 4DF3A 2YLFA 3NPCA 5J7BA 2HZ0A 3WF7A 3O23A 3G33A 4JDJA 2YITA 2W1EA 1JSTA 3K2LA 3OWPA 3VN9A 4CMTA 4E4MA 4Z55A 4XRLA 4FKRA 2WMVA 3SAYA 2XK6A 4NWMA 3I81A 3KN6A 3SC1A 3WBLA 4CKIA 2JDVA 3H4JA 5EYDA 4UXLA 2XNOA 2W1IA 5CU2A 4BI1A 5AUZA 2X2MA 2YM7A 3DQWA 3NW5A 4KIKA 2GNHA 3VVHA 3LMIA 4KA3A 1SYKA 5IKWA 3R7IA 3UQCA 3EQCA 4IWPA 3WZKA 4AOTA 3V8TA 3QU0A 4DEGA 4O7YA 4FKGA 1HCLA 4ZMFA 4B7TA 4TNDA 1RDQE 1YDRE 3GC7A 4GRBA 4E8AA 4IADA 2ITXA 5CX9A 4DGLC 3PXQA 3OTUA 3NNXA 2PMNX 2PVNA 2WOTA 5L8JA 4BKJA 1ND4A 4YBKA 2O2UA 4M0YA 3CKXA 3CD3A 2OWBA 4QYGA 1YW2A 4NJDA 2WXVA 5EOBA 1OIYA 5CF6A 4MQ1A 1B39A 2WMBA 2PVYA 3G0FA 2KULA 4C3RA 3HDMA 3TACA 4A06A 3HV5A 4YJVA 3EFJA 4GSBA 3QCYA 4CFMA 4DEEA 2A0CX 3F66A 4D2WA 5CI7A 3VF8A 2I0HA 3QQGA 1KUTA 2QOIA 3HRBA 4KSPA 4UMTA 5BVWA 5HU3A 3R01A 5B2MA 3UO6A 4ORKA 4AGWA 4O21A 4W4YA 2C5OA 4GJ2A 4LMUA 3UOHA 4DG0E 5B2LA 2UZVA 4E4NA 4XG7A 4M13A 4BCIA 4X3FC 4BF2A 3BZ3A 3FDNA 1JPAA 3GC9A 3QWKA 3OWLA 3OC1A 3UVQA 2FA2A 4AAAA 4DEBA 4NYEA 1UA2A 1H26A 4U44A 3G9LX 3HDNA 3KXZA 3SKCA 4ZS4A 2JGZA 1YDTE 2C4GA 3CP9A 3PY1A 4NTSA 3ITZA 4YO4A 2R3NA 3B2WA 4K6ZA 4ZMEA 3JVRA 4GT3A 1GNGA 4LQMA 3UNZA 4FSWA 4ASXA 3PLAE 3QYZA 4WSQA 3TG1A 2I6LA 4MXAA 1PXJA 2RGPA 2WZJA 5E7RA 3W8LA 5IUHA 3ORPA 4MKCA 2YCRA 5M4FA 2YJRA 3JUHA 4AW0A 5AEPA 2KTYA 4M97A 2QLQA 4IM3A 3W18A 5H8BA 3PSCA 5LWNA 4YJQA 3I5ZA 4EWQA 3K5UA 2QU6A 5B7VA 5BVOA 1BYGA 2Z7QA 4IC8A 4RC4A 3UC3A 4V05A 4ARKA 2JDTA 4C4HA 4DH3A 2XM9A 4OBOA 2C5XA 4GUBA 4U40A 3FXZA 1WVYA 2JIUA 2ACXA 3MSSA 3BYOA 5CEMA 1SMHA 1W98A 4JG7A 3NNUA 5HG5A 3L8SA 5EHYA 2YLEA 3UIXA 2GTMA 3QX2A 5FRIA 3E93A 1SVHA 1QCFA 1FINA 2XKCA 3F3WA 3CPBA 5F95A 3HX4A 3R2YA 4EZ3A 4MQ2A 2E9VA 3FI8A 5IEVA 1Y57A 3TJCA 3VBWA 4YP8A 3ID6C 1GAGA 5AX3A 5J87A 4O81A 2ERZE 2JFLA 4GK2A 5E8YA 3HV7A 2FSTX 4L68A 4YSMA 3FJQE 3RBWA 5JRQA 3VJNA 4YJTA 4QMOA 3IW4A 5C03A 5M55A 3EN7A 5A9UA 4FSNA 1PY5A 2PVRA 5BYZA 2CKQA 3TNIA 4GS6A 2XCHA 3R6XA 4QQ5A 2OJJA 5HVYA 4G9CA 4ZS0A 2ZV8A 1ZMWA 3HMNA 1PMVA 4MWIA 4DGNA 1DI8A 5HEZA 1FMKA 2FSMX 2QNJA 2VV9A 3COKA 3RPRA 3VC4A 3RAIA 3HZTA 4G3FA 1MRVA 4G5PA 4NCTA 2LAVA 1R1WA 3C50A 1REKA 3KXNA 4FKUA 4F7LA 2YEXA 4RJ5A 2VO0A 1H1SA 3DB6A 5M06A 5M08A 4E5AX 1SVEA 3G2FA 3POOA 3WZUA 4EHVA 2CGXA 4J99A 3D14A 4UWCA 1KWPA 1YWVA 2YCQA 3U9NA 1BI7A 2VTPA 3BHTA 4GV1A 3N51A 3ZOSA 3OUKA 2B1PA 5M4CA 2WNTA 2ITNA 3EQDA 3DAKA 5HQ0A 1Q8TA 2QR7A 4I0RA 5JGDA 1PKDA 3FHIA 4U79A 4N4SA 4DITA 2VGPA 3Q6UA 3Q6WA 3TTJA 3ORTA 4EOKA 3SG9A 4GW8A 3EQIA 3MFTA 2Z7SA 2R2PA 4R3RA 3DTWA 3MH2A 4A4OA 2W4JA 3PY0A 4QMMA 4JG6A 4PMPA 2WMAA 3P7AA 4DBXA 2AC5A 4FBXA 5EI2A 4EOOA 2JC6A 3QAME 3R21A 4IJPA 3ZZWA 3R1QA 3V04A 2WTCA 4C3PA 2WEIA 5TF9A 3TV7A 4AOJA 4NM7A 5M53A 3ALOA 3OMVA 4QYHA 3ZO2A 4YZDA 4LV8A 4XX9A 3KY2A 1ZZLA 3UOLA 5GIPE 1F0QA 2OSCA 3JY9A 3TZ8A 3AC4A 4L00A 4FEUA 4YHTA 3KQ7A 3DFCB 2F7EE 4IANA 4D58A 3DKCA 4KIOA 5A6OA 1KOAA 4FT9A 4FNXA 2UZBA 3I0OA 1P4FA 4PTCA 2VO6A 4K77A 3NAXA 3DPKA 4GVJA 5M57A 1APME 1XR1A 4XNEA 5DIAA 3EL8A 2QKRA 5HO8A 3TNQB 3S2PA 3PIYA 2X9EA 3QD0A 4HYUA 4G16A 3RWPA 3OOGA 3O17A 5HNBA 4Y5HA 2XNPA 3AMAA 4BDFA 1H08A 3AG9A 4O83A 3I5NA 3E88A 3ORXA 3VUDA 3Q32A 2QURA 3U87A 4RQKA 1BLXA 1ERKA 3MW1A 4J52A 5AV1A 3NUXA 1TQMA 3IOPA 4ENYA 3QRTA 3QQKA 1ATPE 2CN8A 1OL5A 2OFUA 2QHMA 5A4EA 3MVJA 1QL6A 1IAHA 2BZIB 3BHYA 3ENHA 3NUYA 4WIHA 1OECA 4S30A 5EM5A 1IEPA 4BTKA 3E7VA 3E62A 3LKMA 3SG8A 5IQFA 3MBLA 4MAOA 3RALA 5IPJA 1U59A 1M14A 2WTVA 3IW8A 1YQJA 3R04A 2VWZA 2UVXA 2GU8A 4IWDA 4NM5A 3KMWA 4YHFA 3UPXA 2GTNA 3F3TA 4HYIA 4HCUA 4CFNA 4I5PA 4EK8A 2XJ0A 1WVXA 2W1DA 4GU9A 5L4QA 4G3CA 4PF4A 4Q5HA 1NVRA 4F0GA 2V5QA 3R02A 2ZDTA 4HNIA 3OT3A 4ZIMA 1UVRA 4RIYA 3RINA 5AR5A 1M2PA 4BTMA 2C68A 4GU6A 3ACJA 3NUAA 3ZXTA 2WFYA 3FSFA 5KO1A 4YTCA 2W9ZB 5EDRA 3TEIA 4JBVA 4IFGA 3ZBXA 3NYNA 3WARA 3VS6A 3PXRA 2QQ7A 4TTHB 4YTIA 4HCVA 1ZXEA 3FLWA 3TZ9A 3BU6A 3MPAA 3UODA 5K4JA 5KCVA 1R3CA 5HD7A 3T9IA 3BWJA 1YWRA 3O8PA 4QT1A 4UWYA 1WMKA 3F61A 3CJFA 5DMZA 2OIBA 4I41A 4Y95A 5ANEA 2VWUA 3KMMA 4B9DA 3I6UA 5FGKA 4X3FA 3BPRA 4BCPA 5JRSA 4D1ZA 3CTHA 3QTUA 5HG7A 1AD5A 4RX9A 4FR4A 4C36A 5I4NA 4HGEA 3KGAA 2WMQA 4IWQA 3A8XA 4ZTSA 5TE0A 3FMNA 4IFCA 3VS0A 3QC4A 1OIRA 2ONLC 2X8DA 3DJ5A 4EKLA 4QNAA 5AR7A 1PHKA 1ZZ2A 3OZ6A 4IVAA 2E9UA 2DUVA 3LZBA 3NUSA 4QO9A 5ANKA 2BIYA 3O2MA 5HVJA 4OTFA 4WD5A 1P5EA 4IZYA 4TYHA 3DA6A 5IA1A 3AQVA 3ZSHA 2I1MA 2W05A 4BKZA 3EN4A 4CRLA 3RAWA 3QF9A 4JX3A 4CYIA 3CGOA 1GZOA 3TV4A 4BZNA 2W0JA 4YZCA 3G5DA 5B0XA 2UW8A 3QWJA 4K2RA 4UY9A 4JR7A 2VTSA 4WUAA 3W55A 4IAAA 4YJNA 1AQ1A 5CS6A 5KMKA 2OIQA 1XBAA 4FKTA 4HPUE 3NCZA 2XIXA 2I0YA 2XNMA 4ZTNA 3LFCA 2XIZA 2F7ZE 2JLDA 3DBEA 3KMUA 1OUKA 3EQBA 3RM7A 5BQ0A 4FGRA 4EOIA 1J7LA 3GUBA 2ITWA 5M4IA 1L8TA 2UZLA 4JAIA 4P4CA 4I4FA 4IDVA 3Q53A 