4FL1A

Structural and biophysical characterization of the syk activation switch
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title Structural and biophysical characterization of the syk activation switch.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 268
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fl1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fl1A01
2YAAA 4D2RA 4IM3A 3OBJA 5L6WL 4PPCA 3CXWA 3RNYA 2UZVA 3Q53A 4C0TA 4J8NA 3ACJA 3UZTA 2FSTX 2HWOA 2PUUA 2C6TA 2J0MB 3MB7A 1ZYJA 4FKJA 4TYJA 3GFEA 4JBOA 5B2MA 1J7UA 4FTRA 3QZHA 3DZQA 5AWMA 3OFMA 3OWPA 1X8BA 3RINA 2BRNA 3QXPA 4Y5QA 4F1OA 5GINE 4YO6A 3VW8A 4ERWA 2Y4IC 3CKWA 5LVNA 4ACHA 5J1VA 4L7SA 4H1MA 1M14A 5M53A 4UY9A 2R3KA 3SOAA 3FLQA 3BYUA 2ITWA 2PMLX 2FSLX 4IVCA 1PRYA 1OVEA 4MHAA 5AP3A 2HW6A 4ANNA 3R7YA 4X2NA 4KBKA 4CKIA 3OMVA 3R28A 1W98A 2BFYA 4JOAA 4FA2A 4BTMA 2PK9A 5HG8A 3TNQB 4WBBB 4O82A 5DGZA 4RZVA 3SKCA 4PDOA 3BYOA 3OP5A 3JVRA 3VF9A 3UVPA 3CQUA 4U3ZA 3ELJA 4NTSA 4NK9A 1Y8YA 2GFCA 3F3ZA 4KSPA 5L8JA 4CV9A 3ZMMA 4YU2A 1J3HA 3FXZA 3R8ZA 5LJJA 5M4IA 3ORTA 4ZY6A 2ETRA 4KINA 1STCE 4O0SA 3DAKA 4RPVA 2R5TA 3OY1A 3TEIA 2F9GA 3TJCA 3ZO3A 5BUEA 3UPZA 3O0GA 2WMWA 4F6WA 3GQLA 4DTAA 5C8MA 3C5UA 3FZPA 4IC7A 5F95A 2OU7A 3TNIA 3QTRA 3Q6UA 5CU4A 3R83A 4F6SA 5J1WA 3UPXA 1HCLA 4FL1A 4IFGA 4L01A 3TNPC 4ANMA 4WT6A 3BWFA 2WAJA 2NRUA 4PTCA 2ONLC 2Y7JA 5E8WA 3N4VA 1FVTA 3GU7A 2Z8CA 2XIRA 3PVWA 4FV3A 3R9DA 4DGOA 5DMZA 3ZLYA 5DIAA 4R7HA 3FL5A 5IQDA 4ZAUA 2PHKA 2YJRA 5LMKC 3UZRA 4QTAA 5DVRA 3HAMA 3ZO1A 4ALUA 4YJSA 2VTIA 5C4LA 5D11A 2UW3A 4PUZA 3D7ZA 4IHPA 4OT5A 4YBJA 4EK4A 3KRXA 3GFWA 5HO7A 3JPVA 4U41A 3BU6A 4DHFA 3R71A 4FG9A 4AFEA 4EUTA 1OKYA 1RDQE 2C3KA 3LCSA 3DJ5A 4EI4A 2VTSA 3P86A 4O91A 5D7AA 5AP0A 4E20A 3A4OX 4ANBA 4RX9A 3PXRA 4H05A 3SXFA 3SA0A 2PE2A 1OECA 1ZYLA 2ITNA 2QO9A 3Q4ZA 3SG8A 2QD9A 3C4WA 3IW7A 3QQJA 1A48A 1YRPA 3QYWA 5ETFA 4UZHA 1E1XA 3EKNA 4E8AA 3BLHA 3MH3A 3R00A 4BCOA 5JN2A 5EG3A 5L2TA 2XIYA 3D5XA 1JNKA 1H07A 1H27A 2O5KA 4I6QA 5G1XA 1OUKA 2CGXA 4UWCA 2C6DA 4BL1A 5BVNA 3FSKA 3RAWA 4FKOA 1YHVA 4JDKA 1TKIA 4D1ZA 3R04A 3CQEA 3FBVA 4GU9A 4F99A 1OIUA 4IANA 4MD8E 5A9UA 5G6VA 4P90A 3AC8A 1WFCA 3RPVA 4A9RA 4C3PA 3O71A 3ZM4A 4FSNA 3GENA 4KKEA 4G3FA 2UW8A 2OKRA 4KS8A 5BYLA 2XNEA 2C0OA 4NM7A 2R2PA 5EDPA 3Q5IA 4PDSA 3LFSA 1UKHA 2XM9A 4YHJA 1PXKA 5FEDA 4KS7A 4M14A 3VRZA 4FEXA 3A8WA 4L53A 4DH5A 2VWVA 1BL7A 4JR7A 2JFMA 3RCDA 3ENMA 3EQFA 2HENA 5A4QA 4JRVA 1XWSA 3OROA 4PMPA 1XH9A 2W5AA 3LXKA 3D83A 4W8DA 4BZDA 2W4KA 4QP1A 4G3GA 4CT2A 3SXRA 4OTWA 4QMLA 2WZJA 4J71A 4FKIA 3RZFA 3NAXA 4BDJA 3QD0A 3MIYA 5FG8A 4CZYB 3G9NA 4RFZA 4PF4A 3ORZA 4OTGA 4QO9A 4RG0A 2BILB 2XKDA 3W2RA 5KBQA 5M4UA 4O83A 3S3IA 4YHFA 3K5UA 4M12A 5HTIA 3UP2A 2J5EA 4II5A 3DAEA 2ZB0A 3GGFA 3M11A 4HJOA 4HVHA 1IAHA 5B2LA 2H8HA 3GCSA 2CKQA 1BLXA 4JBVA 4U6RA 3SGCA 4QMTA 3LHJA 3A7GA 4IWDA 5KZ0A 4FKWA 4IZYA 3DK7A 2FO0A 4EH3A 5CAQA 1Z9XA 2XIZA 3PIZA 4C58A 5E9EA 4FNYA 4YNEA 5FDPA 2R3JA 1OL6A 2X2LA 4OTDA 5BVKA 5HG9A 2VTJA 4ACGA 2XF0A 4CYIA 4NFMA 3QTIA 2BR1A 1RW8A 4FKVA 4MXCA 4XRLA 4XG2A 5HICA 4D0XA 4O7YA 1YDRE 4AU8A 4WG3A 4ITJA 2EU9A 3QAME 2PZRA 4YTIA 2HIWA 5FTQA 1H1SA 2EXCX 2GTMA 3BEAA 4FTIA 1NT2A 3ZUTA 4FSZA 2Q0BA 2I6LA 2JBOA 4J52A 4I5HA 2CJMA 4D2SA 4RJ6A 1YDSE 2HZ4A 3ANQA 4USFA 4BYIA 5HO6A 2ZM3A 1PKDA 3BYMA 4G31A 3KEXA 4KSQA 4MXXA 3MN3A 4LYNA 3VULA 4ASXA 3NVMB 2VZ6A 3MGYA 2PVKA 1KE5A 3BKBA 4GG7A 5CLPA 4EOQA 1OL2A 5HORA 2J0IA 3KCKA 4UMUA 3RVGA 1FPUA 4FUYA 1FQ1B 4QNAA 4FR4A 2UW0A 4QP4A 4DFZE 4C4HA 2R7BA 3PLAE 5ANEA 4O81A 4RJ8A 4Q5EA 3LMIA 3R02A 5AV4A 3DBDA 4IVAA 5EQYA 4D28A 3ZC5A 1V1KA 2Y4PA 5CSPA 4FV9A 1ZMWA 5H3QA 3PJ3A 4S33A 3EHAA 3WARA 4O7ZA 4E5AX 4RX7A 4JI9A 5AAEA 4WD5A 1H0VA 5KUPA 2XP2A 3VHKA 5CYIA 3GU6A 4X2KA 3ZFMA 3QF9A 4CTBA 1UVRA 3OBGA 4F9YA 3PG3A 3U4UA 4WHZA 5AP6A 5HOAA 3TM0A 4CFFA 3W8LA 3DU8A 4M15A 3PXZA 3BQCA 3R2BA 4IJPA 4JR3A 3ZZWA 2WQEA 1OZ1A 3NNUA 2IVUA 3D2KA 5JQ8A 2FH9A 4UYNA 2C5OA 1AQ1A 1M17A 2Z7SA 3DFCB 3PA5A 4GYIA 4YJRA 5T68A 3PRIA 2VTMA 2BDWA 3H9RA 4Y73A 1Q8UA 1UV5A 1ZXEA 3U51A 4EOSA 1JKSA 1WVXA 5ETIA 2JBPA 1FGIA 3OCGA 2PULA 3EN7A 4LG4A 1T45A 5FXQA 4L6QA 2ZOQA 2J9MA 3LLTA 2IW6A 5A6NA 4UALA 2QOFA 2ZV2A 3L8PA 4UWBA 2AYPA 2ZAZA 1GY3A 2Y6OA 3NLBA 3RCJA 3EFWA 5HX6A 5IA0A 3AC1A 4XG4A 5IQFA 2B55A 4GFMA 4Z55A 4GG5A 2VO0A 1H25A 3IQ7A 3DK6A 3OCSA 3PZHA 4TL0A 2EVAA 2E9VA 4KBCA 4S34A 5HNGA 5HBJA 3KC3A 2C6MA 1ZYSA 4C62A 5EYMA 3NNXA 3QA8A 5FP5A 4I6BA 5AX3A 5GJDA 2XEYA 2B9IA 2XYNA 4CZUA 4QP8A 4OGRA 3TV6A 1O6KA 3UOLA 3OF0A 2VNWA 3VW6A 2OK1A 4CMTA 4RSSA 3SAYA 5BPYA 3DBFA 3NCZA 2H34A 4ANLA 1Q4LA 2YCSA 3F82A 3VUMA 3KXMA 4EQUA 4EQMA 3VAPA 4FTKA 3SQQA 3WILA 5EI8A 4ZMEA 3FMEA 5CF4A 4ZZMA 4MXAA 4EOPA 3LCOA 3QALE 4QNYA 1PW2A 3BYVA 1H01A 1Z5MA 2WQBA 4F0FA 5CEKA 4YLLA 3U9NA 5CF8A 5CASA 1WAKA 5C01A 3QLGA 4E6AA 3L8VA 4CTCA 3PJ1A 3VS1A 2YM5A 3EQHA 3OOMA 2GQSA 4EBWA 2ZVAA 2HW7A 2OZAA 4Y46A 2XNMA 2JC6A 4L00A 4B6LA 4FZDB 3NUYA 1ZMVA 3EIDA 4C35A 4NT4A 5IDNA 5HD7A 4G34A 4B4LA 2YLFA 5DEYA 3QKLA 2VTQA 2JLDA 5I0BA 4KA3A 3IDPA 