4QMUA

Mst3 in complex with jnj-7706621, 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1h-1,2,4-triazol-3-yl}amino)benzenesulfonamide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
286
Chain Sequence
GMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmuA01
2VO3A 4L9IA 3OWLA 5TF9A 5IKWA 5LVLA 1CSNA 3QTWA 3UOJA 4DCAA 1DAWA 3U4WA 3DDPA 4AT4A 3N51A 2XKCA 3QD4A 3C5UA 4ANSA 4AUAA 4E8AA 4L3PA 4FTIA 3ZZEA 1R3CA 2YZAA 4YLJA 4D2WA 2VTPA 4KS7A 4FV5A 4YJRA 4FKPA 3OOGA 4YC8A 3K54A 3TG1A 1FBNA 4KIKB 4EONA 3C4CA 1SMHA 3BE9A 3VIDA 3HMOA 3ORNA 4FVPA 2Z8CA 3Q3BA 4AA0A 2YWPA 2Y4IC 3ORLA 3HEGA 4AT5A 3BLHA 3ZFMA 4GS6A 4HW7A 1OITA 2NO3A 3PSBA 4P5QA 2V5QA 1OZ1A 4Y5QA 3RPSA 5B2KA 3R28A 3WZKA 5ANIA 2XF0A 3I1AA 4KA3A 4BDHA 4ORKA 2PE2A 2XJ1A 4BDIA 1ERKA 2OFUA 3LVPA 2A1AB 5BMSA 3ATTA 2OW3A 2JKOA 3ZC5A 1Y57A 2B0QA 4FIJA 3QQUA 3N4VA 5LXMA 2R3FA 3LJ1A 3LFSA 3VBYA 4EUUA 4PTGA 2CHLA 1CMKE 1Q8UA 3BGZA 3F2AA 4HJOA 4BKJA 1F5QA 2H34A 3FMEA 1H24A 1WCCA 2ERZE 3OROA 4JI9A 3AC8A 3TKIA 5LARA 4FR4A 4H05A 4I5CA 3IGGA 4APPA 2CMWA 4BCJA 3MW1A 4G16A 3DTWA 3DFAA 4IZYA 4I6HA 3RHKA 3RINA 1U59A 2WMBA 1WAKA 3DZOA 3ORMA 2J0KA 3SVVA 1GIHA 1HCLA 3EJ1A 3CBLA 4ONAA 3OCTA 4G31A 2A2AA 4AZFA 2GU8A 2BR1A 5IA4A 1Q8TA 4MTAA 2UW8A 2OIBA 3D5WA 5TKDA 1MQ4A 3BPRA 2BRBA 3OEFX 4NKAA 3FXWA 4J99A 4F1TA 2XNOA 3O8PA 4K11A 1QCFA 4BY9E 3G51A 3R01A 3KQ7A 3PY3A 3TNPC 4JS8A 4YZNA 5E92A 5HLNA 4GG5A 1UVRA 4WNPA 2ZB1A 2V0DA 4QMOA 3DBEA 3ZM9A 5G1XA 2R3QA 2X0GA 4UMRA 1WBTA 4M15A 3G90X 4C4GA 5CSVA 3NW6A 3R2YA 5HBHA 1VZOA 2J0IA 2PYWA 4NM0A 4CKRA 3BU6A 4EOPA 4OTPA 5ANKA 3KCFA 1BI7A 4JX7A 3UVRA 3FYKX 4CD0A 4GYGA 2HY81 3GU5A 3HV6A 3V6SA 2BIKB 4ITHA 4L53A 3A7HA 3R7UA 1R78A 2AUHA 4BRXA 4CFVA 3JYAA 5KX8A 1R1WA 3W2CA 4G3EA 5AM6A 3KRWA 3PE1A 3WF5A 5AP7A 4RIWB 5HE2A 5HU9A 4NW6A 3ZUVA 4A4LA 4LYNA 5FEEA 2ETMA 3R7YA 4C57A 4JT3A 5AV1A 1PXIA 4PPBA 3L8XA 5A6NA 5M44A 3IS5A 3G15A 3W2QA 3NW5A 2OJIA 3DT1A 1E1XA 3MH0A 2HELA 5M4UA 3EFKA 3OUNB 3UZPA 4TY1A 4X2GA 1YW2A 4WIHA 4CSVA 1A9UA 1R0EA 4AOTA 3RWQA 1PW2A 4V04A 1GZ8A 4UMPA 4YZCA 1H1PA 4G6LA 5L6OA 2OK1A 5JEBA 5AP2A 2UZUE 2OKRA 3GU4A 1Q8ZA 3QX2A 2V7OA 5IEVA 3NIEA 4EKLA 4N57A 2VU3A 1WBPA 4AW1A 4YMJA 4AFEA 1M2PA 5A14A 2OJ9A 4DLJA 5HD7A 2E9NA 4JIKA 3PVWA 3G6HA 3T3VA 2Y4PA 4K0YA 3DQWA 2F9GA 3DJ6A 2BAKA 3RWPA 1H0VA 3VBWA 3NX8A 1JKTA 3GCPA 5FEQA 5E1SA 4ZSAA 4R3RA 4WUNA 5A4CA 2OZAA 2CKQA 5J79A 3QQFA 4D2SA 4RIYB 4K2RA 4YZ9A 3KF7A 4BCQA 3LFDA 4YGAA 5CI6A 4MVFA 4XG2A 2VO0A 3ENMA 1WBOA 3HP5A 2F7ZE 4BKZA 4JAJA 3UYTA 5HG5A 3A99A 4QP9A 1H1SA 2WELA 4GEOA 4U44A 2RFNA 5C01A 4L43A 3S3IA 3VJOA 5D10A 5IF1A 4ZZOA 4RVKA 5DRDA 4HVHA 4UX9A 2PTKA 5AJQA 4BGHA 5M4CA 3QBNA 4FV4A 4G9RA 4QTCA 1BL6A 2CGUA 5D41A 3TZ8A 4FYOA 2FVDA 2ZDUA 2VGOA 4J7BA 4ALUA 2QO2A 2R7IA 4BN1A 2CGVA 4ANBA 4YHFA 4KINA 3CGFA 3UOLA 2G15A 4U9AA 5K3YA 4PL5A 4G5JA 3RGFA 4L68A 3REPA 1UV5A 5GZ8A 4Y95A 4QMQA 3VQUA 4IXPA 4YP8A 4BICA 5H8EA 4FT7A 1OECA 4HVIA 4EOMA 3AOXA 4BDAA 1OL2A 3V5QA 2GDOA 3QKKA 4MNFA 1GAGA 3M1SA 3JXWA 3QXPA 5HI2A 4V0GA 1PXNA 3OCSA 3W2RA 1IAJA 5FP5A 2KULA 3O17A 2YISA 2WD1A 2YITA 3A7IA 3PPKA 1PHKA 4L67A 2RGPA 1ZYJA 4YBKA 3R8MA 4DFZE 2OWBA 3IDPA 4NZWB 4HVSA 5ETFA 4W4WA 4YJUA 4AG8A 2VAGA 5I9XA 2XUUA 3F3VA 3EQGA 3SOCA 3W16A 5K9IA 2JKQA 3QYZA 3LMGA 2O63A 5AX9A 4FIEA 4A7CA 4FGRA 5BUEA 4DFBA 3OCGA 3OVVA 3DKFA 3LJ2A 3AC5A 2I0HA 4W9WA 5CASA 4I6FA 4DT9A 1RDQE 4B7TA 4E6CA 3LFCA 2WZJA 4AZSA 3MBLA 3KN6A 2GHMA 2X9FA 3DTCA 3QL8A 5ANJA 2RL5A 1TQMA 3HV5A 2CNQA 1YRPA 3OC1A 3JVSA 3GOKA 4G3FA 5FTGA 3BHTA 1PF8A 1J1BA 4WT6A 2FSTX 4I93A 2LGCA 2W99B 3D14A 3I60A 4IAFA 4O0TA 4AQCA 5BVFA 5I9YA 3UMXA 4GT3A 5CAQA 3WARA 2C6MA 3D4QA 3LFEA 2CKEA 3D7ZA 3PUPA 4NCTA 4JLCA 3KULA 3EKNA 4ID7A 5C27A 4EL9A 4BIBA 1W98A 2GPHA 2A19B 4YBJA 4ARKA 3ZLYA 4ENXA 4EQCA 1WBWA 3H9FA 5BQ0A 5ANOA 1VYWA 3FQHA 4CFNA 4RX7A 3O23A 5HE1A 3K3IA 1TVOA 4CMUA 4KKGA 5E8SA 3GEQA 4Y72A 3HLLA 3LFBA 4IWOA 3ZLWA 4E4XA 5C1QB 4HGEA 4MH7A 4O0WA 5LVNA 4M3QA 4QQ5A 4OW8A 2YIQA 2YM6A 4RQKA 5KO1A 3PFQA 5M4IA 3FZ1A 4C4EA 4YUQA 4GUEA 1LEWA 4AOIA 4FTMA 2OXDA 3TM0A 3R1SA 4IAZA 4IEBA 2WMWA 4XOZA 4AF3A 4NM5A 4O7SA 4AWIA 3GFWA 2E2BA 1O6YA 2YCFA 4ASDA 2F2CB 1QMZA 4D4VA 3AT2A 3LXLA 2C5XA 4EWQA 1WBVA 5EQEA 3IONA 4C59A 2WQOA 4O0UA 2X4FA 3HRBA 5IA5A 4TWOA 4QYFA 5CU4A 4RIOA 2W17A 4F7JA 4DLIA 4YJOA 5EKNA 4E4MA 5DFPA 3SAYA 2YDJA 3E63A 2OH0E 4N4SA 4P90A 2C1BA 4C3PA 2YCSA 3HRCA 3R22A 4HOKA 4IAKA 4YJTA 1YWRA 3ORXA 5AV2A 3RM7A 2ITPA 2WIPA 5AFVA 3IG7A 4NKSA 4XOYA 3MFTA 5T6KA 3NCGA 4F63A 3PSCA 4C4IA 5JT2A 4FIIA 1ZAOA 2ITWA 4NM7A 2E9VA 3R21A 1PKDA 3FL4A 3QAME 4I1ZA 5AUVA 5CALA 2CCHA 1KWPA 3LQ8A 3VUMA 1ZZLA 1PXLA 2XH5A 2OXXA 3P78A 4L7FA 4FL2A 4QTEA 2EWAA 3FHIA 5BNJA 1ZYCA 3TJCA 2IZTA 4GYIA 1Z5MA 4FT9A 4L52A 5DG5A 3QZHA 4FSMA 3PXZA 5AUTA 3WZUA 3Q2JA 5HOAA 4RVMA 3UO4A 3AT4A 1FGKA 4F9BA 3HMMA 1M7NA 3FMMA 1PY5A 3I7CA 1PMVA 3LXKA 3HX4A 4MXOA 3D5VA 2F7EE 3PWDA 4LI5A 1M2QA 3DCVA 4LMNA 4U5JA 4C0TA 5KNJA 1B6CB 4QP4A 2IWIA 3H9RA 3MA3A 4JBVA 5CX9A 3BV3A 5AM7A 3CE3A 2XIZA 4QNYA 2UV2A 