4QMUA

Mst3 in complex with jnj-7706621, 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1h-1,2,4-triazol-3-yl}amino)benzenesulfonamide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
286
Chain Sequence
GMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmuA01
3QTWA 5CAVA 4MXYA 4UMUA 5CF8A 1V0PA 2PZ5A 1KE9A 1VYZA 1PXIA 2PVMA 3DBFA 2KULA 4FIIA 4PTEA 3NNXA 1UWJA 4RWJA 5GJFA 3OWKA 4H36A 3HX4A 3UOHA 5ITAA 3I0OA 3ULZA 3WZKA 3EQPA 2Y8OA 4YBKA 3EWHA 4CKJA 3FMJA 3DJ6A 1JKTA 3FQEA 3BYOA 2WHBA 4KS7A 4BKJA 2X2MA 2FYSA 1VYWA 3TWJA 3RWQA 1XBBA 4IWPA 4M69A 2E9VA 3RVGA 1JOWB 4Q9SA 5FUTA 2E9PA 2JC6A 1I09A 4B7TA 2FB8A 4ENYA 4DA5A 3A4PA 4XMOA 2YM8A 4FTCA 3PP1A 4PF4A 1ZRZA 3EH9A 3SXRA 4MWIA 3CD3A 4OTFA 3RAHA 3PZEA 5A14A 2V7AA 4QTBA 3TNPC 2J51A 2XJ2A 2F7EE 4JBOA 2HZ4A 3IW6A 1PMUA 2W1GA 3TV4A 5A6NA 3F3UA 4P5QA 4QYHA 4WNMA 2HIWA 3QQUA 4LL0A 3Q3BA 4YJUA 4EOJA 2WIHA 2CKQA 3W32A 4LRKA 4G3FA 3PG1A 4ERWA 5KMNA 4L46A 4QPMA 2VX3A 2IZRA 3QWKA 4LRJA 4FTOA 4MQ2A 3RAWA 4BGHA 3H9RA 5HTIA 1YOJA 1FPUA 2GNLA 4DT9A 2OSCA 2E9NA 2ZB1A 3D94A 4B0GA 3ORNA 4RX8A 3FLYA 4YJSA 5GZ8A 5F1ZA 2XK9A 5CY3A 3LIJA 3U8WA 4O0WA 3BYVA 3Q52A 4QNYA 4Q5HA 4QPSA 1P4FA 3ZHPC 1KOAA 2QO2A 1BL6A 4S34A 1H27A 2W1ZA 2YAAA 3GOKA 5J9YA 5K4IA 4J95A 5DVRA 3HL7A 1ATPE 4PNIA 3OWJA 4L68A 1WZYA 3WE8A 4ANBA 4F7NA 1H1SA 1GIHA 5AP6A 1W8CA 3TNQB 4BR3A 4GFMA 4QMLA 5CQWA 5CAOA 3PPZA 1BYGA 3SHEA 2C6KA 2RFNA 4IZ5A 2WTJA 3KFAA 2X7FA 4CLJA 1B38A 4U40A 4DGOA 5IA5A 5A3XA 3DB8A 4KKGA 4PL3A 3TKHA 1KUTA 4PWNA 2WMBA 5KMOA 4KRDA 4P2KA 1KE8A 3ODYX 5CEKA 3SVVA 5EQEA 5HEZA 1NVSA 4UYAA 4AFEA 5CANA 2E9UA 2GDOA 1OKVA 4MF1A 4AZWA 3KVXA 3LPBA 4W4XA 4GCJA 4QO9A 3A8XA 3UQCA 2OFVA 2QKWB 2OFUA 3BGQA 1UKIA 4XS2A 4I4EA 1OI9A 2XNOA 3Q2JA 1ZYJA 2JBOA 3N4UA 2JEDA 3P1AA 3PDTA 3RAIA 2HZIA 4RPVA 3LKMA 4YLJA 3E88A 3RMFA 3AD6A 5TR6A 4ZY5A 4MNEB 3OZ6A 3R8UA 2R4BA 4JG6A 2IZUA 4IVAA 5CVFA 2YERA 2WZJA 4D2VA 3MB6A 4G1WA 4MTAA 1H01A 3EN6A 4MD9E 4M84A 3RINA 2ZJWA 3HMIA 4S32A 3U4UA 4GEOA 4LG4A 4G5PA 5L8JA 3RGFA 4JVGA 4J1RA 4RX5A 3QTIA 4X3FA 3OFMA 4L8MA 3IQ7A 4F64A 2C1AA 3DBEA 3QBNA 3QCXA 4FVPA 4K8AA 3QKMA 4QPAA 5IEVA 5FTQA 3TDVA 3FL4A 4A9YA 5GINE 5CSXA 2J7TA 3ZRMA 4BVUA 3NUXA 4RC4A 4V0GA 5IA0A 4XV1A 4FK6A 5CZIA 4F7LA 4TN6A 2BROA 4EI4A 3EHAA 4IX4A 1UA2A 2QLUA 2R3LA 2WQMA 4RFYA 3E7VA 3FPMA 1H26A 1FOTA 4YZ9A 2RFSA 4QMNA 3VUMA 3EN9A 2XRUA 1T45A 1PW2A 4O2ZA 3ROCA 4DAWA 4I92A 3QD3A 4RJ6A 3CPCA 4AFJA 2Y0AA 4D4SA 1OVEA 4CVAA 3R71A 3NYXA 1RE8A 2G15A 3F7WA 2XVDA 5M57A 4E93A 1JWHA 1UKHA 4H3QA 3EFJA 4D2PA 2PVLA 1XR1A 2C4GA 4XCUA 5BYZA 4JDIA 2BALA 2P3GX 2PVHA 2ZM4A 4X2KA 4HVSA 3MGYA 4I1ZA 1J91A 3KXHA 3SG9A 1R39A 1FMOE 5DRDA 3V5QA 3R21A 5J1WA 2C6MA 2BZHB 1DI9A 5M44A 3DZOA 5KCVA 5EQYA 4BHZA 2BZKB 3ZRKA 4ITHA 4TT7A 3SDJA 2FO0A 3FY2A 3KULA 3VBXA 4DTKA 3E8DA 5BNJA 1CKJA 4K0YA 2HW6A 3CY3A 3ACJA 4CFXA 4YSMA 4GKIA 2C6DA 4EZ3A 4NL0A 3VS6A 1PXLA 3FKLA 3DQWA 3KCFA 1UV5A 3DA6A 2HZNA 2J2IB 3KMMA 4PDOA 3ZZEA 5IQIA 2B0QA 2W0JA 4FOBA 4L3LA 4MEDA 5LMBA 2JDTA 4DBNA 4V01A 5IQDA 1QL6A 4Y8DA 5HG7A 3R6XA 4ZAUA 4CKRA 4DCEA 1OIUA 4KIOA 3BHHA 5DR6A 2J9MA 2B52A 3IOKA 5IUHA 3NW5A 4IWQA 3RCDA 3Q96A 4EYJA 4FVQA 2UZWE 1OIRA 3F82A 3ZDUA 5AP3A 5AV2A 3TEIA 3MIYA 2OGVA 4NTTA 2OH0E 4B6LA 