4FL1A

Structural and biophysical characterization of the syk activation switch
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biophysical characterization of the syk activation switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
total genus 86
structure length 268
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fl1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fl1A01
3ZH8A 3R6XA 2UZLA 5TR6A 1OBGA 3GEQA 2UVZA 3QRUA 2R0UA 3AT3A 5BVKA 2XKEA 3UG2A 5HKMA 2YABA 4U7ZA 5HLPA 4B0GA 3LXKA 5BUIA 5M07A 4UMRA 4YJVA 3VWAA 3GCSA 4IVDA 3S2PA 3UYSA 4IW0A 3OROA 5LVNA 2BRGA 3EZRA 2GS7A 2WMRA 3GCUA 2W5AA 3TUCA 5CSVA 3UE4A 4QP2A 3L9PA 2X2KA 4I0RA 4BTJA 5HTIA 4IM0A 5CEPA 2C6IA 3BHVA 5JRQA 3R7OA 2VWUA 3F3ZA 4C37A 2ZV9A 1OL1A 1GIHA 4FSZA 5IQEA 2C6OA 3HAVA 4WT6A 4RC3A 5J5TA 5KCVA 5HD7A 1P4OA 2R7IA 4AT3A 2ONLC 3HZTA 2JFMA 4QQTA 3AC4A 4FL2A 5CEOA 5K4IA 4BGHA 4IHPA 1BX6A 4G16A 3KCKA 1TQIA 3T8OA 4LOOA 1BUHA 4V05A 4ZJJA 5JEBA 4BVUA 1M7QA 3LW0A 4HGEA 4B6LA 1S9JA 4BTFA 1WBPA 3D7TA 4OBQA 2Y0AA 5CWZA 3QAME 1OITA 5M53A 2EXCX 3QXOA 5HTCA 3EQRA 3NUPA 2CN8A 2Z7SA 4FL3A 1U54A 4M15A 4CCBA 5AP2A 1QL6A 5IDNA 1PXNA 4XOYA 4K0YA 3QQUA 5KMIA 4FT7A 3FMLA 2CLQA 3G9LX 2C30A 2HZNA 3QKKA 4S32A 5DR6A 4A4LA 1K3AA 4APCA 4JAIA 5HCXA 2XYUA 4HNIA 3HMNA 1OKWA 1XO2B 3LCTA 3ZFMA 2AC5A 4MEDA 4WUNA 4EKKA 5FDPA 2VUWA 4DTAA 4C36A 3WZKA 1H08A 2Y9QA 2OIBA 3D15A 4I5HA 4L3LA 5J7BA 5JMSA 3V04A 3W2SA 2ETMA 4YZNA 5AP0A 3E8DA 1ZMVA 1RJBA 3ROYA 5IA2A 3FZPA 1VR2A 5JQ8A 2CKEA 2J5EA 4GIIA 3JUHA 4IX4A 5HG7A 4QO9A 2XJ0A 2PTKA 3GU4A 3DBDA 3EYGA 4FV2A 1WCCA 4RWKA 3LLTA 1F5QA 3HL7A 4A9YA 3GFEA 3VS4A 3KGAA 5IMEA 4FNYA 1XKKA 4EWHA 1H1SA 5IUGA 5IQIA 3EB0A 4EK3A 4G2FA 3G0FA 4ASEA 1M2QA 3DCVA 4DEAA 3NUAA 3VS1A 4YO4A 4FEUA 4N57A 2OKRA 4OTDA 5EHYA 2WQNA 2PUNA 4O6EA 5HICA 3OTVA 4O7RA 4XMOA 5I4NA 4DG3E 3ZC5A 3UOHA 3NNVA 5JRSA 4JQ7A 1TKIA 3A4OX 4JQ8A 4RA5A 5AFVA 2B52A 4O21A 1FVTA 1PHKA 4RJ4A 5KMKA 2B54A 3UMWA 3F5XA 4EOMA 4WD5A 2X6DA 2P3GX 4ERKA 5BVOA 2GQGA 4RIWB 3POOA 1GZ8A 3HP2A 1Q24A 3M1SA 3P23A 5CAPA 5CZHA 4C59A 2HCKA 1BI8A 4UZDA 2B1PA 3NZ0A 3QL8A 4RA4A 1R3CA 3ZHPC 1WFCA 2C5XA 2WAJA 3IW7A 3PE1A 5I9XA 1GZOA 3GCVA 4E73A 2Z02A 1SVGA 3D0EA 3VRZA 3GQIA 3AT2A 5DRBA 3NDMA 3QD2B 4QYFA 4A9TA 4I1ZA 1A48A 4LRKA 4GYIA 3NW6A 5HHWA 3Q2JA 4O7TA 1O9UA 2R3RA 4GFOA 3PWDA 1CTPE 2X7OA 4MNEA 3T3VA 2VO7A 2C6DA 3IDPA 3P7BA 5JT2A 3FMNA 5CSXA 3GU8A 4O86A 3U55A 2Q0NA 5ACKA 3FC2A 1P5EA 3Q4ZA 3FSKA 1Q4LA 3FEGA 2VTLA 2XF0A 2XK7A 3BGPA 2G1TA 1YI4A 3BGZA 3R83A 3A61A 4EOLA 4XP3A 1GAGA 5FTGA 3KK9A 3PFQA 5AUWA 5EHLA 3OUNB 4RQVA 4BKYA 3SG9A 4IIRA 2CGVA 4QMTA 5HBEA 5HVYA 1MUOA 1OL7A 3PRIA 3Q6UA 4K11A 5IKWA 1H0WA 4L3JA 2VTAA 5L8LA 4FUXA 4O0XA 1OZ1A 1NT2A 3TZ7A 1Y6AA 5E8XA 2J0KA 4MD7E 2Y6OA 3LXLA 2OW3A 2UW8A 3TNQB 2ITPA 4FT9A 3IOPA 5K5NA 2W96B 2X7FA 3A7IA 4AT5A 3QQJA 3Q96A 4BZOA 3MH2A 5F94A 2B9JA 3MY1A 4WHZA 4YZCA 3WIKA 4AN3A 3AGLA 4QMQA 2OFVA 1OUYA 5FRIA 3UG1A 4L46A 2QONA 2YM5A 3D7TB 4Y5QA 4E1ZA 1BL7A 3A99A 4PPBA 1OIRA 5DI1A 3MVLA 4FTCA 4I21A 5JH6A 5CU4A 3BYOA 3WZDA 4C8BA 1I44A 1FVRA 2RFDA 3LCOA 2XIXA 4M12A 3TL8A 4AOTA 1R1WA 3BELA 4CTBA 4PV0A 4JDJA 2W5HA 4UB7A 5HNGA 5LVOA 3MFSA 4ZLZA 1AQ1A 3DA6A 3FWQA 3R7UA 3U8WA 3LMGA 2W4KA 2FH9A 1CKIA 4YBJA 4YZBA 5B0XA 3ZLYA 4M0ZA 4C4FA 5BUEA 5C4LA 3CD8A 3RINA 1FVVA 5EDRA 2BDJA 2YIQA 2AYPA 2IJMA 4CZUA 3NNXA 4DBNA 2WNTA 2WMSA 4FUYA 4PQNA 1V0PA 3U51A 2OJIA 4QMLA 4RJ3A 1XJDA 3ZYAA 5LXMA 4BYJA 2C69A 3E7OA 2FB8A 1W0XC 3DLZA 2XIYA 2Y6MA 5I9VA 3UYTA 1U5QA 3AQVA 2XP2A 2XS0A 3ULIA 4D5KA 4NM3A 4DC2A 5J5SA 3QQLA 1JSTA 5DH3A 1YXUA 2OIDA 2XVDA 4FYNA 4GCJA 4RZVA 2PE0A 2PVFA 5DR9A 1R0EA 4XOZA 3C4CA 2OJJA 4FGBA 4LV5A 3ZUVA 2B4SB 2I40A 4F6WA 4B8MA 4YPDA 5EYDA 4B8LA 3DK7A 2JIVA 2GPHA 3LM0A 3N51A 3EJ1A 4ZTNA 4ANNA 3PJ3A 3RVGA 2XCKA 4LM5A 3CS9A 4EORA 5I3RA 3VIDA 5A4EA 3EQHA 1PMVA 5J9ZA 1Q8ZA 3MPMA 3MB6A 3QRTA 4FTLA 4I20A 4KSPA 5E8UA 3VHEA 4O7SA 3GNIB 1X8BA 4FC0A 4DH3A 2XNGA 1VEBA 4BDJA 1V0BA 5CF4A 1U59A 4HVDA 5IISA 5KMJA 4UXQA 4IE9A 2LAVA 3LMHA 4FNWA 1YWNA 1FPUA 1VJYA 4TNBA 1H24A 4XLIA 5L4QA 4FKLA 2ERZE 3DBCA 4KRCA 4QMNA 2OWBA 4YGAA 4Y8DA 4PUZA 3HRCA 2WFYA 4XP2A 5EW9A 4OTWA 2EU9A 3LJ2A 3DFAA 4EH3A 4EKLA 5LMKC 4YJPA 3Q9ZA 2GMXA 4IEBA 3R9NA 3FBVA 3UODA 5HVJA 4Z55A 3NMUF 2WMWA 4OAVB 5TOZA 5CF5A 3U54A 5GIPE 3UZPA 1XQZA 5DVRA 3OFMA 2QG7A 4E5WA 4AZSA 3MVJA 2IO6A 5I9WA 3M42A 4O0WA 3BQCA 5JGAA 3OEZA 4O1OA 3PXQA 3ZEWA 3OXIA 4KIPA 4EBWA 1G8AA 4L9IA 4ZY4A 4ZLYA 2WD1A 5K5XA 3IGOA 4NKAA 3BIZA 1H07A 5FXRA 3CGOA 2B9IA 4DAWA 5GZ9A 3BHHA 1UWHA 4YSJA 5JFVA 4AZEA 4OBOA 3LCKA 5T6KA 2PE1A 2YN8A 1OL5A 2J90A 4GV1A 1T45A 3VUDA 2WQOA 3QZIA 4D2WA 2A2AA 5BUJA 4PL5A 3UVPA 4PP7A 2YAKA 4JG6A 2F7XE 1U5RA 3TI1A 4C57A 3N4VA 4G31A 4I24A 4HOKA 4F64A 4FKUA 2WMTA 3Q4CA 4BDDA 4D2VA 1AD5A 3DJ6A 3W2OA 4M14A 1Y8YA 5CU0A 2BFXA 3RAWA 1BMKA 2WKMA 2JDRA 4KS8A 4UYAA 5AM7A 5L2QA 3S1HA 4WKQA 3PDTA 4ZJIA 4FYOA 2V22A 4EJNA 4MTAA 4YMJA 5L2TA 1UV5A 4GW8A 4CV9A 3LE6A 4XEYA 5KKRB 3LMIA 5EW8A 1JOWB 3G2FA 5FXQA 2C0TA 2YIXA 4L8MA 3HX4A 1FGIA 4PY1A 2Y8OA 