4MKCA 1SVGA 3FYJX 3MVJA 1ZOHA 2UW3A 1M52A 1ZARA 2YCRA 4FMQA 4I24A 3FJQE 1QL6A 1JAMA 3DOGA 3BBWA 2JBPA 1L3RE 2BRHA 3DBDA 3KXGA 4OTIA 1OIQA 3QTIA 1NW1A 4DH8A 2Y9QA 2VWBA 3R04A 1OGUA 3JPVA 4J97A 5JFVA 4Y5HA 5EM6A 4ZSGA 2XBJA 3OT8A 3GCQA 3SXFA 2PMIA 5EOBA 5AV0A 5GHVA 5BYYA 2XIKA 1PMUA 4CG9A 5FDPA 5BUIA 3ZYAA 1XWSA 5DR6A 4X3JA 5CZIA 1CKPA 1XR1A 3K2LA 4EUTA 2Z7SA 3U8WA 3ZXTA 2OIQA 4BCMA 4M84A 3LZBA 5BVKA 2B1PA 3QC4A 4E4NA 2BRNA 4AAAA 4USEA 3D15A 1WMKA 3EMGA 3LW0A 4B6LA 1FGIA 1MP8A 3R9DA 2IJMA 1Q3DA 1KOAA 4G1WA 4EOLA 5A9UA 3A61A 4TYEA 3TTIA 4IC7A 2CPKE 2F7XE 3EN9A 4NEUA 5DWRA 5EW9A 5C9CA 2IW8A 3W18A 2UW7A 3BLRA 5BUJA 1UU3A 4EYMA 2BKKA 3TDVA 4U45A 2BDFA 4R7BA 2RSVA 3VUHA 5JFWA 3TDWA 4G5PA 2R3IA 5BVDA 3PRFA 4DHFA 3VC4A 3FI4A 3QLGA 4RWLA 3D5XA 3AC1A 4L3LA 5M57A 3BQRA 3OG7A 3PXRA 5CAOA 4XP0A 4QP8A 2XNMA 5F95A 2G2HA 5FD2A 1PRYA 2RFEA 2QNJA 4CZTA 3PJ8A 5KMKA 1JKSA 4M69A 3BIZA 2QVSE 2O2UA 2O65A 3PVBA 4I6BA 4OTGA 1UNHA 2WTWA 4FNYA 1G3NA 3FDNA 3AC4A 4EJ7A 4O7YA 3NAXA 4L42A 3QQJA 4F0IA 2R3JA 3CD3A 2HZ4A 4BDKA 5IQBA 3FI3A 3PP1A 4GV1A 2XMYA 3MPAA 2I6LA 4EOOA 1UWJA 5KZ0A 4IC8A 5KMIA 2YDIA 3ZSGA 3G0EA 4I5HA 2YIRA 3RCDA 3LAUA 2XNPA 4OBQA 2P2HA 4CEGA 4GJ2A 3IECA 4GK4A 5HIDA 4GU9A 4XCUA 3A62A 3QRUA 4AGWA 4B99A 4CKJA 2UW4A 3DBFA 3OY1A 4R1YA 3ZC6A 1WFCA 1NA7A 3II5A 3UYSA 4D1ZA 4E6DA 2A4LA 2BIYA 3EYHA 2XJ2A 3PA3A 4M0YA 4DGMA 4F6SA 4FEUA 4YTFA 4HYUA 4UEUA 1XH9A 3P7BA 3HECA 4MF0A 3S4QA 4F7SA 3ORPA 4YTHA 1CKJA 4MBJA 5GZ9A 3MFSA 5I4NA 4K8AA 3TL8A 3R7IA 4ZTQA 5M55A 2PMLX 3MY1A 5EI2A 4JJRA 1SM2A 4U3YA 3WZEA 2BFYA 4BDEA 2C5VA 4YHTA 4S30A 3VULA 3QRKA 2W7XA 4BVUA 1ZYLA 5CU3A 4BWXA 3V01A 2QOLA 2JIVA 2EUFB 2YIXA 4I4EA 5EYKA 3FEGA 4YTCA 3Q9XA 3UG2A 1KSWA 4W4VA 2R3GA 4LRJA 4HCTA 4MWHA 1Y6BA 5KKRB 3BRBA 3IKAA 5I0BA 1I44A 3PLSA 4GVAA 2GCDA 3OWJA 5HE0A 2WO6A 4JRVA 4IB0A 2ITVA 3UOKA 3VS1A 2IZUA 4CYJA 4RPVA 4GKIA 3ZMMA 5FP6A 4AN9A 5AR3A 5ANEA 2R3KA 3PE2A 3V51A 2PMOX 5GJDA 4OTHA 4UWBA 1TQIA 3Q52A 1KUTA 4GFMA 3Q96A 3LM0A 2UZLA 1U5RA 4PL3A 4XMOA 3QYWA 2XYUA 4O22A 2WTDA 2HYYA 4OAUC 1YXUA 4JR3A 3UC3A 4Y85A 5AA9A 1Q97A 4ACGA 2J5EA 5CAVA 4FKGA 3ZONA 4KIKA 4ZY6A 4F0GA 3UIMA 3SRVA 5HO8A 3ZU7A 3TKHA 4LV8A 1Z57A 3A7GA 4N70A 5CI7A 2G1TA 4FTNA 4BCIA 2X7OA 1WZYA 3C0IA 3B2WA 4WA9A 3VS5A 1IA9A 2XCHA 4GU6A 4MCVA 4RWJA 1MRVA 2UW0A 3TUCA 4JOAA 4JRNA 5C8KA 2QD9A 1ZLTA 2J90A 5CF6A 3RZFA 4FSUA 5HTBA 3R9NA 3F9NA 4QP1A 4BTFA 4BCPA 2XIYA 3D2IA 2XJ0A 2R3MA 4L3JA 5HKMA 3D94A 3ZRLA 1O6LA 5CS6A 3MFUA 3R8LA 4F65A 3UGCA 5C26A 4NT4A 4KABA 3HUCA 5IH5A 3FLSA 5T3QA 4FKIA 3UP7A 2VTHA 2WQEA 3EZRA 4ZSEA 4FSYA 1B38A 2J6MA 2QOFA 3PPJA 4XV9A 3MS9A 5IH4A 2W5AA 1NXKA 5HU3A 1GZNA 3Q4UA 2I40A 3F5GA 4KS8A 2XNBA 3RM6A 2O64A 3MVLA 5FG8A 4TYHA 4F4PA 2R5TA 5FBNC 3UE4A 4M14A 3Q53A 4BZDA 4FZ7A 3IDBA 3VRZA 4EOIA 4PP9A 4FBXA 5D1JA 4A9YA 4FV3A 1WVWA 3QCXA 5DH3A 4JG8A 4C7TA 3UVPA 4G17A 3IO7A 2WFYA 4PF4A 4QMWA 4CRLA 3TUDA 3NUNA 5CEQA 4QP2A 3NUUA 3KXZA 4QD6A 3OY3A 2WNTA 4JQ8A 4LV5A 3Q60A 1T46A 4LGGA 3U6HA 3BBTB 4HPTE 4Z7GA 2GNLA 1DI9A 2W1CA 3KVXA 4IB3A 4DGNA 4IVDA 4CG8A 3ZO3A 1ZXEA 2IVVA 5DGZA 2JBOA 5KMLA 4NWMA 4BGGA 3WIGA 4PUZA 4RRVA 1U4DA 2PVJA 4UXLA 4O6LA 3QZIA 3E7VA 3H10A 4EQMA 1SVEA 4L46A 5EQYA 1UA2A 4XBRA 4ZP5A 2HZNA 3I7BA 4RWKA 3OS3A 4EOJA 3E8CA 3IDCA 5EHYA 4PY1A 5AAEA 3PDTA 1JQHA 1K9AA 1V1KA 5ICPA 5B2LA 4Y83A 4QP7A 2XK4A 3OP5A 4KBKA 5IA0A 3VN9A 4JVGA 4RIWA 2UVYA 4LQMA 4CFUA 3O71A 3CKXA 4DFNA 3LQ5A 2J9MA 2VO6A 4FG7A 5AR2A 5AV4A 3OUKA 3GCSA 4QYHA 5LCJA 3HAMA 3CTJA 3F7WA 4IVCA 1I09A 1YXSA 2W05A 4R6VA 5AX3A 5HIBA 3SC1A 5CU2A 3BYSA 3TT0A 5ANDA 4RA5A 4QMNA 2SRCA 3QCYA 4ITIA 2IO6A 4S2ZA 1VR2A 2GNJA 1M14A 2WEVA 3ETAA 4KSQA 2XK6A 4DINA 3P5KA 3G9NA 2ONLC 3CTQA 1URWA 5BX0A 5LMKA 4E73A 3C5IA 3DLZA 4FA2A 3C0GA 4ASEA 3U54A 3OOMA 5A54A 2C3LA 3NYVA 3C4EA 5IMXA 4RJ3A 3WOWA 4DC2A 3D2KA 3OXTA 3ZSIA 2VX3A 2BUJA 3UIUA 2BTSA 3H3CA 1CKIA 4YJQA 5KMNA 4L7SA 4II5A 3LXPA 2BDWA 3OW4A 5JN2A 5HNBA 5HNIX 1YOMA 2X81A 5CVFA 1QPDA 4J52A 4XLVA 4BHNA 2OBJA 4S33A 4KKHA 3DKGA 1SNXA 5GIOE 4ALVA 1JWHA 2YDKA 4QRCA 5GJFA 1JKKA 4A07A 3FBVA 3FZTA 2VTMA 3R2BA 4BDCA 4RJ7A 4F9AA 5HX8A 4E5AX 2Q83A 4PMMA 4ZLZA 4F9WA 4RVTA 3QHRA 3E8NA 5EDPA 4DH1A 2OLCA 3GUBA 4F99A 2C47A 4WG4A 2BVAA 3I5ZA 5AP1A 3ELJA 1ZYSA 4EOQA 3KMWA 5L8JA 3F69A 5L8LA 4EBWA 2B9IA 3E62A 1H07A 1Q4LA 3L8VA 4U41A 1Q61A 3VJNA 1Q8YA 2DQ7X 4FUYA 2X39A 3MH3A 5CNNA 3ZBXA 3QTSA 5AP0A 4B9DA 3HRFA 2GNGA 4GVJA 2I1MA 4NH1A 4YLKA 3RK7A 3UP2A 4W9XA 4N6YA 4BFMA 5JZJA 5GINE 3Q9YA 4P4CA 3TV4A 4C35A 5AR7A 3HDMA 4O96A 4TT7A 2VN9A 2NRUA 4A9UA 4FC0A 5GZAA 4M68A 4I92A 5TT7A 5HICA 2QONA 4Q2AA 3LCDA 1GZOA 4PRJA 3CKWA 4JDIA 5JQ5A 4ZLYA 5K4IA 2C68A 4Z9LA 2QQ7A 4UN0C 4R78A 5BMMA 3LJ0A 4U80A 4R5YA 1FMOE 2UW9A 4FEVA 5EHLA 5C4LA 4TWPA 4G2FA 3S2PA 2GNFA 4OTFA 4ZIMA 3D7TB 3M42A 1WBNA 2XK3A 4KIOA 4B8MA 3F3WA 3DPKA 4QQJA 3V5WA 4DEDA 3N4TA 4KBAA 3P7AA 4CFFA 4DEHA 4ERKA 4EH6A 3UNKA 1ZMVA 4IANA 2ITTA 4QMXA 4CZUA 4YZMA 2XKEA 3LFFA 4O0SA 3AMAA 3UQGA 4EH7A 3KB7A 1H1WA 2C4GA 3QD2B 2YLEA 2BTRA 4MD8E 5HCXA 2GMXA 