1PXNA 4EZ7A 4FE2A 2PVHA 2W1FA 4ZMFA 5FLFA 3LM5A 3WZDA 4RLLA 4Y8DA 3ZUVA 3I79A 3KREA 2XEZA 3HUBA 4QMOA 3FZRA 3JUHA 3ZLSA 1H26A 5IG1A 3RZBA 2BAJA 4CSVA 4GFGA 4QYHA 4WNOA 3T9TA 4XNEA 5KMNA 2QG7A 3VUKA 3WZUA 3WI6A 2A19B 4YJOA 2XIKA 3TG1A 4FTQA 2Y6MA 5IH4A 3P7CA 5D1JA 3QQGA 2CHLA 4KIOA 3V5QA 2XBJA 3Q04A 4PP9A 5CU3A 5CVGA 3TZMA 4L8MA 5L3AA 2OZAB 4ZLZA 3SC1A 3G33A 5IUIA 5CNOA 3UNKA 1SNUA 4OBQA 4AA0A 3D9VA 3H0YA 4OTFA 4QT1A 1GNGA 2F4JA 1FMOE 5EW8A 5M55A 2YZAA 3GNIB 3UNZA 3MDYA 5AMNA 3RI1A 1KE7A 4GYGA 4FVQA 5CENA 3QQLA 3K5VA 4U8ZA 2X9EA 4FSTA 3H30A 3BU3A 1Q99A 2NP8A 4F7JA 4APCA 5J9ZA 3MVHA 1KV2A 3R7UA 3ULZA 4GVJA 3S2PA 3TZ8A 1ZRZA 5J95A 3TZ7A 4C57A 2I0YA 4L52A 5AA8A 5HVJA 3QL8A 3RK7A 3SV0A 4FOCA 4IB1A 3ORMA 4BBMA 4G3DA 4A06A 2RG5A 5L4QA 4R5SA 2JKOA 4AF3A 4OUCA 4RQKA 1DI8A 2CCIA 3R9HA 4ZS4A 3FQEA 3C4ZA 5M4FA 4YBKA 4ZIMA 4YLKA 1CMKE 4QQCA 3NYXA 1J1BA 3A61A 3P78A 5A14A 5I3OA 2J0LA 3R8VA 2WTKC 3OEFX 5AAFA 4GJ2A 1WBSA 5J8IA 2CDZA 4R3CA 3ZLWA 4BFMA 3H0ZA 2BHEA 3BYSA 4ZZOA 4FSWA 5LVOA 5CEQA 1NY3A 4IZ5A 3NIEA 4RA4A 4N0SA 4WSYA 3VWAA 2BZIB 3JYAA 5KMKA 1H1WA 4FL2A 2C3JA 2ZV8A 3G2FA 4GV1A 3QTSA 1P2AA 3F5XA 5H8EA 3QCSA 3BGQA 5BMMA 4ANQA 3IECA 4E7WA 3KXXA 3P4KA 2WO6A 4YJPA 4ZTRA 3CEKA 2HELA 1Y8GA 5E91A 3FMDA 3K3IA 4XG7A 4FV8A 3F9NA 3DOGA 5TKDA 3CCNA 4HYIA 4G9RA 1ZZ2A 2Q0NA 3UP7A 1VYZA 2ACXA 2YAKA 4IAIA 2VTLA 1OMWA 3NYOA 4BCMA 3AD6A 3PXFA 5KX8A 2OJIA 4OAVB 3O23A 2C1BA 2VGPA 3VS0A 5LOHA 3BHHA 2NO3A 4RIWA 4O7VA 4W4VA 2R3NA 5HG5A 5L2SA 4AW2A 3LIJA 2ITQA 4FKRA 3WOWA 1WBPA 2UW5A 1F0QA 5DR2A 4EQCA 4CKRA 3HMNA 4RRVA 4U79A 1Q3DA 3ZM9A 1XBBA 4YTHA 4P7EA 3IOKA 2WU6A 1Q3WA 4AN9A 2QOKA 4GMYA 3VS4A 3UE4A 4YPDA 2C6KA 5M51A 2QOBA 4OTRA 4F4PA 2CNUA 5D10A 1VYWA 4E4NA 3DT1A 3NCGA 3WE4A 3IDBA 3QRKA 5IMXA 2XJ1A 5ITAA 3UOJA 3HRBA 1BI7A 4RC3A 5E1SA 3UODA 2OZOA 3DKFA 4JBPA 3MH2A 1H8FA 3DK3A 4FBXA 1Q24A 3QXOA 4AA5A 5AA9A 4IADA 3EYHA 3TDWA 2EXEA 3RK5A 4AGCA 3PVBA 5GJFA 3GCUA 3KXHA 2JKMA 3QD2B 4MQ1A 3V51A 3WYYA 4RIWB 1LPUA 4QP6A 4AZSA 3DTCA 2OIBA 4LOPA 3VQHA 4CMUA 5CQWA 5DNRA 2VX3A 4D4RA 4EUUA 2PMNX 4N4SA 3UC3A 2HZ0A 3PE2A 5HG7A 4IWOA 1Q62A 4Y95A 3UZPA 3C5IA 4GEOA 3FUPA 4MWIA 2C6EA 5CVFA 5CWZA 2YACA 5FD2A 3PVUA 3RKBA 2XNGA 4RX8A 4CFWA 4UV0A 4IQ6A 4E3CA 4WKQA 5ETAA 3MA6A 3PE1A 2YIXA 5HCXA 4WO5A 4FL3A 1V0OA 4A4XA 4GT4A 4LUDA 1PJKA 3AC3A 4FOBA 4KIPA 4JAIA 1KOBA 1PY5A 4HYHA 1IASA 2ZM4A 3B8RA 5HGIA 4MF0A 2A4LA 4QTDA 5HVYA 2PE0A 2V7AA 3F5PA 3PY1A 4GT3A 2CN5A 1TQIA 4U80A 3FHIA 4G3CA 3ZSGA 4CV8A 3BGZA 5IISA 5J7BA 3CSVA 3NUPA 3BBTB 4XJ0A 3A7IA 1YWVA 4FYOA 1H1RA 1Z57A 1B39A 3HP5A 4BHZA 4H36A 3WF7A 1QCFA 4HCUA 3VC4A 5A3XA 3RHKA 1W84A 3P1AA 3NAYA 2PVMA 4Z9LA 1WVWA 1PMEA 3NRMA 3R7GA 5CAPA 3PTGA 4FKGA 3KCFA 4HCTA 4CQGA 5CEOA 4O7RA 1APME 3T3UA 2P2IA 5D9HA 3DZOA 3QTUA 4M84A 5I3RA 5M09A 4YPSA 5IPJA 2C6OA 2XNOA 4WG5A 3HMMA 5FP6A 5KHWA 2QOIA 4LUEA 3NGAA 3MWUA 2UW6A 3TTJA 4EHEA 4IDTA 5DT3A 2J0JA 2X7OA 4DEBA 3ROYA 5CZHA 5AUVA 5LVMA 1YQJA 5LVLA 3V8SA 3ZC6A 3PSBA 2UZNA 3QQFA 2OH0E 5J5SA 3DBQA 3O96A 4IJ9A 4M0YA 2BFXA 3R2YA 4GRBA 2XKFA 4QPAA 3KRJA 1UU3A 4JNWA 5IF1A 2WTIA 4C61A 4ZTMA 1UU7A 4DFLA 1M52A 5EHLA 5DYJA 2WXVA 3ACKA 4IW0A 3LCKA 1YOLA 4J97A 4NUSA 3KULA 4BIDA 5H9BA 1H1PA 2IZSA 1GIHA 4TZRA 2E9UA 5BX0A 5IQEA 1XH7A 5EQEA 4AP7A 4EBVA 2W5BA 5ANJA 3IKAA 4TRLA 2GPHA 3G90X 4RWLA 2OO8X 3DPKA 1YXXA 4J53A 2XZSA 2ZYBA 1UNGA 4HPTE 4BGGA 4CYJA 3R63A 4M67A 4NEUA 2X7FA 1W0XC 3PZEA 3AQVA 3MVMA 2BPMA 4EZ5A 1SVGA 2YIRA 3LFDA 3W16A 1UNHA 4FX3A 4O7NA 3VUHA 3C51A 1GIIA 3IGOA 4BZOA 4FT7A 1A06A 1UNLA 4Z3VA 4AZEA 4ZTLA 4ZLOA 3FEGA 2C4GA 5C26A 2IZUA 3O51A 2BTSA 3UDBA 3MVLA 5CTPA 4DEHA 4F09A 2VAGA 4RWJA 2E9NA 2VN9A 4X3JA 5M08A 1OI9A 3GC7A 3GU8A 4BCNA 2OG8A 3ORNA 1QMZA 4BI0A 4YTCA 4DA5A 4AZWA 3MW1A 2PUIA 4MKCA 4D2TA 1XR1A 3V3VA 4EKKA 4JIAA 3UO6A 3I6WA 3HEGA 4PMTA 4PTGA 5FM2A 5HNBA 2C5XA 3KULB 4FKQA 4NM0A 1M7QA 3ZYAA 2QOCA 3DJ7A 4AUAA 2XJ0A 4XBRA 2EB3A 2OXYA 3KVXA 4RT7A 3HGKA 3QZGA 4KIKA 2OFUA 3EQBA 3BLQA 3I5ZA 3PIYA 4DFYA 4ZTHA 2A2AA 4JS8A 4XV1A 5JT2A 4ARKA 3H4JA 5EDQA 4IVBA 2NRYA 3QC4A 2CN8A 3UIMA 3HA6A 4F1MA 4O0TA 4IACA 4J8MA 2UVYA 2VO6A 3BBWA 4QMQA 3R7EA 2A0CX 4ZXTA 2QI8A 3A4PA 1BKXA 1DS5A 1OIYA 3F2AA 4HNIA 4F7SA 1BX6A 3RTPA 4I41A 3IG7A 4HGLA 3WZKA 5JRSA 4TNBA 4Q2AA 3AGLA 1WVYA 5EYDA 1DAYA 4TTHB 3B8QA 2R3GA 2A1AB 4RVTA 5E8ZA 2YCRA 4A4OA 4DFXE 2JIVA 2X8EA 3KN5A 3O8UA 3ZSHA 4YZ9A 2WTVA 4IX3A 4O0YA 2ZMCA 4AN2A 2WPAA 2RIOA 4DH3A 3UVRA 2UW9A 4NU1A 1OIQA 1SVEA 3IO7A 4YGAA 2W96B 3W33A 1Q8YA 3LFQA 5HCZA 3VS5A 4C3FA 5GIPE 3QD4A 3R0TA 3A99A 1IG1A 2WTDA 3VJNA 4KIKB 5DH3A 3REPA 1U5QA 2OF2A 5GNKA 5IA2A 2QKRA 2BROA 2F7XE 2BDJA 4E73A 3DJ6A 3UG1A 2PY3A 5DRBA 2Z2WA 2OW3A 3ZDIA 5FBOA 1JVPP 2X6DA 3OXZA 4K77A 5AM6A 1OBDA 4NCTA 2H6DA 3L1SA 3W10A 1RE8A 2OBJA 4FV5A 3DLSA 4U97A 2QG5A 3LQ8A 1YXVA 4DGLC 4QP7A 3RPRA 4XP2A 5A4LA 1JWHA 2ESMA 2CKPA 3EQRA 5LMAA 4ZK5A 4XOYA 2VGOA 2BIYA 2JIUA 5HD4A 4UB7A 4Y5HA 5J79A 3WF6A 3RPYA 5D7VA 5KBRA 2WEIA 3NW7A 5AR8A 4FKUA 5HBHA 2CNVA 1CSNA 3HV4A 4DEAA 5C4KA 4V04A 4C4IA 3E5AA 1UWHA 3OD6X 5HBEA 4ACMA 