4OW8A 1PF8A 1J1BA 3C4FA 3D2IA 1ZOEA 4G3EA 4PPAA 4U97A 2HK5A 2WOUA 2YDJA 5M09A 1JKTA 3CPCA 3DZQA 3AT4A 3KXXA 3MH3A 2VTPA 2VRXA 1NVQA 4KB8A 2GDOA 4E8AA 2C0IA 2PMNX 2BTRA 4EOOA 4FIIA 5BPYA 5HE1A 2CCHA 1CKJA 2BAJA 5H2UA 3QLGA 2ITVA 4BWXA 3KF4A 3II5A 2PVLA 4H39A 2X1NA 3F5UA 4FIJA 3UQGA 2J0LA 5AMNA 2XB7A 5CAVA 2B53A 5A4TA 1Y57A 3OMVA 1S9IA 4BGGA 5DG5A 4IZYA 2QO2A 2E9OA 4EOJA 3AG9A 2R3MA 3BYVA 4EHEA 4L43A 3BGQA 4RBLA 2UZVA 2NRYA 1OGUA 1TQPA 3E63A 3A8XA 3VQHA 4DH8A 1KE6A 5L6OA 3D14A 3FZRA 5G1XA 4D2SA 4UY9A 4FZFB 4ZK5A 4FTNA 4R5YA 5HLNA 3B2WA 5BVNA 3Q5ZA 2ZM4A 4RVLA 3VBTA 4NSTA 3UMXA 4EH8A 2ZYBA 4FF8A 2W7XA 5ANJA 4FICA 4FZDB 4IFGA 3RAIA 3OW4A 4ZTLA 3VUIA 3ETAA 3PP0A 3BE2A 3KRWA 3R7GA 1WAKA 3FMMA 4U43A 2ETKA 5IMXA 4XG7A 3NLBA 3PA4A 4ZSEA 4YLLA 4UMPA 4RIYB 1DI8A 2VN9A 4X3JA 2GNHA 3COKA 3AMBA 4IBMA 1KE9A 3V6RA 2H96A 3VJOA 4MX9A 4HNFA 5BVEA 2W99B 4PL3A 4ZTMA 4GK4A 2RKUA 3PWYA 3DU8A 2HY81 1UKIA 3B2TA 2PY3A 2NPQA 3DNEA 4YZMA 2E9UA 2ETRA 4BGQA 2UW6A 4O96A 1E9HA 3R01A 5CT7A 5AR8A 3QD4A 4M67A 1KUTA 1XH5A 2X39A 4BIDA 4A9UA 4FV6A 4NM0A 4C38A 3A7HA 5ANGA 3HP5A 3FL5A 1RE8A 2R3FA 2JGZA 3IW6A 4MK0A 3D4QA 4RJ7A 1ZZ2A 2W9FB 4CFVA 2BZJA 5AIKA 3LLAA 2X8EA 3MW1A 4RQKA 3QWJA 2WOTA 4RT7A 4C61A 4CRLA 5JFXA 2GQRA 3PVWA 4U45A 1ZMUA 2JDTA 4JL9A 3WZEA 3Q4TA 4R7HA 3DFCB 3RM6A 3SRVA 1JKKA 3EL8A 3KKVA 2V0DA 4OR5A 5EOLA 5IA4A 3PSCA 3PXZA 4FG9A 3QKMA 4TYHA 3ZO3A 4GT5A 4DGNA 3BU6A 3PA5A 4QP3A 3FLSA 4HYUA 4IAFA 2YWVA 4WO5A 3GVUA 2QOHA 4PL4A 5FXSA 4LRJA 4RX8A 3BZ3A 1O6YA 1U54B 3HMIA 3R8ZA 4KSQA 2QKWB 2CGXA 2C3IB 4Q5HA 2C5YA 3ZZWA 1Q61A 2Y4IC 2YCSA 1G8SA 2YDIA 3RWQA 3V5TA 5GJGA 5AWMA 3IONA 4KBKA 3SXSA 4EUTA 3F66A 5IA5A 2OZAA 3QX2A 4II5A 2PSQA 4X3FA 4AG8A 5IH6A 2PE2A 4L53A 4O7NA 5DWRA 2XNMA 1NA7A 2R64A 5J87A 4F08A 3QCXA 2JIIA 5I0BA 4ENXA 4Q2AA 3QQKA 3ZFYA 4EOSA 2IVTA 3LHJA 3O0GA 3BYMA 4H1MA 5D1JA 3UDBA 3UGCA 4ACMA 3OT3A 2F2CB 3QHRA 5HCYA 4CZTA 5HU9A 1RW8A 3RBWA 2IVUA 3K3JA 1LPUA 4A9RA 4I0TA 3LJ1A 4M69A 1UKHA 3H30A 4NW5A 4PF4A 4BI1A 2C0OA 3QTZA 5EW3A 5JKGA 1YHSA 1NW1A 3DZOA 3ANQA 2EVAA 1IEPA 3GOKA 1GNGA 4M8TA 4QTCA 5EI2A 2QR8A 2UW3A 2OJGA 3QUPA 4TL0A 4EH9A 1H27A 5J9YA 5LCKA 3GOPA 5IU2A 4AGWA 3EFKA 4BCKA 1NVSA 3ACJA 3QQHA 4GL9A 3PP1A 1K2PA 2J0JA 4GEOA 3IW5A 3EKKA 1KOAA 3FSFA 1YDRE 3WBLA 4ZS4A 4ZJVA 2XM9A 2UVYA 3WYXA 4HVHA 3FPQA 4R8QA 3ZDUA 4L42A 3EL7A 3EIDA 2ZOQA 4FI1A 4ZEGA 4UV0A 4YZDA 2WMQA 3GU6A 1OMWA 2HXLA 4IC8A 4RG0A 3IPHA 3RNYA 1T46A 3VC4A 4AW1A 5KUPA 3KY2A 5AP6A 4HJOA 4MXXA 1WBTA 4XRJA 3PLAE 1Q8TA 5ANEA 4F7SA 3LQ8A 4I6HA 4DTKA 1PKDA 5TO8A 2C3JA 2WGJA 4IXPA 5CT0A 3TIZA 2R3NA 3UQCA 5GINE 3A7GA 2WMAA 4AS0A 2QLUA 3R1SA 4M68A 3I7CA 3ITZA 4TYIA 4YLKA 4BC6A 3CIKA 3ATTA 4HYIA 3MV5A 4NT4A 2JKOA 3P7AA 4MWHA 4CYIA 4J1RA 4ALVA 3FQHA 2HYYA 5L2IA 2YWPA 4FEVA 4I23A 3K5VA 4I6FA 3ZEPA 3RPOA 4L67A 1ATPE 4FODA 2UW4A 4D2TA 2VTMA 5LCJA 1FGKA 5CQUA 4OGRA 5C4KA 4ZY5A 2ITYA 1WVXA 2OJ9A 4Z16A 3PLSA 3E8EA 4E4NA 1H1WA 5HU3A 4FNXA 3LJ0A 4DCAA 4LI5A 2G2HA 1OIQA 1YI3A 2X8IA 1CSNA 2VWIA 3IDCA 3W2RA 4D58A 1L8TA 3RPSA 2C68A 2Z8CA 4RWIA 1J7IA 1EH4A 3IO7A 4RVMA 5D10A 3COIA 4YU2A 4U42A 3V01A 4XHKB 4YTHA 4R78A 2ITNA 2OFUA 3UVRA 3IOKA 4QYEA 5A6NA 4K2RA 1Y91A 3MVHA 4PWNA 5CLPA 4FTTA 3RCDA 2YZLA 4K6ZA 2OXDA 2XKFA 3BWFA 1OPJA 4HCUA 4MQ2A 3SOAA 3UP2A 1J7LA 1UNLA 4CKJA 4UMQA 1CMKE 5IA0A 2X9EA 2EWAA 4G5JA 4KIKB 3CTJA 1GJOA 2FSTX 4K9YA 4RFYA 5HG8A 3GXLA 2XMYA 2GU8A 4NCTC 5H8GA 3FMHA 3VUTA 3R30A 4GYGA 4BCFA 3TJCA 4JI9A 5DPVA 3EMGA 3KVXA 5HCZA 1RQQA 3TTJA 4OLIA 4AW2A 3MSSA 5CALA 1Q8YA 4QP4A 3F5PA 3ZM4A 3QTQA 2IZRA 4X2KA 4XBRA 2UZEA 3H0YA 4PX6A 3ZDIA 5CQWA 4FKVA 5C9CA 1FQ1B 3COHA 3ZS5A 3RALA 4F9AA 4C4HA 1YI6A 4NYEA 3BKBA 4FZ7A 1UNHA 4I5CA 5LVPA 5EQEA 4AOIA 4PP9A 3WILA 2ITTA 4B4LA 2BAKA 4U41A 4UN0C 1ZLTA 4FK6A 4AQCA 1RDQE 1PRYA 4ENYA 4HZSA 2H34A 2GNLA 3R0TA 4MQ1A 4CFNA 1KWPA 1UU7A 3V3VA 3VBVA 4M0YA 5HX6A 1DAWA 1BKXA 3VULA 3BV3A 2BZHB 5I3OA 4NJ3A 1Q5KA 5M06A 4I93A 4ARKA 1MQ4A 2OU7A 4CQGA 5M08A 4P7EA 1WMKA 1VZOA 3P79A 4QMYA 2YIWA 3U4WA 4ZMEA 4BIEA 4DFUA 3VUMA 2IW9A 3QTIA 3FXZA 3M11A 3UNJA 5ACBC 4WNOA 3CSVA 3RGFA 1YXTA 2R3HA 4P2KA 3L8XA 2JIUA 4BDIA 3R1NA 4C2VA 3ZO2A 2BZIB 5HG9A 4MHAA 3DQXA 3OS3A 4EQMA 2I0YA 2R7BA 3EYHA 4R6VA 4XG4A 5LMAA 2G9XA 3WI6A 5T3QA 3ZLWA 4F7JA 5LMBA 4DGGA 4F09A 3UO4A 2GHMA 4USDA 4IWQA 1ZY5A 4MH7A 4AU8A 2XK6A 5IA1A 5TE0A 2A0CX 4EHGA 3UZTA 3OT8A 2VX3A 4E5BA 3DBEA 4S2ZA 4IC7A 5BYLA 4MXOA 3NIEA 5AUUA 5LVMA 3BE9A 4YZ9A 5CXHA 3SV0A 2CNUA 3BU3A 3JPVA 4V0GB 4J99A 5E8WA 4DH7A 2CMWA 4BN1A 3H0ZA 4C58A 4LFIA 2BHHA 3LXNA 2JEDA 4WG3A 3PXFA 3OOMA 4CD0A 2PVKA 3R00A 4OBPA 1LP4A 5AR7A 4F1MA 2YEXA 5GZ8A 3KREA 4FKQA 3RHKA 4P90A 3C4ZA 3DS6A 2Y7JA 4BCOA 4D1XA 4R3RA 2E9PA 5HIEA 3L9LA 2WB8A 3FQEA 5FEQA 4HW7A 3FV8A 4RVTA 3ZRMA 2PVYA 4FEXA 3PA3A 4HYSA 2EUFB 2YM6A 3N4UA 4WSYA 3QQFA 4XV9A 1XH8A 4D0XA 1OB3A 1B38A 4CLJA 4QMOA 3WIGA 1E1VA 4FT3A 3UNKA 2YFXA 1SMHA 4U81A 4B7TA 4QPAA 4XG8A 4ANBA 3ORTA 5D12A 4RFMA 2VTOA 4GG7A 4M66A 1WBVA 5EM7A 5I9YA 1H25A 3EQPA 2AC3A 3CQEA 1Y6BA 2BDWA 2YIYA 3GU7A 2YJSA 3FZOA 1YDTE 4EH7A 2YERA 