4E5BA 4IC8A 2GHMA 1OL2A 4AZSA 4FKUA 4P5ZA 3F5UA 5KMKA 1K9AA 1XH9A 2YIXA 3BV3A 3SA0A 3O71A 5HG9A 3R73A 2WD1A 4AGUA 2PPQA 3H9FA 4JQ7A 4X2FA 3LFCA 5LJJA 1P14A 5HX8A 3JPVA 2UW9A 2YAKA 3NYVA 3R1YA 2UZDA 3V04A 2PE0A 4I5MA 2XNPA 4F9YA 5IQBA 2VTHA 5LVOA 3Q4CA 3NNVA 4FOCA 4FV4A 4PPCA 3AMAA 4E4MA 5A4CA 4HGSA 3S00A 3GQLA 2QO9A 2QU5A 4S30A 4C7TA 1IAJA 4FV1A 3AG9A 2OXYA 2PE1A 4LYNA 4CT2A 5DA3A 2OZOA 5DRBA 4RA5A 1WCCA 4D1ZA 5L6WL 2JAVA 3QYWA 5IZFA 4X6QC 4BCPA 5CNOA 5HZNA 4NEUA 4DHFA 4F9AA 4FSZA 3C0GA 4TWOA 1PJKA 1TKIA 2A0CX 5HO6A 5TOZA 3UBDA 5JEBA 2JIVA 4MX9A 2UW5A 3QRJA 4LI5A 4NM5A 4XG6A 3VHKA 2X1NA 3WZJA 3JR1A 2YISA 3LMGA 4DFUA 4D2TA 4O0YA 3MTLA 3ORLA 4FL3A 2VNWA 1H1WA 4F0IA 4GKHA 3QRUA 4FNYA 2W17A 4D1XA 2R9SA 3LCTA 4RIOA 3UE4A 2C3JA 3AMBA 2G01A 3JY0A 2R3RA 2PVYA 4BI2A 4DEDA 1FVVA 3KXMA 2NNWB 4NW6A 4XV3A 2REIA 2X7OA 4EJ7A 3GU5A 5FTGA 3NR9A 4Y72A 3FMNA 2QODA 3UOJA 2R64A 4V04A 5CU4A 4QD6A 5H8BA 2RL5A 2UUEA 3BI6A 4XJ0A 3TT0A 4YZNA 4HVGA 4KINA 4NTSA 4RJ3A 4ZMFA 4TYHB 1HCKA 1TVOA 4MVFA 1RJBA 4CCUA 3SRVB 3ZMMA 3OEFX 4QMTA 2R3JA 3ROYA 2WELA 2IN6A 2BDFA 4D5HA 2C6IA 2OK1A 4KSQA 3WZDA 3SW4A 5K5XA 1PMEA 3DKFA 4F1MA 4RIXA 4KD1A 3GBZA 4IVBA 5EHLA 5HKMA 3DPKA 4JDKA 4RX9A 4K33A 3EQIA 2VTLA 4YZMA 2R3GA 3NW6A 4X0MA 3C4ZA 2WQNA 3DXPA 4WOVA 4R78A 3TV6A 1AQ1A 4QTDA 4DE4A 5FGKA 2XK4A 4C3FA 1Y6AA 4W9XA 4ZXTA 3FMKA 3TUDA 3IS5A 1TQPA 3OT8A 3N4VA 3PXYA 3G15A 4YTCA 3BEAA 3R9NA 3UIBA 3BYUA 2VNYA 4F9CA 4MCVA 1ZWSA 3ZLSA 5IG1A 4XP2A 5L6PA 2OJ9A 4YU2A 1XO2B 2ZV8A 2W1HA 4FSRA 4ZP5A 1H08A 5EW9A 2IVVA 3QRKA 4A9TA 4B8MA 4A06A 3HDMA 1CKPA 4BB4A 2VN9A 3D0EA 3H30A 3N51A 4CKIA 3PZHA 1BUHA 4IW0A 5HHWA 3IDBA 4XBUA 4F99A 2XEZA 1JPAA 4L67A 4GV1A 4USFA 3KF7A 3F5PA 3NIEA 2EXEA 3PVGA 3QUDA 5EK7A 3OWPA 3R8PA 3R83A 3KGAA 3ORMA 4FZDB 4MF0A 1UWHA 4FTTA 4YJNA 4AW2A 3KU2A 5JRQA 3C5UA 4OAUC 2FSTX 4FNWA 5D7AA 3LFDA 3GU6A 1MRUA 3R63A 3ETAA 1S9JA 3HYHA 3KN6A 4JAJA 3W2SA 2RFEA 3QQFA 4BZNA 5ACKA 3WYYA 3QUPA 4FT0A 3AC8A 4AT3A 3CQWA 2PUNA 3A2CA 4C2WA 4FTKA 2BVAA 4MXZA 2XMYA 5AUYA 4JX3A 3UP2A 2YWVA 3VULA 4AWIA 3TN8A 4L00A 5AV4A 4YUQA 3O0GA 5KBRA 2XB7A 3GU4A 3ZSGA 4B4LA 4C4JA 5GHVA 5EOLA 4ZK5A 3GGFA 3TTIA 4DFXE 3A61A 3OOGA 3OBGA 1T46A 1WBOA 2W5AA 2WEVA 5L2QA 4CQEA 3UJGA 4E8AA 4FIFA 4G9RA 4KUJA 5BUJA 5ETCA 4BTKA 5LMKC 2ITOA 3FEGA 2WB8A 2W99B 3FHIA 4UBAA 4J71A 4GL9A 4NFMA 4XG3A 2OKRA 2PVKA 3RKBA 3UPZA 1BMKA 3C51A 4FKIA 4NKSA 3REPA 2CN8A 3HUBA 2BAKA 4IM2A 3EFWA 3K2LA 2I0HA 3DBQA 1Q5KA 4J98A 3FZSA 3VO3A 3LFAA 3RK9A 3G0EA 4YO4A 4EK8A 4L44A 4BDEA 3NNWA 5IISA 4W4VA 5HE0A 1GNGA 4BBFA 2FSOX 3O17A 1Q41A 2AC3A 4RBLA 1KE7A 2CCHA 3ATTA 3VBVA 4R8QA 3ZS5A 1BX6A 3V5LA 4IDTA 4EOQA 4O82A 3ZONA 3LJ2A 4EHVA 3VBQA 4F0GA 3G0FA 5AAFA 3ZEWA 4U45A 3G5DA 5EKNA 2I40A 2WQOA 4LM5A 3DDQA 1LEWA 3OROA 4JQEA 4C0TA 4D28A 4AP7A 2XKCA 1J3HA 2VX1A 4KKEA 1ERKA 4IDVA 3UGCA 3VUTA 3AT2A 3NAXA 4C02A 4O83A 1OECA 3SXFA 1FMKA 2XKEA 3AD5A 5LVMA 2R0UA 5IF1A 2J4ZA 4BIEA 2GS6A 4R5YA 4GFOA 5DR9A 2QVSE 1HCLA 1URWA 3BHYA 3OMVA 4FTJA 2BKZA 3VS1A 4JOAA 3TNHA 3MSSA 4E4NA 2F7XE 2XP2A 4S2ZA 3QGWA 4TTHB 4IZAA 4USDA 2XNGA 3PUPA 5DMZA 4EHEA 4TRLA 4ZLYA 2YIYA 3UVPA 3KREA 2H6DA 2V0DA 2Q0BA 3MY0A 5IQFA 2H9VA 5CEMA 2YM6A 3ULIA 3FE3A 2CCIA 2Z7LA 4BFMA 2ITWA 4ZS4A 