2ZMDA 3H9FA 4IWOA 3R9RA 4F09A 4YJRA 5GJFA 3A7JA 4M69B 2OI4X 2EUFB 5ANDA 4O0TA 3UIMA 3IW6A 1ZOEA 3NYOA 3FMEA 4ZLZA 4U41A 5GJGA 1H28A 4IHPA 5CU3A 3GEQA 2OW3A 4NIFA 4XP0A 2E9OA 2WMSA 3WF5A 4OTWA 5CSWA 4O2PA 2W9FB 4OTQA 3V51A 4D28A 4FSMA 5HKMA 3ZTXA 4EK3A 3PWDA 4DYMA 3DDPA 5DEYA 4JR3A 3MI9A 2QOHA 3QRJA 4IEBA 5DHJA 1R0PA 4RZVA 2XM8A 3H10A 5DR2A 4QMQA 2QC6A 4FV4A 4HGSA 5M07A 4F6WA 2W5BA 4II5A 3DCVA 2YA9A 2YIWA 3CS9A 3KKVA 4JBQA 4TYIA 4WNKA 4BFMA 4EUUA 3RTPA 3U4WA 1FVVA 5CXZA 3R7EA 1LR4A 1DM2A 2P55A 3F7ZA 3EHAA 4DTKA 1W8CA 3OEZA 5L8KA 3Q9XA 2UZDA 4Y73A 3A7IA 3A2CA 3S00A 3WOWA 3CC6A 3OEFX 4M3QA 3Q4UA 4QMVA 4RZWA 3BQCA 3FMDA 4XG3A 4EC9A 3NMUF 3CR0A 1Y6BA 5BUIA 4HVHA 1J91A 3KK8A 3OTVA 4OR5A 4O86A 3ODZX 4LRJA 3VRZA 4DC2A 3MPMA 4I22A 5CVGA 3QQJA 4K33A 4PDSA 3UP7A 3U6IA 2P3GX 3AMBA 4D55A 4EH5A 5J7HA 2GSFA 1Q4LA 4FK3A 5CNNA 3UMWA 3EFKA 3TXOA 1VYWA 3F5PA 4O2ZA 4L3PA 1BX6A 3FZTA 2IJMA 2Y7JA 3FL5A 4FTRA 5JGBA 5KMLA 3REPA 1H24A 2Q83A 2YZLA 4PP7A 4FZ6A 3ROCA 3V6RA 3FHRA 3Q9YA 4GMYA 4C3FA 5J9YA 4CXAA 3MS9A 4O0WA 3AD6A 2J0LA 3HL7A 2Z7LA 4RWKA 2RG6A 3MPTA 4CCUA 3M42A 4AX8A 3I79A 4G17A 4ZTQA 4CYJA 5CU0A 5HG8A 1A9UA 4FEVA 4C57A 2W7XA 4L45A 3FI2A 2QOFA 4YO6A 1JAMA 1UKIA 5FTQA 3SDJA 5M56A 5A46A 1VR2A 2IVVA 2ZV9A 3EYGA 3IGGA 1CSNA 1UKHA 2C3JA 4AE9A 4I6QA 2WPAA 5DR9A 4MVFA 4U81A 4R7BA 3TM0A 4C38A 5CSVA 4QD6A 2Q0NA 2R3IA 3T3VA 3FI3A 2UZWE 2UVYA 5EYKA 4ZLOA 4C62A 5F20A 4BCMA 3E64A 3LJ0A 3K3JA 2C5NA 4QMYA 3KXHA 4ZEGA 3W32A 3TUBA 3W2CA 1YOLA 2C1AA 4FVRA 4KIKB 4H1JA 4CG9A 5FTGA 4FNZA 3IOKA 2BRMA 2Y9QA 3U6JA 4YR8A 4EH3A 3KF7A 1YOJA 4LFIA 3RNYA 3QCXA 4YPSA 3HRCA 2I7QA 2XCKA 4K1BA 3FV8A 4H58A 3P7BA 4DBNA 3ORNA 5K3YA 4GVAA 4NFMA 4QMPA 3SOCA 4OLIA 4QP6A 4D0WA 4YURA 4DFXE 3RP9A 3Q2JA 3FC1X 1NW1A 4O7TA 3KK9A 4I20A 1LP4A 3I6WA 2QOCA 1G5SA 5E1EA 3POZA 3QUPA 5L8LA 2CKPA 3GGFA 3NEWA 4UX9A 3KL8A 4EK5A 4ASZA 5IF1A 2VTRA 5TR6A 2PYWA 2ZJWA 3BBTB 3DKOA 5TO8A 4ASDA 5AADA 4P2KA 3R83A 4JAJA 2FSOX 1JSUA 5E91A 2XEZA 5T68A 3IKAA 4EOMA 4U3YA 3FLZA 5HIEA 4FSZA 4CFXA 5HX6A 1O6YA 3LXNA 1XH5A 3LLAA 3G0EA 3U6HA 2SRCA 3P78A 3PYYA 4UV0A 2XZSA 5AP0A 4WBOA 4LOPA 3ZU7A 4F9CA 3N9XA 4K11A 5LVNA 3A7GA 4GT5A 2YABA 4KBAA 3BYSA 2VTHA 3NZ0A 4GJ3A 1NVQA 5E8WA 1H4LA 3PVWA 2OIDA 3ALNA 5JH6A 3HMPA 4HGTA 4YZNA 4I0SA 4FTTA 4RQVA 2UW7A 4C8BA 1PXOA 2BTRA 3DNEA 3GQLA 4FNWA 1JOWB 4JS8A 1Q97A 4BDKA 4O38A 4UB7A 5E4HA 4FZAB 3V5LA 3FUPA 4O7LA 4GIHA 2RFSA 4FIFA 1DAYA 5IQBA 3Q9WA 3VUMA 4FKIA 2Y4IC 4OTIA 4USDA 1URCA 4NUSA 1OB3A 2BMCA 4QMSA 5A4CA 3FEGA 4O27B 1LEZA 5HCXA 3VBTA 1CDKA 4QYYA 3MN3A 3UMXA 3NAYA 3MTFA 1XWSA 4YZ9A 5LCKA 4OAVB 4EOPA 1B6CB 5HBJA 2V0DA 4ZSLA 3I60A 4HVSA 4EJ7A 5BVDA 3O7LB 4H1MA 1W7HA 2GMXA 4OTPA 3U51A 4YZBA 4RJ8A 4JNWA 4HVDA 4BY9E 4BL1A 5FXRA 4I21A 4D5KA 1SNXA 3S95A 1OUYA 4E20A 3EKNA 1PXMA 4PTGA 2V22A 5L2TA 1H01A 2FH9A 2IZUA 3KVXA 4MX9A 4FV6A 4YC6A 2YJSA 2QI8A 3NW6A 4DEDA 1RW8A 5DEWA 5K9IA 1OITA 2X7GA 3PG3A 4QP2A 3OHTA 2X39A 3ZFYA 1P4OA 4NKAA 2F49A 3D4QA 3O51A 3P23A 4G3DA 2VTQA 3KB7A 2ITUA 4MXZA 1V0OA 4I94A 2CNVA 3EN6A 3OF0A 4YJSA 5CXHA 3LFSA 3LHJA 5IA2A 5JKGA 2ETRA 3VWAA 4LOOA 4RT7A 4DFBA 2VZ6A 2YISA 5FDXA 4XEYA 3UO5A 3A60A 4ZTRA 4P5ZA 3PJ3A 5CEIA 1XBCA 2BZHB 3VNTA 1H8FA 4M68A 5CQWA 3R1NA 2EWAA 3CXWA 4NJ3A 4FODA 3QLFA 3BYUA 4KABA 3LCTA 3SGCA 1YWNA 4BYJA 3AC3A 5DR6A 4DGOA 3PVUA 4GCJA 3FZSA 2UUEA 4EH8A 4Z7HA 4IVBA 3IW5A 4IAYA 5FBOA 1V1KA 3VUIA 1M17A 3ZFMA 4AFJA 1JBPE 2QO9A 1KSWA 2UW6A 3DOGA 3EWHA 4I0TA 5DFPA 3MA6A 3LQ3A 3C51A 1ZYJA 3EFWA 3SRVA 2PVFA 4R7IA 5JEBA 2R3KA 3JY0A 3HV3A 3K3IA 3LPBA 4FTCA 2YIRA 4FKQA 4EUTA 3II5A 2NP8A 1WBWA 2PMLX 3D9VA 2XEYA 3OWKA 2YM4A 3E8DA 2XIRA 5HE1A 4BZDA 2CSNA 2BHHA 4ITIA 5KE0A 3R8PA 3ZLWA 1QPEA 3PJCA 4FSTA 4BDCA 3TJDA 2GNLA 3DJ6A 3DJ7A 4FIIA 4P90A 4XP3A 4AA4A 3BEAA 3WF6A 3PWYA 4F65A 4I93A 5AP1A 4X21A 3EZVA 5DRBA 2YAKA 1V0BA 4PWNA 4LRKA 1MUOA 3G6GA 2UV2A 2YDJA 4U8ZA 3UVRA 1BMKA 2BAQA 1KE5A 2ZM1A 3PTGA 3E8EA 4IVCA 3OBGA 4FV5A 4O0UA 5HE3A 5IUIA 4BHNA 2E2BA 4Y83A 3LMGA 2BR1A 3NWWA 2W4KA 2FGIA 3EB0A 4B8LA 4DFZE 4R8QA 3C4XA 2VX3A 1ZY4A 5L2WA 4CV9A 3GNIB 1BI8A 1OPKA 3WE4A 3ZONA 1W84A 3SXSA 1H1WA 4JL9A 4AZWA 5IQAA 4F7NA 4WT6A 3T9TA 4RC3A 4XV2A 4PPBA 4CMUA 1Z57A 4RVLA 2VTLA 4FTIA 4IW0A 4BICA 4G6LA 4YNOA 3QL8A 5CANA 2BALA 4MD9E 4LM5A 5CENA 4Y46A 2PHKA 3LAUA 4H36A 2AUHA 2HIWA 1GJOA 4CKJA 4WOVA 4NT4A 1ZLTA 4AZEA 4PPCA 4RG0A 3AD4A 4YJUA 5CNOA 4APPA 3CEKA 5CEKA 3DV3A 4F1MA 1URWA 4IQ6A 1MP8A 4RJ6A 1IASA 3MH1A 5GZAA 1Q8YA 5I3OA 4QP8A 5TKDA 3QBNA 3P1AA 5AFVA 3A61A 5IQGA 4XYFA 3HP5A 4BIDA 4OT5A 4PL3A 4IVDA 2P33A 2HZNA 3L8PA 4QMXA 4R5YA 4RIYB 3VQHA 3L9PA 4AW1A 4D0XA 4QP4A 3HEGA 4FICA 2P2IA 2UZEA 3QHWA 5AUWA 5AV4A 3FYJX 4QTBA 5TT7A 4RC2A 4FV8A 3VS2A 3FPQA 5KMJA 