4H05A 4JBVA 3H4JA 5GJDA 5KZIA 4IDTA 1VYWA 2X0GA 4ZXTA 5HD4A 4KINA 1WBWA 3EQCA 3CY2A 3P78A 3G33A 3RP9A 1UVRA 4EBVA 3P9JA 5IH4A 5IQAA 4FTIA 4FZ6A 5M57A 4BCQA 3LCSA 4I0SA 5CX9A 2A19B 5KNJA 3OW3A 4QP7A 3ZO4A 2BAQA 2W1FA 3R9RA 3VS5A 3NW5A 4IB1A 4MD8E 3GB2A 5CSHA 5EI8A 4QP6A 3CGFA 4EQCA 4ACCA 2XYNA 3OY3A 4W4VA 4TXCA 4ALUA 4CSVA 3BX5A 3DKFA 3FUPA 5DMZA 2GNJA 5AUYA 4XBUA 3R8LA 2VWYA 3DGKA 4ASZA 5EYKA 5JK3A 2ZV7A 2CGWA 1ZYLA 1Q3WA 4NM5A 3ZMMA 5A6OA 4XLVA 4MAOA 5EYCA 5J7HA 1M14A 4BCMA 3UIMA 3ENHA 5TKDA 2HZIA 4BTKA 3F7ZA 3ZONA 2R2PA 4ANLA 2PZYA 4E93A 2C1BA 5DHJA 4BL1A 2Q0BA 4A07A 4BF2A 5L2SA 4I5MA 3EKNA 3TV7A 2R3JA 4EH2A 3V8SA 2IPXA 2F2UA 4TYGA 3UO6A 5J9LA 3HA6A 1ND4A 2YA9A 2ONLA 3O2MA 4XV3A 5GHVA 5EI6A 4DA5A 1KSWA 4ACGA 2R4BA 5IEXA 1YRPA 3WF9A 5HG5A 1PY5A 4JX3A 4YBKA 4JX7A 3PY0A 5DOSA 4ANQA 3IG7A 4GUBA 4D4SA 5F9EA 2O3PA 3ZC6A 4FEQA 4G6LA 4FIHA 5CEQA 3Q4UA 4J98A 3VS3A 3FY0A 3VBYA 4RIXB 4YJUA 3A8WA 4PMTA 4S30A 2JC6A 3RK9A 3ZRKA 3CPBA 4HCTA 4IWDA 3BBWA 5D7AA 3VS0A 4RX9A 3E3PA 3KA0A 3MPTA 3QHWA 4M13A 3UNZA 4EJ7A 5FDXA 5J8IA 1XBBA 5KZ0A 3UOKA 3TWJA 3RPVA 3AC2A 4JDHA 4MKCA 4CLIA 3TZ9A 4G3CA 3CP9A 2R3QA 4Y46A 4P5ZA 3Q9YA 3DKOA 3SRVB 3TDVA 3KXZA 3OWPA 3Q5IA 4FK3A 5D7VA 4AACA 3A7FA 2C3KA 2C6KA 2QQ7A 1PXLA 2XZSA 5DLSA 5J1WA 2UW7A 1WBSA 1M7NA 4BIBA 3HV5A 3NEWA 4ACDA 4GFGA 5IQFA 3LAUA 4E4MA 2NP8A 4DE4A 5BYZA 3O7LD 4FBXA 4EOPA 4D4VA 4O0TA 2QOIA 5F1ZA 4BWPA 3GQLA 5BNJA 1PYEA 2WTJA 3PJCA 4D28A 4QYYA 3NUXA 4J52A 4QRCA 3O71A 2WMVA 3QUDA 4GT4A 1O6LA 2XM8A 4R7IA 2HOGA 2PZ5A 2QOKA 4AA4A 3DDQA 4DGLC 5AV3A 2OXYA 3K3IA 5AA8A 1ZYDA 2RFSA 3OWKA 2BTSA 3RM7A 5JGDA 4U44A 5FEDA 3I0OA 2ZB1A 4BBFA 3MA6A 4RIYA 2XKDA 1FMKA 2W06A 1QPCA 2J6MA 4PMPA 3KRLA 4ZSJA 4FVQA 5ETCA 3W2CA 2PU8A 2EXMA 2IWIA 4WG5A 4X2GA 1YXXA 2W05A 1JWHA 3I5ZA 2OG8A 3FXXA 1KE5A 2WQEA 2BMCA 2XNOA 4YUQA 1XH7A 3NAXA 3R63A 4A06A 4EEVA 4GFMA 4JXFA 4ACHA 3IGGA 3LFCA 2ITZA 3NVKI 5AR4A 4D1SA 3QRJA 1WBOA 2XK4A 3QFVA 1J1CA 3BCEA 3ZSHA 3PVUA 5EM5A 3MFTA 5K0XA 5L6PA 2YCFA 2OJFE 3TN8A 2JKKA 3TCPA 4DFNA 4H58A 3FQSA 5LWMA 1YDSE 3TKUA 2OH4A 3QYZA 4XG6A 4G9RA 3JXWA 3ODZX 3S4QA 2BKKA 3PJ1A 5F4NA 3UPXA 4EYJA 1NVRA 3O7LB 5AP3A 3T3UA 5EDQA 5CNOA 5A54A 4JRVA 1UU3A 3ORZA 5CXZA 3F2NA 5HO6A 4PNKA 3PTGA 4GJ2A 3NW7A 4MF1A 4QYGA 5JFSA 3CLYA 2QU5A 4FR4A 5ICPA 3TG1A 4C4GA 4MNFA 3QC9A 4U3ZA 4RJ8A 4NEUA 4W9WA 5DRDA 3PIYA 3F9NA 4FTOA 4JIKA 3FMDA 4U79A 4X3FC 3D83A 1B39A 3HVCA 2XNBA 4L52A 5BMSA 5IPJA 3SXFA 5FEEA 4MYGA 1R0PA 4U40A 2C1AA 2BRMA 4BDKA 2GHGA 3MFRA 4I22A 3LZBA 2CHLA 2JBOA 4X6RA 2QODA 3BLQA 3FLWA 4O7WA 5DBXA 3L8VA 3ZBXA 4N4SA 1JLUE 4DLIA 3CBLA 3BYSA 4FIEA 5FQDC 3KRXA 4IZAA 3VS2A 1E1XA 4GIHA 1ZRZA 3QRKA 2O2UA 4MVFA 2JAVA 2CSNA 5CSPA 3LIJA 1J3HA 1JKSA 4YNOA 1UU9A 3NUYA 1OVEA 4QPMA 4DEDA 4BDHA 3QC4A 3VBWA 2VGPA 2BRBA 4F1TA 3U6HA 4FKWA 4L7FA 4F6SA 4PTEA 2WIHA 4EK4A 4LRMA 5CAQA 2ITQA 4RRVA 4IVCA 1W83A 5M4CA 5ETFA 1FMOE 1H00A 4XS2A 3MJ1A 3U6IA 3W2QA 3OZ6A 4ASXA 2ZMDA 1P2AA 4WBBB 3L9MA 5DR2A 3ORLA 2CCIA 2W4JA 3LM5A 2QVSE 2QOQA 2F9GA 2OSCA 4QQ5A 2BZKB 3QGYA 4G3FA 1P14A 2ZM1A 3A60A 4RIOA 5E8ZA 4DGMA 3QBNA 2CKPA 3QYWA 3NS9A 4U8ZA 4ZSLA 4ZTHA 2IW8A 2OF2A 2UZNA 3N9XA 5TT7A 2HZ0A 4Q9ZA 2IZTA 4I3ZA 5FWKK 3FLNC 3FI8A 4QMSA 2PYWA 3U4UA 3DAJA 1HCKA 4BCHA 3OCTA 5D11A 4MXYA 5E1SA 3O17A 4FTAA 5HI2A 3R9DA 3DBFA 1MRUA 4FX3A 5EM6A 3K5UA 3KXNA 1PXPA 3DLSA 4U0IA 4J95A 5CS6A 4FKIA 2OBJA 2DUVA 2QOBA 4AN9A 3QUEA 3BHTA 4C7TA 4D1ZA 1Z9XA 3PRFA 4PDSA 4FSWA 4KABA 4GSBA 3BWJA 4R3CA 4A4OA 4AFJA 3RAHA 5K9IA 4ORKA 1Q99A 3V5PA 3TUDA 4ZZMA 1IRKA 3CE3A 2F7EE 5EOBA 2WU6A 4GKHA 4A9SA 5C03A 3HYHA 1Y8GA 2GHLA 3Q32A 4HGLA 5EK7A 3D2KA 4BKZA 3EFLA 4WNPA 3N4TA 4QP1A 1URWA 2JFLA 2PZPA 4AZWA 2RG6A 4TPTA 2BILB 1PMEA 4C2WA 4HVIA 1OL2A 4EC9A 4U5JA 1ZYJA 3BHUA 3QGWA 5ANOA 5EM8A 2W17A 2QCSA 3Q04A 1QMZA 3LFQA 4GS6A 4GK3A 1V0OA 4A7CA 3CQUA 4QTAA 4RJ5A 3VF8A 4B9DA 2HZ4A 1IASA 5HO8A 4LGDA 2W1IA 2H6DA 3BYUA 4LOQA 1YXVA 4FTMA 1Q41A 3AC5A 4M97A 4FTKA 3T9IA 3UPZA 5IEVA 4JIAA 3DPKA 3VAPA 2DWBA 4PMMA 3AMAA 4G17A 4L01A 4HGTA 5M55A 2YHVA 1PW2A 4GRBA 3RNIA 3DV3A 3FKNA 3VF9A 1ZMWA 2ITWA 3ORMA 4CG8A 4FZAB 4XNEA 1OPLA 1U4DA 1ZYSA 2RIOA 4C62A 4KBAA 2J2IB 1F3MC 2BHEA 3G5DA 3GI3A 3MGYA 2R0IA 2REIA 2UZDA 4R3PA 1SVHA 4XJ0A 3E93A 3CCNA 2IZSA 3VS7A 4USEA 4DINA 3E3BX 1OIUA 3GC7A 4J97A 4LL0A 4K1BA 2QKRA 2CN5A 2WQBA 5FTQA 3OF0A 1LEZA 5JFWA 5AIRA 5E4HA 5HEZA 3CTHA 3AGMA 3H9FA 3W8QA 3VN9A 4WSQA 4KIKA 4JG7A 4F70A 1QPDA 4D0WA 3O50A 3HKOA 3QZHA 3FLZA 2UV2A 2KULA 2I0VA 2GNIA 4LUDA 2SRCA 3IW4A 3OCGA 4DG0E 1UNGA 4E6QA 4AUAA 2A27A 4XP0A 3CXWA 2PVNA 3FZTA 4G3DA 4C4JA 3DXPA 2O5KA 1STCE 3AD4A 4UZHA 4C35A 2XK8A 2CNVA 3ZFXA 3KB7A 4K18A 3D9VA 2NRUA 3HMMA 2YITA 3MJ2A 3VNTA 4Z3VA 4ANOA 4FV4A 4FV1A 3BQRA 4JR7A 3K2LA 2VD5A 3V6SA 4ZLOA 5IDPA 3WOWA 3MTLA 3VW8A 2BKZA 2YLFA 4BDEA 3BRBA 4O0UA 2WHBA 3KRJA 2J5FA 2HAKA 2ZM3A 5E90A 4EHZA 5CZIA 2Z2WA 3EQFA 4UWBA 3KN5A 5BVWA 3SVVA 4UXLA 3PJ2A 4RJ6A 4IFCA 3JY0A 5HIBA 4W4YA 3FDNA 5FGKA 4ERWA 4OTIA 2OXXA 3E8NA 3O96A 2VWVA 3PPKA 1OBDA 2QNJA 2WTCA 2C4GA 2C6MA 2BUJA 3HMOA 1DI9A 