4C38A 1UU9A 4KABA 3KQ7A 3CJFA 3GC8A 4J95A 1YHWA 5TE0A 5JGBA 2AC3A 2XCHA 3BPRA 4CCBA 4C4JA 3UBDA 2YM6A 3DDPA 2IW8A 3E3BX 2B9JA 2YA9A 2IG7A 3PXKA 4S32A 4ASDA 4ITHA 5AV3A 4K18A 4WNMA 5L8LA 1OUYA 4E4MA 3VO3A 3QCXA 4XOZA 4AGWA 1ZY5A 3G6HA 2XNBA 3DTWA 4FSQA 5K3YA 4FT5A 3OS3A 4I4EA 4HVSA 2YABA 4BWKA 3HA8A 3S95A 3PVGA 4MD9E 3CD8A 4O38A 3A62A 3NDMA 5ICPA 4O21A 4FTJA 3FWQA 1PXMA 3FY0A 5TO8A 4BWXA 3MBLA 1J7LA 3CY2A 1U5RA 3DA6A 3HV5A 4D9TA 2VTOA 3COIA 4JDIA 3U9CA 3OOGA 3A60A 1I09A 3LXLA 3QX4A 1URCA 4KRCA 4L3LA 1KE6A 3U55A 4RBLA 2YDIA 2VX0A 3KXNA 2HWPA 3MPMA 2ITZA 4HGEA 4DGMA 2WNTA 3W2OA 3BELA 3RAKA 2GHLA 2O3PA 5KKRC 1H1QA 3HDMA 4ACCA 2JDOA 2DQ7X 4NSTA 1U4DA 3MH0A 3GT8A 4FG8A 2P55A 3FXWA 4PNIA 3W2PA 5A46A 1TQMA 4BI2A 3ETAA 4AW1A 3F5GA 5T6KA 3LPBA 3DXPA 3LOKA 2XMYA 2F57A 3CJGA 4G9CA 3E87A 3EB0A 3OC1A 4J7BA 1YWNA 4Y85A 4HNFA 4BRXA 5EDRA 4ZSJA 4K6ZA 3C9WA 3F2RA 2BAKA 3KRRA 4RJ4A 2XNPA 4L46A 3ZTXA 5E1EA 2DUVA 4X7QA 3Q9YA 1YKRA 1S9IA 2BCJA 3POOA 4YZNA 3FE3A 3CGOA 4AE9A 4XCUA 4LMNA 2XIXA 3LCTA 4FNWA 5IDPA 4I5MA 2KTYA 3OW3A 4FSMA 4I4FA 1NA7A 4BWPA 4Z16A 2WOUA 2BMCA 2R4BA 4CRLA 5BYZA 5L2IA 4FI1A 3E7OA 4FNZA 2VUWA 4ASEA 3W32A 3HV7A 4DINA 5LXMA 2IVSA 3RHXA 3G51A 3UIUA 4ID7A 5EHOA 3CIKA 1RQQA 3Q60A 2R3IA 4PMSA 3UO5A 3G6GA 3AC5A 3GCQA 2UW4A 4TW9A 3QUEA 4DG2E 4LV8A 1KOAA 5K9IA 2WTWA 3EYGA 5J5TA 3QBNA 2PVFA 5M44A 2IJMA 4ZJJA 4XEYA 5IQBA 3OWLA 4HYSA 2BDFA 4LMUA 3BHVA 4BIBA 5EI6A 1OPJA 3NZ0A 5JGAA 4EEVA 2VTNA 3KMMA 4BDDA 3R9OA 4XH6A 3RNIA 2HCKA 5D41A 4K1BA 4YC8A 5AIRA 5HU9A 3GP0A 2OJGA 2I0VA 3WE8A 3K54A 4QQTA 2WTKB 4O6EA 3VS2A 3HKOA 4Z7HA 2OF4A 3ROCA 5KMLA 5ACKA 2VTRA 3LXNA 4F9AA 3CTQA 2GNJA 3CY3A 4DTKA 2EWAA 2F49A 3FJQE 5HKMA 3UMWA 2X1NA 4A07A 3QRUA 4MVFA 2A27A 4ASZA 4D1XA 3HRCA 4Z7GA 4YLJA 4HVDA 4IX5A 1GOLA 2V0DA 4JBQA 4C37A 2R3FA 2WQOA 1REJA 3HLLA 2QKWB 5IUHA 4BCFA 1L8TA 4MNFA 4PWNA 3JR1A 1G8SA 3C0HA 3Q9WA 2IVTA 3AD5A 4JG8A 2LAVA 2VWZA 3LM0A 2J2IB 3QLFA 2IW9A 2OJ9A 4O0WA 4CCUA 4FMQA 3C0IA 1YWRA 1TVOA 2UZUE 4BZNA 3PXQA 3O7LB 5LVPA 3EJ1A 1JPAA 4YHTA 4I92A 3FHRA 4LRKA 1J7IA 4O7LA 1GZ8A 2XK6A 3A8XA 3DKGA 3C4CA 4MCVA 4P2KA 4I21A 4CXAA 2W9FB 3P7AA 3PUPA 4O22A 4EYMA 4K2RA 1OL5A 4E26A 5F94A 5TF9A 5M57A 5C03A 3E8EA 5IU2A 3ORPA 2ZB1A 4QYEA 2R3LA 3ORXA 4QYGA 5EM5A 4AN3A 4FT3A 2GNLA 1WZYA 4NH1A 4FIJA 2ITYA 3HMPA 5KNJA 4EK5A 3EQGA 2VNYA 3P79A 3C7QA 5LWMA 3KA0A 4NW5A 4IAKA 2UZWE 3RJCA 4X3FA 5FWKK 5EFQA 3OT3A 4WBOA 5LMBA 4IAFA 3FLWA 4NJDA 1WBNA 3ZO2A 3QYZA 2VTAA 5CEIA 5C8NA 1LP4A 1P5EA 1WBVA 4IZAA 2XK3A 5EH0A 4C3RA 5CVHA 4PNKA 4DEIA 5FDXA 2R3PA 5CI7A 3OCTA 2BAQA 1PYXA 4DG0E 2QOLA 2WHBA 2BUJA 2R0IA 3IK3A 2JGZA 1G8AA 1LEWA 2W4JA 4AG8A 2C6IA 2X0GA 1R3CA 2Y8OA 1R39A 3MTLA 4CEGA 1BUHA 2QOHA 2W7XA 3I7BA 3ZEPA 4PY1A 4RJ7A 3UNJA 1K3AA 5E8VA 3CBLA 5AP7A 4RVMA 5TOZA 4C36A 5GZ8A 4NCTC 4ZOGA 4QTEA 4WRGA 3LXPA 2QR8A 4J1RA 4DCEA 3LFEA 3SLSA 3GOPA 3JXWA 4BHNA 2IVVA 2RSVA 2JDRA 2GNFA 5TT7A 4ZY5A 2WMRA 5JK3A 1SYKA 1NW1A 2G9XA 3WZJA 3S1HA 3MS9A 4AOIA 4X3FB 4B0GA 4KD1A 4YNOA 5FUTA 4ENYA 4AFJA 4GK4A 4UBAA 1KE8A 5EQPA 2QHNA 1XHAA 4KKGA 4BDKA 4TN6A 4K0YA 5DE2A 5F4NA 4E4XA 3ZS5A 4W4YA 4Q9ZA 2QU5A 5K4JA 4X21A 4RFMA 3TT0A 2RFEA 5AFVA 5ANIA 3PY3A 3NUSA 4KB8A 3VBYA 3FQHA 3QTXA 3HNGA 4KUJA 4RWKA 3KRLA 4GH2A 4CFUA 2VTPA 1OBGA 4X0MA 1OITA 5IA1A 1F3MC 3EFJA 3FMKA 3VNTA 3P23A 4JJRA 1OKWA 2XJ2A 1U54A 3QX2A 5JFSA 2YEXA 3II5A 3ZUUA 4QMUA 3D5WA 2B7AA 1CM8A 4BBEA 4BR3A 4I22A 1G3NA 1CTPE 3D7TA 3KKVA 4DC2A 1Q8ZA 2YWPA 5GZ9A 5BNJA 3CTJA 1WBTA 3FZTA 2HOGA 4M66A 5HCYA 4E4LA 1LUFA 2UV2A 1ZMUA 4FV1A 3UIBA 2JAMA 3QC9A 3TUDA 4YMJA 4C4GA 1H28A 3AT3A 4I20A 2BRGA 3FPMA 4DGGA 2X8DA 5E92A 4M97A 4XP3A 4YZMA 5AX9A 2XK9A 2HZIA 4WRSA 5I9XA 3ULIA 4U3YA 1UA2A 2HXLA 2J5FA 4O0UA 3WYXA 4RGJA 3E62A 1GAGA 3BGPA 4AX8A 4MYGA 2FUMA 4UMRA 2O63A 2VU3A 4QP3A 5A4CA 3I0QA 2ERKA 5EYKA 3F69A 1I44A 4Q9SA 4K9YA 5JZJA 4EOMA 4QMPA 3O50A 5CEPA 4O6LA 4LL0A 4O7TA 1YXSA 5KMIA 5HVKA 1ZZLA 4YP8A 1XQZA 1Y91A 1R0EA 1U54B 3QGWA 1YW2A 2B1PA 4BCHA 2CPKE 4GS6A 4I3ZA 3ET7A 5DI1A 4BDEA 3D7TB 4BCIA 5I9WA 4B9DA 5E8YA 2YZLA 5EOBA 3LQ5A 2X2MA 4DH7A 5DN3A 4A9YA 3FKOA 1MQ4A 4H3BA 2CKEA 2AC5A 5F20A 5EW9A 5H2UA 4NIFA 2PVJA 3OY3A 4TNDA 3R7VA 3W2SA 3U8WA 2ZV7A 5IMEA 3K2LA 2YERA 2VWIA 3PJ2A 2FA2A 3NNVA 4JIKA 4X2GA 2XKCA 3NYNA 3PY0A 3FZOA 4M0ZA 4B8LA 5BUIA 3ANRA 4FEWA 5IQCA 5F9EA 4PQNA 2C0TA 3Q52A 2J0KA 3ODYX 5FEQA 3DDQA 3LVPA 4E1ZA 4IWPA 2ITPA 2HY81 2G1TA 3JY9A 4DN5A 3HAVA 3FLYA 3COKA 4FTNA 3EWHA 4TY1A 4QMYA 4MWHA 5CY3A 2WD1A 5HIBA 2JIIA 5CT7A 5BVDA 2W1HA 4G17A 1SNXA 3PA3A 3QRIA 3R73A 4DITA 1U46A 2G01A 2JDSA 2XK4A 3LJ2A 1XH4A 4ZTSA 1WCCA 2C5NA 2OSCA 3Q32A 4IIRA 3FMMA 2WKMA 4L43A 4MXOA 5AUTA 5JSMA 5FQDC 4E6CA 4EHZA 4NIFB 4Y83A 2CKOA 3RALA 2Z7LA 1JKKA 2E2BA 3LE6A 4L42A 4EL9A 4OTPA 3Q2MA 3RPSA 4JXFA 4Q5HA 4U0IA 3P9JA 4BB4A 5M06A 1Q41A 2OJFE 4RLKA 3HUCA 1R1WA 3B2WA 3SOCA 3VS6A 4DYMA 2W1IA 4CGAA 4NL0A 3DQWA 4U7ZA 5HE1A 4AOTA 3MFTA 4RIYA 2Z7RA 2RGPA 1ND4A 4BF2A 3KGAA 3PWYA 3U6IA 5EM8A 4GW8A 2IZTA 5T3QA 5KE0A 4ALVA 4LRJA 4F7LA 2J50A 4FC0A 2C3IB 4FZAB 3FKNA 