2XNGA 3OS3A 4I1ZA 4I23A 2R7BA 3OVVA 2BKKA 4L6QA 3GOPA 4TWPA 4ANQA 4Q5EA 3ZM9A 3NS9A 2IZRA 1PYXA 2C6TA 1Y91A 4DH7A 3KRLA 3NYVA 4QPSA 4TZRA 3UVPA 4EK4A 4DTBA 4F63A 1PXPA 3HKOA 4X3FB 4L7SA 4LGDA 4CCBA 2WTDA 2B52A 3TTIA 4F6SA 3COIA 5AIKA 2JBPA 3MDYA 3DTCA 5F1ZA 1IA8A 5BVFA 4PX6A 3VO3A 2HY81 3GXLA 4FZFB 4E4XA 4ACHA 5HORA 3B2TA 5ICPA 2BKZA 3R30A 2YCFA 4KRDA 4CD0A 4DFYA 4PL5A 4NFNA 2IVUA 4ZJJA 3FMLA 4FT5A 2YDKA 1K3AA 1GOLA 3TIYA 1T46A 1F5QA 3QQUA 3F6XA 5EQYA 3ERKA 3QX4A 4TYHB 5J9LA 3HUBA 4ZJIA 4D2SA 3FZ1A 5D41A 3PJ1A 3NIEA 5GZ9A 2EXEA 4C58A 2OZAB 5AJQA 4AUAA 2FB8A 5ANOA 4ZZNA 3Q60A 5EFQA 4CZYB 4DAWA 3QGYA 3PJ8A 3RNIA 2EB2A 3SHEA 1GIHA 1OL7A 1PMEA 2PMIA 1Q3WA 3NUNA 3PP1A 1OIQA 2YM8A 3BGZA 3O50A 5DH3A 1P14A 2C6LA 2PVHA 2CGVA 1RQQA 3MA3A 2XNNA 1H27A 3TKHA 2HY0A 3ROYA 2UVZA 1H0VA 2J0JA 4YSJA 4Y8DA 5HNIX 4RVTA 3HNGA 2ZV2A 4K18A 5EM7A 3RHKA 4CT2A 2F7XE 3O96A 5J1WA 4NW5A 1BL7A 4PQNA 4CRSA 4XRJA 4CFUA 5HBHA 3FQEA 2XK9A 2F57A 1PXIA 4G31A 1M2RA 4LMNA 3ULZA 1K2PA 2F2UA 3VUHA 5KZIA 4LL0A 4AACA 3N4VA 1X8BA 2X7FA 5IQCA 4CQEA 4FSRA 4O7ZA 2VTAA 2QHNA 5AAGA 5AR4A 4BDBA 5HVKA 1OL2A 4O0SA 5ETCA 1YDSE 4NZWB 3OWJA 4YLJA 2C6MA 3PLSA 4A4XA 1OKYA 3LQ5A 3TUDA 5K5XA 5E90A 4NM3A 5JFWA 2J0MB 3O7LD 4JJRA 2OJGA 4DH5A 3C9WA 4ASEA 1H1QA 5H8GA 5HLWA 3UNKA 5L2IA 1GZNA 5IA0A 4KIPA 5J9ZA 4HW7A 3PY3A 3LFAA 3R8ZA 4GFMA 4FOBA 4AGUA 4DH1A 3GFEA 3L9NA 4OW8A 3HA8A 4CFVA 4FKLA 4J8MA 1FVRA 4W8EA 1PF8A 3QKLA 4WG5A 4XG9A 3SOAA 2X2LA 3ZUVA 5HTBA 1Z5MA 5AP7A 4N6ZA 4QMNA 4U7ZA 3GVUA 3R7OA 2BVAA 2C6IA 4ALVA 4U42A 3F9NA 4WA9A 2E9NA 3DKGA 1ZMVA 3FZRA 5ETFA 3IDPA 4O7VA 2NO3A 3JPVA 4NK9A 2WU7A 1R78A 3ORKA 4JT3A 5C26A 1ZYCA 2C47A 4TWCA 4AN3A 1GZKA 2WMXA 3A8WA 3FQHA 4I6FA 4C4JA 4FL1A 4TRLA 5E8SA 5LVPA 5CAQA 1XH8A 2FVDA 4G2FA 4XHKB 3MTLA 4FKVA 4FTLA 5ACKA 2WEVA 1GY3A 3FLSA 3PG1A 4C4FA 2J0KA 4FK6A 5DN3A 2DQ7X 1H07A 4MBJA 4M84A 4CEGA 4R3CA 2R64A 2WQNA 4L67A 4ALUA 4D4SA 2RL5A 4FL2A 4F6UA 1DS5A 4ZZMA 3EQRA 2BRNA 3ZCLA 2QONA 5IU2A 4S34A 2VTOA 2WU6A 5EYMA 2G2IA 3O8UA 4PNIA 1WZYA 3RZBA 3N4UA 3WIGA 3Q3BA 2XUUA 4AT5A 2VWXA 4EEVA 4IMYA 3MB7A 4DCAA 2P0CA 1KE8A 2GQRA 4C4GA 5DE2A 2RF9A 3OOMA 1YXSA 3VHKA 3GQIA 4G3GA 2B9IA 5M51A 5CQUA 4YGAA 5H2UA 3BX5A 1XO2B 4AOIA 3ZBFA 2BROA 1G8AA 1H1RA 4JG8A 4X2FA 4TN6A 3HAVA 2VTIA 2PE2A 1FGKA 2ITOA 3OFMA 3QGWA 3CGFA 3PP0A 4JRNA 5CAOA 3QHRA 3PIZA 4BWKA 4DFNA 1UWHA 3NYXA 3RI1A 5KNJA 4YTHA 3R8LA 1HOWA 5FEDA 3P0MA 4BKYA 3PSBA 5FEQA 1Q62A 3QTIA 5BMSA 4CKRA 2PL0A 3SV0A 3F2AA 3V5JA 3TIZA 4AT4A 5I9WA 4IM0A 1U54B 4K8AA 2VAGA 1KE6A 5HGIA 5LVLA 3C0IA 2B9JA 4A07A 3ZRMA 4D4YA 5FP6A 4MBIA 3V5WA 5H9BA 4ALWA 4BIEA 3MH3A 4DEHA 3A4OX 2E9PA 5CI6A 5GJDA 1TKIA 2W5AA 1XBBA 4RIXA 3COHA 2IVSA 4FYOA 4FV7A 3TUCA 4YC8A 5K0XA 3TDWA 4DE4A 4QQJA 2VTNA 4UYAA 3QC9A 1J7IA 2Q0BA 4TPTA 4LI5A 1Q24A 3DGKA 4JI9A 4KNBA 4JX7A 1IG1A 3HECA 4HJOA 4EH2A 5BNJA 3CY3A 4AW5A 4W4XA 2OZOA 4R77A 4XMOA 3AXWA 3DQXA 4NM0A 3DBQA 2C3LA 3IDBA 4D2PA 1ZYDA 2XVDA 3CTJA 3FQSA 5BX0A 5IDPA 5DYJA 4L46A 2OO8X 2GQGA 2W1ZA 3R8MA 3EN5A 1U5QA 3F3ZA 5LOHA 2PUNA 2B9FA 4G3EA 1EH4A 3C0GA 3LXPA 3TNHA 2Z8CA 4M66A 3KXXA 2XK8A 1VYZA 3VUTA 1OIUA 3RJCA 4BCGA 3JVSA 4X0MA 3V6SA 3L1SA 2WQMA 1MRYA 4HNFA 4E5WA 4QPMA 1YHSA 3H9OA 4XUFA 5A3XA 4MK0A 4CT1A 5IMXA 4RA4A 1IAJA 3HRFA 2YM5A 4XH6A 3ZSGA 2J51A 3JR1A 4U43A 5AV0A 4EOLA 2O63A 5AR3A 4BN1A 3ULIA 2PUIA 5HBEA 1VJYA 4BGQA 3SW4A 3DU8A 3PSDA 4R3PA 4W9XA 4XV1A 4BTJA 3K5VA 3GU6A 2H8HA 3LCDA 3GOKA 3UG2A 5CAVA 3CJGA 1OL6A 1OKZA 5KHWA 2H6DA 3DT1A 3P9JA 4IB5A 3KCKA 4UMQA 3IK3A 1LPUA 3IGOA 1ZYLA 1OGUA 2VX1A 4BCHA 3LFQA 4F9YA 4G9RA 4FTNA 3FY0A 4I6HA 3V5PA 3LCOA 1PKGA 2C3IB 3HLLA 3R73A 4RFYA 3BWFA 4N70A 4D5HA 2CGWA 4FG7A 1ZY5A 1WBNA 2XNBA 4BWXA 4Y72A 3E3BX 2OF4A 2BRHA 3MH0A 5ETIA 4AA5A 4MTAA 4XV9A 3ZDUA 1Y8YA 1JKSA 3BQRA 4U80A 2XP2A 4O1OA 3UIUA 4EH6A 5HLNA 4NSTA 3ZLYA 2EB3A 5DGZA 1WFCA 3ORZA 4UZHA 3AC2A 2WIPA 3PJ2A 2R3HA 4CZTA 3EH9A 4ZXTA 3AT3A 4TWNA 4XG8A 4IX5A 2PVLA 4AXAA 1YRPA 2HZIA 2A1AB 2VWYA 2WTJA 3EMGA 2IPXA 2OH0E 4ACMA 3BHUA 4ZAUA 2X7OA 4ITHA 4YMJA 5H8EA 5FUTA 2GS6A 4GEOA 2CLQA 3GU4A 4RIWB 4U6RA 4QQTA 2GPHA 3BE2A 4S31A 4O1PA 2W1CA 3KN5A 5IUGA 3F3VA 3TI1A 4GL9A 1UU8A 3LJ1A 4O82A 4KS7A 3ETAA 1NVSA 2GHMA 2IWIA 5D9HA 3JS2A 2ITQA 4G34A 5CZHA 1UU3A 4BZOA 4EBWA 3SA0A 3RCDA 2UZUE 5ITAA 4X2KA 4OTGA 4AGDA 4CFFA 2ZM4A 3DFAA 2PVJA 2V7OA 2A27A 2J90A 3DY7A 1YI3A 5IH4A 5EKNA 2H34A 4XBUA 5EI6A 3WYXA 3AGMA 2JITA 5AIRA 5LVMA 2WGJA 1S9JA 2WKMA 4RJ3A 3QRUA 4ZK5A 4AGCA 2JKKA 3QKMA 4DFLA 5HESA 2H9VA 1J1CA 3FBVA 3NIZA 4CTCA 4TYEA 1QMZA 5IQDA 2WELA 3MFSA 4FTJA 1CTPE 2Y8OA 3R71A 5HE2A 3T8OA 5EK7A 4RX5A 1FVTA 5LMKC 3LXLA 3QFVA 3LLTA 3MGYA 4YJOA 3MESA 3SRVB 3E5AA 3G9NA 5EQEA 3GFWA 4TWOA 1OZ1A 4D1SA 4MF0A 4FE2A 3BCEA 