2QR7A 2JITA 4WNMA 5FP5A 1WVWA 5AR2A 3UJGA 3L1SA 1PYXA 5CVHA 3R7YA 5AUZA 5IQDA 3EWHA 2WPAA 2ZVAA 4G9CA 5KMMA 3LFBA 3ORXA 3DB6A 1IA8A 2OICA 2XRUA 3P4KA 2P2IA 2YISA 4I6BA 4IJ9A 3RPRA 4C4EA 4E7WA 3DQWA 4EHVA 2W1GA 3R8MA 3VO3A 1W98A 4QNAA 4X7QA 4JRNA 2GNGA 3LVPA 5EKNA 1Q3DA 3NYXA 3PXKA 5AUVA 3KEXA 1G5SA 5KBRA 4F9BA 3RTPA 4BZDA 2B55A 1YOLA 4UBAA 4EONA 3KXHA 4HPUE 3Q9XA 4KNBA 5AP5A 4DTBA 2RFNA 3NVMB 3AOXA 4TKSA 2GTMA 2OH0E 4FSYA 5FD2A 4DFBA 3OBJA 3UOJA 3AC1A 4E5AX 4EH4A 4QMPA 3BBTB 4GG5A 4HCVA 4CMOA 5KX8A 3NAYA 2EXEA 3TZMA 5E8VA 4R1YA 5C01A 4W4XA 5C8NA 4O27B 4C3PA 3BI6A 4BCGA 2X7GA 2C5OA 2VNYA 3A4PA 4IQ6A 5K0KA 2WMBA 2V62A 2CPKE 3FLYA 4LYNA 5A3XA 2P2HA 4WA9A 2YIRA 3EFJA 3ODYX 3SOCA 4QTBA 3IS5A 5FBNC 1SNXA 4I6QA 4J7BA 3DXNA 4QQJA 4BCNA 3C5IA 1U46A 5CF6A 5F20A 2I0EA 2VU3A 2UZUE 4WG4A 3RZBA 5CAOA 4FKOA 4L3PA 4E4XA 5HO7A 3PY1A 2XNPA 2VWXA 4NIFA 2F4JA 2RG5A 4CEGA 2YDKA 4NKSA 4RMZA 4MF0A 4DFXE 3EZVA 3O23A 3A62A 3OWLA 2WQMA 3W16A 1LEWA 4NZWB 3KK8A 5HTBA 3P0MA 2GFSA 3G90X 4JLCA 1DS5A 4F99A 2PVMA 2X9FA 3L8SA 1QCFA 4OTGA 3MWUA 3E5AA 1KE7A 4DT9A 1V1KA 5LMKA 2XIZA 2WTDA 4XV2A 3MIAA 3R04A 4GT3A 3F3WA 2QG5A 3ORPA 4RFZA 4DYMA 2AUHA 2ZV8A 3C9WA 5T68A 2IG7A 4E20A 4YC6A 3BPRA 2QO9A 3POZA 4NCTA 1MRYA 3FY2A 3DBQA 3H9RA 4O2PA 4V04A 5ETIA 4FSNA 1IR3A 4ANMA 3OOGA 4GUEA 2ACXA 3C5UA 4E6AA 2ITOA 2PMIA 4YHTA 3KXGA 3OXTA 4YSMA 2UZOA 3C1XA 3HV4A 5AJQA 5HNBA 5GZAA 4FV3A 3SX9A 2WTIA 3B8QA 4BBMA 3SLSA 5HNIX 4O7ZA 1WZYA 2WTKC 4Q5EA 4MXZA 5J79A 1APME 5L8KA 5FP6A 4IADA 2QI8A 1P4FA 4I94A 3DY7A 5B7VA 4FEWA 5AAGA 3FMJA 3HV7A 3TJDA 4OT6A 2P4IA 3QTSA 5DT3A 4PDPA 4FG7A 4CZYB 3VW6A 3UP7A 2BDFA 3ZTXA 4DBXA 3F3VA 3OD6X 3EN5A 3I4BA 5IUIA 3VJNA 5KO1A 4NU1A 1PJKA 3F5GA 5H8EA 3C50A 1FINA 3E88A 3UOLA 4YC8A 5FLFA 2J0IA 3DB8A 3OUKA 4IH8A 4AZTA 4QTDA 4ZS0A 3FPMA 4PRJA 4ZTSA 3CJGA 4D9UA 3HMPA 4G6NA 4CFXA 3NUUA 4BDCA 3VVHA 1JVPP 1IA9A 2GTNA 1OI9A 4FG8A 2WTKB 3RKBA 4YHFA 1W82A 3V5WA 4F65A 2I7QA 1GZNA 3QA8A 3CKXA 3NYNA 1PXKA 5BYYA 3FMKA 1JPAA 1GIIA 3FHRA 4IDVA 4UWCA 3KULB 4ID7A 4JNWA 2VTRA 4YJSA 2C47A 1W84A 3GC8A 2HIWA 1B6CB 3D5XA 4J96A 5IA3A 4IAIA 2PHKA 1XH6A 4QOXA 2IN6A 3HNGA 3BV2A 2DYLA 2W1CA 4WRSA 3ALNA 4CFWA 5K4JA 5DGZA 1ZY4A 3KMWA 4LMNA 4AP7A 4ZIMA 5I9ZA 2JD5A 3E87A 3VS6A 4S33A 2EB3A 3GP0A 5CU2A 2O65A 4LMUA 4O91A 3MFUA 3G6HA 2ITXA 3F82A 4MD9E 5AAEA 3C0GA 3ZLXA 3TM0A 2QHNA 3BLRA 4JJRA 4IACA 4FIFA 3EHAA 4W8EA 4BI0A 5JQ5A 4O6LA 5FG8A 4NJDA 4S31A 2X4FA 4ZMFA 3QX4A 5FUTA 2W5BA 2RF9A 3NWWA 4IMYA 2XK9A 5HBHA 1GOLA 3BLHA 3I60A 4J8NA 4TZRA 4LG4A 3ZLSA 2HXQA 3C13A 3GGFA 1OM1A 2OIQA 5AADA 2R5TA 3WF8A 4FV5A 4J71A 4PPCA 3DK3A 3K54A 4FKTA 2XBAA 4BDBA 4IAAA 4RGJA 4ZSGA 4QTEA 5C8KA 3QTWA 2PL0A 3FL4A 4L7SA 1YKRA 5BX0A 1XBAA 3MESA 3HA8A 4KKEA 3ZO1A 4TT7A 4IB3A 3VBQA 3L8PA 1F0QA 4QMVA 2E2BA 2IW6A 4AE6A 3FI2A 3OVVA 4AW0A 2R3GA 4GH2A 5E8YA 4F1OA 1OPKA 2XEYA 2XEZA 2BROA 1ZXEA 4K33A 3TEIA 3UO5A 4FKJA 4FSMA 5HE3A 4JS8A 4APPA 1H1RA 4ZY6A 3DK6A 3OEFX 3MH1A 3OCBA 2F57A 3SXRA 1IAHA 3MY5A 3ZSGA 3DTWA 4CV8A 3I1AA 3KMUA 3RK7A 2OO8X 4QYHA 4YJTA 4KD1A 4NK9A 5AR3A 2WU7A 3ZXZA 4CT2A 3FHIA 4DEBA 1I09A 1OECA 2X2LA 2UW0A 3ET7A 4DFYA 2ZDTA 3PZEA 3FMEA 2A1AB 2BIKB 2YCRA 1SYKA 2G01A 4W4WA 5AV0A 3FKOA 2UZTA 1MRVA 3EFWA 3MIYA 3PSDA 3SW7A 4JVGA 4AFEA 5CENA 2YACA 4OT5A 4BB4A 3MB7A 3F2AA 4R5SA 2XBJA 4Q9SA 1PXMA 4RWJA 2F49A 4IB5A 2Z7QA 3AC8A 4AOJA 2BCJA 3MTFA 2QOCA 2OI4X 4I4EA 5JSMA 1IAJA 3EN4A 3EN9A 5AV2A 3QLFA 3LKMA 3R73A 3W2PA 4O81A 2FVDA 3QD3A 4YLJA 2W0JA 3PPZA 4GU6A 5HORA 2FSMX 2WEIA 1ZARA 4L45A 3P86A 4MBJA 4JBOA 2ESMA 4EK5A 5LQFA 5KHXA 5CSWA 3LFSA 1UWJA 2R3OA 4EOKA 3I0QA 4AN2A 1PXOA 3EQDA 4HYHA 3FXWA 2WO6A 4TRLA 3TACA 4D4YA 2VTJA 2RL5A 4JT3A 2VZ6A 2CNQA 2VTQA 2VTNA 3AD5A 3EN7A 3JYAA 1J7UA 4LGGA 4JBPA 4NM7A 4BYIA 2E9VA 3CC6A 5ANKA 4AGDA 4EL9A 5A4CA 2GS2A 4O7LA 4AW5A 4C34A 4CMTA 4CTCA 3R1YA 5HOAA 4UEUA 4A4XA 3PG3A 5F95A 3OBGA 5HE0A 3A2CA 4O83A 5L3AA 3C4XA 2VNWA 4PNIA 1YOMA 4UWYA 4BY9E 4W8DA 3P08A 3PYYA 4C0TA 5JGBA 3TTIA 2C5NA 1ZOGA 4P5QA 3R9OA 4HVGA 5IEYA 5AAFA 4FA2A 5L2WA 4WIHA 5KMNA 2ERKA 4FOBA 2BFYA 4NFMA 4L6QA 3FZSA 4K77A 4N70A 1JAMA 4IVBA 3JR1A 4P4CA 3UBDA 1XHAA 1A06A 3B8RA 3I6UA 3CJFA 1H26A 4GU9A 5AP4A 1YW2A 1H28A 2PZRA 4RIXA 4F0GA 4EH6A 5EQPA 3CD3A 4EZ7A 4EH5A 1H0VA 4EOIA 3NGAA 5EG3A 5AV1A 3SG8A 3NNWA 3LFNA 3MH0A 2P55A 4FTJA 2Q83A 4C33A 3DTCA 2QHMA 4FV8A 4KS7A 5FTOA 3KN6A 4L00A 4FL1A 5HE2A 4DH1A 4ONAA 3NCGA 5FM3A 3SA0A 4M84A 3SC1A 4BHNA 5AP1A 3WZJA 3BEGA 1UU8A 3EOCA 3P1AA 5LOHA 2WMXA 3VBXA 2BRNA 3VHKA 4V01A 3DT1A 4CFFA 2I1MA 5LARA 1Q97A 4Y83A 4YNEA 3NUSA 4TWOA 2YM7A 4IAYA 3CTQA 4CKIA 3Q9WA 4MXAA 3DJ7A 4WRGA 4X0MA 5C1QB 3UZRA 1MQBA 3D5VA 3RAKA 3FE3A 5CANA 3R22A 4O7VA 3UC3A 1DM2A 3CR0A 1UA2A 4EYMA 3QRIA 1YOJA 5LWNA 4X2JA 2V55A 3MS9A 3V5LA 4MNEB 3JS2A 2ZB0A 3SD0A 4FGRA 4JDKA 4FSUA 5AM6A 1ZWSA 1Z5MA 3M2WA 4DEIA 1LUFA 3C4EA 3KL8A 3QD0A 4ZOGA 3PIZA 2H8HA 4YTIA 2VWZA 3S3IA 5JZNA 1W8CA 5AUTA 2VX1A 1JNKA 2BVAA 2G2FA 2GSFA 2I6LA 3ZU7A 2W9ZB 3NYVA 3KMMA 5A9UA 3FJQE 5I5ZA 5DIAA 4JOAA 3F69A 4FMQA 1WBNA 4JG8A 2VO0A 4WUAA 