4KIPA 4TNBA 1VJYA 4MXCA 2HWPA 4KB8A 2NP8A 3KEXA 2PVMA 3PLAE 4XUFA 3KRXA 3PYYA 1U46A 2GS7A 3QTZA 3WF7A 5AEPA 3NSZA 1V0BA 3DJ7A 3HV4A 4EH4A 2I0EA 4RA4A 1KE6A 3MI9A 2YHVA 3OWKA 4E26A 4UBAA 4YO4A 4FKQA 4W8EA 4AE6A 5J95A 2VTRA 2H96A 2P2IA 3FHRA 3HA8A 4LUEA 2WTCA 3O7LD 3OTVA 3SGCA 3I4BA 4BYIA 3G0FA 2OU7A 1SZMA 5CAUA 3F5XA 2C69A 3JUHA 3SLSA 4FV8A 1WVXA 4IIRA 5AWMA 3OTUA 5CEPA 3TJDA 1LPUA 1XJDA 3LPBA 4AX8A 3PXKA 4DFXE 5CSWA 1Q41A 2W06A 1AQ1A 3ZDIA 2REIA 2YIWA 3HZTA 3NR9A 3R02A 2XK9A 3PG3A 4FTOA 4MXYA 5E8UA 3I6UA 4NFNA 2HIWA 4GKHA 1XBBA 4L6QA 3QQLA 4TKSA 3RMFA 5M08A 3GC8A 4D9TA 2XM8A 3NAYA 4IAYA 2J7TA 2XNGA 3F66A 1J91A 3DAJA 4MQ1A 5CNOA 4F0FA 3OHTA 3RHXA 2ZMCA 1ZRZA 2KTYA 5D7VA 3DNDA 4ZSJA 3U6IA 4GG7A 1ZY5A 5E4HA 2C5YA 4W8DA 2HXLA 1XKKA 4D2VA 2Z7LA 1PXPA 1XBAA 4I6QA 3MB7A 4PWNA 4CT2A 2C5NA 2RF9A 4I22A 3DK3A 1BX6A 3AQVA 3I0OA 4FNXA 4KWPA 5JRSA 3C50A 5IQAA 2YLFA 2ZV9A 4FSZA 1DS5A 3QFVA 4AFJA 3C0HA 2BMCA 5CQUA 3VQHA 5CSPA 1FOTA 4X0MA 2E9PA 4FZAB 4ZTSA 2J0LA 4DAWA 4YJVA 2WMRA 5JQ8A 3GQLA 3HV3A 3I6WA 4ACDA 3DXPA 1SNUA 4ZY4A 4EI4A 5BPYA 3QCSA 4U8ZA 4ANOA 4F9YA 4GH2A 5TOZA 2BRGA 3VWAA 4H3PA 4R8QA 3ZSHA 3G33A 2XA4A 3HKOA 4H3BA 4AGCA 2WQNA 3P08A 4AA4A 1ND4A 2XEYA 3NYXA 2WHBA 3MH2A 1PYEA 4F70A 3QQHA 4CZYB 3VF8A 1ZOGA 2B9FA 2R9SA 4BDFA 3Q9WA 4BTKA 1IEPA 2HY0A 3OW3A 2WQBA 4UWCA 3W10A 3AC2A 2ZM1A 3CXWA 3DA6A 4FKUA 4NTSA 4YSMA 2VWVA 3F88A 5ACKA 3R9HA 5IMEA 2FA2A 2Z7QA 2VTSA 3AD6A 3F2RA 4UXQA 3ZZWA 4XX9A 5KMOA 3EIDA 4GL9A 4LOPA 4QPAA 2E9UA 4F1MA 3HV7A 3PXFA 4N6ZA 1RE8A 4QYYA 2R3LA 3QD3A 5CT0A 3BCEA 4GK2A 4J95A 1OL7A 2W1EA 4NJ3A 5IDNA 2W5HA 1PMEA 3RALA 4LOQA 2AYPA 5CEMA 4G6OA 3EFWA 1KV2A 5FUTA 2X2MA 5LCKA 4I3ZA 3NNVA 3TKUA 3E3BX 4Q5EA 4YC3A 1YXXA 3ZBFA 1FVTA 3RPOA 4UMTA 1NT2A 3MTFA 3O7LB 4NU1A 3FL5A 3KC3A 4EK8A 3OD6X 5KUPA 2FYSA 1XH8A 3VS6A 4D5KA 2CKPA 3W8QA 3ZRKA 2RIOA 4EKKA 3GQIA 3LCTA 3UODA 5E9EA 1OKVA 2UZNA 5JRQA 2ZJWA 4CCUA 2YCQA 3BEAA 4O2PA 1OPLA 4KSPA 3MPTA 1E1VA 3MV5A 1PXKA 4LGDA 5CSXA 4E7WA 3D5UA 4DBXA 1GOLA 3LIJA 4TYJA 2PE1A 4HGLA 4MNEB 4G3CA 2HWOA 4ZLOA 4RX5A 3KF4A 4O0XA 4X2FA 4B8LA 3QZFA 3V8SA 5KKRC 3QA0A 1DI8A 3P9JA 5FWKK 5IG1A 1YKRA 2R0IA 3WF6A 1YWNA 3LMHA 1S9JA 4LL0A 5AV3A 4KAOA 4AT3A 3CSVA 4GRBA 4CLIA 5EYMA 2W9ZB 4KUJA 4YZDA 3ODZX 3UJGA 2CNUA 5FRIA 3B2TA 3R00A 4Z55A 5HLPA 3DLSA 2JKMA 1NVSA 3FLYA 3MA6A 4LFIA 3U9CA 4CLJA 4MD9E 4WSYA 2V55A 4A9RA 2Q0NA 5IU2A 4QMPA 2F4JA 5FGKA 1JOWB 5E8XA 3AGMA 1ZZ2A 2BALA 4J96A 3C9WA 3AG9A 2QKWB 3RBWA 2G2IA 4YSJA 3HMIA 2JFLA 3MPMA 3QLFA 1PKGA 2Y0AA 5EI6A 3EH9A 3A60A 3BLQA 4IB1A 3GI3A 3QTQA 3EKKA 3DFCB 5EQPA 4NSTA 3KRRA 4EJNA 3RK9A 2CLXA 3QGWA 3VUGA 3EQIA 2RG6A 5H8BA 4D9UA 4Z16A 5M07A 2VD5A 4FOCA 4ASZA 2C3KA 3R71A 2W1ZA 4IH8A 5GIPE 1APME 3PA4A 4EK4A 3GC7A 4LRKA 5J7HA 5K5NA 3NCZA 2JKKA 2WMSA 4YJSA 4DGGA 3MIAA 1JBPE 4U6RA 4QPMA 2WU6A 3UO6A 4JBQA 2OICA 2GTNA 4EHZA 3FMNA 1JLUE 5HESA 3M11A 3RPVA 3QQKA 4DFLA 4ZOGA 3EOCA 5FTOA 4PX6A 3FZPA 5HCZA 4RLLA 3IK3A 5CYIA 4BC6A 4DEBA 4EYJA 4JBOA 3ORTA 4DA5A 3GENA 4WG3A 5JFXA 4IADA 4FNWA 5CT7A 3ULZA 5M4FA 5HIEA 4E6AA 5IQCA 4M13A 2W1IA 4ZTRA 4F7NA 4RLKA 5I3OA 3VUTA 2JFMA 1BYGA 2Y8OA 3QXOA 3NEWA 3OXZA 5CSHA 2ZV8A 4RX8A 3HL7A 3KCKA 4I23A 5CVGA 3PY1A 2PZIA 4IW0A 4K9YA 5HG7A 1OL1A 4EHVA 5TR6A 5AUWA 4IVBA 1S9IA 4KNBA 4WHZA 5AUZA 4YURA 2W5BA 4GFGA 3GCVA 4XS2A 4CMOA 4QTDA 2CKOA 5J1WA 3ALOA 2JIUA 3Q9ZA 3H30A 4K1BA 3SKCA 2OFVA 5HE3A 4TWCA 3ID6C 4C2VA 4UY9A 3RAWA 3Q4TA 3RK5A 3KY2A 3DBQA 2QHNA 2PMNX 4XG4A 5AUUA 3HNGA 3P86A 4PQNA 5JGBA 1J1CA 3WIKA 2X7FA 5EDRA 3R7VA 3I0QA 2UZEA 3L9NA 2J2IB 3NRMA 5JMSA 2CN5A 2QR8A 2WTKB 4IAAA 4FVRA 4APCA 5FTQA 3KKVA 1W0XC 5HEZA 4CXAA 3PJ3A 4MK0A 5FM2A 5AIRA 4W4YA 1JSVA 4BBEA 4U97A 4Y8DA 5A4EA 4BCKA 3A4PA 2R7BA 4P7EA 3RAHA 4FZFB 1TQPA 4IWDA 3JY0A 1LR4A 3DB6A 4D4YA 4MBIA 3SG8A 2YZLA 4QOXA 4DG3E 2WMAA 3JVRA 2YM3A 3LFNA 3R83A 3ALNA 4FEXA 5ANGA 3FY0A 2GNHA 1MUOA 3EQCA 4EQUA 5H8GA 2UZVA 3GFEA 3UZTA 2GFCA 3P4KA 1GZKA 5DPVA 3WILA 3KU2A 3QUEA 3ROCA 3WF9A 4IZ5A 4DFYA 3PZEA 4OUCA 4FZ6A 4O0VA 3B8QA 2PVRA 3ZFXA 1STCE 3NMUF 2J0MB 1P5EA 2VV9A 3SQQA 4ASXA 3QWKA 4EK5A 1BI8A 4NIFB 3B8RA 3W2SA 2UZOA 3BGPA 3OCBA 4O2ZA 2JDVA 3V5TA 1NVQA 5HBJA 3ITZA 4FGBA 4ZMFA 2PWLA 3CY2A 4H36A 5HO7A 4PTEA 4I0SA 3EZVA 4EWHA 4FV2A 1JSTA 3EYGA 1KE9A 5CZHA 4BWKA 3N4UA 2NPQA 1TKIA 3I5NA 5EK7A 4RFYA 5ETAA 3OF0A 2UZTA 3HAVA 3CPBA 4E93A 2QCSA 3F5PA 4QMMA 3KGAA 4P2KA 5J5TA 4FIHA 4ZZNA 3MYGA 2HK5A 2VTQA 4BI1A 5HX6A 4PDOA 3IW7A 3PIYA 4BI0A 3UPZA 4I5PA 3V6RA 4U40A 3QCQA 1YOLA 2BRMA 2OJGA 5DEWA 2BPMA 2B7AA 2DS1A 5HNGA 5DA3A 5EM5A 2YM5A 2PULA 1YHSA 2FSLX 2PZRA 3KULB 4PV0A 3CGOA 5A6OA 5DYJA 4FEWA 4O1PA 5J9ZA 3NYOA 1YXTA 4EZ7A 1G8SA 3WI6A 1REJA 3FMLA 5FEDA 5IQEA 2OXYA 4O7VA 5EM7A 3FSKA 3UBDA 3TTJA 3MSSA 5KHWA 2VTOA 4FTJA 3M2WA 5DI1A 4ZK5A 1CM8A 4BCNA 4YHJA 5AR4A 3TCPA 5DR9A 5L4QA 4PTCA 3QF9A 3H9OA 2VRXA 4CV8A 1YI4A 2ETKA 3ACJA 3GBZA 4USDA 2OZOA 5HG9A 4RIXB 2HW6A 4F08A 3MJ1A 2PY3A 4EK3A 4BBFA 4IDTA 4FNZA 5CF4A 2Z2WA 4JNWA 2C0IA 3QTUA 3FMJA 3C7QA 3AMBA 4ACHA 1M17A 5CY3A 4I41A 