3Q4ZA 2JFLA 4C59A 5FQDC 5JT2A 1R0PA 3Q04A 4RVLA 3A7FA 3CJGA 2XKFA 1OB3A 3VS5A 4AACA 2QC6A 4GRBA 4GG5A 5CEOA 1OM1A 5K0KA 4O7SA 5GIPE 4NCTC 3PA3A 5C26A 3DFAA 4IACA 2XF0A 3QF9A 4MBJA 2YDIA 3HVCA 3EN5A 3WYXA 5FEQA 3EYHA 5EM5A 2VO6A 4MWHA 2YJRA 4RJ8A 1O6YA 1BLXA 3ATSA 3PSBA 3SX9A 2PVRA 5JKGA 2BAQA 4ENXA 3TUCA 4CFWA 4FTNA 3DS6A 2ONLC 4YTIA 4YP8A 4O0XA 2YACA 3D7ZA 3EQDA 4HZRA 2E9OA 3LVPA 4MBIA 4FG8A 4G16A 3OWLA 4ZIMA 3UIXA 4IEBA 4DC2A 3N9XA 2GHGA 1DAWA 4BZOA 3ENHA 2EUFB 4EH5A 3O8PA 3OTUA 4PL5A 3VHEA 1Q97A 2CJMA 5C03A 4E5AX 3FJQE 4RG0A 3S3IA 2BHEA 3DV3A 3IGOA 3W2PA 4D4VA 5IQEA 2X2LA 4KABA 3QQLA 2A2AA 3TL8A 2CNVA 4OTHA 3QXOA 4R7HA 3LOKA 2W1CA 5AP2A 3FPQA 4XLVA 1Q99A 3LM0A 4Z7GA 2IW6A 4RMZA 1GZKA 3QD2B 4QQ5A 5HX6A 3KQ7A 3HDNA 3Q9ZA 3D5XA 1UU8A 1URCA 1YVJA 2OICA 2W7XA 4QT1A 4O0UA 4N57A 1STCE 2R3FA 3GU7A 3R7OA 5D12A 2YITA 3BE9A 4XLIA 3W2RA 3ZBFA 4U8ZA 3CTQA 4UWCA 4NH1A 5CI7A 4O0SA 4UMTA 1UVRA 4DT8A 1MQ4A 5A4LA 3F6XA 5AJQA 2ZM1A 4C3PA 1JAMA 3A8WA 2R3HA 3CTHA 4RFMA 3FQSA 1V0BA 4R1YA 3IO7A 5HVJA 3FZTA 3FLWA 4O38A 4O7ZA 2PTKA 3F3WA 3DKCA 4Y73A 4BDIA 3IDPA 2JKMA 4X6RA 3L9MA 4NK9A 4F70A 2IVSA 4AF3A 1ZMUA 4M68A 2OF2A 3D4QA 4HJOA 3CY2A 3QLGA 4PUZA 3V3VA 1YWRA 3OC1A 1E1VA 4JNWA 3RPSA 1OZ1A 2B9HA 3W16A 3UC3A 3PXKA 4EH3A 1B6CB 4KNBA 5M4FA 5FTOA 5HLPA 2IW9A 3SV0A 1QPCA 4U9AA 3TNIA 3QTXA 4I0TA 1BI8A 4E20A 1TQMA 3BKBA 5LVLA 3LHJA 5EI8A 3QGYA 1PYXA 1JKSA 4UWYA 2I0VA 2ITZA 2UVXA 2WMWA 4XX9A 2J6MA 4IZYA 5HG8A 3ZCLA 1XWSA 3NS9A 2ZDTA 4UV0A 2C3IB 4C4FA 4DG0E 4FC0A 3DK3A 2X2KA 3HRBA 3MBLA 4FTRA 4HGEA 4UWBA 3MN3A 2PULA 1Y6BA 3KKVA 3ZFYA 3Q2MA 4C62A 2YEXA 3MESA 4IH8A 4UZHA 3PPKA 3WOWA 1U54B 2XJ0A 5CF6A 2QOCA 3WILA 2ZB0A 4MQ1A 2VZ6A 3W8QA 4CG8A 4TWNA 4I0SA 4QMQA 3FZPA 3VVHA 5AUWA 3QA8A 4D2SA 5M09A 1YWNA 2A27A 3ERKA 4BTFA 4ZSGA 4KIKB 4QYGA 3MTFA 3T3UA 4IAAA 1JSUA 1IRKA 1OL6A 3I81A 4K18A 1WAKA 5HU3A 5KMMA 2WKMA 3R2YA 2RG5A 1NXKA 2ITUA 2ZDUA 2CGXA 4ALVA 5FLFA 5AM6A 2IW8A 4E5WA 3DNEA 4CYIA 2W4JA 2YJSA 4N0SA 5HNIX 5AMNA 2JAMA 2VWZA 3K5UA 3L9PA 4FKLA 4TYGA 4KRCA 4U6RA 3PSDA 3K5VA 4F08A 2BFYA 3FMEA 1DS5A 4FKVA 4BDDA 3RALA 2HAKA 4CFFA 4YR8A 4FSWA 4ZSEA 2RSVA 2X4ZA 3IW5A 3QTRA 1Q3WA 3COKA 3C4CA 5M07A 2XCHA 5LVPA 4FIHA 3LLAA 2YIQA 3NUYA 3PG3A 4DFNA 4RJ5A 2WTWA 4XP0A 4FKPA 4RVTA 5CXZA 4O81A 1Q61A 1XJDA 2UZBA 4OTIA 1YXXA 2F2CB 4FSMA 4QP3A 4XH6A 4KS8A 4HW7A 1ZZLA 2O5KA 3TIYA 3O7LD 1M14A 3IKAA 3PTGA 4GT3A 4H1JA 5JQ8A 3EQRA 1O6KA 3D5WA 3G9LX 3ITZA 2OJIA 5GJDA 3R9OA 3VBYA 3VC4A 3Q32A 3WF5A 1XKKA 3RWPA 4DGGA 4BRXA 1H07A 2R3QA 4BCQA 2EB3A 4CZYB 4XV2A 2C6TA 2XKDA 1UU3A 2F7ZE 2VWUA 3NIZA 4FTUA 2GS2A 2YM7A 4QMXA 4ZEGA 5T3QA 4AW5A 3FMHA 2O63A 3EN7A 4GVJA 4M3QA 4LUEA 1P4OA 4LGDA 4YZDA 5BPYA 3AC1A 4NIFB 4BI1A 4AE9A 2CGVA 4OT5A 5DE2A 2C69A 3VF9A 4O7NA 2BMCA 5I3RA 2IO6A 3SG8A 3FYKX 2Z60A 4Q2AA 5J8IA 4Z16A 3DAEA 2X8IA 1PF8A 3FLQA 4QTCA 3QZFA 2G2IA 4ZLOA 4OT6A 4UMQA 4RT7A 3GENA 4G34A 4DEEA 4M14A 2FUMA 2YFXA 4F0FA 1E9HA 4PY1A 3LFNA 2BRMA 4L7FA 2QG5A 4LOOA 4U41A 4XBRA 3R7IA 2CKOA 3UNKA 4MXOA 4ASEA 4KBCA 1OUYA 3F7ZA 3H10A 3GU8A 2W9FB 2ZVAA 4RGJA 3EB0A 1PKDA 1YXVA 4XNEA 2YHVA 4XHKB 2XK7A 1ND4A 3CGOA 1APME 1ZYSA 3BLQA 3D7TB 4YHFA 3HEGA 2BR1A 3EIDA 4WRSA 4F7SA 1WBSA 1KWPA 4GG7A 2QURA 4WA9A 3KMUA 3LCSA 