4QMWA 3WYYA 5EH0A 5CI6A 4DF3A 1YWVA 5HQ0A 4F0IA 1YQJA 4KWPA 3I5NA 3LOKA 4QMXA 4TW9A 1YXSA 1G3NA 2QOOA 3NNUA 2R3KA 3PVGA 2BPMA 4H3BA 3IQ7A 4RSSA 3RZFA 3I7BA 3ENMA 4BDFA 4X2FA 4XCUA 4O38A 4XG9A 3WARA 4F7NA 4ZZNA 3QCSA 3D5WA 4GJ3A 3VUHA 4IZ7A 3U9NA 3ZSIA 3THBA 3DKGA 3SHEA 3VRYA 4LL5A 1TQMA 5CEMA 1URCA 4CXAA 5IZFA 3IDBA 3OWJA 1YWRA 3LPBA 3AC3A 3DAKA 4H3PA 1Q8UA 2YZAA 5CVGA 3RK5A 5A46A 4Z7HA 4DFLA 1H1PA 5BQ0A 5B2MA 4MBIA 1KE8A 3SKCA 2J50A 2XKCA 4FTQA 3GC0A 4O0YA 4AWIA 4MXCA 4AAAA 3O51A 4BBEA 1XH9A 2O0UA 4YPSA 5HBJA 2PZIA 5E91A 4QP9A 4AA0A 5CAUA 3VUGA 4ZZOA 3ZCLA 2J7TA 4LOPA 4F9WA 2X81A 4HPTE 2IVVA 1R39A 2GS6A 3ZZEA 3ROCA 4O0VA 4JQEA 3GCPA 5DN3A 4AT4A 3I6WA 3QCQA 4G1WA 4NFNA 4IZ5A 3MDYA 5M51A 3D7ZA 4DITA 1H01A 5EDPA 3HV3A 3LFFA 3QU0A 3R8UA 1BL6A 1KV2A 3F7WA 4GKIA 4Y72A 2PUIA 4E6DA 4IAKA 5TF9A 2XIKA 3RWPA 3HV6A 4NL0A 4CT1A 3OY1A 2J9MA 4FNZA 3A7JA 4Y85A 4J8MA 5E7RA 2Y4PA 4NTSA 4IB0A 4BI2A 3GC9A 1BYGA 5CU6A 3Q2MA 4YR8A 5IQCA 1O6KA 4QMZA 5M4FA 3MY0A 3GFWA 4H1JA 3R2BA 4ITJA 3WF6A 4BWKA 2OK1A 3H3CA 4G3GA 2ZAZA 3FC1X 4CFMA 3C0IA 2O8YA 5CYIA 5A14A 2DS1A 4WBOA 3IK3A 2WMUA 3PG1A 1M52A 4Z9LA 4AF3A 4FIGA 1LR4A 5E8TA 3V8WA 3ID6C 5AR5A 3ZUTA 3KRRA 2HW7A 2W1EA 3QA0A 4F7LA 4BRXA 5IUHA 5HESA 2PWLA 3HUBA 1SZMA 2RSVA 4R1VA 2R3IA 4ZTQA 1OKYA 1M2RA 4L44A 3RJCA 5ITAA 3QZFA 4R7BA 4BKJA 4AE9A 3NPCA 3HRBA 4KA3A 2UZWE 4O2ZA 3MVMA 3OG7A 4FOCA 4I41A 4BR3A 4E6CA 5DNRA 4JR3A 5JN2A 3D94A 3FAAA 3QTRA 3ZUUA 4BICA 4YJRA 4N0SA 4XX9A 5M4UA 1SVEA 1PXJA 3AXWA 4YTFA 1L3RE 2G15A 1HCLA 3H9OA 4RIWA 4C3FA 4ASDA 5CVFA 3V51A 4C3RA 3F88A 3TKIA 5IQHA 4FE2A 3ATSA 3MBLA 3F2RA 2X4ZA 4O84A 4XYFA 2HWOA 5EHOA 1QPJA 4K8AA 5CI7A 4EOQA 4M3QA 2ZDUA 4HVSA 5EKOA 3CY3A 3Q6WA 4IX6A 3NIZA 4TYJA 1Q8WA 4KBCA 2JAMA 3AD6A 4D2PA 2QOLA 4QQCA 2CKQA 4YHJA 2NO3A 4DEHA 2R3PA 3EH9A 3OC1A 5FBOA 2X2MA 4AGCA 3NRMA 3AMYA 4FV0A 3LQ3A 3KCFA 2GQSA 3SAYA 3ZXTA 3TNPC 3TV6A 3R1QA 5AEPA 3KF7A 1OKVA 2Y4IB 2YAAA 1CDKA 4RLKA 5GJFA 2WTWA 3LFDA 3U9CA 4BFMA 2H9VA 4NTTA 2IZUA 2X6EA 4DCEA 3G15A 2YM4A 4FTUA 3R7IA 2FYSA 3TIYA 4NH1A 3OHTA 2XJ2A 2C6EA 2JDSA 5AX9A 1CKPA 2GFCA 3TT0A 2PMLX 4PTGA 3WF5A 2B7AA 4CG9A 3R02A 2YM8A 2J0MB 5JZJA 3I79A 2RFEA 4FKGA 5D9HA 4X3FB 3PPJA 3DNDA 3D5UA 5CU3A 4F9CA 3KC3A 4EZ5A 2ZMCA 5HIDA 2QURA 3FLQA 3BEAA 3MYGA 3PVBA 5DE2A 3RMFA 4XUFA 4AGUA 3W1FA 1JBPE 4U9AA 2HW6A 4YP8A 4EQUA 4O0RA 3MN3A 4GMYA 3RHXA 5CEIA 1YHWA 1SM2A 3DKCA 5M4IA 1DAYA 4USFA 3G51A 3QTXA 4G6OA 1JSVA 3P7CA 4FSTA 3QF9A 4EWQA 4FT5A 4LQMA 5AP7A 4MBLA 2OGVA 4RWLA 4YC3A 3ANRA 4D2RA 4JAJA 5E9EA 2XRWA 2BR1A 3MA3A 3HDMA 4E26A 3NCZA 3I81A 4MCVA 1KV1A 4BDAA 1M17A 5EFQA 4YJNA 3COMA 2JKMA 4IWPA 4KRDA 2VTTA 3OP5A 2F7ZE 3Q53A 4AZFA 4FVPA 4V0GA 5E92A 4TWCA 3LQ5A 3UIXA 3VUKA 4FT0A 4XG2A 3TKHA 1TVOA 3EN6A 4IJPA 2B0QA 3KULA 3LCDA 3ERKA 2FO0A 3QXPA 2VTIA 4NWMA 5ANIA 1XH4A 2ZV2A 3REPA 2QLQA 2Z7LA 5FM2A 4IVAA 3NX8A 3TNWA 3BHYA 4Y73A 4AXAA 2A4LA 1J91A 1XWSA 4NIFB 1SNUA 4F6UA 2P0CA 4D5HA 1PMNA 4G34A 5K3YA 3GBZA 2ITUA 4CYJA 2LGCA 2V5QA 2XNNA 1WVYA 3PIXA 4QT1A 4J53A 5M56A 3S0OA 3JVRA 2C3LA 2FGIA 2JBPA 3LFAA 2XNEA 4FSRA 2CLXA 3IECA 4U6RA 5J1VA 4BCIA 1NXKA 3E7VA 5DT4A 1MP8A 2PULA 3ORNA 2VO3A 1PXIA 3ULZA 2O63A 4D9TA 5L6WL 4ZTRA 1JSUA 4UX9A 4CRSA 4CMUA 4XG3A 2FSOX 3U6JA 1ZAOA 4DLJA 3DXQA 5CASA 1IG1A 2CJMA 5DEWA 4I4FA 5EYMA 4ITIA 2YM3A 4X2NA 5J95A 2FUMA 2PPQA 2VWWA 3W33A 4KUJA 4M7IA 3Q60A 3SW4A 3U87A 3CQWA 4KKHA 2PK9A 5E8SA 4IX5A 4QMUA 5KMOA 3DJ5A 4DN5A 3E64A 3FKLA 4OTQA 3OCSA 1JKLA 2PVJA 4NW6A 3PZHA 3ORKA 3V5JA 5HLWA 3RI1A 4C4IA 2HELA 3GU5A 5A4QA 1BLXA 3MI9A 2R3LA 4ITHA 2CDZA 4OUCA 5C8MA 4ANSA 4X6QC 4RPVA 4B99A 3HAMA 1PKGA 5C26A 5KMLA 1YVJA 1XR1A 2J4ZA 3SDJA 2PVRA 3ALOA 2EB2A 1NY3A 3ACKA 4I92A 3G6GA 3WE4A 5IH5A 4IX3A 4X21A 4LV8A 1REKA 3KVWA 1OKZA 3KU2A 5C27A 1FBNA 3EQIA 3FYJX 3UVQA 4DFZE 3KFAA 3EQGA 5AX3A 4F63A 2HY0A 5BVFA 4OTRA 4AA5A 2JDOA 3DAEA 3R8VA 4F4PA 4Z7GA 3QZGA 5DFPA 3R71A 4S34A 3WE8A 4FKRA 3WZUA 2JKQA 5HGIA 2QOFA 3DOGA 4IAZA 1HOWA 5IQBA 2QU6A 3IW8A 4TWPA 5CEKA 3FI4A 2W1ZA 4I5PA 2UZBA 2VWBA 3ZRLA 4Y5HA 2ZJWA 4EI4A 2VX0A 2OLCA 2OZOA 2XJ1A 4LUEA 2FA2A 4KAOA 3R9HA 5B2LA 5G6VA 2B9FA 2C6LA 1Q62A 3GUBA 4JDIA 4UYNA 1ZOHA 3W10A 2G2IA 3FZ1A 3SGCA 2HENA 4F9YA 4O7YA 4BZNA 4QD6A 3O8PA 4EUUA 2QO7A 4E3CA 3LXPA 2JDVA 4OTHA 4XV1A 5EQYA 1GY3A 1W7HA 3VQUA 2JLDA 1M2PA 4PMSA 2P33A 4TY1A 1H4LA 5KHWA 4D55A 5KE0A 1OUKA 4G5PA 4YJOA 3ZM9A 2RGPA 2W1HA 2CGUA 2XK3A 4QPSA 5ETAA 2XH5A 3W55A 3NYOA 3OTUA 3PXYA 4CVAA 2W1DA 4CCUA 3S00A 4AZVA 2XIRA 4Y95A 3ZBFA 4DEGA 2O64A 5L8JA 3HRFA 3O8TA 4C02A 4PDYA 2VAGA 3W18A 2I0HA 1QPEA 4N6YA 4U3YA 5DT0A 3R7VA 4ALWA 5ANDA 4BDGA 2FSLX 3TUBA 3F3UA 3FI3A 1K9AA 2B9HA 4IM2A 4TN6A 4W9XA 4TNDA 4DT8A 3GENA 2VTHA 5B2KA 4HGSA 3DDPA 3E8CA 2KTYA 1ZYCA 2W4OA 2BALA 4F0FA 3QWKA 3IKAA 4RVKA 3HEGA 2V7OA 4RC2A 4IANA 3E92A 3EQBA 4KIOA 5LJJA 3TDWA 3NR9A 4DH5A 5IG1A 2BRHA 3TXOA 5DYJA 2R9SA 4CFUA 2UVXA 1H8FA 3FYKX 5D41A 5AUXA 3TZ8A 3ZOSA 4DHFA 3F6XA 4FV7A 3QKLA 3TV4A 2WTVA 2WZJA 2QD9A 4PDOA 4QNYA 4PTCA 1FOTA 2WELA 2OZAB 4OTPA 2UW9A 1CM8A 3NSZA 4XRLA 3HECA 3KXMA 