4DH7A 3CTHA 3MTLA 3ZLXA 2VTAA 4ZAUA 3OWPA 1OMWA 2RG5A 3CCNA 3R9OA 4FEQA 3UOHA 4QP6A 5CU6A 5AUYA 4FSQA 1OIRA 5H3QA 2YACA 4L8MA 3AD4A 4HVGA 4JDKA 5EW3A 5KMMA 2GTMA 3RNIA 3UMWA 3UO5A 3LHJA 5CXZA 2CLQA 2GQRA 3JR1A 3EQPA 4HZSA 1Q62A 3R7OA 3V3VA 3DS6A 3PJ2A 4PPAA 4AW2A 1U54B 2I0YA 3CY3A 4HVDA 2EXCX 3MN3A 5B7VA 2IW6A 3KFAA 1PXMA 2PZYA 3L9MA 3BX5A 4HZRA 1YHVA 2GS2A 1OBDA 1R0PA 3V5PA 4AXAA 2H6DA 2IVTA 3NUXA 3KMMA 3QKLA 5TO8A 1UNGA 4FV7A 2FH9A 1F3MC 4HCUA 5IUIA 3HUBA 5E91A 1B39A 3POOA 2QHMA 5B0XA 3AMYA 4RJ6A 4ZTNA 4OBPA 2BDJA 3QRJA 2FO0A 5J5SA 4XG7A 3RI1A 3EN7A 5A4LA 2C5OA 2PUNA 3KVWA 4AU8A 4UV0A 3BEGA 3C4XA 3DV3A 1OI9A 1Y8GA 3PXYA 4FYNA 1U5QA 4TW9A 3TACA 4B4LA 5D12A 5D11A 3BV2A 3ORZA 2J5FA 2ZVAA 3AGLA 4IZAA 4CKIA 4IFGA 5LJJA 1OUYA 3PRIA 4I0TA 4PL4A 4YPSA 5DR2A 3ZHPC 2WOTA 4D28A 3NUSA 4C34A 4MBLA 3D0EA 1LEZA 5AP4A 1P14A 1K3AA 3ZO4A 4F6WA 5J87A 3LLTA 2H9VA 3LFAA 3BZ3A 3S0OA 3OMVA 3QALE 3LCKA 2C6TA 3QTXA 2QOIA 2VX0A 1CDKA 3AT3A 3L8PA 3W2OA 4FKLA 4X3FC 2J50A 4MF1A 4BCHA 1FVRA 4F09A 4ZSLA 5IH6A 5IPJA 1GIJA 3ENHA 3F61A 4HYSA 4ALWA 3RJCA 3NWWA 2PZ5A 5KCVA 2X2KA 4FV1A 2V22A 2C3JA 3FZRA 4W4XA 2CN8A 4CQEA 4OBOA 3R0TA 3FKLA 1FVVA 3BYMA 4D1SA 4D58A 5L8KA 4MXZA 4X7QA 4BTJA 4C3FA 5JFSA 5LMBA 2QR7A 3UQCA 5HCYA 3BHUA 2P55A 4JX3A 4LMUA 4RQVA 4PDYA 3EB0A 3PXQA 3WZDA 2OI4X 4RGJA 3FC1X 4RT7A 1FQ1B 2R4BA 3NUYA 3UNZA 4YJPA 1YQJA 4GUBA 3BELA 4BDGA 2VWUA 2GQSA 4Z7HA 2JLDA 1IRKA 4MQ2A 2QC6A 4FT5A 2BAJA 3OFMA 1H8FA 4M97A 3Q5IA 3C1XA 4ANLA 2XKFA 1XH5A 2OO8X 2W0JA 4H58A 4J53A 3FQSA 3BKBA 4R5SA 3SV0A 4JG6A 5KBRA 1ZMWA 3PY0A 5I3RA 3N9XA 2QOKA 2YAAA 2WOUA 3IOPA 4GW8A 3V8WA 5M06A 2FUMA 3JS2A 4JDHA 1OL6A 3DKOA 4FI1A 1Z9XA 4KD1A 5DVRA 4J71A 3EN4A 1YVJA 1YOJA 4GIHA 4UYAA 1VYZA 3R7EA 3FE3A 3LLAA 2UVZA 3F82A 3EQDA 4EOSA 3V5JA 5FBOA 3EL7A 3F3UA 4AACA 4DEEA 5A4QA 4BB4A 5C4KA 2R3OA 5CQWA 1IA8A 4FL3A 2BROA 2PVNA 3NLBA 4NJDA 5EKOA 4D0XA 3KK8A 2UZWE 3QUPA 3BI6A 3CQWA 2BKZA 3SDJA 4IZ7A 1YDSE 5AAGA 3TZ9A 3TXOA 2B53A 4EK6A 3MVMA 4AZWA 1XBCA 3RPRA 5CEIA 3EFJA 3VF9A 4CFWA 5E1EA 4BWPA 2I7QA 3C51A 3GGFA 2PVKA 3EFLA 5HHWA 5IQFA 2EXEA 4G3GA 3U4UA 3EWHA 3A2CA 3NPCA 4DBNA 3QU0A 4FVQA 4XG9A 3PG1A 5J8IA 3RNYA 2PVHA 3U51A 3FKNA 1Y6AA 2BZHB 3KRJA 2IZSA 5E8YA 3W55A 2WTJA 3CEKA 3Q32A 4OTWA 3WF8A 4TXCA 2QU5A 4AE9A 2PK9A 3ZUUA 1UU9A 4ZZMA 4EZ3A 3DAEA 5DNRA 2JAMA 2ZMDA 2VTJA 4G34A 4Q5HA 5J1VA 3PTGA 3ZLSA 4RIYA 2ITQA 2W1HA 4PDSA 3OEZA 4FKWA 5EI8A 2C6LA 4O7TA 1Q8WA 4R1VA 4K18A 3SOAA 5IUGA 1UU7A 2XEZA 4Z3VA 4RSSA 3EQRA 5EOLA 3CJGA 4ERWA 5AA8A 1H26A 3IOKA 2C6OA 2P4IA 1W7HA 3QRIA 1URCA 3VHKA 4IWQA 1H1RA 2YM4A 3NYNA 3P79A 3PPZA 4GFOA 3NS9A 5HVKA 5L6PA 4QP3A 3GCUA 4A4OA 4ACCA 4EZ5A 5AADA 5IUHA 2G9XA 1P4FA 5CAPA 2VWZA 3NVKI 2X1NA 3L9PA 4PDPA 3TV6A 4R3PA 2C0TA 4DITA 2GS6A 4WKQA 4CVAA 4MXAA 2ZM3A 1KOBA 5JSMA 2C6DA 4MD7E 4DG0E 5IDPA 2YWVA 1P2AA 2PVLA 3OZ6A 4C61A 2ONLA 3FI2A 4WG5A 5KZIA 4BR3A 3E5AA 3HP2A 4J98A 1O9UA 4ZS4A 1Q99A 2R2PA 3QHWA 3PP0A 5DT3A 3ZO1A 3VAPA 1V0OA 1YDRE 4WRGA 4BIEA 5IQIA 3NW7A 4O0YA 3OT3A 4O91A 4XV3A 4RMZA 3KREA 1NVRA 4HNFA 3VBTA 5IEYA 4C58A 4JIAA 1Q3WA 3A7FA 3FLNC 4FKTA 4RVLA 3RAKA 2ZV2A 3C4WA 2C30A 4AZEA 2WGJA 4BBMA 4C4JA 3F6XA 3SRVB 4Q9ZA 4ZS0A 3NUAA 5LWMA 4YLLA 3QA8A 2C1AA 5E8ZA 4D5HA 5CTPA 5EM8A 4EOKA 4FX3A 1IG1A 3FKOA 4C3RA 4DTBA 1BKXA 4CFMA 5BYLA 1E9HA 3E93A 2QLQA 3LE6A 2ETRA 1A06A 4IHPA 3ERKA 3SHEA 5LWNA 1UNLA 3R8ZA 3GNIB 2XRWA 4FUXA 1UWHA 4QYEA 4QMYA 1YXVA 2BZIB 3UVQA 4E20A 3E3PA 2F57A 5F4NA 3CLYA 3RVGA 4AP7A 4DH3A 2QO9A 2VGPA 3FMKA 1FPUA 4UWYA 5AP6A 2XZSA 2YABA 4S32A 2AC3A 2PUIA 4J8NA 4OTDA 4NYEA 2VTNA 4YZBA 3FPQA 5J9YA 4MNEA 4O1OA 4AOJA 3DK6A 4O27B 3SA0A 2B54A 3DB8A 2QO7A 5M09A 2WMUA 3WZJA 4G9CA 2X8EA 2HZIA 4UMQA 2IVSA 3PSDA 5IEXA 2Z02A 2CDZA 2JD5A 5K0XA 3MFRA 4TYHB 2ZB0A 2HXQA 1O6KA 3Q6UA 2F2UA 2R3PA 4WOVA 1OKWA 2F49A 3HDNA 2YJSA 4LL5A 5LOHA 2G2FA 5DOSA 3HMPA 2XNEA 4MYGA 5I9ZA 3VUIA 4WNKA 2BAQA 1JKLA 3P23A 4XBUA 4L01A 4X3FB 2ZV7A 4CMTA 2P0CA 4UALA 5CVHA 3A7JA 3P7CA 1JNKA 1KE7A 2YAKA 3FWQA 4BCGA 1J7LA 4X2KA 2VWIA 2O5KA 4OT6A 4OTQA 3V04A 5EFQA 4BCFA 1J7IA 3GU8A 4AZVA 3A8WA 5JKGA 4FKSA 4O6EA 3CJFA 2J0JA 2H8HA 3VS0A 2JDSA 3FPMA 2P33A 2Z7RA 3E87A 4GJ3A 4ANNA 5E8WA 1F0QA 2VTTA 2Z60A 2EB2A 5L2TA 5HGIA 1YI3A 4YNEA 4RJ4A 1WBSA 3NNWA 1V0PA 4U43A 2XK8A 1H1QA 2QODA 4DEGA 2FGIA 1H01A 2WB8A 2WTKC 3A8XA 3H0ZA 4IFCA 5ACBC 4DH5A 4MXXA 4C4HA 1ATPE 1HCKA 2DUVA 5KBQA 2WAJA 4D4RA 4FT3A 3GU6A 3ZOSA 2IN6A 2ITZA 3U9NA 2B9HA 4OTRA 5HO6A 4BGQA 3ORIA 4I4FA 2GHLA 3W2PA 2HCKA 4F7LA 4IMYA 3K5VA 3NDMA 2JDRA 5D9HA 4PP7A 1DAYA 3CP9A 3NUPA 5K4JA 4E3CA 3QUDA 3NGAA 1KE8A 4AW5A 2W1DA 2ERKA 2GHGA 2VX1A 4BZNA 5HLWA 2R3HA 5JZNA 4JQ7A 4C36A 3VS7A 3QGYA 4R77A 3FLQA 3MGYA 3P0MA 5EW8A 4H1JA 3DXNA 3R1NA 4TYIA 2W4KA 1ZY4A 4ENYA 2EVAA 4CRSA 1A48A 1ZWSA 3BU3A 4FTCA 4YTIA 3DDQA 3R8PA 5HORA 4ZTHA 4U7ZA 3EN5A 5DEYA 1H4LA 4CV9A 2QI8A 2X8IA 3QC9A 4ACMA 4MX9A 2AC5A 3RPYA 2BZKB 4WUAA 4BDJA 4DFUA 3T3UA 4JR7A 3ZEWA 3TNWA 5CWZA 3TNQB 2J51A 4TPTA 2UZBA 1FMKA 3BE2A 4FZDB 2FSOX 2OSCA 5IISA 1MRYA 5IA2A 