4W4WA 3BHYA 4CD0A 4BY9E 2W0JA 4GIHA 2PZ5A 1KE9A 5AR7A 2ETMA 4AAAA 4AS0A 1QPDA 3MFRA 2W05A 4BICA 3D14A 3FI3A 2ZJWA 2PZPA 5E8UA 2YM4A 2YFXA 4YJNA 3VBWA 4S2ZA 3PXYA 2BKKA 3LFBA 2UUEA 3AMBA 2GS7A 3CLYA 4IEBA 5CSWA 2UZBA 5EHYA 5C8KA 5IZFA 1CKIA 3BLRA 4FKTA 3W8QA 3ZDUA 3IDCA 1REKA 4WIHA 2ETKA 3OEZA 4O1PA 5BUJA 3U54A 2JFLA 4TPTA 3I6UA 4BDHA 2WMXA 3FSFA 4G16A 2ERZE 4AWIA 1P4FA 2YITA 4HZRA 4RIYB 4EKLA 2WGJA 3ORLA 4D4YA 4DEGA 4IAAA 1WBWA 2OWBA 4NZWB 4IB0A 4OBPA 5AV1A 5CNNA 4G1WA 1R0PA 1ZARA 2CNQA 2BHHA 4FV6A 4IDVA 2EXMA 4YC3A 3GQIA 4IFCA 2I1MA 2PZIA 4R6VA 2O8YA 4AT4A 1IA8A 4EORA 3EMGA 1OM1A 2G2IA 4X3FC 3G0EA 4FTOA 5JMSA 4IX4A 2W1ZA 3LFAA 4XG9A 4RJ5A 4ZY4A 4X2FA 2I7QA 3UQFA 2I40A 2QC6A 2RFSA 1YOMA 1ZOHA 3Q6WA 4M7IA 5HX8A 5LQFA 2JITA 4MAOA 3BEGA 3W2QA 1W83A 4C34A 5AR2A 3NNWA 3QTQA 4ANSA 1XBAA 3C50A 4OT6A 5CSVA 3TZ9A 4YZCA 1Q61A 5IQGA 1PXLA 4MNEA 3M1SA 4CLIA 5IA3A 5CAVA 4IH8A 4AXAA 3JVSA 4C4FA 2B53A 4A9TA 1JKTA 2XS0A 4NYEA 2WMSA 3G0FA 1QPJA 3LW0A 4NWMA 4DH8A 5BVEA 2C1AA 3HMOA 1XKKA 4FGBA 3R8MA 1JSVA 5DFPA 2DS1A 4CNHA 4FYNA 1XBCA 3PYYA 4GIIA 2PL0A 4FK3A 4WA9A 3CC6A 2ZDUA 5KMOA 3FMNA 4QRCA 3RK9A 2ITUA 2PPQA 3MV5A 3Q4UA 4PL4A 3U6HA 2NNWB 3HMIA 3GUBA 1VZOA 3VS3A 3JY0A 1AD5A 1WBOA 4JDHA 4R1VA 2X2KA 4JQEA 4QYFA 2R9SA 4DAWA 3MY5A 4ZSGA 4C33A 4LI5A 2HXQA 5D12A 4OTQA 3PJ8A 4MEDA 1PXPA 3BWJA 2VV9A 1BL6A 3DB8A 4EK8A 2HAKA 4BKYA 3GC0A 5E8TA 2PWLA 3N4TA 4NM3A 1OL1A 3PRFA 5B0XA 3WZEA 4EH2A 4EK3A 4IC8A 4M69B 3EZVA 3ERKA 4MH7A 2PUPA 4MXYA 3N9XA 4MD7E 5KKRB 4E93A 4UZDA 2YWVA 4H3QA 4QMMA 1SM2A 5JFXA 2QQ7A 4FIEA 4MNEB 3AT4A 4ZTQA 3RP9A 2X39A 4GCJA 4OTHA 5I9VA 2GQRA 3M2WA 2XVDA 2DYLA 2GFSA 5HESA 4XP0A 3ZOSA 5FXSA 3RM6A 1M7NA 2V7OA 3OG7A 4UYAA 4EOKA 5AP1A 3A2CA 3EFLA 3VBXA 1UWJA 1W82A 4PPAA 3KMWA 4FTUA 3U4WA 1O6LA 1PMUA 1IEPA 3FMHA 5AUYA 1V0BA 4AQCA 4ORKA 3EN5A 2RFNA 1QL6A 1OL7A 3EN4A 4GVAA 4U81A 4FIGA 4DG3E 4EH6A 3H9OA 3R22A 4UMTA 3SHEA 2J90A 5AUXA 4BGQA 1YXUA 1MUOA 2BTRA 5AR3A 1NVQA 2F2UA 2XRUA 3KK9A 3R1NA 3BI6A 3VHEA 3W18A 4D2PA 5IQHA 5CF6A 2UVZA 4MBIA 3GI3A 2GSFA 2EB2A 2W99B 4ZS0A 5ETCA 1PXIA 5AUUA 1ERKA 4CKJA 1KWPA 2GNGA 5HLPA 3V04A 3GEQA 1KUTA 1WMKA 2J7TA 4UMPA 2UZOA 3TKIA 5BMSA 4MQ2A 5I9YA 5H8BA 4LOQA 3D5VA 4ALWA 3F3VA 4CZTA 1ZYCA 2ITVA 5HLWA 3F7WA 2C5VA 4AOJA 3D2IA 3EZRA 5AV2A 4WNPA 3SVVA 3ZFXA 2X6EA 2C69A 3DKCA 3EOCA 4IZ7A 3R9NA 4QP9A 3IW8A 3HV6A 4I5CA 4KKHA 3R7IA 3WF9A 4F9WA 4X2JA 4RIOA 1IRKA 4IAZA 3UYTA 4PRJA 4FZFB 5AEPA 3V6RA 4O96A 4LV5A 3LMHA 4QQJA 4RFYA 5JQ5A 1FINA 4LGDA 4DF3A 5HLNA 4G3EA 3V5JA 3C0GA 3ENHA 4D58A 3D5UA 5KO1A 3FDNA 2YM8A 4GK3A 4WUNA 3I60A 4EZ3A 4CFMA 3VRYA 2H96A 5KZIA 3ZRMA 3LZBA 4S31A 4TXCA 5DR9A 4E6QA 4ZSAA 4KWPA 4CG8A 1FVVA 2JKKA 4FG7A 2OICA 2WIHA 1YI3A 2QU6A 4O2ZA 2VX1A 2X4FA 4G5PA 4I93A 3VUDA 4IWQA 5EKNA 1H0WA 4TWOA 4BDGA 3DBCA 5FM3A 4C2WA 3GVUA 1GZNA 3Q9XA 4FIHA 2WELA 4FZ7A 3QHRA 4JAJA 2WQMA 3F61A 4BCGA 2UZTA 3DQXA 1GZOA 1Q97A 2BIKB 5HNIX 5LWNA 4U40A 4K11A 3VN9A 2WEVA 4L44A 1O9UA 5FRIA 2OXXA 3DB6A 4B8MA 4QP2A 3SG9A 3P7BA 3V8WA 3UTOA 4O84A 4D5HA 3PFQA 3FQSA 1QPCA 2W1DA 2W1GA 4AGUA 4BN1A 2QO7A 2HZNA 2WTJA 3DGKA 1T46A 2C3LA 4W8EA 4XG6A 2IO6A 3AG9A 4FODA 1B6CB 4O0VA 3L8SA 4A9SA 4CFNA 4LGGA 5CI6A 3TJDA 5C27A 2O2UA 2QR7A 4NFNA 4UMQA 5JFVA 2OFVA 3VVHA 3RGFA 4GSBA 1YDTE 4FIFA 4LQMA 1S9JA 3DV3A 5AP5A 5IA4A 1ZOGA 1ZAOA 4TWPA 2JAVA 3T8OA 4RIXA 4FT9A 1OIRA 2BZKB 5E4HA 3FI4A 5ACBC 3IW6A 3ALOA 3E93A 2OIDA 4I1ZA 3RWQA 4BTJA 3OTVA 1GZKA 4PL5A 3MH1A 3VQUA 2BZJA 1O6YA 4FVPA 3OTUA 2GNIA 4FIIA 3EFKA 4EH7A 5HEZA 3I5NA 4KRDA 1M2PA 3CQWA 3IONA 4APPA 4IM2A 5M4CA 3OHTA 4G5JA 2PMOX 4F65A 1ZLTA 2OGVA 3QWKA 4U5JA 5HQ0A 3Q4TA 4BKJA 4DH1A 4XBUA 3FLNC 3PJCA 4FTCA 2PTKA 3C4EA 4U44A 2W06A 3GU4A 3QU0A 3SX9A 3SW7A 3NMUF 3O7LD 5AAGA 5DLSA 3QCQA 2JDVA 1LR4A 2QO2A 4DT9A 3C13A 3I81A 3QTZA 2BZHB 4F1TA 3TUBA 1VJYA 1DAWA 3FV8A 4M13A 4RWIA 2WMTA 3EH9A 2YM7A 4GT5A 4AT5A 4U43A 3CR0A 3DXNA 5BYYA 3ZEWA 4FTLA 4RZWA 3OT8A 3T9IA 3UJGA 2CGWA 4L9IA 3TIYA 4D0WA 3ZO4A 4RIXB 3FI2A 4I6FA 5CU0A 4YTFA 5HTCA 5CQUA 2P33A 2X7GA 4FSRA 5TR6A 3QWJA 4OBOA 4XMOA 4PMMA 2IPXA 4RVLA 5K0KA 4KAOA 5IEVA 2XCKA 2FB8A 3BRBA 2WMQA 3I0OA 1IR3A 4YZBA 4F6UA 3QD3A 5A4EA 1DM2A 4ZEGA 5BVFA 2R3OA 3NYVA 4ZZNA 1JOWB 4IXPA 2R3QA 5IA5A 3E8DA 3RMFA 3V5WA 2JEDA 4AE6A 3V5TA 3N4UA 3F3TA 1VEBA 4N6YA 2E9PA 4XUFA 4ZSLA 5CXHA 3FKLA 3Q96A 1CKJA 4FTAA 2GMXA 4BCKA 2F7ZE 4FV7A 4I6HA 2BRHA 3CS9A 3OZ6A 4EC8A 5IQAA 1J1CA 4R3RA 5J9LA 3QKMA 3NPCA 4C8BA 2C6LA 3S0OA 3PPZA 3SDJA 4BGHA 4UXQA 5J87A 5GZAA 1Q5KA 3G9LX 4F0GA 1L3RE 3F6XA 5DT0A 3VUGA 4UXLA 4H58A 5EOLA 4LRMA 4B7TA 2J4ZA 2B54A 2CSNA 4MBLA 5J7HA 3F7ZA 4DT8A 3MA3A 4LL5A 4ZP5A 4D2VA 2E9OA 4J99A 3C4XA 3QZFA 3PSCA 2W5HA 4IB3A 5I9UA 5CAUA 2IWIA 4IE9A 5ANGA 5LARA 4FV0A 4L68A 5AR5A 1MRUA 1TQPA 2UZLA 5K4IA 4TYGA 4O86A 4JQ7A 4EWHA 4AGDA 5KCVA 2YIWA 4R7BA 4ZJIA 3F2NA 3POZA 2FSOX 3G5DA 3ZXZA 1KV1A 4BCJA 3R01A 4QMZA 2QURA 4DGNA 1CDKA 4O2PA 4TWNA 5KHXA 3H3CA 3KFAA 3H10A 4AW0A 3HVCA 4V01A 3F3UA 3QCYA 3CP9A 4BI1A 2XH5A 1Y6BA 3JS2A 5ANDA 4M8TA 5E8XA 4OR5A 5EM6A 4BBFA 3VBVA 4G2FA 