4GVJA 5HVKA 3G9NA 3CKWA 2XCHA 3HLLA 3R21A 1BI7A 1OIYA 2WEVA 3F3TA 3OXZA 3PSBA 4DG2E 3KQ7A 4JBQA 3GCQA 1REJA 3T9TA 3WF7A 3UIUA 4BCPA 2X8DA 2C5VA 3L9NA 3O8UA 2WIPA 3C0HA 4FV9A 4H3QA 3R7EA 2PUPA 3R28A 4GK2A 2V7AA 2HWPA 4IM3A 4TTHB 4WNKA 4XH6A 3R2YA 3W32A 4EK6A 4FKPA 2C6TA 5E1EA 3CEKA 4DEEA 4M69B 4IWOA 4ZSAA 3BU5A 3H10A 4OAUC 2VGOA 4KIQA 3LFEA 2PUUA 3PUPA 2UW5A 3C7QA 4RX5A 2PMOX 3P5KA 4QP8A 4EC8A 5HZNA 3HGKA 4L68A 2DQ7X 4CKRA 3JY9A 2E9NA 3E62A 2CKOA 3QALE 4UMUA 5GIOE 4RC4A 1OL6A 4AX8A 4CNHA 4R77A 4HZRA 2UUEA 3C51A 3NUNA 2J51A 5AV4A 4TWNA 5BVDA 1JQHA 1GIJA 2GCDA 4CGAA 1H1QA 4LGHA 4E4LA 4YJQA 5CTPA 4O82A 1ZZLA 3G0EA 4MWIA 5M44A 5KBQA 2VV9A 3GT8A 5GNKA 2WXVA 5CNNA 4UALA 1VYZA 3V8TA 2YLEA 4DGOA 3MPAA 3Q3BA 3PXRA 4UMTA 5DEYA 3R8PA 5HX8A 4FTRA 4FKSA 3Q52A 3QQGA 3C4WA 4EK8A 1KOBA 3PY3A 2YJRA 4N6ZA 4O0SA 4BCJA 5IF1A 1R78A 3QCYA 1XBCA 4WOVA 3TNIA 4O1PA 3V5QA 4NUSA 3F61A 3UIBA 3S95A 4TYHB 5I9UA 4YTCA 4CQEA 4FVRA 5CY3A 4GVAA 1PMUA 4U80A 4RZWA 4QMMA 3HUCA 2VTSA 2Z60A 1GZKA 3UTOA 5H8BA 5BMMA 1Z57A 4YO6A 4H36A 2YCQA 2VO6A 3HDNA 3PE2A 3QTUA 3ELJA 5DA3A 4BTMA 5CF8A 3ORIA 4D4RA 4KKGA 5H9BA 1ERKA 4ZP5A 5A4LA 2Z7RA 4ZAUA 3RPYA 2QC6A 4EZ3A 5AA9A 4FSQA 2IVSA 2XUUA 2GNFA 3RCJA 3PJ8A 3UC4A 2XA4A 3JVSA 4BHZA 4O22A 5H3QA 1A9UA 3W8LA 2BIYA 2PVHA 4OTFA 1AGWA 4RLLA 5IQGA 5LVLA 5KKRC 2OF4A 4YURA 4TYEA 2NNWB 1YHVA 3UQFA 4RX7A 3SQQA 3TNHA
chains in the Genus database with same CATH superfamily
3ZH8A 3R6XA 2UZLA 5TR6A 1OBGA 3GEQA 2UVZA 3QRUA 2R0UA 3AT3A 5BVKA 3PFYA 2XKEA 3UG2A 5HKMA 2YABA 4U7ZA 5HLPA 4B0GA 3LXKA 5BUIA 5M07A 4UMRA 4YJVA 3VWAA 3GCSA 4IVDA 3S2PA 3UYSA 4IW0A 3OROA 5LVNA 2BRGA 3EZRA 2GS7A 2WMRA 3GCUA 2W5AA 3TUCA 5CSVA 3UE4A 4QP2A 3L9PA 2X2KA 4I0RA 4BTJA 5HTIA 4IM0A 5CEPA 2C6IA 3BHVA 5JRQA 3R7OA 2VWUA 3F3ZA 4C37A 2ZV9A 1OL1A 1GIHA 4FSZA 5IQEA 2C6OA 3HAVA 4WT6A 4RC3A 5J5TA 5KCVA 5BV3A 5HD7A 1P4OA 2R7IA 4AT3A 2ONLC 3HZTA 2JFMA 4QQTA 3AC4A 4FL2A 5CEOA 5K4IA 4BGHA 4IHPA 1BX6A 4G16A 3KCKA 1TQIA 3T8OA 4LOOA 1BUHA 4V05A 4ZJJA 5JEBA 4BVUA 3AKJA 1M7QA 3LW0A 4HGEA 4B6LA 1S9JA 4BTFA 1WBPA 3D7TA 4OBQA 2Y0AA 5CWZA 3QAME 1OITA 5M53A 2EXCX 3QXOA 5HTCA 3EQRA 3NUPA 3UDTA 2CN8A 2Z7SA 4FL3A 1U54A 4M15A 4CCBA 5AP2A 1QL6A 5IDNA 1PXNA 4XOYA 4K0YA 3QQUA 5KMIA 4FT7A 3FMLA 2CLQA 3G9LX 2C30A 4FJVA 2HZNA 3QKKA 4S32A 5DR6A 4A4LA 1K3AA 4APCA 4JAIA 5HCXA 2XYUA 4HNIA 3HMNA 1OKWA 1XO2B 3LCTA 3ZFMA 2AC5A 4MEDA 4WUNA 4EKKA 5FDPA 2VUWA 4DTAA 4C36A 3WZKA 1H08A 2Y9QA 2OIBA 3D15A 4I5HA 4L3LA 5J7BA 5JMSA 3V04A 3W2SA 2X0PA 2ETMA 4YZNA 5AP0A 3E8DA 1ZMVA 1RJBA 3ROYA 5IA2A 3FZPA 1VR2A 5JQ8A 2CKEA 2J5EA 4GIIA 3JUHA 4IX4A 5HG7A 4QO9A 2A98A 2XJ0A 2PTKA 3GU4A 3DBDA 3EYGA 4FV2A 1WCCA 4RWKA 3LLTA 1F5QA 3HL7A 4A9YA 3GFEA 3VS4A 3KGAA 5IMEA 4FNYA 1XKKA 4EWHA 1H1SA 5IUGA 5IQIA 3EB0A 4EK3A 4G2FA 3G0FA 4ASEA 1M2QA 3DCVA 4DEAA 3NUAA 3VS1A 4YO4A 4FEUA 4N57A 2OKRA 4OTDA 5EHYA 2WQNA 2AEGA 2PUNA 4O6EA 5HICA 3OTVA 4O7RA 4XMOA 5I4NA 4DG3E 3ZC5A 3UOHA 3NNVA 5JRSA 4JQ7A 1TKIA 3A4OX 4JQ8A 4RA5A 5AFVA 2B52A 4O21A 1FVTA 1PHKA 4RJ4A 5KMKA 2B54A 3UMWA 3F5XA 4EOMA 4WD5A 2X6DA 2P3GX 4ERKA 5BVOA 2GQGA 4RIWB 3POOA 1GZ8A 3HP2A 1Q24A 3M1SA 3P23A 5CAPA 5CZHA 4C59A 2HCKA 1BI8A 4UZDA 2B1PA 3NZ0A 3QL8A 4RA4A 1R3CA 3ZHPC 1WFCA 2C5XA 2WAJA 3IW7A 3PE1A 5I9XA 1GZOA 3GCVA 4DGLC 4E73A 1SVGA 3D0EA 3VRZA 2Z02A 3GQIA 3AT2A 5DRBA 3NDMA 3QD2B 4QYFA 4A9TA 4I1ZA 1A48A 4LRKA 4GYIA 3NW6A 5HHWA 3Q2JA 4O7TA 1O9UA 2R3RA 4GFOA 3PWDA 1CTPE 2X7OA 4MNEA 3T3VA 2VO7A 2C6DA 3IDPA 3P7BA 5JT2A 3FMNA 5CSXA 3GU8A 4O86A 3U55A 2Q0NA 5ACKA 3FC2A 1P5EA 3Q4ZA 3FSKA 1Q4LA 3FEGA 2VTLA 2XF0A 2XK7A 3BGPA 2G1TA 1YI4A 3BGZA 3R83A 3A61A 4EOLA 4XP3A 1GAGA 5FTGA 3KK9A 3PFQA 5AUWA 5EHLA 3OUNB 4RQVA 4BKYA 3SG9A 4IIRA 2CGVA 4QMTA 5HBEA 5HVYA 1MUOA 1OL7A 3PRIA 3Q6UA 4K11A 5IKWA 1H0WA 4L3JA 2VTAA 5L8LA 4FUXA 4O0XA 1OZ1A 1NT2A 3TZ7A 1Y6AA 5E8XA 2J0KA 4MD7E 2Y6OA 3LXLA 2OW3A 2UW8A 3TNQB 2ITPA 4FT9A 3IOPA 5K5NA 2W96B 2X7FA 3A7IA 4AT5A 3QQJA 3Q96A 4BZOA 3MH2A 5F94A 2B9JA 3MY1A 4WHZA 4YZCA 3WIKA 4AN3A 3AGLA 4QMQA 2OFVA 1OUYA 5FRIA 3UG1A 4L46A 2QONA 2YM5A 3D7TB 4Y5QA 4E1ZA 1BL7A 3A99A 4PPBA 2XALA 1OIRA 5DI1A 3MVLA 4FTCA 4I21A 5JH6A 5CU4A 3BYOA 3WZDA 4C8BA 1I44A 1FVRA 2RFDA 3LCOA 2XIXA 4M12A 3TL8A 4AOTA 1R1WA 3BELA 4CTBA 4PV0A 4JDJA 2W5HA 4UB7A 5HNGA 5LVOA 3MFSA 4ZLZA 1AQ1A 3DA6A 3FWQA 3R7UA 3U8WA 3LMGA 2W4KA 2FH9A 1CKIA 4YBJA 4YZBA 5B0XA 3ZLYA 4M0ZA 4C4FA 5BUEA 5C4LA 3CD8A 3RINA 1FVVA 5EDRA 2BDJA 2YIQA 2AYPA 2IJMA 4CZUA 3NNXA 4DBNA 2WNTA 2WMSA 4FUYA 4PQNA 1V0PA 3U51A 2OJIA 4QMLA 4RJ3A 1XJDA 3ZYAA 5LXMA 4BYJA 2C69A 3E7OA 2FB8A 1W0XC 3DLZA 2XIYA 2Y6MA 5I9VA 3UYTA 1U5QA 3AQVA 2XP2A 2XS0A 3ULIA 4D5KA 4NM3A 4DC2A 5J5SA 3QQLA 1JSTA 5DH3A 1YXUA 2OIDA 2XVDA 4FYNA 4GCJA 4RZVA 2PE0A 2PVFA 5DR9A 4AAYA 1R0EA 4XOZA 3C4CA 2OJJA 4FGBA 4LV5A 3ZUVA 2B4SB 2I40A 4F6WA 4B8MA 4YPDA 5EYDA 4B8LA 3DK7A 2JIVA 2GPHA 3LM0A 3N51A 3EJ1A 3BLAA 4ZTNA 4ANNA 3PJ3A 3RVGA 2XCKA 4LM5A 3CS9A 4EORA 5I3RA 3VIDA 5A4EA 3EQHA 1PMVA 5J9ZA 1Q8ZA 3MPMA 3MB6A 3QRTA 4FTLA 4I20A 4KSPA 5E8UA 3VHEA 4O7SA 3GNIB 1X8BA 4FC0A 