4NTTA 2PUPA 2J0IA 3UG1A 3IPHA 3ZS5A 1SM2A 3UTOA 4M12A 4FIEA 3CE3A 4YPDA 1OMWA 5D7AA 2VWBA 3QD4A 5JQ5A 2GDOA 4LGGA 4BCKA 4FKOA 3UIBA 1W83A 1YXXA 5IA4A 2UW0A 4IC7A 3ATSA 3GU8A 5JFXA 2GFSA 3LFBA 3QTZA 4MXYA 4IAIA 2PU8A 3KA0A 3GCQA 4QTDA 3P7CA 4NU1A 2ESMA 3GCVA 5AUUA 3CIKA 1KV2A 3QUDA 4FV0A 4BTFA 4QMWA 3T3UA 3FXXA 4KAOA 1ZRZA 2XBJA 4IDTA 3GC0A 2XRWA 5KHXA 3ENMA 1ZOHA 5L6WL 4FEWA 1CKPA 3C4FA 2VNYA 1OKWA 5CU4A 4A9UA 3QD2B 3G51A 1XJDA 4KRCA 2QODA 3RM6A 4QMUA 3F88A 3UNJA 1MRUA 4MEDA 3CY2A 4WO5A 3RHXA 3VW8A 4F1TA 5IEYA 5KMMA 4JBOA 5EM6A 4ZTLA 4C37A 1PW2A 3RGFA 2PZRA 3VS4A 3I4BA 3QCQA 4O0VA 3E3PA 3FYKX 2EXMA 2YIYA 4ID7A 2WMRA 4OBPA 3F3UA 2QU5A 4R1VA 4L43A 4EC8A 5KUPA 3NRMA 2B9HA 3AC8A 5DRDA 3NLBA 2CKEA 3I1AA 4LUEA 4BI2A 4RVKA 3M1SA 3QRKA 4UYNA 4LYNA 5J95A 2JKMA 3DK3A 2HWPA 3ORIA 3UO4A 3DLSA 5K4IA 2HK5A 5CT0A 2BTSA 4G6NA 5C4LA 2CJMA 4KKHA 4F08A 2ZV7A 3BEGA 4QPAA 5DPVA 3TV6A 4DEIA 3MIAA 4EK6A 3SXRA 3NNVA 3ANRA 1PYEA 2R3JA 4J1RA 4AS0A 2QOOA 3KCFA 4O84A 4M0ZA 1IA9A 4IAKA 3MY0A 3DBDA 3W33A 2PY3A 3PA4A 2YACA 4O0RA 3V01A 2XKDA 1YKRA 5HE0A 4YLLA 5IEXA 4BCOA 3AC1A 5IG1A 2VTJA 3OY3A 4IXPA 5H3QA 3PXYA 3N4TA 2X6DA 4I6BA 4BI0A 4FKJA 1REJA 2ZOQA 3IG7A 5GINE 4L44A 1TVOA 2J5FA 3BRBA 4PRJA 2B0QA 4DFUA 2CGUA 3DKFA 1YI6A 4EJNA 4B0GA 1UU9A 3VS1A 4F9WA 4HGLA 4KS8A 4U5JA 5LQFA 1STCE 3O0GA 5CY3A 3RZFA 5L2SA 4EQMA 3FKNA 1JKLA 4X2GA 5I9ZA 5D1JA 3G6HA 4Q9ZA 1M7NA 2C0TA 3NUPA 4WRSA 5AUYA 5M09A 2YAAA 5KX8A 3ZRLA 1YHVA 3QD3A 3ZO3A 2VGOA 3OCSA 3D7TA 4RGJA 5EW8A 3LFFA 2OKRA 5HNGA 1SZMA 2HCKA 3E7OA 3FXWA 5FM3A 5E8UA 1WBPA 2VWIA 3ZEPA 2JAVA 2VUWA 5K5NA 2ITYA 4W4WA 3ZUTA 2CNUA 4JLCA 1RJBA 5DG5A 4X6QC 3V3VA 5CSXA 2ZB1A 3FLYA 3CLYA 3VRYA 2C69A 2HXLA 2Y4IB 3RPSA 3R28A 2C6EA 3E8NA 5HU9A 2V55A 2W1FA 2O5KA 2HELA 4U0IA 3RK7A 5I0BA 3EKKA 1YXUA 2VN9A 3C1XA 2IW6A 4MD7E 4V0GA 2J6MA 4KBCA 3ANQA 4GYGA 5FLFA 2FUMA 4M69A 2QLUA 3BYVA 3PZEA 2OJFE 3F82A 5BVNA 2GNJA 3E87A 3DBFA 1R0EA 4X2JA 2VD5A 5IH6A 4KB8A 2JAMA 3OT8A 5EQPA 3QQLA 4FIJA 3PA5A 4K9YA 4JRVA 4A7CA 4GKHA 4MYGA 2YHVA 2JEDA 3WF9A 4RFZA 5JQ8A 4MXCA 3LFNA 5AA8A 3CBLA 3OBJA 3QTQA 2VTTA 5DT4A 4HVGA 5IMEA 2OK1A 4O7RA 3W2OA 5C1QB 4QMZA 4AP7A 3TNWA 2WHBA 3COMA 2GHLA 4FUYA 4BGHA 3BHHA 5C8KA 3UC4A 2VTMA 4FI1A 4OGRA 5LXMA 2G2FA 4JBPA 5J79A 2I0VA 5AUVA 4N57A 2GHGA 3E63A 4H3QA 4MXXA 1Q5KA 2IW8A 3P86A 5AP2A 2UW3A 5KBQA 3D94A 2BPMA 2QCSA 4TNBA 2ERKA 4CV8A 4ZTMA 4USEA 5J5TA 4E5BA 3D7ZA 3NSZA 5IQEA 4JDHA 1L3RE 4FL3A 5AWMA 5LVOA 4QP3A 4OT6A 1ZYSA 3R7UA 3DAJA 2IO6A 3LMHA 4XLVA 1ZWSA 4AZTA 4RFMA 5JT2A 2OH4A 3NR9A 5AUTA 3EQHA 4DN5A 2BFYA 3W1FA 5CVHA 4P7EA 3F5XA 5CSHA 1BL6A 3LM0A 4ZSGA 3UZTA 4JIAA 4C02A 5EW3A 4HZRA 4FGBA 4E93A 1Q61A 3BU5A 4S33A 4IE9A 5KBRA 4QTAA 2IN6A 4GFOA 4WNOA 3FMHA 3ZLSA 4IIRA 1PJKA 3IS5A 4HCTA 4YJPA 3F2NA 1WCCA 4F7JA 4ZY5A 5CTPA 4C4EA 3M11A 4F9AA 4UN0C 4KKEA 5CF8A 4DH8A 2J4ZA 1H00A 1S9IA 4C34A 4IH8A 4JVGA 4H05A 2PVMA 3P4KA 3BLRA 2ITTA 2QO7A 3NX8A 2RG5A 3LFEA 2BUJA 1NY3A 1Q8ZA 3CTQA 2XH5A 1J3HA 3QUEA 4JIKA 3MY1A 4KBKA 4TL0A 5CAUA 2YCSA 2J7TA 4PP9A 3THBA 5HICA 5EHLA 4D4RA 2UZTA 3BHVA 4YBJA 3S0OA 1JSVA 4DINA 3Q52A 3ZYAA 5KMOA 3NUUA 1E1VA 1UNHA 1TQIA 2XF0A 5L2QA 5ETAA 2X1NA 2OGVA 3W2QA 2HOGA 4GG5A 4ZZOA 4USFA 4FV9A 3PPJA 3C5IA 3CQWA 3ZRKA 2RKUA 2OXYA 4GKIA 1FPUA 1PXNA 2LGCA 3R0TA 4YC3A 1NT2A 2Y4PA 2ZVAA 3EYHA 3RKBA 3TCPA 3E92A 4FIHA 4AW2A 3KRWA 3I7CA 4G1WA 4DGGA 3GB2A 3WZEA 3P08A 3S3IA 4F7SA 1A06A 5C4KA 2F9GA 5HOAA 3R63A 4XCUA 4Z3VA 3PZHA 3Q4TA 3D5WA 4KSQA 1ZMUA 4ZY6A 5LMKA 1GIIA 4XJ0A 4F0FA 4ANOA 4AZSA 3AMYA 2PZIA 3ZC5A 4BDDA 4XOYA 4BBEA 5JFVA 4PDOA 4E4LA 2I40A 2XIKA 4WRGA 3VJOA 4DLIA 1M2QA 2X4ZA 4F64A 3A62A 4MH7A 4EONA 2QG7A 4BCFA 3BLHA 4FEXA 3R9OA 1OPLA 2PE0A 3DDQA 4EL9A 2WO6A 3W2PA 3F69A 3SQQA 5EHOA 4EQUA 1NXKA 3LW0A 4NH1A 2X6EA 4YHJA 5KKRC 4RIXB 2Y6OA 2W1HA 3AT2A 4NW6A 4O6LA 4V01A 1CKJA 2C6KA 1OBDA 4RPVA 1YXTA 4LOQA 5E9EA 3GT8A 4EHGA 2QOBA 3HV6A 2XIYA 3B8QA 5FTOA 2NRYA 1H25A 4Z7GA 4WBBB 3P79A 5JSMA 2YN8A 1Q99A 2R3RA 4QMLA 1YHWA 4BCQA 4EYJA 2C5YA 3EN9A 3VULA 2CCIA 2PPQA 4UALA 3GCSA 1R39A 2CN5A 3ZC6A 3C0HA 4ZP5A 3GU7A 5A4LA 4MD8E 5KKRB 4U97A 4D2VA 1QPJA 3VS3A 3WF8A 3TKUA 3FLQA 4BR3A 3ZDIA 3D83A 5T3QA 3UDBA 5CEPA 5ANGA 3H3CA 4E6AA 5EI8A 3OXZA 3C4CA 4KIQA 1U5RA 3MV5A 4LRMA 1OBGA 2BRGA 2FSLX 4IZAA 5JK3A 3QCSA 4IAZA 4OAUC 4EOSA 5IZFA 4FT7A 2XB7A 4PY1A 4QQCA 4AWIA 5FP5A 5AAFA 2R3MA 4PMTA 2JFMA 3U8WA 5JN2A 4RVMA 5JZJA 3KRRA 4FKSA 2XJ1A 3FWQA 2IZSA 1DI9A 2PVKA 2XNEA 1VZOA 4TKSA 4FKPA 5DI1A 2WMWA 3IO7A 4CQGA 3EQGA 2PULA 3W16A 3S1HA 5GNKA 4ZSJA 3PVGA 1WVWA 4RJ7A 2V7AA 4GK4A 4RSSA 4XG2A 5AV3A 3QXPA 3BV2A 2W06A 3C4ZA 2C6OA 2QOQA 2ITZA 5E92A 4EYMA 2X2KA 5BPYA 1V0PA 2HYYA 4FA2A 4FTUA 3OCGA 5CF4A 3LCKA 4AE6A 5A54A 3PXKA 