3R1SA 4RX5A 3ZZEA 4XLVA 4YZDA 2PU8A 4GL9A 4KIQA 3O17A 5KMMA 4L45A 4L3PA 3RAHA 2PMIA 3FPQA 3ZSIA 5CEMA 4IX6A 2XA4A 2BALA 3KU2A 3EQPA 4D55A 4DTBA 4DE4A 3TNHA 3ALNA 5JKGA 1R78A 3FMJA 4DLJA 4GJ3A 4EJNA 3BV2A 1ATPE 1P14A 3CE3A 2OLCA 2R0UA 4F64A 3D15A 3C4FA 4CFXA 4CQEA 3ITZA 3TACA 3W1FA 2QNJA 4IAYA 5LCKA 5JEBA 2XB7A 3CKXA 1JAMA 3FLSA 4EYJA 4PP7A 5FTGA 4OW8A 1MRVA 4WUAA 4TWCA 4H39A 5HE3A 3CTHA 5CXZA 2PVNA 4DFNA 3IPHA 4F9BA 2BVAA 4DEDA 2R3MA 2H9VA 1GJOA 4XG8A 2W1EA 5C1QB 3NR9A 1IA9A 2UVXA 4E5BA 4MTAA 1Y6AA 4L7FA 4AW5A 1H08A 5EM7A 5CS6A 3RM7A 3WF8A 3HV3A 5J9YA 5JFWA 2PVYA 3GU5A 5EYCA 3P5KA 4I0TA 4C02A 3BX5A 4HVGA 4O7WA 4U45A 3HYHA 2XBAA 3DS6A 3EQDA 2J6MA 2Z02A 4JX3A 3FL4A 1M2RA 1QPEA 4TYHA 4FTMA 4IBMA 2GS6A 4O0RA 2V5QA 3V5LA 2PVLA 2G2HA 4H1JA 5JH6A 3UVQA 3AMYA 4W4XA 3TIZA 4PDPA 3Q2JA 3WIGA 4BKZA 1KSWA 3NIZA 2P2HA 4CG9A 2GHMA 3V5PA 3WIKA 2FVDA 1OPKA 2C47A 3AOXA 1XH6A 3TUCA 4B99A 1CKPA 2KULA 3H9FA 4KNBA 5L6PA 5FBNC 5DR6A 3LLAA 3MPTA 1RJBA 1AGWA 2WMAA 3L9PA 2QHMA 5FTOA 3F3WA 4XHKB 1JKLA 2WB8A 3TL8A 2PYWA 3MB6A 3QHWA 5AP2A 5HE0A 4HGSA 5DOSA 3HDNA 4N70A 2B9HA 1ZY4A 4TYIA 4ENXA 5BQ0A 2EUFB 3OW4A 1ZWSA 3PP1A 3TN8A 4QQ5A 2QOQA 2P3GX 5L2WA 3ZRLA 1K9AA 2RF9A 3BQRA 2FGIA 1YVJA 2YN8A 4TYHB 5DPVA 2BKZA 4O1OA 2GDOA 4TKSA 2V22A 4QMSA 4WSQA 4HZSA 3PSDA 3LKMA 2REIA 1MP8A 5HO8A 2BRMA 4XX9A 1NXKA 2V55A 4MX9A 1JLUE 1E1VA 2XRWA 4QYYA 3F88A 1H24A 2QLUA 3KXZA 2W4OA 1SMHA 3F5UA 2PVRA 4JVGA 4PL3A 5E90A 4A9UA 3VJOA 4D5KA 3S00A 4X6QC 4JG6A 5I4NA 2R3HA 3QA0A 2VTTA 3B2TA 3PPJA 3MPAA 2O64A 4YC6A 1OKZA 4UEUA 4BCQA 3OCBA 4D4SA 3E64A 3AXWA 3AC4A 2CLXA 5AR4A 3UG2A 2Z60A 4FUXA 2VWYA 4QTBA 4F63A 2VWXA 3GBZA 2ZM1A 4FK6A 3D94A 4FKLA 4FV4A 3UO4A 3VBQA 3L9LA 5KMJA 5AIKA 3LQ3A 1OB3A 2QCSA 2JD5A 4BC6A 2W9ZB 5K0XA 4C59A 4XV2A 3ZHPC 2GTNA 3C1XA 1M2QA 3KRWA 4W9XA 3I7CA 5IUGA 3QFVA 2WMBA 2HK5A 3DNEA 1HCKA 4Y72A 3HZTA 4USDA 3UMXA 3CPCA 3Q4CA 4JG7A 1H00A 3NX8A 4NKSA 4V05A 4RVKA 3L8XA 2QOOA 2VO7A 3NWWA 1FOTA 4XLIA 3QGYA 4PTEA 3NSZA 3FYJX 2IZRA 3RAIA 5B7VA 3HX4A 3GCVA 3V6SA 3QQKA 3RWPA 4DLIA 5LCJA 4NJ3A 4F0IA 4ZJVA 4FVRA 5HZNA 3PWDA 3QRTA 5AADA 2OIQA 4R8QA 3MJ2A 3BHUA 5CSHA 5DG5A 3FYKX 4G6NA 4JT3A 4JDJA 2BRBA 2RFDA 4U9AA 4FV2A 5DHJA 4R7IA 3BE9A 4O27B 5AM7A 4UX9A 4GUBA 5L6OA 1XH8A 1V0PA 2OI4X 3EQIA 4LM5A 3UIXA 4DFBA 4TYEA 2FSMX 2O65A 3O2MA 1Y57A 1OGUA 3BE2A 3ZLXA 1EH4A 4IB5A 5E8SA 5HU3A 4GK2A 1YOJA 1YI4A 3O8TA 5DA3A 4BDFA 3GOKA 4PV0A 1FMKA 3TV7A 1HOWA 1GIJA 1UU8A 4P4CA 5I5ZA 4L67A 3E63A 4W9WA 3G15A 2OXDA 2C30A 3ORIA 4A7CA 3ODZX 3DKOA 3V01A 2GU8A 3AD4A 4EHVA 1J91A 3OWJA 3PPKA 3DBEA 5BVWA 4XYFA 5CALA 4UWYA 3R8LA 3SRVA 4JLCA 2VRXA 5CF5A 3Q5ZA 2NPQA 2B9FA 1B38A 3IGGA 3NW5A 4FKSA 5EW3A 2JDTA 5HTBA 3PP0A 5A4TA 3EN9A 3L9NA 3E8NA 3TXOA 2P0CA 3KY2A 4IMYA 5A54A 1E9HA 4BCPA 3PDTA 3LFFA 1IAJA 5HHWA 4PDYA 3DNDA 1ZOEA 2ITXA 4UN0C 3R6XA 4O7SA 4FSYA 4I0RA 2R64A 3QTWA 3TKUA 2XNNA 4HW7A 5HIEA 2LGCA 1DI9A 4YJTA 4BDIA 5CU2A 4OTIA 2G2FA 4P5QA 3S4QA 3CGFA 5L2QA 4CMOA 2VTHA 3ATSA 4M3QA 4I23A 4FEQA 3ZU7A 4DEEA 3VBTA 4XS2A 3FI8A 2B52A 4BYJA 3AT2A 1BYGA 3FAAA 3MY1A 2UW7A 1XJDA 2GHGA 2CGUA 3R21A 4YUQA 5FXRA 4N6ZA 2WU7A 3A7FA 3LMGA 2HYYA 3KVWA 2R7IA 3WF5A 5M07A 1YI6A 3RBWA 5EKOA 4I5PA 3SRVB 4N57A 3ZXTA 1ZYDA 1MQBA 3NVKI 2JKQA 2V62A 3EKKA 3HP2A 2R3RA 4OAUC 3QUPA 5IKWA 3TI1A 4AACA 2WFYA 4HCVA 4BDAA 4BDCA 1FBNA 4EJ7A 3R1QA 5BVOA 5EI2A 4EONA 4YJQA 4XRJA 3D4QA 3W2CA 4JX7A 4EH4A 3BCEA 4V0GA 1PXOA 3DCVA 5DWRA 3ZBXA 4EHGA 2F7EE 4JL9A 3LFCA 4YJVA 3ZBFA 3FC2A 4BTFA 5IQIA 2W1CA 3GB2A 3IW5A 4O0XA 4RA5A 1F5QA 2ITOA 5HE2A 4C4EA 4YR8A 1XO2B 3THBA 3K3JA 4R77A 5AUZA 3T3VA 3R9RA 3MFSA 3TTIA 3R8UA 3FLZA 2YLEA 4NW6A 3VUTA 3E3PA 4QMXA 4FSUA 3UOKA 3SD0A 2CCHA 5JRQA 3CD3A 3BU5A 3OWKA 2WIPA 2GCDA 3HECA 3A7JA 4NTTA 1NVSA 3A7HA 4YO4A 4ACDA 4MBJA 4FICA 3EL8A 2CGVA 4CFVA 4EC9A 3DFAA 4FTTA 2RKUA 3NUUA 3OUNB 5CAOA 4FGRA 2GQGA 1H4LA 2X8IA 4J96A 3COMA 4LGHA 4RC4A 4RMZA 5JZNA 4EOOA 4R3PA 4GKIA 2Y9QA 3EL7A 5C9CA 3PA4A 4XG3A 3LJ1A 4HPUE 4J98A 3UOHA 5M56A 3LAUA 2WMUA 5CT0A 5DT4A 5H8GA 4AZTA 3DY7A 2XK7A 5IH5A 2QONA 3ORKA 4LFIA 4V0GB 3M42A 2Y4IB 3P0MA 1NVRA 2GS2A 2J51A 3AC2A 5I9ZA 5IH6A 4EH9A 5IEYA 1PYEA 3FXXA 4YSJA 1JSUA 1Q8TA 4EWQA 3KK8A 3R8PA 1SZMA 2ZMDA 3NEWA 4IVDA 4K33A 1XH5A 2UZDA 4F9CA 2YCFA 2ONLA 2YJSA 3ZH8A 4MK0A 4NKAA 4C7TA 1FGKA 2QLQA 4ZSEA 3HRFA 1JQHA 4CLJA 5LMKA 2X9FA 4GUEA 2I0EA 2PE1A 4D1SA 1W8CA 2XUUA 3QQUA 4USEA 3NS9A 3OXTA 5CU6A 2PUNA 3SW4A 2ITTA 3WBLA 5CANA 3E92A 3TDVA 4AZFA 1UKIA 3MYGA 4G6LA 3MY0A 1LEZA 4EK6A 2YISA 5K5NA 3FMLA 4I24A 4L3JA 4FZ6A 4BDBA 3UC4A 4CT1A 2XM8A 5A6OA 2G15A 4M69A 4QPMA 4EH8A 3FZSA 3TWJA 1PMVA 2UZEA 2Z7QA 3QKKA 4ONAA 4S30A 4R78A 3I1AA 2DWBA 3AGMA 5ANOA 3UGCA 2O0UA 3NUXA 4ERKA 3F66A 5F1ZA 3NUAA 3EN6A 3QRJA 2YM3A 5HIDA 4A4LA 4ZLYA 4I94A 4RJ3A 3MIAA 4M68A 4WG4A 3VIDA 3UYSA 2VD5A 4AT3A 2YCQA 4RQVA 4FEVA 3BHTA 3BV3A 3DAJA 3KF4A 3Q3BA 4JRNA 4F7NA 2XK8A 3KN6A 3R30A 4EH5A 3KB7A 4EOIA 4RC2A 3O8PA 4R5YA 3V8TA 3EQCA 2ZV9A 4HGTA 2F2CB 2CLQA 4MF1A 4D9UA 4QMNA 2RL5A 2QVSE 3I4BA 4K8AA 4YURA 4ITIA 2Q83A 3LJ0A 5EK7A 