4DH3A 2XNGA 1VEBA 4BDJA 1V0BA 5CF4A 1U59A 4HVDA 5IISA 5KMJA 4UXQA 4QEBA 4IE9A 2LAVA 3LMHA 4FNWA 1YWNA 1FPUA 1VJYA 4TNBA 1H24A 4XLIA 5L4QA 2IEWA 4FKLA 2ERZE 3DBCA 4KRCA 4QMNA 2OWBA 4YGAA 4Y8DA 4PUZA 3HRCA 2WFYA 4XP2A 5EW9A 4OTWA 2EU9A 3LJ2A 3DFAA 4EH3A 2ZFYA 4EKLA 5LMKC 4YJPA 3Q9ZA 1OGYA 2GMXA 4IEBA 3R9NA 3FBVA 3UODA 5HVJA 4Z55A 3NMUF 2WMWA 4OAVB 5TOZA 5CF5A 3U54A 5GIPE 3UZPA 1XQZA 5DVRA 3OFMA 2QG7A 4E5WA 4AZSA 3MVJA 2IO6A 5I9WA 3M42A 4O0WA 3BQCA 5JGAA 3OEZA 4O1OA 3PXQA 3ZEWA 3OXIA 4KIPA 4EBWA 1G8AA 4L9IA 4ZY4A 4ZLYA 2WD1A 5K5XA 3IGOA 4NKAA 3BIZA 1H07A 5FXRA 3CGOA 2B9IA 4DAWA 5GZ9A 3BHHA 1UWHA 4YSJA 5JFVA 4AZEA 4OBOA 3LCKA 5T6KA 2PE1A 2YN8A 1OL5A 2J90A 4GV1A 1T45A 3VUDA 2WQOA 3QZIA 4D2WA 2A2AA 5BUJA 4PL5A 3UVPA 4PP7A 2YAKA 4JG6A 2F7XE 1U5RA 3TI1A 4C57A 3N4VA 4G31A 4I24A 4HOKA 4F64A 4FKUA 2WMTA 3Q4CA 4BDDA 4D2VA 3P5JC 4AXCA 1AD5A 3DJ6A 3W2OA 4M14A 1Y8YA 5CU0A 2BFXA 3RAWA 1BMKA 2WKMA 2JDRA 4KS8A 4UYAA 5AM7A 5L2QA 3S1HA 4WKQA 3PDTA 4ZJIA 4FYOA 2V22A 4EJNA 4MTAA 4YMJA 5L2TA 1UV5A 4GW8A 4CV9A 3LE6A 4XEYA 5KKRB 3LMIA 5EW8A 1JOWB 3G2FA 5FXQA 2C0TA 2YIXA 4L8MA 3HX4A 1FGIA 4PY1A 2Y8OA 4OW8A 1PF8A 1J1BA 3C4FA 3D2IA 1ZOEA 4G3EA 4PPAA 4U97A 2HK5A 2WOUA 2YDJA 5M09A 1JKTA 3CPCA 3DZQA 3AT4A 3KXXA 3MH3A 2VTPA 2VRXA 1NVQA 4KB8A 2GDOA 4E8AA 2C0IA 2PMNX 2BTRA 4EOOA 4FIIA 5BPYA 5HE1A 2CCHA 1CKJA 2BAJA 5H2UA 3QLGA 2ITVA 4BWXA 3KF4A 3II5A 2PVLA 4H39A 2X1NA 3F5UA 4FIJA 3UQGA 2J0LA 5AMNA 2XB7A 5CAVA 2B53A 5A4TA 1Y57A 3OMVA 1S9IA 4BGGA 5DG5A 4IZYA 2QO2A 2E9OA 4EOJA 3AG9A 2R3MA 3BYVA 4EHEA 4L43A 3BGQA 4RBLA 2UZVA 2NRYA 4BJJA 1OGUA 1TQPA 3E63A 3A8XA 3VQHA 4DH8A 1KE6A 5L6OA 3D14A 3FZRA 5G1XA 4D2SA 4UY9A 4FZFB 4ZK5A 4FTNA 4R5YA 5HLNA 3B2WA 5BVNA 3Q5ZA 2ZM4A 4RVLA 3VBTA 4NSTA 3UMXA 4EH8A 2ZYBA 4FF8A 2W7XA 5ANJA 4FICA 4FZDB 4IFGA 3RAIA 3OW4A 4ZTLA 3VUIA 3ETAA 3PP0A 3BE2A 3KRWA 3R7GA 1WAKA 3FMMA 4U43A 2ETKA 5IMXA 4XG7A 3NLBA 3PA4A 4ZSEA 4YLLA 4UMPA 4RIYB 1DI8A 2VN9A 4X3JA 2GNHA 3COKA 3AMBA 4IBMA 1KE9A 3V6RA 2H96A 3VJOA 4MX9A 4HNFA 5BVEA 2W99B 4PL3A 4ZTMA 4GK4A 2RKUA 3PWYA 3DU8A 2HY81 1UKIA 3B2TA 2PY3A 2NPQA 3DNEA 4YZMA 2E9UA 2ETRA 4BGQA 2UW6A 4O96A 1E9HA 3R01A 5CT7A 5AR8A 3QD4A 4M67A 1KUTA 1XH5A 2X39A 4BIDA 4A9UA 4FV6A 4NM0A 4C38A 3A7HA 5ANGA 3HP5A 3FL5A 1RE8A 2R3FA 2JGZA 3IW6A 4MK0A 3D4QA 4RJ7A 1ZZ2A 2W9FB 4CFVA 2BZJA 5AIKA 3LLAA 2X8EA 3MW1A 4RQKA 3QWJA 2WOTA 4RT7A 4C61A 4CRLA 5JFXA 2GQRA 3PVWA 4U45A 1ZMUA 2JDTA 4JL9A 3WZEA 3Q4TA 4R7HA 3DFCB 3RM6A 3SRVA 1JKKA 3EL8A 3KKVA 2V0DA 4OR5A 5EOLA 5IA4A 3PSCA 3PXZA 4FG9A 3QKMA 4TYHA 3ZO3A 4GT5A 4DGNA 3BU6A 3PA5A 4QP3A 3FLSA 4HYUA 4IAFA 2YWVA 4WO5A 3GVUA 2QOHA 4PL4A 5FXSA 4LRJA 4RX8A 3BZ3A 1O6YA 1U54B 3HMIA 3R8ZA 4KSQA 2QKWB 2CGXA 2C3IB 4Q5HA 2C5YA 3ZZWA 1Q61A 2Y4IC 2YCSA 1G8SA 2YDIA 3RWQA 3V5TA 5GJGA 5AWMA 3IONA 4KBKA 3SXSA 4EUTA 3F66A 5IA5A 2OZAA 3QX2A 4II5A 2PSQA 4X3FA 4AG8A 5IH6A 2PE2A 4L53A 4O7NA 5DWRA 2XNMA 1NA7A 2R64A 5J87A 4F08A 3QCXA 2JIIA 5I0BA 4ENXA 4Q2AA 3QQKA 3ZFYA 4EOSA 2IVTA 3LHJA 3O0GA 3BYMA 4H1MA 5D1JA 3UDBA 3UGCA 4ACMA 3OT3A 2F2CB 3QHRA 5HCYA 4CZTA 5HU9A 4AXDA 1RW8A 3RBWA 2IVUA 3K3JA 1LPUA 4A9RA 4I0TA 3LJ1A 4M69A 4AXEA 1UKHA 3H30A 4NW5A 4PF4A 4BI1A 2C0OA 3QTZA 5EW3A 5JKGA 1YHSA 1NW1A 4QDVA 3DZOA 3ANQA 2EVAA 1IEPA 3GOKA 1GNGA 4M8TA 4QTCA 5EI2A 2QR8A 2UW3A 2OJGA 3QUPA 4TL0A 4EH9A 1H27A 5J9YA 5LCKA 3GOPA 5IU2A 4AGWA 3EFKA 4BCKA 1NVSA 3ACJA 3QQHA 4GL9A 3PP1A 1K2PA 2J0JA 4GEOA 3IW5A 3EKKA 1KOAA 3FSFA 1YDRE 3WBLA 4ZS4A 4ZJVA 2XM9A 2UVYA 3WYXA 4HVHA 3FPQA 4R8QA 3ZDUA 4L42A 3EL7A 3EIDA 2ZOQA 4FI1A 4ZEGA 4UV0A 4YZDA 2WMQA 3GU6A 1OMWA 2HXLA 4IC8A 4RG0A 3IPHA 3RNYA 1T46A 3VC4A 4AW1A 5KUPA 3KY2A 5AP6A 4HJOA 4MXXA 1WBTA 4XRJA 3PLAE 1Q8TA 5ANEA 4F7SA 3LQ8A 4I6HA 4DTKA 1PKDA 4O4FA 5TO8A 2C3JA 2WGJA 4IXPA 5CT0A 3TIZA 2R3NA 3UQCA 5GINE 3A7GA 2WMAA 4AS0A 2QLUA 3R1SA 4M68A 3I7CA 3ITZA 4TYIA 4YLKA 4BC6A 4LDTA 3CIKA 3ATTA 4HYIA 3MV5A 4NT4A 2JKOA 3P7AA 4MWHA 4CYIA 1VLRA 4J1RA 4ALVA 3FQHA 2HYYA 5L2IA 2YWPA 4FEVA 4I23A 3K5VA 4I6FA 3ZEPA 3RPOA 4L67A 1ATPE 4FODA 2UW4A 4D2TA 2VTMA 5LCJA 1FGKA 5CQUA 4OGRA 5C4KA 4ZY5A 2ITYA 1WVXA 2OJ9A 4Z16A 3PLSA 3E8EA 4E4NA 1H1WA 5HU3A 4FNXA 3LJ0A 3PUFC 4DCAA 4LI5A 2G2HA 1OIQA 1YI3A 2X8IA 1CSNA 2VWIA 3IDCA 3W2RA 4D58A 1L8TA 3RPSA 2C68A 2Z8CA 4RWIA 1J7IA 1EH4A 3IO7A 4RVMA 5D10A 3COIA 4YU2A 4U42A 3V01A 4XHKB 4YTHA 4R78A 2ITNA 2OFUA 3UVRA 3IOKA 4QYEA 5A6NA 4K2RA 1Y91A 3MVHA 4PWNA 5CLPA 4FTTA 3RCDA 2YZLA 4K6ZA 2OXDA 2XKFA 3BWFA 1OPJA 4HCUA 4MQ2A 3SOAA 3UP2A 1J7LA 1UNLA 4CKJA 4UMQA 1CMKE 5IA0A 2X9EA 4MUQA 2EWAA 4G5JA 4KIKB 3CTJA 1GJOA 2FSTX 4K9YA 4RFYA 5HG8A 3GXLA 2XMYA 2GU8A 4NCTC 5H8GA 3FMHA 3VUTA 3R30A 4GYGA 4BCFA 3TJCA 4JI9A 5DPVA 3EMGA 3KVXA 5HCZA 1RQQA 3TTJA 4OLIA 4AW2A 3MSSA 5CALA 1Q8YA 4QP4A 3F5PA 3ZM4A 3QTQA 2IZRA 4X2KA 4XBRA 2UZEA 3H0YA 4PX6A 3ZDIA 5CQWA 4FKVA 5C9CA 1FQ1B 3COHA 3ZS5A 3RALA 4F9AA 4C4HA 1YI6A 4NYEA 3BKBA 4FZ7A 1UNHA 4I5CA 5LVPA 5EQEA 4AOIA 4PP9A 3WILA 2ITTA 4B4LA 2BAKA 4U41A 4UN0C 1ZLTA 4FK6A 4AQCA 1RDQE 1PRYA 4ENYA 4HZSA 2H34A 2GNLA 3R0TA 4MQ1A 4CFNA 1KWPA 1UU7A 