4LM5A 4Q9SA 3LOKA 4A9SA 3ZXZA 4O84A 4XH6A 1XHAA 2O0UA 3KXXA 1BMKA 3PVGA 4CTCA 3LQ3A 1LUFA 3QZGA 3BWJA 3R1YA 1YWVA 3GB2A 3GOPA 3LFQA 5EG3A 3TIZA 4GSBA 3UTOA 4EH3A 5HTCA 4U0IA 4QNAA 3IW6A 4GT4A 3RAIA 5LQFA 5I9UA 2R3RA 4A06A 3HYHA 4OAVB 1YHWA 3R30A 4BL1A 1T45A 4IACA 4E4LA 1PXOA 2Q0BA 2QOCA 5ETIA 1ZYDA 4X6QC 3F2NA 4TN6A 4D4SA 3PJCA 4NCTC 4NL0A 3EQBA 3FXXA 3V5LA 3R8UA 3VBVA 4G3DA 4RG0A 5BVEA 5LVPA 5M51A 3AC3A 3VS3A 3ROYA 5L2QA 3Q4CA 4CFXA 3FC2A 2XCKA 3ZRMA 5A4TA 2RFDA 4FTUA 2WPAA 5EHOA 5DBXA 3T9TA 2EB3A 4NIFA 3FQEA 1H25A 2WMXA 2BILB 3GXLA 4DN5A 4F6UA 4FK3A 2QU6A 4QMUA 4OT5A 2X9EA 4FKOA 4FTLA 3L9LA 3TV7A 1VEBA 3TWJA 3ZFYA 4HNIA 3UC4A 5E8TA 3ET7A 5EH0A 5IQDA 2OF2A 3MB6A 1H08A 3ZO2A 3LM5A 1OPJA 1RQQA 1OL5A 3DNEA 4FG8A 5FXRA 2YEXA 4XRLA 2CSNA 5AR8A 4LUDA 4M8TA 3TNIA 3I81A 4I5MA 4AW0A 1M2RA 1QPJA 3G6GA 3L8SA 4RZWA 4IBMA 2X6DA 2Y4IB 1XH4A 2OG8A 2PUUA 3D83A 4USFA 3FUPA 1WVYA 4N0SA 3THBA 3NVMB 4TYGA 3IGOA 4L45A 1MRUA 4IJPA 4QQTA 3K3JA 3VRYA 2IVUA 4EH9A 3VS2A 3G9LX 3VO3A 1UU8A 4JL9A 4MWIA 1YDTE 4KBCA 2W1GA 4V05A 3UIXA 4HGSA 4S31A 4FV6A 3Q4ZA 3MESA 2RFSA 4RZVA 2EXMA 3DGKA 5I9WA 1QPCA 4XV2A 4K77A 2PU8A 5E7RA 1OKYA 3ZS5A 5LVMA 1IAHA 2O8YA 3PWYA 4RX9A 3PZHA 2DWBA 3GT8A 4PMTA 3FZOA 2IPXA 2JDOA 3DZQA 3MDYA 3ULIA 4YU2A 3CR0A 4QO9A 4XEYA 4WNOA 4UZDA 2B9JA 4A4XA 3PIZA 5J9LA 4WBBB 4X21A 4FKVA 5AP5A 5FLFA 4FKRA 5AP3A 5ITAA 4RIXA 3ODYX 3VVHA 5L2SA 2JEDA 2ACXA 4GCJA 4TWNA 4XYFA 4YPDA 5H2UA 4EC9A 1G8AA 4JQEA 4WO5A 3NNUA 2NNWB 3DXQA 3G5DA 2UW6A 3PJ1A 2QOHA 5E90A 3F3TA 3RZBA 4BKYA 4I0RA 3PA5A 4RC3A 2VWYA 4GK3A 4U81A 3SW4A 4FICA 1OIUA 3IQ7A 2PSQA 1UKIA 3C4FA 1OPKA 2BZJA 2R64A 2NRYA 4FG9A 2W1FA 2ESMA 4IB5A 5HVJA 4DGLC 4E5BA 4LGHA 3FSFA 5T68A 4XP3A 5KHXA 3SXSA 2XNNA 3E8DA 5IA1A 4DF3A 4O81A 3T8OA 2C0OA 4EHGA 4C33A 3NNXA 4J8MA 4IX5A 3VW6A 3U87A 1KE5A 3VBQA 5I5ZA 1H00A 2PHKA 1U54A 3CQUA 4IX6A 5GNKA 2BFXA 5EDQA 3ANRA 4LRMA 4ZEGA 2PUPA 4UB7A 3MVHA 2YA9A 2Y6MA 3ZUTA 3WBLA 2C3IB 5CEKA 2PL0A 2XKDA 3KXNA 5F1ZA 4JBPA 4NTTA 3NIZA 4FTTA 1LP4A 2X2LA 3CQEA 3TIYA 2X4ZA 4FF8A 3GC9A 3E92A 2X6EA 3JY9A 2OZAB 5JGAA 5L3AA 2XRUA 3UNJA 3U6JA 1H28A 1RJBA 2V62A 2I0VA 5C03A 4BI2A 4AN3A 3HGKA 3VS4A 1P4OA 3DY7A 3W32A 2V7AA 4ZTLA 3D9VA 4DTAA 3OBJA 2JAVA 5CU0A 2CGXA 3KN5A 1AD5A 3HMNA 3CS9A 4QT1A 2W9FB 4BZOA 5FM3A 3WYXA 2PPQA 4ZJIA 4C37A 3UQFA 2LAVA 4EH2A 4F1OA 3F3ZA 4UMUA 2XIRA 5FDXA 2YM8A 3W8LA 3EL8A 3GU7A 1ZMUA 2WKMA 4RC4A 1ZOEA 4CGAA 5D7AA 2UZDA 4MHAA 4YNOA 4JAIA 5F94A 4DTKA 1REKA 1UKHA 4ZY5A 2QURA 1M7QA 3ACKA 4WSQA 3VUDA 4X2NA 3F5UA 2BCJA 3GP0A 1OIYA 5L6WL 5L2WA 3C4ZA 5F20A 3Q6WA 3MY5A 4BYJA 2W4OA 4IM0A 3O96A 3VBXA 1GIIA 3KK9A 1W82A 4CTBA 4LG4A 2XBAA 4V0GB 5BYZA 4D2PA 4HYHA 2ITXA 2VTIA 3SW7A 4QMZA 3QX4A 2FSMX 2IW9A 3UIBA 5DN3A 4QMSA 4WBOA 3H4JA 2JIIA 5JH6A 4PPCA 3DKCA 4KKEA 4ZMEA 2VZ6A 2PZPA 3BQCA 4RJ5A 4AGUA 3LCSA 2HENA 5AMNA 2WU7A 5C8NA 4BIDA 5HG8A 2JITA 4M67A 4I94A 4QTBA 1J3HA 4V01A 4X2JA 1JSUA 4DT8A 3DBCA 5IQHA 3MY0A 3BHVA 1PYXA 4RFZA 2B4SB 3ORKA 4MEDA 5DE2A 5GJGA 4YC6A 1AGWA 4FTRA 2WTIA 4FSRA 4TL0A 4I20A 1KV1A 2HZ0A 1CTPE 2R3NA 3PVUA 3MH1A 4FTAA 4MAOA 4IX3A 5EYCA 2QG7A 3BYOA 2VNYA 2UUEA 5B2MA 3IPHA 4B0GA 4KRCA 1SYKA 4XLIA 2E9OA 4ZJJA 1OB3A 1OVEA 2C6KA 4M66A 3S95A 4C02A 1XO2B 1BLXA 2C6IA 3DU8A 3HVCA 4JG7A 1PMNA 1NY3A 4U3ZA 3T9IA 5HZNA 2QOBA 3BHYA 2VWXA 2XYNA 3DQXA 4NM3A 2WQMA 4ZTMA 3MIYA 4M12A 3KL8A 3R6XA 5HTIA 5CF5A 5ETCA 3R1QA 4FV0A 4A9TA 5HBEA 1XH7A 3L1SA 3UZRA 5CANA 4QTAA 4F64A 4P5ZA 5K5XA 1H27A 4GT5A 4PMSA 1XQZA 3LCOA 4AZTA 2OGVA 1X8BA 3BYVA 4U42A 1SVHA 3FY2A 4WNMA 2B52A 4M7IA 3ZH8A 2BHEA 4XV1A 1R39A 3TI1A 4XG8A 3CIKA 4LOOA 3VW8A 1Q24A 4FKJA 4QQCA 2XK7A 4AS0A 2CGWA 4NFMA 5FXSA 1W8CA 3ANQA 5DIAA 3Q5ZA 4TZRA 3WE8A 3FI8A 4CYIA 4NUSA 4DGOA 2HOGA 2ZYBA 3TZ7A 1Y8YA 4ANMA 4EH8A 2XB7A 2W4JA 4EC8A 4O86A 4ITJA 3NZ0A 4EBVA 3R9RA 3CD8A 4ZJVA 4HCVA 3W33A 3COKA 4C38A 2IG7A 1OKZA 3ZM4A 2EU9A 4E6QA 5J7BA 3LKMA 5IZFA 2OJJA 3IW8A 3ATSA 4FOBA 2QKRA 2WMQA 5BVWA 2X7GA 5KE0A 4GMYA 3S00A 4DEIA 4YR8A 3Q2MA 4L00A 4TNDA 3COIA 2DYLA 3R63A 4PMPA 5DT0A 4DCEA 2QLUA 3F7ZA 5C8MA 1BL7A 5AR5A 4RC2A 4UZHA 4QYGA 4WD5A 4EORA 1W84A 2ZDTA 4D2TA 4D1XA 3G2FA 4CNHA 3OBGA 1OUKA 2XP2A 2XIXA 4OGRA 3LMIA 3SG9A 3AD5A 4I21A 2WMVA 4QPSA 2W96B 1MQBA 3FLWA 2YIYA 4X6RA 2CCIA 3H0YA 5LMAA 4BF2A 4IM3A 4RWIA 4ANQA 4C8BA 4O7NA 1GJOA 4FTKA 4CCBA 4FTQA 3FV8A 2FB8A 3COHA 2WTVA 3EN6A 3QKMA 1L8TA 3CC6A 3A4OX 4FL1A 4FT0A 3FLZA 4IAIA 4M0ZA 5BVOA 3QWJA 4C4FA 2BHHA 3RTPA 4OR5A 4C2WA 4O0RA 5AUXA 3BHHA 3C13A 4DG2E 5CENA 4FE2A 4AN2A 3K5UA 5FQDC 3ZDUA 3D7TA 1Q5KA 2O3PA 3O50A 5DT4A 3HA6A 4O82A 4O7WA 2Y7JA 3POZA 4U79A 5AAFA 4DYMA 3BYUA 4E1ZA 2ITYA 3LXNA 4R7IA 4RFMA 4XG6A 3P1AA 4TTHB 3AXWA 3ZCLA 4O21A 4O7RA 4Y46A 5CXHA 4XP2A 2JC6A 2WXVA 4O7ZA 5E8VA 4NW5A 3UDBA 2R0UA 2UVXA 3OXIA 4F9CA 3O8UA 5AIKA 3RKBA 3TN8A 3UG1A 4KIQA 3W1FA 4E5WA 4KRDA 4H1MA 2YM7A 4ZXTA 5HD4A 4JXFA 2XM9A 3QQGA 4O83A 5K0KA 2PVFA 2OJFE 1W83A 2OF4A 1YI6A 3WYYA 4XRJA 3EQFA 5DHJA 4QMLA 4FK6A 3SD0A 4IE9A 4YJNA 4CT1A 4J1RA 1BUHA 4O7LA 3O2MA 1JVPP 2WIHA 