4OLIA 4TT7A 3VF8A 2PSQA 1G5SA 3E8CA 2P4IA 3IW4A 2YIQA 2C0IA 1PF8A 1MRYA 5CZIA 4D4VA 4F08A 2YDJA 4BTKA 3ID6C 5AP4A 3GC9A 2OJJA 1JBPE 5CX9A 4ANOA 4R1YA 4HVIA 3FZ1A 4BIEA 3NW6A 3E88A 4P5ZA 2XKEA 1FVRA 2WTCA 4AZVA 5CSXA 2ZDTA 5DRDA 4CVAA 3BZ3A 3W55A 1BMKA 2GNHA 2YDKA 3TV4A 3D0EA 2B4SB 4EOLA 4U42A 2B0QA 3Q9ZA 2SRCA 2YIYA 2IN6A 4PX6A 4DBXA 3MESA 3N51A 1JSTA 2QODA 3PG1A 4FT0A 4C2VA 4JQ8A 3MI9A 5FGKA 4GFOA 3QZIA 4AA4A 3KXGA 3KMUA 3U87A 4EOJA 3R7OA 2X4ZA 3FY2A 3IS5A 5GJGA 1PMNA 3E7VA 3DLZA 3DXQA 3U6JA 3ATTA 3BIZA 3FC1X 4XV3A 4CRSA 3KF7A 3HL7A 3MVJA 3ZCLA 2I0HA 1Q8WA 3LFNA 3MSSA 3PLSA 4KBAA 2RG6A 3MFUA 3GCPA 4WNKA 4X6RA 2VO3A 5DEWA 3MJ1A 4D2WA 3CPBA 4QPSA 5AUWA 2VWWA 2XYUA 3RPOA 2VWBA 4IM0A 4QD6A 4E5WA 3QUDA 2X81A 4G6OA 1K2PA 1PXJA 3NUNA 4WOVA 5B2KA 3ZRKA 5HI2A 1PKGA 3IOPA 2YHVA 2FYSA 5DBXA 4LOOA 1A9UA 1PHKA 5ANKA 2WOTA 1P4OA 3P08A 4QMVA 4PPBA 5IEXA 3UQGA 4FNXA 4DFUA 4YSMA 5JGDA 4E6DA 4DCAA 4DBNA 5FEEA 2W17A 1SVHA 4GU6A 5L8KA 3QQHA 5GIOE 4HYUA 4I0SA 2C5YA 2WQNA 3OUKA 4FF8A 3COHA 3ZFYA 4QMWA 1URWA 3PIXA 4FKPA 3LCDA 3L9MA 1VR2A 3OVVA 3SXSA 4MXZA 2Y0AA 2OH4A 4HOKA 2C68A 3TNWA 2PZYA 3UQCA 4YJUA 5AJQA 3ZONA 1OPLA 2AUHA 3KL8A 4BVUA 5AV0A 4GKHA 1YXTA 1BI8A 4XV9A 1YHSA 4QOXA 5E7RA 4QTCA 4ZTNA 4F70A 3OXIA 3AMAA 3R1YA 2WMVA 1U59A 3GXLA 3VS7A 2HY0A 1W7HA 2CMWA 3TCPA 3VUIA 2VWUA 3TKHA 4FEUA 3MTFA 4H3PA 5K5XA 1OKVA 5GHVA 4NM5A
chains in the Genus database with same CATH superfamily
2YAAA 4D2RA 4IM3A 3OBJA 5L6WL 4PPCA 3CXWA 3RNYA 2UZVA 3Q53A 4C0TA 4J8NA 3ACJA 3UZTA 2FSTX 2HWOA 2PUUA 2C6TA 2J0MB 3MB7A 1ZYJA 4FKJA 4TYJA 3GFEA 4JBOA 5B2MA 1J7UA 4FTRA 3QZHA 3DZQA 5AWMA 3OFMA 3OWPA 4MUQA 1X8BA 3RINA 2BRNA 3QXPA 4Y5QA 4F1OA 5GINE 4YO6A 3VW8A 4ERWA 2Y4IC 3CKWA 5LVNA 4ACHA 5J1VA 4L7SA 4H1MA 1M14A 5M53A 4UY9A 2R3KA 3SOAA 3FLQA 3BYUA 2ITWA 2PMLX 2FSLX 4IVCA 1PRYA 1OVEA 4MHAA 5AP3A 2HW6A 4ANNA 3R7YA 4X2NA 4KBKA 4CKIA 3OMVA 3R28A 1W98A 2BFYA 4JOAA 4FA2A 4BTMA 2PK9A 2X0OA 5HG8A 4O4EA 3TNQB 4QDEA 4WBBB 4O82A 5DGZA 4RZVA 3SKCA 4PDOA 3BYOA 3OP5A 3JVRA 3VF9A 3UVPA 3CQUA 4U3ZA 3ELJA 4NTSA 4NK9A 1Y8YA 2GFCA 3F3ZA 4KSPA 5L8JA 4CV9A 3ZMMA 4YU2A 1J3HA 3FXZA 3R8ZA 5LJJA 3NFGB 5M4IA 3ORTA 4ZY6A 2ETRA 4KINA 1STCE 4O0SA 3DAKA 4RPVA 2R5TA 3OY1A 3TEIA 2F9GA 3TJCA 3ZO3A 5BUEA 3UPZA 3O0GA 2WMWA 4F6WA 3GQLA 4DTAA 3BL7A 5C8MA 3C5UA 3FZPA 4IC7A 5F95A 2OU7A 3TNIA 3QTRA 3Q6UA 5CU4A 3R83A 4F6SA 5J1WA 3UPXA 1HCLA 4FL1A 4IFGA 4L01A 3TNPC 4ANMA 4WT6A 3BWFA 2WAJA 2NRUA 4PTCA 2ONLC 2Y7JA 5E8WA 3N4VA 1FVTA 3GU7A 2Z8CA 2XIRA 3PVWA 4FV3A 3R9DA 4DGOA 5DMZA 3ZLYA 5DIAA 4R7HA 3FL5A 5IQDA 4ZAUA 2PHKA 2YJRA 5LMKC 3UZRA 4QTAA 5DVRA 1G8JA 3AKKA 3HAMA 3ZO1A 4ALUA 4YJSA 2VTIA 5C4LA 5D11A 2UW3A 4PUZA 3D7ZA 4IHPA 4OT5A 4YBJA 4EK4A 3KRXA 3GFWA 5HO7A 3JPVA 4U41A 3BU6A 4DHFA 3R71A 4FG9A 4AFEA 4EUTA 1OKYA 1RDQE 2C3KA 3LCSA 3DJ5A 4EI4A 2VTSA 3P86A 4O91A 5D7AA 3ML1A 5AP0A 4E20A 3A4OX 4ANBA 4RX9A 3PXRA 4H05A 3SXFA 3SA0A 2PE2A 1OECA 1ZYLA 2ITNA 2QO9A 1ST4A 3Q4ZA 3SG8A 2QD9A 3C4WA 3IW7A 3QQJA 1A48A 1YRPA 3QYWA 5ETFA 4UZHA 1E1XA 3EKNA 4E8AA 3BLHA 3MH3A 3R00A 4BCOA 5JN2A 5EG3A 5L2TA 2XIYA 3D5XA 1JNKA 1H07A 1H27A 2O5KA 4I6QA 5G1XA 1OUKA 2CGXA 4UWCA 2C6DA 4BL1A 5BVNA 3FSKA 3RAWA 4FKOA 1YHVA 4JDKA 1TKIA 4D1ZA 3R04A 3CQEA 3FBVA 4GU9A 4F99A 1OIUA 4IANA 4MD8E 5A9UA 5G6VA 4P90A 3AC8A 1WFCA 3RPVA 4A9RA 4C3PA 3O71A 3ZM4A 4FSNA 3GENA 4KKEA 4G3FA 2UW8A 2OKRA 4KS8A 5BYLA 2XNEA 2C0OA 4NM7A 2R2PA 5EDPA 3Q5IA 4PDSA 3LFSA 1UKHA 2XM9A 4YHJA 1PXKA 5FEDA 4KS7A 4M14A 3VRZA 4FEXA 3A8WA 4L53A 4DH5A 2VWVA 1BL7A 4JR7A 2JFMA 3RCDA 3ENMA 3EQFA 2HENA 5A4QA 4JRVA 1XWSA 3OROA 4PMPA 1XH9A 2W5AA 3LXKA 3D83A 4W8DA 4BZDA 2W4KA 4QP1A 4G3GA 4CT2A 3SXRA 4OTWA 4QMLA 2WZJA 4J71A 4FKIA 3RZFA 3NAXA 4BDJA 3QD0A 3MIYA 5FG8A 4CZYB 3G9NA 4RFZA 4PF4A 3ORZA 4OTGA 4QO9A 4RG0A 2BILB 2XKDA 3W2RA 5KBQA 5M4UA 4O83A 3S3IA 4YHFA 3K5UA 4M12A 5HTIA 3UP2A 2J5EA 4II5A 3DAEA 2ZB0A 3GGFA 3M11A 4HJOA 4HVHA 1IAHA 5B2LA 2H8HA 3GCSA 2CKQA 1BLXA 4JBVA 4U6RA 3SGCA 4QMTA 3LHJA 3A7GA 4IWDA 5KZ0A 4FKWA 4IZYA 3DK7A 2FO0A 4EH3A 5CAQA 1Z9XA 2XIZA 3PIZA 4C58A 5E9EA 4FNYA 4YNEA 5FDPA 2R3JA 1OL6A 2X2LA 4OTDA 5BVKA 5HG9A 2VTJA 4ACGA 2XF0A 4CYIA 4NFMA 3QTIA 2BR1A 1RW8A 4FKVA 4MXCA 4XRLA 4XG2A 4O4BB 5HICA 4D0XA 4O7YA 1YDRE 4AU8A 4QEBA 4WG3A 4ITJA 2EU9A 3QAME 2PZRA 4YTIA 2HIWA 5FTQA 1H1SA 2EXCX 2GTMA 3BEAA 4FTIA 1NT2A 3ZUTA 4FSZA 2Q0BA 2I6LA 2JBOA 4J52A 4I5HA 2CJMA 4D2SA 4RJ6A 1YDSE 2HZ4A 3ANQA 4USFA 4BYIA 5HO6A 2ZM3A 1PKDA 3BYMA 4G31A 3KEXA 4KSQA 4MXXA 3MN3A 4LYNA 3VULA 4ASXA 3NVMB 2VZ6A 3MGYA 2PVKA 1KE5A 3BKBA 4GG7A 5CLPA 4EOQA 1OL2A 5HORA 2J0IA 3KCKA 4UMUA 3RVGA 4QDVA 1FPUA 4FUYA 1FQ1B 4QNAA 4FR4A 2UW0A 4QP4A 4DFZE 4C4HA 2R7BA 3PLAE 5ANEA 4O81A 4RJ8A 4Q5EA 3LMIA 3R02A 5AV4A 3DBDA 4IVAA 5EQYA 4D28A 3ZC5A 1V1KA 2Y4PA 5CSPA 4FV9A 1ZMWA 5H3QA 3PJ3A 4S33A 3EHAA 3WARA 4O7ZA 4E5AX 4RX7A 4JI9A 4DDIA 5AAEA 4WD5A 1H0VA 5KUPA 2XP2A 3VHKA 5CYIA 3GU6A 4X2KA 3ZFMA 3QF9A 4CTBA 1UVRA 3OBGA 4F9YA 3PG3A 3U4UA 4WHZA 5AP6A 5HOAA 3TM0A 4CFFA 3W8LA 3DU8A 4M15A 3PXZA 3BQCA 3R2BA 4IJPA 4JR3A 3ZZWA 2WQEA 