3V3VA 3VBVA 4M0YA 5HX6A 1DAWA 1BKXA 3VULA 3BV3A 2BZHB 5I3OA 4NJ3A 1Q5KA 5M06A 4I93A 4ARKA 1MQ4A 2OU7A 4CQGA 5M08A 4P7EA 1WMKA 1VZOA 3P79A 4QMYA 2YIWA 3U4WA 4ZMEA 4BIEA 4DFUA 3VUMA 2IW9A 3QTIA 3FXZA 3M11A 3UNJA 5ACBC 4WNOA 3CSVA 3RGFA 1YXTA 2R3HA 4P2KA 3L8XA 2JIUA 4BDIA 3R1NA 4C2VA 3ZO2A 2BZIB 5HG9A 4MHAA 3DQXA 3OS3A 4EQMA 2I0YA 2R7BA 3EYHA 4R6VA 4XG4A 5LMAA 2G9XA 3WI6A 5T3QA 3ZLWA 4F7JA 5LMBA 4DGGA 4F09A 3UO4A 2GHMA 4USDA 4IWQA 1ZY5A 4MH7A 4AU8A 2XK6A 5IA1A 5TE0A 2A0CX 4EHGA 3UZTA 3OT8A 2VX3A 4E5BA 1G8JA 3DBEA 4S2ZA 4IC7A 5BYLA 4MXOA 4DHIB 3NIEA 5AUUA 5LVMA 3BE9A 4YZ9A 5CXHA 3SV0A 2CNUA 3BU3A 3JPVA 4V0GB 4J99A 5E8WA 4DH7A 2CMWA 4DHJA 4BN1A 3H0ZA 4C58A 4LFIA 2BHHA 3LXNA 2JEDA 4WG3A 3PXFA 3OOMA 4CD0A 2PVKA 3R00A 4OBPA 1LP4A 5AR7A 4F1MA 2YEXA 5GZ8A 3KREA 4FKQA 3RHKA 4P90A 3C4ZA 3DS6A 2Y7JA 4BCOA 4D1XA 4R3RA 2E9PA 5HIEA 3L9LA 2WB8A 3FQEA 5FEQA 4HW7A 3FV8A 4RVTA 3ZRMA 2PVYA 4FEXA 3PA3A 4HYSA 2EUFB 2YM6A 3N4UA 4WSYA 3QQFA 4XV9A 1XH8A 4D0XA 1OB3A 1B38A 4CLJA 4QMOA 3WIGA 1E1VA 3TMOA 4FT3A 3UNKA 2YFXA 1SMHA 4U81A 1ST4A 4B7TA 4QPAA 4XG8A 4ANBA 3ORTA 5D12A 4RFMA 2VTOA 4GG7A 4M66A 1WBVA 5EM7A 5I9YA 1H25A 3EQPA 2AC3A 3CQEA 1Y6BA 2BDWA 2YIYA 3GU7A 2YJSA 3FZOA 1YDTE 4EH7A 2YERA 4H05A 4JBVA 3H4JA 5GJDA 5KZIA 4IDTA 1VYWA 2X0GA 4ZXTA 5HD4A 4KINA 1WBWA 3EQCA 3CY2A 3P78A 3G33A 3RP9A 1UVRA 4EBVA 3P9JA 5IH4A 5IQAA 4FTIA 4FZ6A 5M57A 4BCQA 3LCSA 4I0SA 5CX9A 2A19B 5KNJA 3OW3A 4QP7A 3ZO4A 2BAQA 2W1FA 3R9RA 3VS5A 3NW5A 4IB1A 4MD8E 3GB2A 5CSHA 5EI8A 4QP6A 3CGFA 4EQCA 4ACCA 3W0RA 2XYNA 3OY3A 4W4VA 4TXCA 4ALUA 4CSVA 3BX5A 3O5AA 3DKFA 3FUPA 5DMZA 2GNJA 5AUYA 4XBUA 3R8LA 2VWYA 3DGKA 4ASZA 5EYKA 5JK3A 2ZV7A 2CGWA 1ZYLA 1Q3WA 4NM5A 3ZMMA 5A6OA 4XLVA 4MAOA 5EYCA 5J7HA 1M14A 4BCMA 3UIMA 3ENHA 5TKDA 2HZIA 4BTKA 3F7ZA 3ZONA 2R2PA 4ANLA 2PZYA 4E93A 2C1BA 5DHJA 4BL1A 2Q0BA 4A07A 4BF2A 5L2SA 4I5MA 3EKNA 1ST0A 3TV7A 2R3JA 4EH2A 3V8SA 4F78A 2IPXA 2F2UA 4TYGA 3UO6A 5J9LA 3HA6A 1ND4A 2YA9A 2ONLA 3O2MA 4XV3A 5GHVA 5EI6A 4DA5A 1KSWA 4ACGA 2R4BA 5IEXA 1YRPA 3WF9A 5HG5A 1PY5A 4JX3A 4YBKA 4JX7A 3PY0A 5DOSA 4ANQA 3IG7A 4GUBA 4D4SA 5F9EA 2O3PA 3ZC6A 4FEQA 4G6LA 4FIHA 5CEQA 3Q4UA 4J98A 3VS3A 3FY0A 3VBYA 4RIXB 4YJUA 3A8WA 4PMTA 4S30A 2JC6A 3RK9A 3ZRKA 3CPBA 4HCTA 4IWDA 3BBWA 5D7AA 3VS0A 4RX9A 3E3PA 3KA0A 3MPTA 3QHWA 4M13A 3UNZA 4EJ7A 5FDXA 5J8IA 1XBBA 5KZ0A 3UOKA 3TWJA 3RPVA 3AC2A 4JDHA 3W0NA 4AQKA 4MKCA 4CLIA 3TZ9A 4G3CA 3CP9A 2R3QA 4Y46A 4P5ZA 1W2DA 3DKOA 3Q9YA 3SRVB 3TDVA 3KXZA 3OWPA 3Q5IA 4FK3A 5D7VA 4AACA 3A7FA 2C3KA 2C6KA 2QQ7A 1PXLA 2XZSA 5DLSA 5J1WA 2UW7A 1WBSA 1M7NA 4BIBA 3HV5A 3NEWA 4ACDA 4GFGA 5IQFA 3LAUA 4E4MA 2NP8A 4DE4A 5BYZA 3O7LD 4FBXA 4EOPA 4D4VA 4O0TA 2QOIA 5F1ZA 4BWPA 3GQLA 5BNJA 1PYEA 2WTJA 3PJCA 4D28A 4QYYA 3NUXA 4J52A 4QRCA 3O71A 2WMVA 3QUDA 4GT4A 1O6LA 2XM8A 4R7IA 2HOGA 2PZ5A 2QOKA 1W2FA 3DDQA 4AA4A 5AV3A 2OXYA 3K3IA 5AA8A 1ZYDA 2RFSA 3OWKA 2BTSA 3RM7A 5JGDA 4U44A 5FEDA 3I0OA 2ZB1A 4BBFA 3MA6A 4RIYA 2XKDA 1FMKA 2W06A 1QPCA 2J6MA 4PMPA 3KRLA 4ZSJA 4FVQA 5ETCA 3W2CA 2PU8A 2EXMA 2IWIA 4WG5A 4X2GA 1YXXA 2W05A 1JWHA 3I5ZA 2OG8A 3FXXA 1KE5A 2WQEA 2BMCA 2XNOA 4YUQA 1XH7A 3NAXA 3R63A 4A06A 4EEVA 4GFMA 4JXFA 4ACHA 3IGGA 3LFCA 2ITZA 3NVKI 5AR4A 4D1SA 3QRJA 1WBOA 2XK4A 3QFVA 1J1CA 3BCEA 3ZSHA 3PVUA 5EM5A 3MFTA 5K0XA 5L6PA 2YCFA 2OJFE 3TN8A 2JKKA 3TCPA 4DFNA 4H58A 3FQSA 5LWMA 1YDSE 3TKUA 2OH4A 3QYZA 4XG6A 4G9RA 3JXWA 3ODZX 3S4QA 2BKKA 3PJ1A 5F4NA 3UPXA 4EYJA 1NVRA 3O7LB 5AP3A 3T3UA 5EDQA 5CNOA 5A54A 4JRVA 1UU3A 3ORZA 5CXZA 3F2NA 5HO6A 4PNKA 3PTGA 4GJ2A 3NW7A 4MF1A 4QYGA 5JFSA 3CLYA 2XAMA 3ML1A 2QU5A 4FR4A 5ICPA 3TG1A 4C4GA 4MNFA 3QC9A 4U3ZA 4RJ8A 4NEUA 4W9WA 5DRDA 3PIYA 3F9NA 4FTOA 4JIKA 3FMDA 4U79A 4X3FC 3D83A 1B39A 3HVCA 2XNBA 3W0SA 4L52A 5BMSA 5IPJA 3SXFA 5FEEA 4MYGA 1R0PA 4U40A 2C1AA 2BRMA 4BDKA 2GHGA 4O4DA 3MFRA 4I22A 3LZBA 2CHLA 2JBOA 4X6RA 2QODA 3BLQA 3FLWA 4O7WA 5DBXA 3L8VA 3ZBXA 4N4SA 1JLUE 4DLIA 3CBLA 3BYSA 4FIEA 5FQDC 3KRXA 4IZAA 3VS2A 1E1XA 4GIHA 1ZRZA 3QRKA 2O2UA 4MVFA 2JAVA 2CSNA 5CSPA 3LIJA 1J3HA 1JKSA 4YNOA 1UU9A 3NUYA 1OVEA 4QPMA 4DEDA 4BDHA 3QC4A 3VBWA 2VGPA 2BRBA 4F1TA 3U6HA 4FKWA 4L7FA 4F6SA 4PTEA 2WIHA 4EK4A 4LRMA 5CAQA 2ITQA 4RRVA 4IVCA 1W83A 5M4CA 5ETFA 1FMOE 1H00A 4XS2A 3MJ1A 3U6IA 3W2QA 3OZ6A 4ASXA 2ZMDA 1P2AA 4WBBB 3L9MA 5DR2A 3ORLA 2CCIA 2W4JA 3LM5A 2QVSE 2QOQA 2F9GA 2OSCA 4QQ5A 2BZKB 3QGYA 4G3FA 1P14A 2ZM1A 3A60A 4RIOA 5E8ZA 4DGMA 3QBNA 2CKPA 3QYWA 3NS9A 4U8ZA 4ZSLA 4ZTHA 2IW8A 2OF2A 2UZNA 3N9XA 5TT7A 2HZ0A 4Q9ZA 2IZTA 4I3ZA 5FWKK 3FLNC 3FI8A 4QMSA 2PYWA 3U4UA 3DAJA 1HCKA 4BCHA 3OCTA 5D11A 4MXYA 5E1SA 3O17A 4FTAA 5HI2A 3R9DA 3DBFA 1MRUA 4FX3A 5EM6A 3K5UA 3KXNA 1PXPA 3DLSA 4U0IA 4J95A 5CS6A 4FKIA 2OBJA 2DUVA 2QOBA 4AN9A 3QUEA 3BHTA 4C7TA 4D1ZA 1Z9XA 3NFFB 3PRFA 4PDSA 4FSWA 4KABA 4GSBA 3BWJA 4R3CA 4A4OA 4AFJA 3RAHA 5K9IA 4ORKA 1Q99A 3V5PA 3TUDA 4ZZMA 1IRKA 3CE3A 2F7EE 5EOBA 2WU6A 4GKHA 4A9SA 5C03A 3HYHA 1Y8GA 2GHLA 3Q32A 4HGLA 5EK7A 3D2KA 4BKZA 3EFLA 4WNPA 3N4TA 4QP1A 1URWA 2JFLA 2PZPA 4AZWA 2RG6A 4TPTA 2BILB 1PMEA 4C2WA 4HVIA 1OL2A