5DBXA 4IZ7A 4YZMA 4APCA 4ZY4A 4O96A 4E3CA 1JKTA 4IM2A 4OTHA 3QXOA 4L3LA 5BUJA 4CLJA 2UW4A 2X9FA 2RSVA 3DLZA 4JQEA 5FXQA 4A4LA 3R8UA 2DYLA 3KU2A 2O0UA 3SX9A 3V5QA 5HO7A 2HXQA 3V8WA 3ZMMA 5LCJA 4FUXA 3ZFXA 4F99A 1JKKA 3A99A 2B55A 3H0ZA 4FSYA 4PPAA 4WG4A 2BHEA 5CEQA 2UZOA 2R3FA 2Z02A 2CLXA 3C4WA 3KULA 4GK3A 2OLCA 3MFRA 5C8NA 5I3RA 4Y5QA 3FMJA 3FMMA 2OXXA 3Q5IA 4GYIA 2XJ2A 5AR8A 4BDAA 4IX6A 4MNEA 4DLJA 4NIFB 4OBQA 2OF2A 2W4OA 1IR3A 4QYFA 1JWHA 3UOKA 3AC5A 4BHZA 5FXSA 4BDHA 5HLPA 5B2KA 1XHAA 3S4QA 2OG8A 4G6OA 3SD0A 2CPKE 1KV1A 4J53A 3W2SA 2R5TA 4E1ZA 4RWLA 3RAHA 3BLQA 1U46A 1YXVA 4FZ7A 1Q8UA 4QNYA 3FZPA 3PPKA 3QTSA 5DT0A 2EVAA 4IX3A 4Y85A 4JOAA 3UZRA 3ATTA 3UPZA 1PXKA 3QQHA 5AR2A 4EKKA 3VBYA 4QMTA 3R2BA 2ZDUA 1LUFA 4RX8A 2B4SB 5TOZA 4QTEA 5AAEA 1TQPA 2CMWA 2OJ9A 1YOMA 3EQPA 1YI4A 2GNIA 1OVEA 2GS2A 4Q2AA 3CD8A 1JQHA 3LXKA 3R7VA 4D9TA 3EZRA 4RWIA 4UMRA 2F2CB 2VU3A 5G6VA 4AN2A 4S2ZA 2UZNA 4J7BA 5FQDC 3GENA 3LFDA 2B54A 4O0YA 3GCPA 5BVEA 4C0TA 5M44A 4AQCA 4CMOA 4CVAA 2BDWA 4BDIA 2VNWA 3R22A 2PSQA 2IG7A 4FOCA 1SNUA 2Z2WA 3PRIA 1QPCA 3Q2MA 4B4LA 4F1OA 3VW6A 2GCDA 4C61A 3HA6A 1OKVA 3ZM4A 5FBNC 3R9HA 4XG4A 4O7SA 3WYYA 2FO0A 3V5TA 3ZO4A 2HAKA 4A9YA 2R3GA 4UBAA 3R9NA 2BZKB 2C0OA 4DT9A 5FWKK 1O9UA 1B38A 3WZJA 2WTKC 4NL0A 3NVKI 2QO2A 4JDKA 1FGIA 3IECA 3DK7A 1PXLA 2C30A 4QOXA 4DGMA 1RE8A 3R7YA 4FV1A 5CVFA 1UWJA 1DAWA 4FG8A 3TN8A 5L6OA 5LJJA 3E8CA 3RVGA 4W9WA 3FI4A 5HIBA 4B8MA 2JKQA 2BILB 2OU7A 4EZ5A 3WIKA 4EORA 4IAFA 4BDGA 3ODYX 1FMOE 2WTKB 3ZUUA 2A4LA 4WSYA 4ANBA 3BI6A 2OXDA 2A2AA 4ANMA 4DHFA 5DNRA 3MWUA 3UOJA 2B7AA 4MCVA 3F7WA 4V04A 4KWPA 5CT7A 3C5UA 5AUXA 4EZ7A 2PMOX 2EXCX 3BELA 4EHZA 1BUHA 5CYIA 1XH9A 3HP2A 4RWJA 5L6PA 1WBTA 2W17A 4TYJA 4ZSEA 1HCKA 1M7QA 1MQ4A 2YZAA 2G1TA 3I0QA 1H0WA 3NW7A 4IZ5A 3Q5ZA 4RX7A 2X8EA 5C01A 3CQUA 2G9XA 4QTCA 4AZFA 5HCZA 4D9UA 3BIZA 5JMSA 4ACGA 5FG8A 4AF3A 2GS7A 4LV5A 4YTFA 4D2RA 3ET7A 4HOKA 4F9BA 3UQFA 4MNFA 4YNEA 1MQBA 3LIJA 4ZLYA 4AT3A 4AG8A 2W1GA 3EFLA 5DVRA 3D2IA 2QOLA 3MVLA 3FKOA 5EG3A 5BUEA 1IRKA 2PZ5A 3LJ2A 3PPZA 5I9VA 2GQSA 3DB8A 4LUDA 4EOJA 1H1PA 4CLIA 1JLUE 4U3ZA 3QA0A 3KEXA 3MIYA 4PUZA 2XMYA 5GZ8A 4YUQA 3W2RA 4GH2A 3D5UA 3L9LA 3U55A 2PZYA 3NDMA 3SLSA 4FYNA 5IQIA 3ZLXA 2ITPA 3RWQA 4BBMA 3TZ7A 2C3KA 4KUJA 2RFDA 4MWHA 3OUNB 2XBAA 5D12A 4QP1A 3NCGA 2WQBA 3WE8A 4NKSA 2YERA 4U9AA 4Q9SA 3R7GA 4TY1A 2WD1A 4BGGA 4D2TA 5CAPA 4N6YA 4J8NA 3W10A 4RJ4A 3ZEWA 5CALA 5HD4A 5A4QA 4TXCA 4XG6A 5KMIA 4RA5A 4S32A 4DG3E 3KC3A 4CGAA 3F5UA 5AP3A 3SXFA 4L3JA 2XK7A 1J1BA 4EI4A 3MVMA 5E8XA 5FEEA 3GI3A 1Q8WA 4E6CA 1G3NA 5CWZA 4WNPA 4R6VA 3VF9A 4BIBA 4CTBA 4OTRA 3FY2A 4J97A 1KOBA 4RIOA 1BKXA 2W5HA 2WIHA 3BYMA 3H9RA 5ACBC 3DS6A 2X81A 1NA7A 3DZQA 3LOKA 1XQZA 2PK9A 3R8VA 3ZO1A 4E26A 1Q41A 3D5XA 4FTQA 4GFGA 5J5SA 4ERKA 2P2HA 1E1XA 5LMBA 3CQEA 2R9SA 3M2WA 1W82A 2RFNA 4IB3A 4ZOGA 2VO7A 4GUEA 4RLLA 4IB1A 5E8VA 5CEOA 3D2KA 1U4DA 2WMTA 3DK6A 5D10A 3BU3A 4R1YA 3A7HA 5DWRA 4I24A 5C27A 4AFEA 4BBFA 4EH9A 2WTWA 4WG3A 3DXPA 4I92A 2O65A 5AP5A 2BAJA 4AA0A 3D7TB 2DWBA 4FT3A 4LGHA 2HENA 2UW5A 3HYHA 1Y6AA 2C0IA 5DT3A 4PL4A 3R9DA 5DLSA 2WOUA 2XKFA 1T45A 3UE4A 4C2VA 2R3LA 4XV3A 1WBSA 3DAEA 2YIQA 2OZAA 5CLPA 4YU2A 1P2AA 4DA5A 2YWPA 4BDJA 4EH7A 2QR8A 3FLNC 4DEAA 1FBNA 3RPOA 5IDNA 4FT0A 4FMQA 3HVCA 2IZTA 3EOCA 4XOZA 2WTIA 3VQUA 1K9AA 5ANJA 4BB4A 4BVUA 3WILA 5HZNA 3FMKA 3MJ1A 5CF5A 2WAJA 1WBVA 3GBZA 3MJ2A 4ANNA 2PE1A 4M67A 3Q4ZA 4AZVA 3MY5A 4O22A 2CKOA 3HV4A 2JDSA 2XA4A 5F4NA 4NEUA 4V0GB 1GIJA 5BYLA 4I4EA 3TT0A 1PRYA 3QZIA 4WHZA 3C4EA 3Q4CA 4E6QA 5CZIA 3KF4A 2C5VA 3PVBA 3R00A 5HTCA 3BBWA 5HHWA 3UP2A 2J5EA 3H30A 3QLGA 4H39A 2QKWB 3VBVA 4DT8A 2P4IA 4X7QA 4TYGA 3EQFA 4MBLA 2QG5A 5E1SA 4HVIA 5A4TA 3FC2A 5AM7A 4B99A 5AP4A 4O0XA 4AN9A 3DZOA 3IDCA 5HG9A 3QALE 4X3JA 1W0XC 1WAKA 5IA3A 2QOKA 3BKBA 4RMZA 2CDZA 1PMNA 2QD9A 4KINA 4WKQA 3BGPA 2ITVA 2X4FA 2JDRA 3AD5A 4QP7A 3RCJA 4IBMA 4O7NA 4LG4A 5T6KA 5D11A 5GHVA 3GU5A 2OFVA 2OBJA 3OG7A 1OL1A 3VBQA 4ZTHA 4JDIA 2YWVA 3PDTA 3DNDA 3WZDA 2BDJA 3TNPC 4CSVA 3LQ8A 2WB8A 5EKOA 4L42A 2R0UA 2HWOA 2BCJA 2R3OA 4JQ8A 4FNYA 4QP9A 5I5ZA 3U9CA 2BZJA 5JGAA 4J96A 5AA9A 3Q96A 3IW7A 3RK5A 1JVPP 1PMUA 3ORLA 4J95A 3VIDA 2NRUA 3PXZA 5J1VA 2RIOA 5BMMA 5JFSA 3VUGA 4B6LA 5IH5A 2Y6MA 3W8QA 2PTKA 1QPDA 4FV2A 3G90X 3UZPA 4O91A 3OROA 1ZOGA 4I5MA 4RLKA 3A7FA 4J71A 2GNFA 3LM5A 4ONAA 5HCYA 2HZ4A 4BDEA 4FC0A 2ZMCA 5LMAA 4C4IA 1KE9A 2VX0A 3F5GA 3TL8A 2JDOA 3LVPA 4EH4A 4BCNA 1Q3DA 5EDPA 3TKIA 5KZ0A 4GG7A 4CFWA 4O7WA 3FAAA 4MHAA 3DXQA 2PUUA 3HGKA 5IA5A 4W4VA 4XP2A 1F3MC 3FE3A 4O6EA 3PXFA 3UQGA 4D1XA 1E9HA 4FF8A 2ZAZA 2ZB0A 4FZDB 5I9UA 4E7WA 2OJIA 5BYYA 2XYNA 2WQOA 4PDYA 3BGQA 3MVHA 3L8XA 4F0IA 4BYIA 4L7FA 4E73A 3HMMA 2PWLA 2BIKB 3VHEA 4FTAA 3UGCA 2J50A 2CHLA 1SVGA 4PNKA 3TZMA 3RMFA 3AGLA 5A14A 2GNGA 2XKEA 3QZFA 1OM1A 4X2NA 4L01A 2XK3A 4I5CA 5AP6A 3RAKA 5J8IA 3NVMB 2A19B 4QRCA 2JBOA 3KRXA 4DCEA 5M4UA 3OW3A 3QQFA 2G15A 4R5SA 2YIXA 3ZHPC 4ANLA 2VWWA 4H3BA 2R7IA 1U54A 1Y8GA 4OUCA 3HAMA 5EW9A 2ETKA 3KREA 3CKWA 3FPMA 2JKOA 2RFEA 2OICA 5HO6A 4A9RA 3L8VA 2BDFA 3L9MA 4J98A 3DXNA 3ZXZA 3EL7A 4I3ZA 3D5VA 2J2IB 3AT4A 3QKKA 3VAPA 4AU8A 4PMMA 5E8TA 3FSKA 3QTWA 5JZNA 3PUPA 3ORMA 5IQHA 3B8RA 3IONA 4RRVA 3UYTA 2YM3A