4TYHA 5E90A 1QMZA 3R0TA 3PE1A 3EOCA 5CVHA 2Z2WA 4IB1A 2ZMDA 3SRVA 3F66A 4F4PA 1REKA 2YWPA 5AM7A 4PRJA 2P2IA 2IZTA 4Y46A 4U81A 5BVFA 5HBHA 3WE4A 5JQ5A 5C1QB 3PVUA 3MFSA 3HGKA 2PK9A 3ID6C 3WZUA 2X9FA 4JDJA 3TZ7A 1LR4A 1R3CA 4ZTQA 4RVMA 4AA5A 2WXVA 1SYKA 5LCJA 3ENMA 3PRFA 4FKWA 3LE6A 4AS0A 1JLUE 3EQGA 3R8MA 2AYPA 5CSPA 1ZMVA 4DCAA 3QKKA 4YJPA 1NY3A 3EQCA 1H1QA 4AN2A 4U42A 2C5VA 5E8YA 4P4CA 3BU6A 2VUWA 4HPUE 4EK4A 3NX8A 2DS1A 1JBPE 4DITA 1Q3DA 2Y9QA 3ZUUA 3V8WA 4CFVA 1BI7A 3NLBA 2XBJA 4NT4A 5B7VA 4BBEA 1WBPA 2O3PA 3Q53A 1MP8A 1REJA 5I3OA 3GCUA 4WG3A 3G51A 4BCIA 4NKAA 3AC4A 3V5WA 4WO5A 4BWXA 4FEWA 4BI0A 4FV7A 3LFFA 4BDCA 4BCNA 4TKSA 3MV5A 5ANGA 5TE0A 1MQBA 4AGCA 4E3CA 3FSKA 2WMQA 3I79A 5HESA 3L9LA 3HV4A 4QP7A 3R02A 3QTSA 2YIWA 5EOBA 4XOZA 2X39A 4GT5A 3PY3A 4YNOA 5IQHA 4WG5A 2P55A 5L2WA 2IVUA 4PPBA 2PMNX 3NZ0A 2HY0A 3BLRA 3BLHA 4UN0C 5JK3A 3KXGA 2X81A 4UEUA 5FRIA 4D0WA 3F2NA 2JDVA 3KY2A 1G3NA 4WSYA 2R0IA 4QYYA 3WBLA 2FH9A 3W8LA 3RHKA 2BTRA 2HK5A 4YHTA 4O7YA 4O1OA 1VJYA 3OBJA 3ZO3A 3OUNB 3VQUA 3RNYA 4DFYA 4MNFA 4E6AA 3PLAE 4LQMA 1Q8ZA 4ALWA 5M4IA 2XM9A 4BDHA 2ACXA 3OXZA 3TZ9A 3VAPA 1WVXA 2O64A 3I0QA 2W5BA 4IIRA 3NVMB 4F6UA 3VW6A 2YLEA 5E9EA 3I5ZA 4JAIA 3DNDA 2OW3A 3CKXA 3QFVA 3MWUA 3RBWA 2EU9A 3T9IA 1Q8UA 3BBTB 3FMMA 3VBWA 3RTPA 4EHZA 1YXTA 1OKYA 4MXXA 2FA2A 1XH7A 4O0RA 3U51A 2ZAZA 3U9CA 1H28A 4BKZA 1U5QA 3VUGA 5I9YA 4GK3A 5J9LA 3UPXA 4BCGA 3COMA 3E64A 2OU7A 1SZMA 3PJ2A 2XNMA 3PIYA 4AT4A 3G6GA 3MPTA 3PJ8A 3EZVA 3QQKA 4QQCA 4C57A 4BIDA 4RIYB 3EQHA 4PPAA 3MH0A 3QX4A 4NW5A 3SKCA 2JKOA 5L2SA 5E8SA 5C4KA 3MPAA 3UOKA 2WTCA 3E92A 2V62A 5DR2A 1YOLA 3QHRA 4M8TA 2RG6A 2XBAA 4MHAA 3SXSA 5FDPA 4CFUA 2C0TA 2XH5A 5ANJA 1FGIA 3FAAA 3PA4A 4A4LA 4YURA 4FE2A 5EFQA 1OPJA 4MAOA 4B9DA 5IMXA 3Q5ZA 4M15A 4BHNA 3LQ8A 3V8SA 4E26A 3IECA 5ETFA 3L8PA 2QONA 2ITQA 2XRWA 2V5QA 3MFRA 5HORA 5I9XA 5K0XA 3L9NA 4YBJA 3CTJA 5CU3A 4FIEA 4PQNA 5DH3A 3COHA 3WF6A 2E2BA 3QALE 2RKUA 3NEWA 3VRYA 5E8XA 5AAEA 5K3YA 4C4GA 2P2HA 2ITYA 3NUSA 5EQPA 1F5QA 5CSHA 4CT1A 3EFKA 4G17A 3C4XA 4QP2A 4LMUA 1W82A 4R1VA 5L8KA 3P86A 2EXMA 3RJCA 4FK3A 1GZ8A 5CT0A 1KSWA 3OCGA 3Q6WA 3BYMA 2ESMA 3LJ0A 3ORZA 5M4UA 4L53A 4ZTNA 2PZPA 1H25A 4QYFA 3R04A 1PHKA 4FKSA 3ZZWA 1YI3A 1A9UA 2I0EA 5CSWA 4DGNA 2HZ0A 2JDOA 3P7CA 4H3BA 3VJNA 4OTDA 1J7UA 5AUXA 3BBWA 5IH4A 3IK3A 3BU5A 3RK5A 1GZNA 1XBAA 1R1WA 3DK7A 2GQRA 2R5TA 4DFZE 4EZ7A 2PZRA 2XK6A 3FUPA 3TTJA 4ANQA 4MBLA 3O8UA 5ANEA 5AV1A 1S9IA 1PMNA 1OKZA 4Z55A 5C8NA 4D2WA 3U55A 2CKPA 4KAOA 4BBMA 1A06A 5IA1A 4ZTRA 3UO4A 1XQZA 2ETKA 2ITPA 2UZTA 4NM3A 2HWPA 2PYWA 3P0MA 5EDRA 2B53A 3UC4A 5FD2A 4PDPA 5C8MA 4CMTA 5J87A 1YDTE 1GZOA 1OGUA 3CEKA 5IDNA 4KWPA 4K77A 3MH3A 3PY0A 3BGPA 5HVKA 5FBNC 5BVWA 5L2IA 3LMIA 5L4QA 2PL0A 4KBKA 3EZRA 3POOA 3RP9A 2BCJA 3DTWA 3P7BA 2QI8A 4EQMA 5M56A 1RDQE 1LP4A 3BE2A 1L3RE 3O51A 3BQRA 3LFEA 4DF3A 3WZEA 5EM8A 3R28A 4BCJA 3VWAA 3UYTA 5KO1A 2R7IA 5EYCA 4D4RA 3NYNA 5H8GA 1SVHA 2QLQA 2PZIA 4JBPA 4O21A 3VS4A 4RJ7A 4Z9LA 3RPOA 3E93A 3IOPA 2JDRA 3ZO2A 1KOBA 3KB7A 2B55A 3NWWA 3ZRLA 3SC1A 4CG9A 1CMKE 2PMLX 5EH0A 2BFXA 4EOIA 2J0MB 2Z7SA 3GVUA 3W55A 5F9EA 3GT8A 4A9RA 2PUUA 5F95A 3TZMA 3ZSIA 4YHJA 5J79A 4GW8A 2ITXA 4ASDA 2WMRA 3EN4A 5K9IA 1JSTA 3NNUA 5FXQA 