3KRLA 1DM2A 4QMVA 2WMTA 3KMUA 3V8TA 1Y91A 4XG3A 4WRSA 3CPCA 2GSFA 2RKUA 2QOOA 4R3CA 3I79A 2HAKA 4RJ8A 2P3GX 4EHEA 5M53A 3R8VA 3EQHA 3UPXA 5HVYA 4XHKB 2YFXA 5JGDA 1J7UA 5CLPA 4X3FA 1RW8A 4HYIA 4YO6A 2A0CX 2GFSA 3R7GA 3SX9A 2YERA 4D0WA 2OH4A 5M56A 3U55A 2ITNA 1EH4A 2ITUA 4HGTA 1G5SA 2CJMA 5LMKC 4M69B 1PJKA 3MWUA 3TUBA 3TZMA 4HPUE 4S34A 4FSNA 1IASA 4EEVA 2JGZA 2Y6OA 4TRLA 3QTRA 5DRBA 4BDBA 3GVUA 5F9EA 3E8EA 3FAAA 3SXRA 2JDTA 2GNIA 3KXHA 4GIIA 5LVOA 2QOQA 5G6VA 3PIXA 3S1HA 5I9VA 5HQ0A 1GY3A 3DAKA 4D2RA 2WEIA 3DK7A 3E88A 2CNVA 3O51A 3R73A 5A46A 4FSWA 4FSTA 4IDVA 4JDJA 2YJRA 5CEOA 2UW5A 2IZRA 4AGDA 1GNGA 4UYNA 1OM1A 4OLIA 3BU5A 3QD0A 3TEIA 3FXZA 4EH5A 3KXMA 2ZM4A 2G01A 2VTLA 2ZAZA 4K33A 3RP9A 1IR3A 4FIFA 3E7OA 4H39A 1XH6A 4RBLA 3FMDA 4IWPA 2A27A 4G6NA 4C62A 4Y73A 4NK9A 4L44A 4R7HA 3VHEA 4PNIA 4PNKA 3BGQA 2ZOQA 2VUWA 5CF8A 5DMZA 4K6ZA 2X8DA 2GQGA 5BVNA 3O0GA 3ZEPA 1JPAA 3BWFA 3E64A 2QG5A 2OIDA 4BTMA 2ITOA 4IX4A 3GC0A 1PXJA 4BHZA 2YN8A 2XVDA 3O8TA 4FODA 2VO7A 4O38A 3DJ5A 5KMJA 5H9BA 1OBGA 4AA5A 2PVYA 4FV9A 4QMTA 5A3XA 3WE4A 5JK3A 5IQGA 1H0WA 3MJ2A 3COMA 4FIGA 3FMHA 4BCOA 5L2IA 2XS0A 2HW7A 2VNWA 4XNEA 4DEAA 1HOWA 4BDDA 3VUKA 5TE0A 2PE0A 4IQ6A 3Q04A 2B55A 2C6EA 3QRTA 5EYDA 4XJ0A 3RCJA 4CQGA 2J4ZA 5IA3A 3TNHA 3VNTA 1K2PA 2VWWA 4IJ9A 3EHAA 1QPEA 5DLSA 4D55A 4H3QA 3FZSA 3ZTXA 3KA0A 4IVAA 1FINA 4IM2A 5FXQA 3IW4A 3IW5A 4DE4A
chains in the Genus database with same CATH superfamily
2VO3A 4L9IA 3OWLA 5TF9A 5IKWA 5LVLA 1CSNA 3QTWA 3UOJA 4DCAA 1DAWA 3U4WA 3DDPA 4AT4A 3N51A 2XKCA 3QD4A 3C5UA 4ANSA 4AUAA 4E8AA 4L3PA 4FTIA 3ZZEA 1R3CA 2YZAA 4YLJA 4D2WA 2VTPA 4KS7A 4FV5A 4YJRA 4FKPA 3OOGA 4YC8A 3K54A 3TG1A 1FBNA 4KIKB 4EONA 3C4CA 1SMHA 3BE9A 3VIDA 3HMOA 3ORNA 4FVPA 2Z8CA 3Q3BA 4AA0A 2YWPA 2Y4IC 3ORLA 3HEGA 4AT5A 3BLHA 3ZFMA 4GS6A 4HW7A 1OITA 2NO3A 3PSBA 4P5QA 2V5QA 1OZ1A 4Y5QA 3RPSA 5B2KA 3R28A 3WZKA 5ANIA 2XF0A 3I1AA 4KA3A 4BDHA 4ORKA 2PE2A 2XJ1A 4BDIA 1ERKA 2OFUA 3LVPA 2A1AB 5BMSA 1G8KA 2OW3A 2JKOA 3ATTA 3ZC5A 1Y57A 2B0QA 4FIJA 3QQUA 3N4VA 5LXMA 2R3FA 3LJ1A 3LFSA 3VBYA 2IF8A 4EUUA 4PTGA 2CHLA 1CMKE 1Q8UA 3BGZA 3F2AA 4HJOA 4BKJA 1F5QA 2H34A 3FMEA 1H24A 1WCCA 2ERZE 3OROA 4JI9A 3AC8A 3TKIA 5LARA 4FR4A 4H05A 4I5CA 3IGGA 4APPA 2CMWA 4BCJA 3MW1A 4G16A 3DTWA 3DFAA 4IZYA 4I6HA 3RHKA 3RINA 1U59A 2WMBA 1WAKA 3DZOA 3ORMA 2J0KA 3SVVA 1GIHA 1XMMA 1HCLA 3EJ1A 3CBLA 4ONAA 3OCTA 4G31A 2A2AA 4AZFA 2GU8A 2BR1A 5IA4A 1Q8TA 4MTAA 2UW8A 2OIBA 3D5WA 5TKDA 1MQ4A 3BPRA 2BRBA 3OEFX 4NKAA 3FXWA 4J99A 4F1TA 2XNOA 4AQKA 3O8PA 4K11A 1QCFA 4BY9E 3G51A 3R01A 3KQ7A 3PY3A 3TNPC 4JS8A 4YZNA 5E92A 5HLNA 4GG5A 1UVRA 4WNPA 2ZB1A 2V0DA 4QMOA 3DBEA 3ZM9A 5G1XA 2R3QA 2X0GA 4UMRA 1WBTA 4M15A 3G90X 4C4GA 5CSVA 3NW6A 3R2YA 5HBHA 1VZOA 2J0IA 2PYWA 4NM0A 2XALA 4CKRA 3BU6A 4EOPA 4OTPA 5ANKA 3KCFA 1BI7A 4JX7A 3UVRA 3FYKX 4CD0A 4GYGA 2HY81 3GU5A 3HV6A 3V6SA 2BIKB 4ITHA 4L53A 3A7HA 3R7UA 1R78A 2AUHA 4BRXA 4CFVA 3JYAA 5KX8A 1R1WA 3W2CA 4G3EA 5AM6A 3KRWA 3PE1A 3WF5A 3PUFC 5AP7A 4RIWB 5HE2A 5HU9A 4NW6A 3ZUVA 4A4LA 4LYNA 5FEEA 2ETMA 3R7YA 4C57A 4JT3A 5AV1A 1PXIA 4PPBA 4O4EA 3L8XA 5A6NA 5M44A 3IS5A 3G15A 3W2QA 3NW5A 2OJIA 3DT1A 1E1XA 3MH0A 2HELA 5M4UA 3EFKA 3OUNB 3UZPA 4TY1A 4X2GA 1YW2A 4WIHA 4CSVA 1A9UA 1R0EA 4AOTA 3RWQA 1PW2A 4V04A 1GZ8A 4UMPA 4YZCA 1H1PA 4G6LA 5L6OA 2OK1A 5JEBA 5AP2A 2UZUE 2OKRA 3GU4A 1Q8ZA 3QX2A 2V7OA 5IEVA 3NIEA 4EKLA 4N57A 2VU3A 1WBPA 4AW1A 4YMJA 4AFEA 1M2PA 5A14A 2OJ9A 4DLJA 5HD7A 2E9NA 4JIKA 3PVWA 3G6HA 3T3VA 2Y4PA 4K0YA 3DQWA 2F9GA 3DJ6A 2BAKA 3RWPA 1H0VA 3VBWA 3NX8A 1JKTA 3GCPA 5FEQA 5E1SA 4ZSAA 4R3RA 4WUNA 5A4CA 2OZAA 2CKQA 5J79A 3QQFA 4D2SA 4RIYB 4K2RA 4YZ9A 3KF7A 4BCQA 3LFDA 4YGAA 5CI6A 4MVFA 4XG2A 2VO0A 3ENMA 1WBOA 3HP5A 2F7ZE 4BKZA 4JAJA 3UYTA 5HG5A 3A99A 4QP9A 1H1SA 2WELA 4GEOA 4U44A 2RFNA 5C01A 4L43A 3S3IA 3VJOA 5D10A 5IF1A 4ZZOA 4RVKA 5DRDA 4HVHA 4UX9A 2PTKA 5AJQA 4BGHA 5M4CA 3QBNA 4FV4A 4G9RA 4QTCA 1BL6A 2CGUA 5D41A 3TZ8A 4FYOA 2FVDA 2ZDUA 2VGOA 4J7BA 4ALUA 2QO2A 2R7IA 4BN1A 2CGVA 4ANBA 4YHFA 4KINA 3CGFA 3UOLA 2G15A 4U9AA 5K3YA 4PL5A 4G5JA 3RGFA 4L68A 3REPA 1UV5A 5GZ8A 4Y95A 4QMQA 3VQUA 4IXPA 4YP8A 4BICA 5H8EA 4FT7A 1OECA 4HVIA 4EOMA 3AOXA 4BDAA 1OL2A 3V5QA 2GDOA 3W0MA 3QKKA 4MNFA 1GAGA 3M1SA 3JXWA 3QXPA 5HI2A 4V0GA 1PXNA 3OCSA 3W2RA 1IAJA 5FP5A 2KULA 3O17A 2YISA 2WD1A 2YITA 3A7IA 3PPKA 1PHKA 4L67A 2RGPA 1ZYJA 4YBKA 3R8MA 4DFZE 2OWBA 3IDPA 4NZWB 4HVSA 5ETFA 4W4WA 4YJUA 4AG8A 2VAGA 5I9XA 2XUUA 3F3VA 3EQGA 3SOCA 3W16A 5K9IA 4DHJA 2JKQA 3QYZA 3LMGA 2O63A 5AX9A 4FIEA 4A7CA 4FGRA 5BUEA 4DFBA 3OCGA 3OVVA 1OGYA 3DKFA 3LJ2A 3AC5A 2I0HA 1VLRA 4W9WA 5CASA 4I6FA 4DT9A 1RDQE 4B7TA 4E6CA 3LFCA 2WZJA 4AZSA 3MBLA 3KN6A 2GHMA 2X9FA 3DTCA 3QL8A 5ANJA 2RL5A 1TQMA 3HV5A 2CNQA 1YRPA 3OC1A 3JVSA 3GOKA 4G3FA 5FTGA 3BHTA 1PF8A 1J1BA 4WT6A 2FSTX 4I93A 2LGCA 2W99B 3D14A 3I60A 4IAFA 4O0TA 4AQCA 5BVFA 5I9YA 3UMXA 4GT3A 5CAQA 3WARA 2C6MA 3D4QA 4FRFA 3LFEA 2CKEA 3D7ZA 3PUPA 4NCTA 4JLCA 3KULA 3EKNA 4ID7A 5C27A 4EL9A 4BIBA 1W98A 2GPHA 2A19B 4YBJA 4ARKA 3ZLYA 