chains in the Genus database with same CATH superfamily
3BV3A 3I7BA 2VRXA 3D0EA 5E8ZA 1KE7A 3UYSA 3LE6A 2VWVA 4C2WA 4XLIA 4KD1A 3PE2A 2H96A 3R1YA 3Q04A 1ZARA 3G15A 2YFXA 3Q9ZA 2NPQA 4M14A 2WQEA 4PTEA 4XBRA 4OTDA 3OXTA 2HW7A 4C7TA 3KFAA 4FVQA 5LARA 1XKKA 2I0EA 3MFUA 5DA3A 4KKGA 4ZJVA 3O71A 4ACCA 4L8MA 5C9CA 5LWMA 3KXMA 5EYCA 3ACKA 3QZGA 1XH6A 3PFQA 3EJ1A 3ELJA 4YLKA 4FSUA 2GFCA 4R78A 3ZZEA 4TT7A 3OXIA 4GIIA 4N0SA 4WUNA 4C59A 4ANSA 3GP0A 3OW4A 4JQ7A 4C33A 4Z16A 1AGWA 3RK9A 1XH7A 4FTMA 3ZSIA 2J9MA 1J7UA 2O8YA 4UEUA 2DS1A 2ONLA 2G01A 3UBDA 4FV3A 2CCHA 2JD5A 1OPJA 1FOTA 1CM8A 2BAKA 4UXQA 3OP5A 4WNMA 4G5JA 1GZ8A 2YDIA 4MF1A 2Z7RA 1VEBA 4DTAA 4U45A 4PV0A 2XK4A 3CSVA 1XH4A 2C6DA 3P5KA 3PE1A 4EHEA 1WBOA 5KMNA 4CG8A 3RPYA 4ENXA 4HYSA 5EOLA 5FD2A 5FM2A 2R0IA 4D4VA 2O64A 1ZAOA 3PIXA 5F94A 1G8SA 4LV7A 3JXWA 4HYHA 3QRIA 2REIA 4IACA 2CNQA 2Z60A 3MB6A 3DBCA 4M15A 3U4UA 3V8SA 4CZUA 2Y0AA 4L9IA 1M52A 1A48A 1JNKA 3FKLA 4MXOA 2R3PA 4A9SA 4EBVA 3MYGA 3KXGA 4FTOA 2R4BA 5C8MA 3EIDA 3LCSA 1O6KA 4GT4A 3RPVA 3PA3A 3VBXA 5EM8A 2BRBA 5G1XA 4BWPA 4LDTA 3PRFA 5AV2A 4RBLA 2V62A 2F4JA 2ZYBA 1CMKE 3JYAA 3KULB 3R1SA 2FYSA 4IJ9A 1CKIA 3WI6A 4DG2E 2YM6A 5A6NA 3U54A 5EH0A 3OCTA 4ITJA 3OY1A 3SW7A 1I44A 4MNEB 5CASA 5I9XA 3AOXA 4NCTC 4HPTE 2IW9A 3SVVA 1FQ1B 4UWBA 1UV5A 4BRXA 2ETMA 4Z9LA 2VO3A 3GC8A 4RIWA 3BE9A 4FTKA 2IVTA 1UNLA 5DOSA 5AX9A 4CNHA 5IISA 3ZH8A 5AM6A 3KVWA 3NNWA 3C13A 5HIDA 2XS0A 3IQ7A 1UNGA 4UZDA 2QVSE 3C7QA 5FDPA 4UMPA 4F4PA 2O3PA 4HZSA 3A4PA 3QTRA 1Z9XA 4FIGA 5HX8A 5D7VA 3VS5A 2G2HA 2JIVA 3TWJA 4C35A 5CSPA 3HMIA 3K54A 3O8TA 4ERWA 3FZOA 5BVKA 4IB0A 2W99B 4XS2A 5K0KA 2HW6A 4M8TA 2ZM3A 2EU9A 3QZHA 4JXFA 4M7IA 4BJJB 1UU7A 1OI9A 2AYPA 3QTXA 3VS7A 4BCJA 2W96B 4AXDA 2C1BA 5GIOE 2XRUA 2NNWB 4FX3A 5L3AA 3F2RA 4A9TA 1O6LA 4E6DA 2BFXA 3D15A 4TW9A 3OCBA 3H0YA 3OD6X 1YVJA 2AC3A 4EQCA 3CPCA 5AMNA 5F9EA 4ACDA 4BC6A 3CCNA 2B53A 4FEQA 2UW9A 5HI2A 4EOQA 3TDVA 3VUKA 1I09A 2R3QA 5CU6A 4L53A 2WMUA 4P5QA 4LL5A 4X6RA 4FSQA 5I9YA 4H3PA 4PMSA 4F70A 3UJGA 4FKWA 5ANIA 2JIIA 2X8IA 3NGAA 3QYWA 4EWHA 3FL4A 4I5HA 4FVPA 1LEWA 4QYEA 5EDQA 4PDPA 2XYUA 4R7HA 3HMOA 3GCUA 3QA8A 2X0GA 4ZSAA 4FG9A 2PZPA 4W8DA 4UMUA 4IX4A 2IEWA 4K0YA 3KRJA 4L52A 3HUCA 5HTIA 2YLFA 3NPCA 5J7BA 4DF3A 2HZ0A 3WF7A 3O23A 3G33A 4JDJA 2YITA 2W1EA 1JSTA 3K2LA 3OWPA 3VN9A 4CMTA 4E4MA 4Z55A 4XRLA 4FKRA 2WMVA 3SAYA 2XK6A 4NWMA 3I81A 3KN6A 3SC1A 3WBLA 4CKIA 2JDVA 3H4JA 5EYDA 4UXLA 3NFFB 4O4FA 2XNOA 2W1IA 5CU2A 4BI1A 5AUZA 2X2MA 2YM7A 3DQWA 3NW5A 4KIKA 2GNHA 3VVHA 3LMIA 4KA3A 1SYKA 4O4EA 5IKWA 3R7IA 3EQCA 3UQCA 4IWPA 3WZKA 4AOTA 3V8TA 3P5JC 3QU0A 4DEGA 4O7YA 4FKGA 1HCLA 4ZMFA 4B7TA 4TNDA 1RDQE 1YDRE 3GC7A 4GRBA 4E8AA 4IADA 2ITXA 5CX9A 4DGLC 3W0OA 3PXQA 3OTUA 3NNXA 2PMNX 2PVNA 2WOTA 5L8JA 4BKJA 1ND4A 4YBKA 2O2UA 4M0YA 3CKXA 3CD3A 2OWBA 4QYGA 1YW2A 4NJDA 2WXVA 5EOBA 1OIYA 5CF6A 4MQ1A 1B39A 2WMBA 2PVYA 3G0FA 2KULA 4C3RA 3HDMA 3TACA 4A06A 3HV5A 4YJVA 3EFJA 4GSBA 3QCYA 4CFMA 4DEEA 2A0CX 3F66A 4D2WA 5CI7A 3VF8A 2I0HA 3QQGA 1KUTA 2QOIA 3HRBA 4KSPA 4UMTA 5BVWA 5HU3A 3R01A 5B2MA 3UO6A 4ORKA 4AGWA 4O21A 4W4YA 2C5OA 4GJ2A 4LMUA 3UOHA 4DG0E 5B2LA 2UZVA 4E4NA 4XG7A 4M13A 4BCIA 4X3FC 4BF2A 3BZ3A 3FDNA 1JPAA 3GC9A 3QWKA 3OWLA 3OC1A 3UVQA 2FA2A 4AAAA 4DEBA 4NYEA 1UA2A 1H26A 4U44A 3G9LX 3HDNA 3KXZA 3SKCA 4ZS4A 2JGZA 1YDTE 2C4GA 3CP9A 3PY1A 4NTSA 3ITZA 4YO4A 3W0PA 2R3NA 3B2WA 4K6ZA 4ZMEA 3JVRA 4GT3A 1GNGA 4LQMA 4FRFA 4FSWA 3UNZA 4ASXA 3PLAE 3QYZA 4WSQA 3TG1A 2I6LA 4MXAA 1PXJA 2RGPA 2WZJA 5E7RA 3W8LA 5IUHA 3ORPA 4MKCA 2YCRA 5M4FA 2YJRA 3W0RA 3JUHA 4AW0A 5AEPA 2KTYA 4M97A 2QLQA 4IM3A 3W18A 5H8BA 3PSCA 5LWNA 4YJQA 3I5ZA 4EWQA 3K5UA 2QU6A 5B7VA 5BVOA 1BYGA 2Z7QA 4IC8A 4RC4A 3UC3A 4V05A 4ARKA 2JDTA 4C4HA 4DH3A 2XM9A 4OBOA 2C5XA 4GUBA 4U40A 3FXZA 1WVYA 2JIUA 2ACXA 3MSSA 3BYOA 5CEMA 1SMHA 1W98A 4JG7A 3NNUA 5HG5A 3L8SA 5EHYA 2YLEA 3UIXA 2GTMA 3QX2A 5FRIA 3E93A 1SVHA 1QCFA 1FINA 2XKCA 3F3WA 3CPBA 5F95A 3HX4A 3R2YA 4EZ3A 4MQ2A 2E9VA 3FI8A 5IEVA 1Y57A 3TJCA 3VBWA 4YP8A 3AKKA 3ID6C 1GAGA 5AX3A 5J87A 4O81A 2ERZE 2JFLA 4GK2A 5E8YA 3HV7A 2FSTX 4L68A 4YSMA 3FJQE 3RBWA 5JRQA 3VJNA 4YJTA 4QMOA 3IW4A 5C03A 5M55A 3EN7A 5A9UA 4FSNA 1PY5A 2PVRA 5BYZA 2CKQA 3TNIA 4GS6A 2XCHA 