4YTHA 4ZZNA 4JG7A 3PXRA 3QTUA 4WT6A 4EUTA 3IPHA 5CEIA 5KX8A 4PTGA 4U97A 4HYIA 1Q8TA 2YA9A 3PYYA 2C6LA 2GFCA 2EVAA 3FDNA 2CDZA 2QR8A 5AX3A 3I4BA 4NSTA 2J0LA 2WMTA 1NVQA 3AC5A 4IB5A 4M13A 3KA0A 3PXQA 4JX7A 4XV9A 3UZRA 5EDQA 4C33A 4OTRA 1YHSA 2UVYA 4YTFA 3U54A 3ZLWA 3D5VA 4PDYA 1WBVA 4KB8A 5M08A 3S4QA 4GU6A 3I6UA 3VUIA 3QL8A 3UQFA 4IMYA 4QMPA 5AP1A 3TG1A 1ZYCA 2J90A 1NT2A 1YQJA 1OIQA 3O8TA 3LAUA 4FKJA 4MK0A 5E1SA 5TF9A 3ZEPA 4EWQA 2YZAA 4FTQA 3NPCA 4EYMA 3SLSA 4DH5A 3WI6A 5LWMA 3D2IA 4FV3A 4G9CA 1PKGA 2ITNA 1Q24A 5D9HA 4BDJA 3EKNA 3VS7A 2Y4IB 4H58A 3ORXA 4KIQA 3DB6A 4W9WA 4UZDA 4Y85A 3HA6A 5JMSA 4YJVA 1Z9XA 3BELA 1E1XA 3VIDA 2F4JA 4I23A 5CZHA 5JFVA 4GH2A 4CV9A 3TDWA 4KSPA 5BQ0A 5CEPA 3ELJA 3ZUVA 4RRVA 2W1FA 4BF2A 1BKXA 3H0ZA 2OJFE 5CX9A 1H0VA 4JR7A 4YPSA 4ZY4A 4DTBA 1YW2A 1VZOA 3OTVA 4CV8A 5LMAA 3DQXA 2BIYA 5A54A 4AA4A 1U54A 3PIZA 1TQIA 2HYYA 1K2PA 4ORKA 3OHTA 4BDBA 4BDFA 3G9NA 5AIRA 3R8LA 2W1DA 3OG7A 4ANNA 2YDJA 1PXPA 3DCVA 5IA4A 3T9TA 1AD5A 3FC1X 4D58A 2WEIA 4JBVA 4BTMA 1ZOGA 4ZJIA 4I21A 4FNXA 3KXNA 4V0GB 4KIKA 2PHKA 5HG5A 3SGCA 1GJOA 3NCZA 5FBOA 1ZY4A 3Q9WA 4TL0A 4ACGA 5L2TA 4EORA 1W83A 5AR5A 2VV9A 4UALA 1CKIA 5HOAA 4A4XA 4F6WA 2YM4A 3F9NA 3FI4A 2PMIA 1OIYA 3IW7A 2PVFA 5DOSA 3CP9A 4J97A 2JKQA 4YO6A 4AAAA 3BX5A 4EOMA 4DLJA 3HAMA 4GIHA 2BTSA 4FEQA 3C4EA 3MA3A 4R6VA 3RAKA 2CPKE 2P0CA 3OEZA 2GMXA 2XEYA 3PFQA 4S33A 1HOWA 4WNPA 2Z7RA 2G2FA 3DAKA 3QD4A 4LL5A 3KMWA 5FP6A 2VTNA 3F5XA 4HCVA 4N4SA 3ZUTA 4M0YA 4AU8A 2LGCA 5E8WA 5EYKA 4B8LA 3QUEA 1WFCA 5TT7A 4DH3A 2VTMA 3F3ZA 5LOHA 4L6QA 1W7HA 4O84A 4QMOA 3A7IA 3LMHA 2BZJA 3KULB 2VTJA 4R77A 1NVRA 2HXQA 3GFWA 4FV0A 4ZJVA 2F2UA 5IEYA 3K3IA 3BCEA 1PXOA 3FKNA 3I1AA 5KKRC 3NYOA 4M0ZA 4EEVA 3AMYA 5EW3A 3CQEA 1XH6A 3TXOA 4AA0A 3U6HA 2UV2A 3RZBA 3Q4UA 3AT4A 3OY1A 4QP8A 2J0KA 2OJGA 2UZOA 3UNJA 2C0IA 4FV9A 4GUBA 4FF8A 4FGRA 2O8YA 1XH5A 5EI2A 3UZTA 1GIIA 1UNLA 4QMZA 3BPRA 2HW7A 3VS2A 2BKKA 3HKOA 2W4KA 4EOPA 4IJPA 3H0YA 1YXUA 4LUDA 5AV0A 5EKOA 3TUBA 1PXKA 4RC2A 5AP5A 3E8CA 4NIFA 4PMSA 5I9WA 3NSZA 4AW0A 5HNGA 3FZOA 3A7GA 2W05A 3CGFA 3UQGA 5CLPA 2XZSA 2QKRA 4OW8A 3TCPA 5CXHA 5BX0A 4H39A 3CS9A 2WNTA 4TYJA 2QOOA 4JRNA 3DDPA 4JL9A 4AT5A 3R9RA 3GCSA 5DG5A 1YHVA 5CASA 2I0YA 2X0GA 4AUAA 2YLFA 3FLSA 4AW1A 5K4JA 2XA4A 4CTBA 5ICPA 2Y6OA 2CN5A 3A99A 3QQGA 3VS0A 4ACDA 3GC0A 4AZFA 2XNEA 3HRFA 2BPMA 4O7VA 5AR8A 2XIRA 2GNGA 2VWWA 1X8BA 4YNEA 5HBJA 5HD7A 5LMKA 5KZ0A 4H1MA 3R8ZA 4UY9A 4NUSA 1FBNA 4FODA 1J7IA 4CMOA 1SVGA 4HCUA 5HCYA 1H0WA 3ZOSA 1SNUA 1ZYDA 5IH6A 3UO6A 2GNHA 2BUJA 2XIZA 3GFEA 3P79A 3QX2A 2YN8A 5BYLA 4IJ9A 5CNNA 2VWBA 4O6EA 4GVAA 1OKWA 4FKRA 1PY5A 4JS8A 4ZOGA 3OD6X 5AX9A 2VTRA 4ZSLA 4C38A 4MYGA 4X2NA 5JFXA 4WUNA 1XH8A 3CR0A 2C3KA 4CTCA 3TV7A 3OF0A 4FG7A 4C3RA 3V51A 5F94A 1G8SA 5JGAA 3ORKA 2XNNA 3FLNC 5BVDA 4W4YA 2UW8A 4RQKA 5JZNA 4EOOA 5A4QA 2BHHA 1OPKA 3FV8A 3RPRA 4FZ6A 4JLCA 4QYEA 5CSVA 4FTMA 4IFCA 2EWAA 5EI6A 1YDSE 4C2VA 4ZLZA 3LXPA 3CXWA 3OVVA 3QQJA 4BCOA 5CF4A 4ZTHA 2Y7JA 4XUFA 4EONA 3FXZA 3QCSA 4QQTA 3P9JA 3DFCB 5GNKA 3OOMA 3W10A 3C5IA 1WBTA 4RIWB 3AT3A 3GNIB 3PLSA 4MNEA 2YDKA 3RZFA 4EOLA 4EZ5A 5I0BA 4J8NA 3TM0A 2UW6A 3G2FA 4KBAA 3FHRA 5HICA 4O27B 3SOCA 4L43A 5BVKA 3EQBA 4PP9A 3L8SA 4TZRA 3I5NA 4I0RA 5DEYA 