1OZ1A 3NNUA 2IVUA 3D2KA 5JQ8A 2FH9A 4UYNA 2C5OA 1AQ1A 1M17A 2Z7SA 3DFCB 3PA5A 4GYIA 4YJRA 5T68A 3PRIA 2VTMA 2BDWA 3H9RA 4Y73A 1XMLA 1Q8UA 1UV5A 1ZXEA 3U51A 4EOSA 1JKSA 1WVXA 5ETIA 2JBPA 1FGIA 3OCGA 2PULA 3EN7A 4LG4A 1T45A 5FXQA 4L6QA 2ZOQA 2J9MA 3LLTA 2IW6A 5A6NA 4UALA 2QOFA 2ZV2A 3L8PA 4UWBA 2AYPA 2ZAZA 1GY3A 2Y6OA 3NLBA 3RCJA 3EFWA 5HX6A 5IA0A 3AC1A 4XG4A 5IQFA 2B55A 4GFMA 4Z55A 4GG5A 2VO0A 1H25A 3IQ7A 3DK6A 3OCSA 3PZHA 4TL0A 2EVAA 2E9VA 4KBCA 4S34A 5HNGA 5HBJA 3KC3A 2C6MA 1ZYSA 4C62A 5EYMA 3NNXA 3QA8A 5FP5A 4I6BA 5AX3A 5GJDA 2XEYA 2B9IA 2XYNA 4CZUA 4QP8A 4OGRA 3TV6A 1O6KA 3UOLA 3OF0A 2VNWA 3VW6A 2OK1A 4CMTA 4RSSA 3SAYA 5BPYA 3DBFA 3NCZA 2H34A 4ANLA 1Q4LA 2YCSA 3F82A 3VUMA 3KXMA 4EQUA 4EQMA 3VAPA 4FTKA 3SQQA 3WILA 5EI8A 4ZMEA 3FMEA 5CF4A 4ZZMA 3UDTA 4MXAA 4EOPA 3LCOA 3QALE 4QNYA 1PW2A 3BYVA 1H01A 1Z5MA 2WQBA 4F0FA 5CEKA 4YLLA 3U9NA 5CF8A 5CASA 1WAKA 5C01A 3QLGA 4E6AA 3L8VA 4CTCA 3PJ1A 3VS1A 2YM5A 3EQHA 3OOMA 2GQSA 4EBWA 2ZVAA 2HW7A 2OZAA 4Y46A 2XNMA 2JC6A 4L00A 4B6LA 4FZDB 3NUYA 1ZMVA 3EIDA 4C35A 4NT4A 5IDNA 5HD7A 4G34A 4B4LA 2YLFA 4BJJA 5DEYA 3QKLA 2VTQA 2JLDA 5I0BA 4KA3A 3IDPA 1PXNA 4EZ7A 4FE2A 2PVHA 2W1FA 4ZMFA 5FLFA 3LM5A 3WZDA 4RLLA 4Y8DA 3ZUVA 3I79A 3KREA 2XEZA 3HUBA 2XAOA 4QMOA 3FZRA 3JUHA 3ZLSA 1H26A 5IG1A 3RZBA 2BAJA 4CSVA 4GFGA 4QYHA 4WNOA 3T9TA 4XNEA 5KMNA 2QG7A 3VUKA 3WZUA 3WI6A 2A19B 4YJOA 2XIKA 3TG1A 4FTQA 2Y6MA 5IH4A 3P7CA 5D1JA 3QQGA 2CHLA 4KIOA 3V5QA 2XBJA 3Q04A 4PP9A 5CU3A 5CVGA 3TZMA 4L8MA 5L3AA 2OZAB 4ZLZA 3SC1A 3G33A 5IUIA 5CNOA 3UNKA 1SNUA 4OBQA 4AA0A 3D9VA 3H0YA 4OTFA 4QT1A 1GNGA 4O4FA 2F4JA 1FMOE 5EW8A 5M55A 2YZAA 3GNIB 3UNZA 3MDYA 5AMNA 3RI1A 4BJJB 1KE7A 4GYGA 2XAMA 4FVQA 5CENA 3QQLA 3K5VA 4U8ZA 2X9EA 4FSTA 3H30A 3BU3A 1Q99A 2NP8A 4F7JA 4APCA 5J9ZA 3MVHA 1KV2A 3R7UA 3ULZA 4GVJA 3S2PA 3TZ8A 1ZRZA 5J95A 3TZ7A 4C57A 2I0YA 4L52A 5AA8A 5HVJA 3QL8A 3RK7A 3SV0A 4FOCA 4IB1A 3ORMA 4BBMA 4G3DA 4A06A 2RG5A 5L4QA 4R5SA 2JKOA 4AF3A 4OUCA 4RQKA 4F78A 1DI8A 2CCIA 3R9HA 4ZS4A 3FQEA 3C4ZA 5M4FA 4YBKA 4ZIMA 4YLKA 1CMKE 4QQCA 3NYXA 1J1BA 3A61A 3P78A 5A14A 5I3OA 2J0LA 3R8VA 2WTKC 3OEFX 5AAFA 4GJ2A 1WBSA 5J8IA 2CDZA 4R3CA 3ZLWA 4BFMA 3H0ZA 2BHEA 3BYSA 4ZZOA 4FSWA 5LVOA 5CEQA 1NY3A 4IZ5A 3NIEA 4RA4A 4N0SA 4WSYA 3VWAA 2BZIB 3JYAA 5KMKA 1H1WA 4FL2A 2C3JA 2ZV8A 3G2FA 4GV1A 3QTSA 1P2AA 3F5XA 5H8EA 3QCSA 3BGQA 5BMMA 4ANQA 3IECA 4E7WA 3KXXA 3P4KA 2WO6A 4YJPA 4ZTRA 3CEKA 2HELA 1Y8GA 2XALA 5E91A 4AXEA 3FMDA 3K3IA 4XG7A 4FV8A 3F9NA 3DOGA 5TKDA 3CCNA 4HYIA 4G9RA 1ZZ2A 2Q0NA 3UP7A 1VYZA 2ACXA 2YAKA 4IAIA 2VTLA 1OMWA 3NYOA 4BCMA 3AD6A 4DHIB 3PXFA 5KX8A 2OJIA 4OAVB 3O23A 2C1BA 2VGPA 3VS0A 5LOHA 3BHHA 2NO3A 4RIWA 4O7VA 4W4VA 2R3NA 5HG5A 5L2SA 4AW2A 3LIJA 2ITQA 4FKRA 3WOWA 1WBPA 2UW5A 1F0QA 3NFFB 5DR2A 4EQCA 4CKRA 3HMNA 4RRVA 4U79A 1Q3DA 3ZM9A 1XBBA 4YTHA 4P7EA 3IOKA 2WU6A 1Q3WA 4AN9A 2QOKA 4GMYA 3VS4A 3UE4A 4YPDA 2C6KA 5M51A 2QOBA 4OTRA 4F4PA 2CNUA 5D10A 1VYWA 4E4NA 3DT1A 3NCGA 3WE4A 3IDBA 3QRKA 5IMXA 2XJ1A 5ITAA 3UOJA 3HRBA 1BI7A 4RC3A 5E1SA 3UODA 3W0NA 2OZOA 3DKFA 4JBPA 3MH2A 1H8FA 3DK3A 4FBXA 1Q24A 3QXOA 4AA5A 5AA9A 4IADA 3EYHA 3TDWA 2EXEA 3RK5A 4AGCA 3PVBA 5GJFA 3GCUA 3KXHA 2JKMA 3QD2B 4MQ1A 3V51A 3WYYA 4RIWB 1LPUA 4QP6A 4AZSA 3DTCA 2OIBA 4LOPA 3VQHA 4CMUA 5CQWA 5DNRA 2VX3A 4D4RA 4EUUA 2PMNX 4N4SA 3UC3A 2HZ0A 3PE2A 5HG7A 4IWOA 1Q62A 4Y95A 3UZPA 3C5IA 4GEOA 3FUPA 4MWIA 2C6EA 5CVFA 5CWZA 2YACA 5FD2A 3PVUA 3RKBA 2XNGA 4RX8A 4CFWA 3W0QA 4UV0A 4IQ6A 4E3CA 4WKQA 5ETAA 3MA6A 3PE1A 2YIXA 5HCXA 1XMMA 4WO5A 4FL3A 1V0OA 4A4XA 4GT4A 4LUDA 1PJKA 2NYAA 3AC3A 4FOBA 4KIPA 4JAIA 1KOBA 1PY5A 4HYHA 1IASA 2ZM4A 3B8RA 5HGIA 4MF0A 2A4LA 4QTDA 5HVYA 2PE0A 2V7AA 3F5PA 3PY1A 4GT3A 2CN5A 1TQIA 4U80A 3FHIA 4G3CA 3ZSGA 4CV8A 3BGZA 5IISA 5J7BA 3CSVA 3NUPA 3BBTB 4XJ0A 3A7IA 1YWVA 4FYOA 1H1RA 1Z57A 1B39A 3HP5A 4BHZA 4H36A 3WF7A 1QCFA 4HCUA 3VC4A 5A3XA 3RHKA 1W84A 3P1AA 3NAYA 2PVMA 4Z9LA 1WVWA 1PMEA 3NRMA 3R7GA 5CAPA 3PTGA 4FKGA 3KCFA 4HCTA 3UDSA 4CQGA 5CEOA 4O7RA 1APME 3T3UA 2P2IA 5D9HA 3DZOA 3QTUA 4M84A 5I3RA 5M09A 4YPSA 5IPJA 2C6OA 2XNOA 4WG5A 3HMMA 5FP6A 5KHWA 2QOIA 4LUEA 3NGAA 3MWUA 3PUFC 2UW6A 3TTJA 4EHEA 4IDTA 5DT3A 2J0JA 2X7OA 4DEBA 3ROYA 5CZHA 5AUVA 5LVMA 1YQJA 5LVLA 3V8SA 3ZC6A 3PSBA 2UZNA 3QQFA 2OH0E 5J5SA 3DBQA 3O96A 4IJ9A 4M0YA 2BFXA 3R2YA 4GRBA 2XKFA 4QPAA 3KRJA 1UU3A 4JNWA 5IF1A 2WTIA 4C61A 4ZTMA 1UU7A 4DFLA 1M52A 5EHLA 5DYJA 2WXVA 3ACKA 4IW0A 3LCKA 1YOLA 4J97A 4NUSA 3KULA 4BIDA 5H9BA 1H1PA 2IZSA 1GIHA 4TZRA 2E9UA 5BX0A 5IQEA 1XH7A 5EQEA 4AP7A 4EBVA 2W5BA 5ANJA 3IKAA 4TRLA 2GPHA 3G90X 4RWLA 2OO8X 3DPKA 1YXXA 4J53A 2XZSA 2ZYBA 1UNGA 4HPTE 4BGGA 4CYJA 3R63A 4M67A 4NEUA 2X7FA 1W0XC 3PZEA 3AQVA 3MVMA 2BPMA 4EZ5A 1SVGA 2YIRA 3LFDA 3W16A 1UNHA 4FX3A 4O7NA 3VUHA 3C51A 1GIIA 3IGOA 4BZOA 4FT7A 1A06A 1UNLA 4Z3VA 4AZEA 4ZTLA 4ZLOA 3FEGA 2C4GA 5C26A 2IZUA 3O51A 2BTSA 3UDBA 3MVLA 5CTPA 4DEHA 4F09A 2VAGA 4RWJA 2E9NA 2VN9A 4X3JA 5M08A 1OI9A 3GC7A 3GU8A 4BCNA 2OG8A 3ORNA 1QMZA 4BI0A 4YTCA 4DA5A 4AZWA 3MW1A 2PUIA 4MKCA 4D2TA 1XR1A 3V3VA 4EKKA 4JIAA 3UO6A 