4ENXA 4EQCA 1WBWA 3H9FA 5BQ0A 5ANOA 1VYWA 3FQHA 4CFNA 4RX7A 3O23A 5HE1A 3K3IA 4O4BB 1TVOA 4CMUA 4KKGA 5E8SA 3GEQA 4Y72A 3HLLA 3LFBA 4IWOA 3ZLWA 4E4XA 5C1QB 4HGEA 4MH7A 4O0WA 5LVNA 4M3QA 4QQ5A 4OW8A 2YIQA 2YM6A 4RQKA 5KO1A 3PFQA 5M4IA 3FZ1A 4C4EA 4YUQA 4GUEA 1LEWA 4AOIA 4FTMA 2OXDA 3TM0A 3VONA 3R1SA 4IAZA 4IEBA 2WMWA 4XOZA 4AF3A 4NM5A 4O7SA 4AWIA 3GFWA 2E2BA 1O6YA 2YCFA 4ASDA 2F2CB 1QMZA 4D4VA 3AT2A 3LXLA 2C5XA 4EWQA 1WBVA 5EQEA 3IONA 4C59A 2WQOA 4O0UA 2X4FA 3HRBA 5IA5A 4TWOA 4QYFA 5CU4A 4RIOA 2W17A 4F7JA 4DLIA 4YJOA 5EKNA 4E4MA 5DFPA 3SAYA 2YDJA 3E63A 2OH0E 4N4SA 4P90A 2C1BA 4C3PA 2YCSA 3HRCA 3R22A 4HOKA 4IAKA 4YJTA 1YWRA 3ORXA 5AV2A 3RM7A 2ITPA 2WIPA 5AFVA 3IG7A 4NKSA 4XOYA 3MFTA 5T6KA 3NCGA 4F63A 3PSCA 4C4IA 5JT2A 4FIIA 1ZAOA 2ITWA 4NM7A 2E9VA 3R21A 1PKDA 3FL4A 3QAME 4I1ZA 5AUVA 5CALA 2CCHA 1KWPA 3LQ8A 3VUMA 1ZZLA 1PXLA 2XH5A 2OXXA 3P78A 4L7FA 4FL2A 4QTEA 2EWAA 3FHIA 5BNJA 1ZYCA 3TJCA 2IZTA 4GYIA 1Z5MA 4FT9A 4L52A 5DG5A 3QZHA 4FSMA 3PXZA 5AUTA 3WZUA 3Q2JA 5HOAA 4RVMA 3UO4A 3AT4A 1FGKA 4F9BA 3HMMA 1M7NA 3FMMA 1PY5A 3I7CA 1PMVA 3LXKA 4DHZA 3HX4A 4MXOA 3D5VA 2F7EE 3PWDA 4LI5A 1M2QA 3DCVA 4LMNA 4U5JA 4C0TA 5KNJA 1B6CB 4QP4A 2IWIA 3H9RA 3MA3A 4JBVA 5CX9A 3BV3A 5AM7A 3CE3A 2XIZA 4QNYA 2UV2A 4MKCA 1SVGA 3FYJX 3MVJA 1ZOHA 2UW3A 1M52A 1ZARA 2YCRA 4FMQA 4I24A 3FJQE 1QL6A 1JAMA 3DOGA 3BBWA 2JBPA 1L3RE 2BRHA 3DBDA 3KXGA 4OTIA 1OIQA 3QTIA 1NW1A 4DH8A 2Y9QA 2VWBA 3R04A 1OGUA 3JPVA 4J97A 5JFVA 4Y5HA 5EM6A 4ZSGA 2XBJA 3OT8A 3GCQA 3SXFA 2PMIA 5EOBA 5AV0A 5GHVA 5BYYA 2XIKA 1PMUA 4CG9A 5FDPA 5BUIA 3ZYAA 1XWSA 5DR6A 4X3JA 5CZIA 1CKPA 1XR1A 3K2LA 4EUTA 2Z7SA 3U8WA 3ZXTA 2OIQA 4BCMA 4M84A 3LZBA 5BVKA 2B1PA 3QC4A 4E4NA 2BRNA 4AAAA 4USEA 3D15A 1WMKA 3EMGA 3LW0A 4B6LA 1FGIA 1MP8A 3R9DA 2IJMA 1Q3DA 1KOAA 4G1WA 4EOLA 1W2DA 5A9UA 3A61A 4TYEA 3TTIA 4IC7A 2CPKE 2F7XE 3EN9A 4NEUA 5DWRA 5EW9A 5C9CA 2IW8A 3W18A 2UW7A 3BLRA 5BUJA 1UU3A 4EYMA 2BKKA 3TDVA 4U45A 2BDFA 4R7BA 2RSVA 3VUHA 5JFWA 3TDWA 4G5PA 2R3IA 5BVDA 3PRFA 4DHFA 3VC4A 3FI4A 3QLGA 4RWLA 3D5XA 3AC1A 4L3LA 5M57A 3BQRA 3OG7A 3PXRA 5CAOA 4XP0A 4QP8A 2XNMA 5F95A 2G2HA 5FD2A 1PRYA 2RFEA 2QNJA 4CZTA 3PJ8A 5KMKA 1JKSA 4M69A 3BIZA 2QVSE 2O2UA 2O65A 3PVBA 4I6BA 4OTGA 1UNHA 2WTWA 4FNYA 1G3NA 3FDNA 3AC4A 4EJ7A 4O7YA 3NAXA 4L42A 1TFFA 3QQJA 4F0IA 2R3JA 3CD3A 2HZ4A 4BDKA 5IQBA 3FI3A 3PP1A 4GV1A 1W2FA 2XMYA 3MPAA 2I6LA 4EOOA 1UWJA 5KZ0A 4IC8A 5KMIA 2YDIA 3ZSGA 3G0EA 4I5HA 2YIRA 3RCDA 3LAUA 2XNPA 4OBQA 2P2HA 4CEGA 4GJ2A 3IECA 4GK4A 5HIDA 4GU9A 4XCUA 3A62A 3QRUA 4AGWA 4B99A 4CKJA 2UW4A 3DBFA 3OY1A 4R1YA 3ZC6A 1WFCA 1NA7A 3II5A 3UYSA 4D1ZA 4E6DA 2A4LA 2BIYA 3EYHA 2XJ2A 3PA3A 4M0YA 4DGMA 4F6SA 4FEUA 4YTFA 4HYUA 4UEUA 1XH9A 3P7BA 3HECA 4MF0A 3S4QA 4F7SA 3ORPA 4YTHA 1CKJA 4MBJA 5GZ9A 3MFSA 5I4NA 4K8AA 3TL8A 3R7IA 4ZTQA 5M55A 2PMLX 3MY1A 5EI2A 4JJRA 1SM2A 4U3YA 3WZEA 2BFYA 4BDEA 2C5VA 4YHTA 4S30A 3VULA 3QRKA 2W7XA 4BVUA 1ZYLA 5CU3A 4BWXA 3V01A 2QOLA 2JIVA 2EUFB 2YIXA 4I4EA 5EYKA 3FEGA 4YTCA 3Q9XA 3UG2A 1KSWA 4W4VA 2R3GA 4LRJA 4HCTA 4MWHA 1Y6BA 5KKRB 3BRBA 3IKAA 5I0BA 1I44A 3PLSA 4GVAA 2GCDA 3OWJA 5HE0A 2WO6A 4JRVA 4IB0A 2ITVA 3UOKA 3VS1A 2IZUA 4CYJA 4RPVA 4GKIA 3ZMMA 5FP6A 4AN9A 5AR3A 5ANEA 2R3KA 3PE2A 3V51A 2PMOX 5GJDA 4OTHA 4UWBA 1TQIA 3Q52A 1KUTA 4GFMA 3Q96A 3LM0A 2UZLA 1U5RA 4PL3A 4XMOA 3QYWA 2XYUA 4O22A 2WTDA 2HYYA 4OAUC 1YXUA 4JR3A 3UC3A 4Y85A 5AA9A 1Q97A 4ACGA 2J5EA 5CAVA 4FKGA 3ZONA 4KIKA 4ZY6A 4F0GA 3UIMA 3SRVA 5HO8A 3ZU7A 3TKHA 4LV8A 1Z57A 3A7GA 4N70A 5CI7A 2G1TA 4FTNA 3KIOC 4BCIA 2X7OA 1WZYA 3C0IA 3B2WA 4WA9A 3VS5A 1IA9A 2XCHA 4GU6A 2NYAA 4AXCA 4MCVA 4RWJA 1MRVA 2UW0A 3TUCA 4JOAA 4JRNA 5C8KA 3W0OA 2QD9A 1ZLTA 2J90A 5CF6A 3RZFA 4FSUA 5HTBA 3R9NA 3F9NA 4QP1A 4BTFA 4BCPA 2XIYA 3D2IA 2XJ0A 2R3MA 4L3JA 5HKMA 3D94A 3ZRLA 1O6LA 5CS6A 3MFUA 3R8LA 4F65A 3UGCA 5C26A 4NT4A 4KABA 3HUCA 5IH5A 3FLSA 5T3QA 4FKIA 3UP7A 2VTHA 2WQEA 3EZRA 4ZSEA 4FSYA 1B38A 2J6MA 2QOFA 3PPJA 4XV9A 3MS9A 5IH4A 2W5AA 1NXKA 5HU3A 1GZNA 3Q4UA 2I40A 3F5GA 4KS8A 2XNBA 3RM6A 2O64A 3MVLA 5FG8A 4TYHA 4F4PA 2R5TA 5FBNC 3UE4A 4M14A 3Q53A 4BZDA 4FZ7A 3IDBA 3VRZA 4EOIA 4PP9A 4FBXA 5D1JA 4A9YA 4FV3A 1WVWA 3QCXA 5DH3A 4JG8A 4C7TA 3UVPA 4G17A 3IO7A 2WFYA 4PF4A 4QMWA 4CRLA 3TUDA 3NUNA 5CEQA 4QP2A 3NUUA 3KXZA 4QD6A 3OY3A 2WNTA 4JQ8A 4LV5A 3Q60A 1T46A 4LGGA 3U6HA 3BBTB 4HPTE 4Z7GA 2GNLA 1DI9A 2W1CA 3KVXA 4IB3A 4DGNA 4IVDA 4CG8A 3ZO3A 1ZXEA 2IVVA 5DGZA 2JBOA 5KMLA 4NWMA 4BGGA 3WIGA 4PUZA 4RRVA 1U4DA 2PVJA 4UXLA 4O6LA 3QZIA 3E7VA 3H10A 4EQMA 1SVEA 4L46A 5EQYA 1UA2A 4XBRA 4ZP5A 2HZNA 3I7BA 4RWKA 3OS3A 4EOJA 3E8CA 3IDCA 5EHYA 4PY1A 5AAEA 3PDTA 1JQHA 1K9AA 1V1KA 5ICPA 5B2LA 4Y83A 4QP7A 2XK4A 3OP5A 4KBKA 5IA0A 3VN9A 4JVGA 4RIWA 2UVYA 4LQMA 4CFUA 3O71A 3CKXA 4DFNA 3LQ5A 2J9MA 2VO6A 4FG7A 5AR2A 5AV4A 3OUKA 3GCSA 4QYHA 5LCJA 3HAMA 3CTJA 3F7WA 4IVCA 1I09A 1YXSA 2W05A 4R6VA 5AX3A 5HIBA 3SC1A 5CU2A 3BYSA 3TT0A 5ANDA 4RA5A 4QMNA 4I6LA 2SRCA 3QCYA 4ITIA 2IO6A 4S2ZA 1VR2A 2GNJA 1M14A 2WEVA 3ETAA 4KSQA 2XK6A 4DINA 3P5KA 3G9NA 2ONLC 3CTQA 1URWA 