4FTIA 4DH7A 2JDSA 4APPA 5BMSA 2V22A 4FT5A 1WBNA 4AE6A 1FVRA 1GAGA 1VEBA 4FNZA 1K3AA 4G6LA 4I6HA 4GJ3A 3WIGA 2WGJA 1YKRA 5CT7A 3A4OX 5D10A 2ZYBA 4RC3A 3ZLYA 5DGZA 2VO7A 3QZIA 4P90A 3CCNA 3BEGA 3O7LB 3UODA 4R7BA 2A1AB 4BN1A 4Y5QA 3VUHA 4BDGA 4ID7A 4OTQA 3ZU7A 3DOGA 1J1CA 4UXQA 5H9BA 4NCTA 3W18A 4CFNA 3LFSA 3HAVA 5E92A 4O0TA 4EUUA 4I6QA 5CU0A 4IAFA 2X6EA 3CC6A 4BYJA 4YLKA 3UIMA 3POZA 3QYZA 5ETIA 5M55A 3B2WA 1Q62A 3H4JA 1W98A 3D15A 3MY1A 4FL1A 4AZEA 2W1EA 3C7QA 4AOTA 1XH4A 4DEAA 1QPDA 2IWIA 1OL5A 4I94A 4ERKA 2KTYA 4A9SA 5DT0A 3H9OA 3UNZA 3FL5A 3ZSHA 4C61A 1WBWA 4QMVA 4CZUA 2ZV7A 3E5AA 4FVRA 3PVBA 2YCFA 3LCKA 5E8UA 2UVZA 3UVQA 3ZH8A 4X21A 2CHLA 4GIIA 3EKKA 1AGWA 4RIYA 3AOXA 5ANIA 5JSMA 4FV8A 3R30A 2B54A 3DBCA 4OR5A 4PMMA 4QMSA 3LZBA 4GK4A 3FKOA 1M2QA 4I93A 3B2TA 4I3ZA 3AD4A 5HVYA 4EH7A 2C1BA 2NRUA 4FIJA 3U4WA 5BUEA 3EYGA 3V6RA 2XM8A 4M12A 3PWYA 2OIDA 4EBVA 3E8EA 3CE3A 1OITA 3DBDA 2R3MA 4L45A 3HMPA 2F9GA 4AGWA 2JBPA 4L52A 1JKKA 5HIBA 2ZMCA 4QRCA 4L42A 3GC9A 4ANLA 1Y8GA 3JVSA 5HQ0A 3ET7A 5BVOA 4BY9E 2OO8X 2R3PA 4FTAA 5I4NA 3EL7A 5I5ZA 5IA2A 2IZSA 3GXLA 1KV2A 4YZCA 5J7BA 4CQGA 4ZZOA 4O7RA 3DGKA 4R3RA 1W84A 2YIRA 2WMUA 4YJOA 4HOKA 3NUUA 2WQEA 2QD9A 4BC6A 3A62A 4BKYA 1W0XC 1ZARA 3W2QA 3PE2A 1MUOA 3JS2A 4FZAB 4LOPA 3S2PA 2XJ1A 2NPQA 4GS6A 3DKOA 4IM0A 5CEQA 3SQQA 4BCMA 4DEIA 3KRLA 3Q5IA 3PWDA 3HMMA 1JQHA 2CGUA 2HCKA 1A48A 4RSSA 2ERZE 5I9ZA 2DWBA 3P23A 4XOYA 4HVDA 2BRBA 4GSBA 2QCSA 2J5EA 3IW8A 4IVCA 4R5SA 2GNIA 4NJ3A 5A6OA 3ZC5A 4WNKA 4O7TA 4QOXA 1Q4LA 3EFLA 4FSQA 5D41A 4F1OA 3M1SA 5T6KA 2C5YA 3R7YA 4HNIA 3HV7A 3JUHA 4PP7A 1O6LA 3Q4TA 2V55A 3MVMA 4LV8A 5EYMA 4R3CA 2O0UA 3V5JA 3MJ1A 3ZBXA 4BTJA 3M42A 4E6CA 5C9CA 2W4OA 4QTEA 5FP5A 4EL9A 4TNDA 5LXMA 3FI3A 1NW1A 2Y4IC 4H05A 3QA0A 5CALA 3MH2A 4I5HA 1H4LA 2PE2A 2O2UA 3RK7A 4U5JA 4IADA 2UW0A 4FZFB 5AAGA 2XUUA 4D4YA 3OUKA 5DPVA 1IASA 3KK9A 4YZBA 3RM6A 5BVEA 4EKLA 4FTLA 1JNKA 4X2GA 1I44A 4ZZMA 4AQCA 3CPBA 1FINA 3FWQA 1YRPA 3MI9A 4NM0A 5JRSA 5AFVA 2QNJA 2H96A 5FM3A 3QWJA 4G6OA 5ANDA 2UZEA 4F63A 4X3FC 2PVNA 1ZMWA 4PDSA 4YJQA 1P5EA 1U5RA 2WOTA 2OG8A 3LXLA 3BGZA 4Y83A 3UIUA 4EKKA 2C0OA 2WMVA 3T3VA 4IQ6A 5HTBA 3R01A 4XG4A 3C9WA 5DFPA 3R9DA 4C36A 4RZWA 5J5SA 1ZOHA 5DLSA 2RIOA 4IAKA 5H3QA 5JFWA 1V0OA 4XYFA 2VTPA 4J8MA 4EWHA 2IPXA 4DTAA 5HE3A 2LAVA 5IPJA 3OW3A 4ZY6A 4JIAA 2YCQA 3I7BA 3QXPA 4A7CA 5K5NA 2ZOQA 2Q0NA 4M97A 3ALOA 3OCTA 4F09A 4WHZA 2XIYA 3F3VA 3VJOA 5J7HA 1CDKA 2IJMA 5KMLA 4TYEA 5HIDA 3R8VA 2B9IA 2XS0A 3R00A 4BWKA 2QOFA 3TIZA 4C58A 5M53A 5DT4A 3KRJA 3FQHA 4FEXA 3G90X 1ZYLA 4C4EA 2RGPA 2WFYA 2BAJA 5GIOE 5IU2A 3M2WA 3KXZA 3QAME 4CRSA 5EDPA 4FA2A 3D5UA 3PIXA 1GY3A 2A19B 1PXNA 3TNWA 4QTAA 3V6SA 3HV5A 3BV2A 3IDCA 4C8BA 4IFGA 1G5SA 1SM2A 3A7HA 4EK5A 4ZMEA 3SOAA 1ZOEA 3MH1A 3I7CA 3ZM9A 4HVIA 4FR4A 2C47A 5KKRB 3ZYAA 3O2MA 2GCDA 5FEDA 3HECA 5HE1A 4A9UA 2C5OA 1M17A 2VTSA 4RVKA 3TJDA 3OXTA 1ZZ2A 4Z7HA 4G3DA 4KIPA 5HE2A 4TPTA 1WMKA 1WVYA 3DAJA 2OXXA 2YM5A 2ZV9A 4FG9A 3ZXZA 1V1KA 4MH7A 3BRBA 2F57A 4G3CA 2PWLA 4XEYA 3OY3A 3P5KA 4PMPA 4MD8E 4QQJA 3F61A 4IHPA 4I41A 2OZAB 2VAGA 4IAZA 3KK8A 5DNRA 5BUIA 5E8VA 2WAJA 5HLNA 4I20A 3P4KA 4LMNA 5IDPA 2VU3A 3ANRA 5C01A 4PNKA 2YCRA 3HP5A 4FYOA 4LFIA 4O22A 3UDBA 3FZRA 4ACMA 