3R6XA 4QQ5A 2OJJA 5HVYA 4G9CA 4ZS0A 2ZV8A 1ZMWA 3HMNA 1PMVA 4MWIA 4DGNA 1DI8A 5HEZA 1FMKA 2FSMX 2QNJA 2VV9A 3COKA 3RPRA 3VC4A 3RAIA 3HZTA 4G3FA 1MRVA 4G5PA 4NCTA 2LAVA 1R1WA 3C50A 1REKA 3KXNA 4FKUA 4F7LA 2YEXA 4RJ5A 2VO0A 1H1SA 3DB6A 5M06A 5M08A 4E5AX 1SVEA 3G2FA 3POOA 3WZUA 4EHVA 2CGXA 4J99A 3D14A 4UWCA 1KWPA 1YWVA 2YCQA 3U9NA 1BI7A 2VTPA 3BHTA 4GV1A 3N51A 3ZOSA 3OUKA 2B1PA 5M4CA 2WNTA 2ITNA 1VLRA 3EQDA 3DAKA 5HQ0A 1Q8TA 2QR7A 4I0RA 5JGDA 1PKDA 3FHIA 4U79A 4N4SA 4DITA 2VGPA 3Q6UA 3Q6WA 3TTJA 3ORTA 4EOKA 3SG9A 4GW8A 3EQIA 3MFTA 2Z7SA 2R2PA 4R3RA 3DTWA 3MH2A 4A4OA 2W4JA 3PY0A 4QMMA 4JG6A 4PMPA 2WMAA 3P7AA 4DBXA 2AC5A 4FBXA 5EI2A 4EOOA 2JC6A 3QAME 3R21A 4IJPA 3ZZWA 3R1QA 3V04A 2WTCA 4C3PA 2WEIA 5TF9A 3TV7A 4AOJA 4NM7A 5M53A 3ALOA 3OMVA 4QYHA 3ZO2A 4YZDA 4LV8A 4XX9A 3KY2A 1ZZLA 3UOLA 5GIPE 1F0QA 2OSCA 3JY9A 3TZ8A 3AC4A 4L00A 4FEUA 4YHTA 3KQ7A 3DFCB 2F7EE 4IANA 4D58A 3DKCA 4KIOA 5A6OA 1KOAA 4FT9A 4FNXA 2UZBA 3I0OA 1P4FA 4PTCA 2VO6A 4K77A 3NAXA 3DPKA 4GVJA 5M57A 1APME 1XR1A 4XNEA 5DIAA 3EL8A 2QKRA 5HO8A 3TNQB 3S2PA 3PIYA 2X9EA 3QD0A 4HYUA 4G16A 3RWPA 3OOGA 3O17A 5HNBA 4Y5HA 2XNPA 3AMAA 4BDFA 1H08A 3AG9A 4O83A 3I5NA 3E88A 3ORXA 3VUDA 3Q32A 2QURA 3U87A 4RQKA 1BLXA 1ERKA 3MW1A 4J52A 5AV1A 3NUXA 1TQMA 3IOPA 4ENYA 1ST0A 3QRTA 3QQKA 1ATPE 2CN8A 1OL5A 2OFUA 2QHMA 5A4EA 3MVJA 1QL6A 1IAHA 2BZIB 3BHYA 3ENHA 3NUYA 4WIHA 1OECA 4S30A 5EM5A 1IEPA 4BTKA 3E7VA 3E62A 3LKMA 3SG8A 5IQFA 3MBLA 4MAOA 3RALA 5IPJA 1U59A 1M14A 2WTVA 3IW8A 1YQJA 3R04A 2VWZA 2UVXA 2GU8A 4IWDA 4NM5A 3KMWA 4YHFA 3UPXA 2GTNA 3F3TA 4HYIA 4HCUA 4CFNA 4I5PA 4EK8A 2XJ0A 1WVXA 2W1DA 4GU9A 5L4QA 4G3CA 4PF4A 4Q5HA 1NVRA 4F0GA 2V5QA 3R02A 2ZDTA 4HNIA 3OT3A 4ZIMA 1UVRA 4RIYA 3RINA 5AR5A 1M2PA 4BTMA 2C68A 4GU6A 3ACJA 3NUAA 3ZXTA 2WFYA 3FSFA 5KO1A 4YTCA 2W9ZB 5EDRA 3TEIA 4JBVA 4IFGA 3ZBXA 3NYNA 3WARA 3VS6A 3PXRA 2QQ7A 4TTHB 4YTIA 4HCVA 1ZXEA 3FLWA 3TZ9A 3BU6A 3MPAA 3UODA 3BL7A 5K4JA 5KCVA 1R3CA 5HD7A 3T9IA 3BWJA 1YWRA 3O8PA 4QT1A 4UWYA 1WMKA 3F61A 3CJFA 5DMZA 2OIBA 4I41A 4Y95A 5ANEA 2VWUA 3KMMA 4B9DA 3I6UA 5FGKA 4X3FA 3BPRA 4BCPA 5JRSA 4D1ZA 3CTHA 3QTUA 5HG7A 1AD5A 4RX9A 4FR4A 4C36A 5I4NA 4HGEA 3KGAA 2WMQA 4IWQA 3A8XA 4ZTSA 5TE0A 3FMNA 4IFCA 3VS0A 3QC4A 1OIRA 2ONLC 2X8DA 3DJ5A 4EKLA 4QNAA 4AXEA 5AR7A 1PHKA 1ZZ2A 3OZ6A 4IVAA 2E9UA 2DUVA 3LZBA 3NUSA 4QO9A 5ANKA 2BIYA 3O2MA 5HVJA 4OTFA 4WD5A 1P5EA 4IZYA 4TYHA 3DA6A 5IA1A 3AQVA 3ZSHA 2I1MA 2W05A 4BKZA 3EN4A 4CRLA 3RAWA 3QF9A 4JX3A 4CYIA 3CGOA 1GZOA 3TV4A 4BZNA 2W0JA 4YZCA 3G5DA 5B0XA 2UW8A 3QWJA 4K2RA 4UY9A 4JR7A 2VTSA 4WUAA 3W55A 4IAAA 4YJNA 1AQ1A 5CS6A 5KMKA 2OIQA 1XBAA 4FKTA 4HPUE 3NCZA 2XIXA 2I0YA 2XNMA 4ZTNA 3LFCA 2XIZA 2F7ZE 2JLDA 3DBEA 3KMUA 1OUKA 3EQBA 3RM7A 5BQ0A 3PUFC 4EOIA 4FGRA 1J7LA 3GUBA 3PFYA 2ITWA 5M4IA 1L8TA 2UZLA 4JAIA 4P4CA 4I4FA 4IDVA 3Q53A 2ZMDA 3H9FA 4IWOA 3R9RA 4F09A 4YJRA 5GJFA 3A7JA 4M69B 2OI4X 2EUFB 5ANDA 4O0TA 3UIMA 3IW6A 1ZOEA 3NYOA 3FMEA 4ZLZA 4U41A 5GJGA 1H28A 4IHPA 5CU3A 3GEQA 2OW3A 4NIFA 4XP0A 2E9OA 2WMSA 3WF5A 4OTWA 5CSWA 4O2PA 2W9FB 4OTQA 3V51A 4D28A 4FSMA 4JMQA 5HKMA 3ZTXA 4EK3A 3PWDA 4DYMA 3DDPA 5DEYA 4JR3A 3MI9A 2QOHA 3QRJA 4IEBA 5DHJA 1R0PA 4RZVA 2XM8A 3H10A 5DR2A 4QMQA 2QC6A 4FV4A 4HGSA 5M07A 4F6WA 2W5BA 4II5A 3DCVA 2YA9A 2YIWA 3CS9A 3KKVA 4JBQA 4TYIA 4WNKA 4BFMA 4EUUA 3RTPA 3U4WA 1FVVA 5CXZA 3R7EA 1LR4A 1DM2A 2P55A 2AQXA 3F7ZA 3EHAA 4DTKA 3UDSA 1W8CA 3OEZA 5L8KA 3Q9XA 2UZDA 4Y73A 3A7IA 3A2CA 3S00A 3WOWA 3CC6A 3OEFX 4M3QA 3Q4UA 4QMVA 4RZWA 3BQCA 3FMDA 4XG3A 4EC9A 3NMUF 3CR0A 1Y6BA 5BUIA 4HVHA 1J91A 3KK8A 3OTVA 4OR5A 4O86A 3TYKA 3ODZX 4LRJA 3VRZA 4DC2A 4O4DA 3MPMA 4I22A 5CVGA 3QQJA 4K33A 4PDSA 3UP7A 3U6IA 2P3GX 3AMBA 4AXFA 4D55A 4EH5A 5J7HA 2GSFA 1Q4LA 4FK3A 5CNNA 3UMWA 3EFKA 3TXOA 1VYWA 3F5PA 4O2ZA 4L3PA 1BX6A 3FZTA 2IJMA 2Y7JA 3FL5A 4FTRA 5JGBA 5KMLA 3REPA 1H24A 2Q83A 2YZLA 4PP7A 4FZ6A 3ROCA 3V6RA 3FHRA 3Q9YA 4GMYA 4C3FA 5J9YA 4CXAA 3MS9A 4O0WA 3AD6A 2J0LA 3HL7A 2Z7LA 4RWKA 2RG6A 3MPTA 4CCUA 3M42A 4AX8A 3I79A 4G17A 4ZTQA 4CYJA 5CU0A 5HG8A 1A9UA 4FEVA 4C57A 2W7XA 4L45A 3FI2A 2QOFA 4YO6A 1JAMA 1UKIA 5FTQA 3SDJA 5M56A 5A46A 1VR2A 2IVVA 2ZV9A 3EYGA 3IGGA 3AKJA 1CSNA 1UKHA 2C3JA 4AE9A 4I6QA 2WPAA 5DR9A 4MVFA 4U81A 4R7BA 3TM0A 4C38A 3W0NA 5CSVA 4QD6A 2Q0NA 2R3IA 3T3VA 3FI3A 2UZWE 2UVYA 5EYKA 4ZLOA 4C62A 5F20A 4BCMA 3E64A 3LJ0A 3K3JA 2C5NA 4QMYA 3KXHA 4ZEGA 3W32A 3TUBA 3W2CA 1YOLA 2C1AA 4FVRA 4KIKB 4H1JA 4CG9A 5FTGA 4FNZA 3IOKA 2BRMA 2Y9QA 3U6JA 4YR8A 4EH3A 3KF7A 1YOJA 4LFIA 3RNYA 3QCXA 4YPSA 3HRCA 2I7QA 2XCKA 4K1BA 3FV8A 4H58A 3P7BA 4DBNA 3ORNA 5K3YA 4GVAA 4NFMA 4QMPA 3SOCA 4OLIA 4QP6A 4D0WA 4YURA 4DFXE 3RP9A 3Q2JA 3FC1X 1NW1A 4O7TA 3KK9A 4I20A 1LP4A 3I6WA 2QOCA 1G5SA 5E1EA 3POZA 3QUPA 5L8LA 