5BX0A 5LMKA 4E73A 3C5IA 3DLZA 4FA2A 3C0GA 4ASEA 3U54A 3OOMA 4DHIB 5A54A 2C3LA 3NYVA 3C4EA 5IMXA 4RJ3A 3WOWA 4DC2A 3D2KA 3OXTA 3ZSIA 2VX3A 2BUJA 3UIUA 2BTSA 3H3CA 1CKIA 4YJQA 5KMNA 4L7SA 4II5A 3LXPA 2BDWA 3OW4A 5JN2A 5HNBA 5HNIX 1YOMA 2X81A 5CVFA 1QPDA 4J52A 4XLVA 4BHNA 2OBJA 4S33A 4KKHA 3DKGA 1SNXA 5GIOE 4ALVA 1JWHA 2YDKA 4QRCA 5GJFA 1JKKA 4A07A 3FBVA 3FZTA 2VTMA 3R2BA 4BDCA 4RJ7A 4F9AA 5HX8A 4E5AX 2Q83A 4O4DA 4PMMA 4ZLZA 4F9WA 4RVTA 3QHRA 3E8NA 5EDPA 4DH1A 2OLCA 3GUBA 4F99A 2C47A 4WG4A 2BVAA 3I5ZA 5AP1A 3ELJA 1ZYSA 4EOQA 3KMWA 5L8JA 3F69A 5L8LA 4EBWA 2B9IA 3E62A 1H07A 1Q4LA 3L8VA 4U41A 1Q61A 3VJNA 1Q8YA 2DQ7X 4FUYA 2X39A 3MH3A 5CNNA 3ZBXA 3QTSA 5AP0A 4B9DA 3HRFA 2GNGA 4GVJA 2I1MA 4NH1A 4YLKA 3RK7A 3UP2A 4W9XA 4N6YA 4BFMA 5JZJA 5GINE 3Q9YA 4P4CA 3TV4A 4C35A 5AR7A 3HDMA 4O96A 4TT7A 2VN9A 2NRUA 4A9UA 4FC0A 5GZAA 4M68A 4I92A 5TT7A 5HICA 2QONA 4Q2AA 3LCDA 1GZOA 4PRJA 3CKWA 4JDIA 5JQ5A 4ZLYA 5K4IA 2C68A 4Z9LA 2QQ7A 4UN0C 4R78A 5BMMA 3LJ0A 4U80A 4R5YA 1FMOE 2UW9A 4FEVA 5EHLA 5C4LA 4TWPA 4G2FA 3S2PA 2GNFA 4OTFA 4ZIMA 3D7TB 3M42A 1WBNA 2XK3A 4KIOA 4B8MA 3F3WA 3DPKA 4QQJA 3V5WA 4DEDA 3N4TA 4KBAA 3P7AA 4CFFA 4DEHA 4ERKA 4EH6A 3UNKA 1ZMVA 4IANA 2ITTA 4QMXA 4CZUA 4YZMA 2XKEA 3LFFA 4O0SA 3AMAA 3UQGA 4EH7A 3KB7A 1H1WA 2C4GA 3QD2B 2YLEA 2BTRA 4MD8E 5HCXA 2GMXA 4KIPA 4TNBA 1VJYA 4MXCA 2HWPA 4KB8A 2NP8A 3KEXA 2PVMA 3PLAE 4XUFA 3KRXA 3PYYA 1U46A 2GS7A 3QTZA 3WF7A 5AEPA 3NSZA 1V0BA 3DJ7A 3HV4A 4EH4A 2I0EA 4RA4A 1KE6A 3MI9A 2YHVA 3OWKA 4E26A 4UBAA 4YO4A 4FKQA 5BV3A 4W8EA 4AE6A 5J95A 2VTRA 2H96A 2P2IA 3FHRA 3HA8A 4LUEA 2WTCA 3O7LD 3OTVA 3SGCA 3I4BA 4BYIA 3G0FA 2OU7A 1SZMA 5CAUA 3F5XA 2C69A 3JUHA 3SLSA 4FV8A 1WVXA 4IIRA 5AWMA 3OTUA 5CEPA 3TJDA 3BL9A 1LPUA 1XJDA 4QDVA 3LPBA 4AX8A 3PXKA 4DFXE 5CSWA 1Q41A 2W06A 1AQ1A 3ZDIA 2REIA 2YIWA 3HZTA 3NR9A 3R02A 2XK9A 3PG3A 4FTOA 4MXYA 5E8UA 3I6UA 4NFNA 2HIWA 4GKHA 1XBBA 4L6QA 3QQLA 4TKSA 3RMFA 5M08A 3GC8A 4D9TA 2XM8A 3NAYA 4IAYA 2J7TA 2XNGA 3F66A 1J91A 3DAJA 4MQ1A 5CNOA 4F0FA 3OHTA 3RHXA 2ZMCA 1ZRZA 2KTYA 5D7VA 3DNDA 4ZSJA 1TZDA 3U6IA 4GG7A 1ZY5A 5E4HA 2C5YA 4W8DA 2HXLA 1XKKA 4D2VA 2Z7LA 1PXPA 1XBAA 4I6QA 3MB7A 4PWNA 4CT2A 2C5NA 2RF9A 4I22A 3DK3A 1BX6A 3AQVA 3I0OA 4FNXA 4KWPA 5JRSA 3C50A 5IQAA 2YLFA 2ZV9A 4FSZA 1DS5A 3QFVA 4AFJA 3C0HA 2BMCA 5CQUA 3VQHA 5CSPA 1FOTA 4X0MA 2E9PA 4FZAB 4ZTSA 2J0LA 4DAWA 4YJVA 2WMRA 5JQ8A 4F78A 3GQLA 3HV3A 3I6WA 4ACDA 3DXPA 1SNUA 4ZY4A 4EI4A 5BPYA 3QCSA 4U8ZA 4ANOA 4F9YA 4GH2A 5TOZA 4QDEA 2BRGA 3VWAA 4H3PA 4R8QA 3ZSHA 3G33A 3WF8A 2XA4A 3HKOA 4H3BA 4AGCA 2WQNA 3P08A 4AA4A 1ND4A 2XEYA 3NYXA 2WHBA 3MH2A 3AKLA 1PYEA 4F70A 3QQHA 4CZYB 3VF8A 1ZOGA 2B9FA 2R9SA 4BDFA 2XAOA 3Q9WA 4BTKA 1IEPA 2HY0A 3OW3A 2WQBA 4UWCA 3W10A 3AC2A 2ZM1A 3CXWA 3DA6A 4FKUA 4NTSA 4YSMA 2VWVA 3F88A 5ACKA 3R9HA 5IMEA 3UDSA 2FA2A 2Z7QA 2VTSA 3AD6A 3F2RA 4UXQA 3ZZWA 4XX9A 5KMOA 3EIDA 4GL9A 4LOPA 4QPAA 1W2CA 2E9UA 4F1MA 3HV7A 3PXFA 4N6ZA 1RE8A 4QYYA 2R3LA 3QD3A 5CT0A 3BCEA 4GK2A 4J95A 1OL7A 2W1EA 4NJ3A 5IDNA 2W5HA 1PMEA 3RALA 4LOQA 2AYPA 5CEMA 4G6OA 3EFWA 1KV2A 5FUTA 2X2MA 5LCKA 4I3ZA 3NNVA 3TKUA 3E3BX 4Q5EA 4YC3A 1YXXA 3ZBFA 1FVTA 3RPOA 4UMTA 1NT2A 3MTFA 3O7LB 4NU1A 3FL5A 3KC3A 4EK8A 3OD6X 5KUPA 2FYSA 2XARA 1XH8A 3VS6A 4D5KA 2CKPA 3W8QA 3ZRKA 2RIOA 4EKKA 3GQIA 3LCTA 3UODA 5E9EA 1OKVA 2UZNA 5JRQA 2ZJWA 4CCUA 4BJJA 2YCQA 3BEAA 4O2PA 1OPLA 4KSPA 3MPTA 1E1VA 3MV5A 1PXKA 4LGDA 5CSXA 4E7WA 3D5UA 4DBXA 1GOLA 3LIJA 4TYJA 2PE1A 4HGLA 4MNEB 4G3CA 2HWOA 4ZLOA 4RX5A 3KF4A 4O0XA 4X2FA 4B8LA 3QZFA 3V8SA 5KKRC 3QA0A 1DI8A 3P9JA 5FWKK 5IG1A 1YKRA 2R0IA 3WF6A 1YWNA 3LMHA 1S9JA 4LL0A 5AV3A 4KAOA 4AT3A 3CSVA 4GRBA 4CLIA 5EYMA 2W9ZB 4KUJA 4YZDA 3ODZX 3UJGA 2CNUA 5FRIA 3B2TA 4O4FA 3R00A 4Z55A 5HLPA 3DLSA 2JKMA 1NVSA 3FLYA 3MA6A 4LFIA 3U9CA 4CLJA 4MD9E 4WSYA 2V55A 4A9RA 2Q0NA 5IU2A 4QMPA 2F4JA 5FGKA 1JOWB 5E8XA 3AGMA 1ZZ2A 2BALA 4J96A 3C9WA 3AG9A 2QKWB 3RBWA 2G2IA 4YSJA 3HMIA 2JFLA 3MPMA 3QLFA 1PKGA 2Y0AA 5EI6A 3EH9A 3A60A 3BLQA 4IB1A 3GI3A 3QTQA 3EKKA 3DFCB 5EQPA 4NSTA 3KRRA 4EJNA 3RK9A 2CLXA 3QGWA 3VUGA 3EQIA 2RG6A 5H8BA 4D9UA 4Z16A 5M07A 2VD5A 4FOCA 4ASZA 2C3KA 3R71A 2W1ZA 4IH8A 3W0PA 5GIPE 1APME 3PA4A 4EK4A 3GC7A 4LRKA 5J7HA 5K5NA 3NCZA 2JKKA 2WMSA 4YJSA 4DGGA 3MIAA 1JBPE 4U6RA 4QPMA 2WU6A 3UO6A 4JBQA 2OICA 2GTNA 4EHZA 3FMNA 1JLUE 5HESA 3M11A 3RPVA 3QQKA 4DFLA 4ZOGA 3EOCA 5FTOA 4PX6A 3FZPA 5HCZA 4RLLA 3IK3A 5CYIA 4BC6A 4DEBA 4EYJA 4JBOA 3ORTA 4DA5A 3GENA 4WG3A 5JFXA 4IADA 4FNWA 5CT7A 3ULZA 5M4FA 5HIEA 4E6AA 5IQCA 4M13A 2W1IA 4ZTRA 4F7NA 4RLKA 5I3OA 3VUTA 2JFMA 1BYGA 2Y8OA 3QXOA 3NEWA 2X0QA 3OXZA 5CSHA 2ZV8A 4RX8A 3HL7A 3KCKA 4I23A 5CVGA 3PY1A 2PZIA 4IW0A 4K9YA 5HG7A 1OL1A 4EHVA 5TR6A 5AUWA 4IVBA 1S9IA 4KNBA 4WHZA 5AUZA 4YURA 2W5BA 4GFGA 3GCVA 4XS2A 4CMOA 4QTDA 2CKOA 5J1WA 3ALOA 2JIUA 3Q9ZA 3H30A 4K1BA 3SKCA 2OFVA 5HE3A 4TWCA 3ID6C 4C2VA 4UY9A 3RAWA 3Q4TA 3RK5A 3KY2A 3DBQA 2QHNA 2PMNX 4XG4A 5AUUA 3HNGA 3P86A 4PQNA 5JGBA 1J1CA 3WIKA 2X7FA 5EDRA 3R7VA 3I0QA 2UZEA 3L9NA 2J2IB 3NRMA 5JMSA 2CN5A 2QR8A 2WTKB