4FSTA 4Y5HA 4ZJJA 5BYYA 3QKLA 3TJCA 4ANMA 5KMJA 4LOQA 3KF4A 4YMJA 2GTNA 3MPMA 4CZTA 3KL8A 3TKUA 4BDKA 3PXZA 2PU8A 5L8LA 4TWPA 3CQUA 1ZAOA 3TACA 3CKWA 2B9FA 2R3NA 4IAIA 2VWVA 4U43A 5BMMA 3C4FA 4B99A 4O0VA 3HNGA 5BVNA 5E1EA 4FGBA 4OTGA 3K54A 5CQUA 4WD5A 4FZ7A 5J95A 2YABA 4BIBA 3PP0A 4M66A 3ORPA 3UZPA 4UMPA 2JIUA 3PJCA 4LV5A 3RPVA 3PA5A 3E87A 4FI1A 4U3YA 4GT4A 1VR2A 3UVRA 4EJNA 4QMWA 2UZNA 3GQIA 2W9ZB 5AADA 4PL4A 2VD5A 5AR7A 2Y4PA 4RQVA 4BDAA 4DEHA 5KHXA 1L8TA 3ZLXA 1Z5MA 3GCPA 3KRRA 4ZTMA 2EB2A 3CD8A 1OBGA 3GC8A 4APCA 4QP4A 3N4TA 3OXIA 4IX5A 2IVTA 3ALNA 3D83A 4OGRA 4A4OA 5KMIA 4NU1A 2EXCX 5D1JA 1SVEA 2WTKC 3VBTA 3ODZX 2QOBA 5F20A 5H2UA 4E4XA 1OUKA 3TZ8A 3DZQA 4IVDA 4K1BA 4O7LA 2GQSA 4FSYA 3R7EA 1M2PA 3P7AA 4USEA 5C8KA 4D55A 4CMUA 4RWLA 3QHWA 2WU7A 4GUEA 4JBQA 4DGLC 5A4TA 4FT9A 3W33A 2OH4A 3U6JA 4W8EA 1NA7A 4FX3A 5G1XA 3NUNA 4BICA 4CYJA 3MW1A 4ZTSA 5LCKA 2PZYA 4G31A 3U87A 4YJTA 4FEVA 5AP4A 3BYSA 3MB7A 1IR3A 2GPHA 5L6OA 4X3JA 4CLIA 3NGAA 3PRIA 1IEPA 4M67A 4CXAA 4DH1A 2G9XA 4LGHA 5CTPA 4M7IA 1YXSA 1MRVA 3ORTA 2X6DA 3FI2A 2BRHA 1P2AA 2UZLA 4CFMA 1J7LA 1DI8A 2W06A 4N6YA 2CNQA 4WBOA 3F2AA 3BZ3A 2VGOA 2FSLX 4BCHA 4Q9ZA 3JY9A 3R1QA 1M7NA 4IX3A 3VUDA 3WF8A 4L7SA 2V7OA 3KVWA 2X7GA 3M11A 4J99A 3LJ1A 4YC3A 3UOLA 1QPJA 4P7EA 4HVHA 4HZSA 3KCKA 4H3PA 4JG8A 3RNIA 2VGPA 3BU3A 3EQFA 4GYIA 3S1HA 3QZGA 4Y95A 1JKLA 4ARKA 4F7JA 4DFBA 2QOIA 3H3CA 2RFDA 3VS3A 4KA3A 5KHWA 2PMOX 3LW0A 4ITIA 3FMDA 4OLIA 5AR4A 5JZJA 2BDJA 4HGLA 1PYEA 3AXWA 3F3TA 5IUGA 2PUIA 3GB2A 1F3MC 4U7ZA 5GJGA 3DK6A 4NM7A 4E6DA 1KV1A 1RW8A 2VTOA 3C1XA 4FT3A 4LRMA 4G6NA 4DBXA 2J50A 2QHMA 2HWOA 1LUFA 5HO8A 4FT7A 3QCYA 2JKKA 3UTOA 5AUUA 2QOHA 2B9JA 4G3EA 4NZWB 4WSQA 4IANA 4IWDA 2ZM3A 4FICA 4N70A 4EOKA 1Q8YA 3G33A 4C35A 3RI1A 3BHTA 3MYGA 3HV6A 4FYNA 3ZTXA 2VWIA 4EK3A 4OAVB 4J53A 4M69B 5D11A 3A7JA 4GJ2A 5IQGA 4FEUA 2UW4A 3C13A 2WMXA 3FBVA 5HNBA 1RQQA 2Z8CA 5KZIA 1CTPE 2X8DA 4OTWA 3W2CA 4IC7A 3HRCA 3O50A 5C27A 3ZO1A 2CKEA 5FWKK 5IMEA 4GYGA 4QMUA 4TXCA 4DG2E 2WMAA 4XRLA 4W4WA 5HCXA 4JRVA 1CSNA 1IA9A 4YC8A 4N6ZA 3E7OA 5DYJA 1PMVA 4DFLA 4RLLA 3QU0A 4FUYA 4TYIA 2SRCA 4XRJA 2R7BA 3MY5A 4O6LA 2CGWA 4O1PA 4EH4A 1YDRE 1SMHA 3KEXA 3JVRA 3QZHA 5FM2A 4GFGA 5ACBC 4S31A 2JITA 3D14A 3HZTA 4WUAA 4FV6A 5J1VA 5AA8A 2FSMX 2GFSA 4JJRA 2VWYA 2YZLA 4JIKA 4AN9A 2NP8A 2VWXA 3D9VA 5I9VA 2B4SB 1JSVA 2GU8A 3R7VA 3NMUF 5KUPA 5J5TA 4XG9A 3CIKA 3ZXTA 3QRTA 4JXFA 3V5PA 2C6OA 3DU8A 3UMXA 4BWPA 5A46A 5DT3A 5E7RA 2XCKA 2DYLA 3DY7A 3ZO4A 3F88A 4IZ7A 3IW4A 3LQ5A 2H8HA 1JVPP 2IG7A 5G6VA 2OBJA 2HY81 2QO7A 4U0IA 4AOIA 5HO7A 3NUAA 5B2MA 4L01A 2JLDA 4AG8A 2Q83A 3B8QA 2JFMA 3QRIA 3BQCA 4RIWA 3I6WA 2C6EA 3DTCA 5DHJA 4IM3A 5AR3A 4EBWA 5CYIA 2W96B 4U80A 4L3PA 1U4DA 2WQBA 3II5A 2GQGA 2WTIA 1H1PA 1O9UA 3OCSA 1ZY5A 4FV5A 4UB7A 5AA9A 5HD4A 2P33A 4NWMA 4OBOA 2YCSA 5H8EA 4EK6A 5FXRA 3Q9XA 3JYAA 3W1FA 3QLFA 3ANQA 4PMTA 5L3AA 4ITJA 3E3PA 3GI3A 2CMWA 4I24A 4LGGA 5EHOA 4D2RA 4EC8A 2I6LA 1GIJA 4ALUA 4KKHA 3GOPA 3LM5A 4MD7E 5E91A 2VO0A 3S95A 1YWVA 4NJDA 3FXWA 4WRGA 3BWJA 4I6BA 3V01A 4CEGA 2UZVA 3FYJX 1H8FA 2DUVA 2OIQA 3B8RA 2QHNA 2UW3A 4DINA 3BWFA 1EH4A 5AV3A 3EL8A 2G2HA 3MVHA 3QC9A 4FL2A 4PV0A 4RA4A 4C37A 2C5XA 3DXQA 1OMWA 4K9YA 4DEGA 2XK3A 5AUVA 4F9BA 