2CKPA 3GGFA 3NEWA 4UX9A 3KL8A 4EK5A 4ASZA 5IF1A 2VTRA 5TR6A 2PYWA 2ZJWA 3BBTB 3DKOA 5TO8A 4ASDA 5AADA 4P2KA 3R83A 4JAJA 2FSOX 1JSUA 5E91A 2XEZA 5T68A 3IKAA 4EOMA 4U3YA 3FLZA 5HIEA 4FSZA 4CFXA 5HX6A 1O6YA 3LXNA 1XH5A 3LLAA 3G0EA 3U6HA 2SRCA 3P78A 3PYYA 4UV0A 2XZSA 5AP0A 4WBOA 4LOPA 3ZU7A 4F9CA 3N9XA 4K11A 5LVNA 3A7GA 4GT5A 2YABA 4KBAA 3BYSA 2VTHA 3NZ0A 4GJ3A 1NVQA 5E8WA 1H4LA 3PVWA 2OIDA 3ALNA 5JH6A 3HMPA 4HGTA 4YZNA 4I0SA 4FTTA 4RQVA 2UW7A 4C8BA 1PXOA 2BTRA 3DNEA 3GQLA 4FNWA 1JOWB 4JS8A 1Q97A 4BDKA 4O38A 4UB7A 5E4HA 4FZAB 3V5LA 3FUPA 4O7LA 4GIHA 2RFSA 4FIFA 1DAYA 5IQBA 3Q9WA 3VUMA 4FKIA 2Y4IC 4OTIA 4USDA 1URCA 4NUSA 1OB3A 2BMCA 4QMSA 5A4CA 3FEGA 4O27B 1LEZA 5HCXA 3VBTA 1CDKA 4QYYA 3MN3A 3UMXA 3NAYA 4F78A 3MTFA 1XWSA 4YZ9A 5LCKA 4OAVB 4EOPA 1B6CB 5HBJA 2V0DA 4ZSLA 3I60A 4HVSA 4EJ7A 5BVDA 3O7LB 4H1MA 1W7HA 2GMXA 4OTPA 3U51A 4YZBA 4RJ8A 4JNWA 4HVDA 4BY9E 4BL1A 5FXRA 4I21A 4D5KA 1SNXA 3S95A 1OUYA 4E20A 3EKNA 1PXMA 4PTGA 2V22A 5L2TA 1H01A 2FH9A 2IZUA 3KVXA 4MX9A 4FV6A 4YC6A 2YJSA 2QI8A 3NW6A 4DEDA 1RW8A 5DEWA 5K9IA 1OITA 2X7GA 3PG3A 4QP2A 3OHTA 2X39A 3ZFYA 1P4OA 4NKAA 2F49A 3D4QA 3O51A 3P23A 4G3DA 2VTQA 3KB7A 2ITUA 4MXZA 1V0OA 4I94A 2CNVA 3EN6A 3OF0A 4YJSA 5CXHA 3LFSA 3LHJA 5IA2A 5JKGA 2ETRA 3VWAA 4LOOA 4RT7A 4DFBA 2VZ6A 2YISA 5FDXA 4XEYA 3UO5A 3A60A 4ZTRA 4P5ZA 3PJ3A 5CEIA 1XBCA 2BZHB 3VNTA 1H8FA 4M68A 5CQWA 3R1NA 2EWAA 3CXWA 4NJ3A 4FODA 3QLFA 3BYUA 4KABA 3LCTA 3SGCA 1YWNA 4BYJA 1W2DA 3AC3A 5DR6A 4DGOA 3PVUA 4GCJA 3FZSA 2UUEA 4EH8A 4Z7HA 4IVBA 3IW5A 4IAYA 5FBOA 1V1KA 3VUIA 1M17A 3ZFMA 4AFJA 1JBPE 2QO9A 1KSWA 2UW6A 3DOGA 3EWHA 4I0TA 5DFPA 3MA6A 3LQ3A 3C51A 1ZYJA 3EFWA 3SRVA 2PVFA 4R7IA 5JEBA 2R3KA 3JY0A 3HV3A 3K3IA 3LPBA 4FTCA 2YIRA 4FKQA 4EUTA 3II5A 2NP8A 1WBWA 2PMLX 3D9VA 2XEYA 3OWKA 2YM4A 3E8DA 2XIRA 5HE1A 4BZDA 2CSNA 2BHHA 4ITIA 5KE0A 3R8PA 3ZLWA 1QPEA 3W0SA 3PJCA 4FSTA 4BDCA 3TJDA 2GNLA 3DJ6A 3DJ7A 4FIIA 4P90A 4XP3A 4AA4A 3BEAA 3WF6A 3PWYA 4F65A 4I93A 5AP1A 4X21A 3EZVA 5DRBA 2YAKA 1V0BA 4PWNA 4LRKA 1MUOA 3G6GA 2UV2A 2YDJA 4U8ZA 3UVRA 1BMKA 2BAQA 1KE5A 2ZM1A 3PTGA 3E8EA 4IVCA 3OBGA 4FV5A 4O0UA 5HE3A 5IUIA 4BHNA 2E2BA 4Y83A 3LMGA 2BR1A 3NWWA 2W4KA 2FGIA 3EB0A 4B8LA 4DFZE 4R8QA 3C4XA 2VX3A 1ZY4A 5L2WA 4CV9A 3GNIB 1BI8A 1OPKA 3WE4A 3ZONA 1W84A 3SXSA 1H1WA 4JL9A 4AZWA 5IQAA 4F7NA 4WT6A 3T9TA 4RC3A 4XV2A 4PPBA 4CMUA 1Z57A 4RVLA 2VTLA 4FTIA 4IW0A 4BICA 4G6LA 4YNOA 3QL8A 5CANA 2BALA 4MD9E 4LM5A 3BLAA 5CENA 4Y46A 2PHKA 3LAUA 4H36A 2AUHA 2HIWA 1GJOA 4CKJA 4WOVA 4NT4A 1ZLTA 4AZEA 4PPCA 4RG0A 3AD4A 4YJUA 5CNOA 4APPA 3CEKA 5CEKA 3DV3A 4F1MA 1URWA 4IQ6A 1MP8A 4RJ6A 1IASA 3MH1A 5GZAA 1Q8YA 5I3OA 4QP8A 5TKDA 3QBNA 3P1AA 5AFVA 3A61A 5IQGA 4XYFA 3HP5A 4BIDA 4OT5A 4PL3A 4IVDA 2P33A 2HZNA 3L8PA 4QMXA 4R5YA 4RIYB 3VQHA 3L9PA 4AW1A 4D0XA 4QP4A 3HEGA 4FICA 2P2IA 2UZEA 3QHWA 5AUWA 5AV4A 3FYJX 4QTBA 5TT7A 4RC2A 1OGYA 4FV8A 3VS2A 3FPQA 5KMJA 2XNGA 3OS3A 4I1ZA 4I23A 2R7BA 3OVVA 2BKKA 1W2FA 3GOPA 4L6QA 4TWPA 4Q5EA 4ANQA 3ZM9A 3NS9A 2IZRA 1PYXA 2C6TA 1Y91A 4DH7A 3KRLA 3NYVA 4QPSA 4TZRA 3UVPA 4EK4A 4DTBA 4F63A 1PXPA 3HKOA 4X3FB 4L7SA 4LGDA 4CCBA 2WTDA 2B52A 3TTIA 4F6SA 3COIA 5AIKA 2JBPA 3MDYA 3DTCA 5F1ZA 1IA8A 5BVFA 3KIOC 4PX6A 3VO3A 2HY81 3GXLA 4FZFB 4E4XA 4ACHA 5HORA 3B2TA 5ICPA 2BKZA 3R30A 2YCFA 4KRDA 1ST4A 4CD0A 4DFYA 4PL5A 4NFNA 2IVUA 4ZJJA 2IF8A 3FMLA 4FT5A 2YDKA 1K3AA 1GOLA 3TIYA 1T46A 1F5QA 3QQUA 3F6XA 5EQYA 3ERKA 3QX4A 4TYHB 5J9LA 3HUBA 4ZJIA 4D2SA 3FZ1A 5D41A 3PJ1A 3NIEA 5GZ9A 2EXEA 2XAMA 4C58A 2OZAB 5AJQA 4AUAA 2FB8A 5ANOA 4ZZNA 3Q60A 5EFQA 4CZYB 4DAWA 3QGYA 3PJ8A 3RNIA 2EB2A 3SHEA 1GIHA 1OL7A 1PMEA 2PMIA 1Q3WA 3NUNA 3PP1A 1OIQA 2YM8A 3BGZA 3O50A 5DH3A 1P14A 2C6LA 2PVHA 2CGVA 1RQQA 3MA3A 2XNNA 1H27A 3TKHA 2HY0A 3ROYA 2UVZA 1H0VA 2J0JA 4YSJA 4Y8DA 5HNIX 4RVTA 3HNGA 2ZV2A 4K18A 5EM7A 3RHKA 4CT2A 2F7XE 3O96A 5J1WA 4NW5A 1BL7A 4PQNA 4CRSA 4XRJA 4CFUA 5HBHA 3FQEA 2XK9A 2F57A 1PXIA 4G31A 1M2RA 4LMNA 3ULZA 1K2PA 2F2UA 3VUHA 5KZIA 4LL0A 4AACA 3N4VA 1X8BA 2X7FA 5IQCA 4CQEA 4FSRA 4O7ZA 2VTAA 2QHNA 5AAGA 5AR4A 4FJVA 4BDBA 5HVKA 1OL2A 4O0SA 5ETCA 1YDSE 4NZWB 3OWJA 4YLJA 2C6MA 3PLSA 4A4XA 1OKYA 3LQ5A 3TUDA 5K5XA 5E90A 4NM3A 5JFWA 2J0MB 3O7LD 4JJRA 2OJGA 4DH5A 3C9WA 4ASEA 1H1QA 5H8GA 5HLWA 3UNKA 5L2IA 1GZNA 5IA0A 4KIPA 5J9ZA 4HW7A 3PY3A 3LFAA 3R8ZA 4GFMA 4FOBA 4AGUA 4DH1A 3GFEA 3L9NA 4OW8A 3HA8A 4CFVA 4FKLA 4J8MA 1FVRA 4W8EA 1PF8A 3QKLA 4WG5A 4XG9A 3SOAA 2X2LA 3ZUVA 5HTBA 1Z5MA 5AP7A 4N6ZA 4QMNA 4U7ZA 3GVUA 3R7OA 2BVAA 2C6IA 4ALVA 4U42A 3F9NA 4WA9A 2E9NA 3DKGA 1ZMVA 3FZRA 5ETFA 3IDPA 4O7VA 2NO3A 3JPVA 4NK9A 2WU7A 1R78A 3ORKA 4JT3A 5C26A 1ZYCA 2C47A 4TWCA 3UDZA 4AN3A 1W2CA 1GZKA 2WMXA 3A8WA 3FQHA 4I6FA 4C4JA 4FL1A 4DHZA 4TRLA 5E8SA 5LVPA