3I6WA 3HEGA 4PMTA 4PTGA 5FM2A 5HNBA 2C5XA 3KULB 4DDGA 4FKQA 4NM0A 1M7QA 3ZYAA 2QOCA 3DJ7A 4AUAA 2XJ0A 4XBRA 2EB3A 2OXYA 3KVXA 4RT7A 3HGKA 3QZGA 4KIKA 2OFUA 3EQBA 3BLQA 3I5ZA 3PIYA 4DFYA 4I6LA 4ZTHA 2A2AA 4JS8A 4XV1A 5JT2A 4ARKA 3H4JA 5EDQA 4IVBA 2NRYA 3QC4A 2CN8A 3UIMA 3HA6A 4F1MA 4O0TA 4IACA 4J8MA 2UVYA 2VO6A 3BBWA 4QMQA 3R7EA 2A0CX 4ZXTA 2QI8A 3A4PA 1BKXA 1DS5A 1OIYA 3F2AA 4HNIA 4F7SA 1BX6A 3RTPA 4I41A 3IG7A 1OGYA 4HGLA 3WZKA 5JRSA 4TNBA 4Q2AA 3AGLA 1WVYA 5EYDA 1DAYA 4TTHB 3B8QA 2R3GA 2A1AB 4RVTA 5E8ZA 2YCRA 4A4OA 4DFXE 2JIVA 2X8EA 3KN5A 3O8UA 3ZSHA 4YZ9A 2WTVA 4IX3A 4O0YA 2ZMCA 4AN2A 2WPAA 2RIOA 4DH3A 3UVRA 2UW9A 4NU1A 1OIQA 1SVEA 3IO7A 4YGAA 2W96B 3W33A 1Q8YA 3LFQA 5HCZA 3VS5A 4C3FA 5GIPE 3QD4A 3R0TA 3A99A 1IG1A 2WTDA 3VJNA 4KIKB 5DH3A 3REPA 1U5QA 2OF2A 5GNKA 5IA2A 2QKRA 2BROA 2F7XE 2BDJA 4E73A 3DJ6A 3UG1A 2PY3A 5DRBA 2Z2WA 2OW3A 3ZDIA 5FBOA 1JVPP 2X6DA 3OXZA 4K77A 5AM6A 1OBDA 4NCTA 2H6DA 3L1SA 3W10A 1RE8A 2OBJA 4FV5A 3DLSA 4U97A 2QG5A 3LQ8A 1YXVA 4DGLC 4QP7A 3RPRA 4XP2A 5A4LA 1JWHA 2ESMA 2CKPA 3EQRA 5LMAA 4ZK5A 4XOYA 2VGOA 2BIYA 2JIUA 5HD4A 4UB7A 4Y5HA 5J79A 3WF6A 3RPYA 5D7VA 5KBRA 2WEIA 3NW7A 5AR8A 4FKUA 5HBHA 2CNVA 1CSNA 3HV4A 4DEAA 5C4KA 4V04A 4C4IA 3E5AA 1UWHA 3OD6X 5HBEA 4ACMA 4C38A 1UU9A 4KABA 3KQ7A 3CJFA 3GC8A 4J95A 1YHWA 5TE0A 5JGBA 2AC3A 2XCHA 3BPRA 4CCBA 4C4JA 3UBDA 2YM6A 3DDPA 2IW8A 3E3BX 2B9JA 2YA9A 2IG7A 3PXKA 4S32A 4ASDA 4ITHA 5AV3A 4K18A 4WNMA 5L8LA 1OUYA 4E4MA 3VO3A 3QCXA 4XOZA 4AGWA 1ZY5A 3G6HA 2XNBA 3DTWA 4FSQA 5K3YA 4FT5A 3OS3A 4I4EA 4HVSA 2YABA 4BWKA 3HA8A 3S95A 3PVGA 4MD9E 3CD8A 4O38A 3A62A 3NDMA 5ICPA 4O21A 4FTJA 3FWQA 1PXMA 3FY0A 5TO8A 4BWXA 3MBLA 1J7LA 1U5RA 3CY2A 3DA6A 3HV5A 4D9TA 2VTOA 3COIA 4JDIA 3U9CA 3OOGA 3A60A 1I09A 3LXLA 3QX4A 1URCA 4KRCA 4L3LA 1KE6A 3U55A 4RBLA 2YDIA 2VX0A 3KXNA 2HWPA 3MPMA 2ITZA 4HGEA 4DGMA 2WNTA 3W2OA 3BELA 3RAKA 2GHLA 2O3PA 5KKRC 1H1QA 3HDMA 4ACCA 2JDOA 2DQ7X 4NSTA 1U4DA 3MH0A 3GT8A 4FG8A 2P55A 3FXWA 4PNIA 3W2PA 5A46A 1TQMA 4BI2A 3ETAA 4AW1A 3F5GA 5T6KA 3LPBA 3DXPA 3LOKA 2XMYA 2F57A 3CJGA 4G9CA 3E87A 3EB0A 3OC1A 4J7BA 1YWNA 4Y85A 4HNFA 4BRXA 5EDRA 4ZSJA 4K6ZA 3C9WA 3F2RA 2BAKA 3KRRA 4RJ4A 2XNPA 4L46A 3ZTXA 5E1EA 2DUVA 4X7QA 3Q9YA 1YKRA 1S9IA 2BCJA 3POOA 4YZNA 3FE3A 3CGOA 4AE9A 4XCUA 4LMNA 2XIXA 3LCTA 4FNWA 5IDPA 4I5MA 2KTYA 3OW3A 4FSMA 4I4FA 1NA7A 4BWPA 4Z16A 2WOUA 2BMCA 2R4BA 4CRLA 5BYZA 5L2IA 4FI1A 3E7OA 4FNZA 2VUWA 4ASEA 3W32A 3HV7A 4DINA 5LXMA 2IVSA 3RHXA 3G51A 3UIUA 4ID7A 5EHOA 3CIKA 1RQQA 3Q60A 2R3IA 4PMSA 3UO5A 3G6GA 3AC5A 3GCQA 2UW4A 4TW9A 3QUEA 4DG2E 4LV8A 1KOAA 5K9IA 2WTWA 3EYGA 5J5TA 3QBNA 2PVFA 5M44A 2IJMA 4ZJJA 4XEYA 5IQBA 3OWLA 4HYSA 2BDFA 4LMUA 3BHVA 4BIBA 5EI6A 1OPJA 3NZ0A 5JGAA 4EEVA 2VTNA 3KMMA 4BDDA 3R9OA 4XH6A 3RNIA 2ZFYA 2HCKA 5D41A 4K1BA 4YC8A 5AIRA 5HU9A 3GP0A 2OJGA 5BV3A 2I0VA 3WE8A 3K54A 4QQTA 4AXFA 2WTKB 4O6EA 3VS2A 3HKOA 4Z7HA 2OF4A 3ROCA 5KMLA 5ACKA 2VTRA 3LXNA 4F9AA 3CTQA 2GNJA 3CY3A 4DTKA 2EWAA 2F49A 3FJQE 5HKMA 3UMWA 2X1NA 4A07A 3QRUA 4MVFA 2A27A 4ASZA 4D1XA 3HRCA 4Z7GA 4YLJA 4HVDA 4IX5A 1GOLA 2V0DA 4JBQA 4C37A 2R3FA 2WQOA 1REJA 3HLLA 2QKWB 5IUHA 4BCFA 1L8TA 4MNFA 4PWNA 3JR1A 1G8SA 3C0HA 3Q9WA 2IVTA 3AD5A 4JG8A 2LAVA 2VWZA 3LM0A 2J2IB 3QLFA 2IW9A 2OJ9A 4O0WA 4CCUA 4FMQA 3C0IA 1YWRA 1TVOA 2UZUE 4BZNA 3PXQA 3O7LB 5LVPA 3EJ1A 1JPAA 4YHTA 4I92A 3FHRA 4LRKA 1J7IA 4O7LA 1GZ8A 2XK6A 3A8XA 3DKGA 3C4CA 4MCVA 4P2KA 4I21A 4CXAA 2W9FB 3P7AA 3PUPA 4O22A 4EYMA 4K2RA 1OL5A 4E26A 5F94A 5TF9A 5M57A 5C03A 3E8EA 5IU2A 3ORPA 2ZB1A 4QYEA 2R3LA 3ORXA 4QYGA 5EM5A 4AN3A 4FT3A 2GNLA 1WZYA 4NH1A 4FIJA 2ITYA 3HMPA 5KNJA 4EK5A 3EQGA 2VNYA 3P79A 3C7QA 5LWMA 3KA0A 4NW5A 4IAKA 2UZWE 3RJCA 4X3FA 5FWKK 5EFQA 3OT3A 4WBOA 5LMBA 4IAFA 3FLWA 4NJDA 1WBNA 3ZO2A 3QYZA 2VTAA 5CEIA 5C8NA 1LP4A 1P5EA 1WBVA 4IZAA 2XK3A 5EH0A 4C3RA 5CVHA 4PNKA 4DEIA 5FDXA 2R3PA 5CI7A 3OCTA 2BAQA 1PYXA 4DG0E 2QOLA 2WHBA 2BUJA 2R0IA 3IK3A 2JGZA 1G8AA 1LEWA 2W4JA 4AG8A 2C6IA 3P5JC 2X0GA 1R3CA 2Y8OA 1R39A 3MTLA 4CEGA 1BUHA 2QOHA 2W7XA 3I7BA 3ZEPA 4PY1A 4RJ7A 3UNJA 1K3AA 5E8VA 3CBLA 5AP7A 4RVMA 5TOZA 4C36A 5GZ8A 4NCTC 4ZOGA 4QTEA 4WRGA 3LXPA 2QR8A 4J1RA 4DCEA 3LFEA 3SLSA 3GOPA 3JXWA 4BHNA 2IVVA 2RSVA 2JDRA 2GNFA 5TT7A 4ZY5A 2WMRA 5JK3A 1SYKA 1NW1A 2G9XA 3WZJA 3S1HA 3MS9A 4AOIA 4X3FB 4B0GA 4KD1A 4YNOA 5FUTA 4ENYA 4AFJA 4GK4A 4UBAA 1KE8A 5EQPA 2QHNA 1XHAA 4KKGA 4BDKA 4TN6A 4K0YA 5DE2A 5F4NA 4E4XA 3ZS5A 4W4YA 4Q9ZA 2QU5A 5K4JA 4X21A 4RFMA 3TT0A 2RFEA 5AFVA 5ANIA 3PY3A 3NUSA 4KB8A 3VBYA 3FQHA 3QTXA 3HNGA 4KUJA 4RWKA 3KRLA 4GH2A 4CFUA 2VTPA 2X0QA 1OBGA 4X0MA 1OITA 5IA1A 1F3MC 3EFJA 3FMKA 3VNTA 3BL9A 3P23A 4JJRA 1OKWA 2XJ2A 1U54A 3QX2A 5JFSA 2YEXA 3II5A 3ZUUA 4QMUA 3D5WA 2B7AA 1CM8A 4BBEA 4BR3A 4I22A 1G3NA 1CTPE 3D7TA 3KKVA 4DC2A 1Q8ZA 2YWPA 5GZ9A 5BNJA 3CTJA 1WBTA 3FZTA 2HOGA 4M66A 5HCYA 4E4LA 1LUFA 2UV2A 1ZMUA 4FV1A 3UIBA 2JAMA 3QC9A 3TUDA 4YMJA 4C4GA 1H28A 3AT3A 4I20A 2BRGA 3FPMA 4DGGA 2X8DA 5E92A 4M97A 4XP3A 4YZMA 5AX9A 2XK9A 2HZIA 4WRSA 5I9XA 4JMQA 3ULIA 4U3YA 1UA2A 2HXLA 2J5FA 4O0UA 3WYXA 4RGJA