3UO5A 4OUCA 4X3FB 5CENA 3F2RA 4IB3A 4GU9A 5A4EA 4ASZA 3LCDA 4EOSA 4RX7A 2QOLA 3NW7A 5ANOA 1YOMA 4FSUA 4ANOA 4IB0A 4WNOA 5AWMA 4FBXA 5HLWA 2BZIB 3LXNA 5CI6A 2VX0A 4C4HA 3O23A 1BL7A 1UNGA 5JN2A 4ZSAA 4II5A 2VTTA 4C34A 3DLZA 4F9WA 3VN9A 3R1NA 1F0QA 4BL1A 2JIIA 3UG1A 2B1PA 1CM8A 2DQ7X 1YHWA 4I5CA 3SW7A 2CLQA 3ORIA 4TW9A 4U44A 5FXSA 3PY1A 4R3PA 4OTPA 3UYSA 4RLKA 4E6QA 3ZFXA 5IKWA 4ZS0A 4F1TA 3HMOA 1IAHA 3C0IA 4IWOA 3WF9A 4WKQA 5F4NA 4DYMA 3HUCA 3PSCA 3R2BA 5AEPA 4D5KA 3C4WA 4D9TA 3CJFA 4DLIA 3HP2A 4EH9A 4FMQA 5IA3A 1OL1A 4CNHA 4O96A 5EM7A 4EH2A 5IUIA 3R22A 1Y8YA 4QP6A 4FKGA 2QOKA 5EW8A 3AQVA 2XYNA 4G2FA 4NFNA 2OIBA 2UZUE 2WO6A 3NRMA 4UXLA 1XBCA 4A07A 5JGBA 4FV2A 3S0OA 3K3JA 3G6HA 4AZVA 3NVKI 3VNTA 3Q9YA 4FSNA 2CNUA 4PX6A 4UMRA 2ETRA 4NYEA 4QP1A 3C0HA 5LQFA 1MRYA 1XHAA 2C5NA 3E3BX 3NDMA 4WBBB 3VRZA 2VRXA 3GCVA 3COIA 3HMNA 3RPYA 3SAYA 3BHUA 3MVLA 4MXAA 2Y6MA 4FKOA 1LPUA 4BCFA 3P78A 3IGGA 2VTIA 2JD5A 2PY3A 1IA8A 4TNBA 3VF8A 1H00A 3PXFA 4F65A 5HIEA 4O86A 2ITTA 2VO3A 3GUBA 2WTVA 3EMGA 1YI6A 3FMLA 3L8VA 3QCQA 4HYSA 1YI4A 4EC9A 3MJ2A 1Y57A 4FKQA 4YSJA 5KBQA 2XK8A 2XIXA 2GSFA 2ZV2A 3PPJA 3GP0A 3QTQA 3CSVA 3PJ1A 1ZXEA 5CU6A 3VUKA 5B2KA 4BCKA 4RZVA 3E8NA 4ASXA 5AP7A 4FKTA 5FG8A 5CAUA 3L8XA 2FGIA 3P08A 3QTZA 4RFZA 4BYIA 1OPLA 2WTDA 3RM7A 4K6ZA 3HV3A 3F5GA 2F49A 3MIAA 4YPDA 4D9UA 2C68A 2HENA 1UU9A 2X4FA 3BIZA 3NUPA 4X7QA 4JQ8A 2ITVA 4XG7A 3AGLA 5JH6A 5CU2A 5EM6A 4J7BA 4CD0A 5E8TA 5LVNA 5AP0A 5CAQA 2R3OA 2WMSA 5IQAA 2UW7A 2XIKA 4YJRA 3D7TA 1M52A 1U46A 3FXXA 4R7IA 5EG3A 1GOLA 1H1RA 3IONA 4TWCA 4YC6A 2PVJA 3LFBA 3NCGA 2WTKB 3KN5A 4X2JA 3A60A 2YM3A 3KRXA 5IQCA 4W8DA 2RF9A 2I1MA 3ZDIA 2X9EA 3E63A 4OBQA 2G1TA 5HI2A 3LFQA 4AGDA 4QMYA 5M4CA 4QMMA 5I9UA 2C30A 1UU7A 2BRGA 3FY0A 1G8AA 4FIGA 2QU6A 4HYHA 4I5PA 3Q6UA 3F69A 4EQUA 1PXMA 5ANKA 2WU6A 3FI8A 4IX6A 1Z57A 4O91A 4D1SA 3FSFA 1OL7A 4CSVA 4ACCA 2WIPA 5CVGA 3MDYA 5AUZA 1FVTA 5HBEA 5HTCA 2GNFA 4O2PA 4O7WA 3IG7A 2OWBA 4G5JA 4ONAA 5AR2A 3RCJA 3THBA 4RJ4A 3CBLA 3LCOA 3MS9A 4TY1A 4Z3VA 2WPAA 3ZM4A 5FDXA 2NRYA 5DWRA 3V8TA 5AIKA 3EJ1A 1WVWA 2AC5A 4DGMA 5IEXA 4CRLA 2GTMA 4AXAA 2ERKA 3ZFMA 3DXNA 3R7UA 2VTQA 3UP7A 1H24A 4JDHA 4K11A 2P4IA 5M51A 5TO8A 3BHVA 4EHGA 4RIXB 5B2LA 4HNFA 4J96A 3D2KA 3OT3A 3LLTA 1FGKA 5D7VA 1Y91A 3TI1A 2QOQA 4WG4A 4G3GA 5GZ9A 4ZSJA 2OZAA 4QNAA 1B39A 2AUHA 2Z7QA 3CLYA 4UYNA 1QPEA 5JFSA 4UX9A 1Q8WA 3UMWA 2A4LA 3FLZA 1R78A 5EHYA 3WARA 4MKCA 2QG7A 4ANSA 1SNXA 5FEEA 3OS3A 4JI9A 4XG2A 1FQ1B 3WF7A 2WOUA 4QP9A 3KXXA 1PRYA 3OW4A 2J0IA 4OBPA 5CS6A 5DIAA 3T8OA 3I60A 2BDWA 4BGQA 1DM2A 4E7WA 3AC3A 5DN3A 2BILB 4AN3A 3DLSA 3GEQA 4GK2A 4DG3E 3LXKA 4IE9A 3VW8A 3TKIA 4DN5A 4U79A 3DJ7A 3QQHA 5KE0A 4E73A 3AC2A 2W1IA 2Z02A 2J0JA 1UNHA 2OF4A 4JT3A 4MXCA 2PUPA 3WIKA 3KRWA 4AOJA 2HXLA 4YGAA 5DI1A 4E1ZA 5M06A 3FC2A 4AZTA 5DBXA 5A9UA 2PSQA 3MFUA 4L3JA 3RHXA 2J5FA 5LARA 2ONLA 4I6FA 2R2PA 4I4FA 4JR3A 4XG8A 1R0EA 4ACHA 5E8ZA 5CAPA 2X8EA 5J9ZA 5LWNA 3Q60A 5ETAA 2GHLA 1U59A 1ZLTA 5DEWA 4RWKA 3R7GA 2GS7A 5EYDA 2GNJA 3U6IA 4HCTA 1QCFA 4EH8A 4E4LA 5IH5A 3VQHA 3KC3A 1LEZA 2BRNA 4J52A 4CCBA 5C4LA 4I22A 4RWIA 4Q5EA 4BGGA 2OLCA 1J1BA 3LQ3A 2VTAA 2XYUA 3OP5A 3ACKA 2CSNA 2W5HA 2O65A 1OBDA 2HOGA 4ZTLA 5HCZA 3SD0A 3DKGA 5GZAA 2OJJA 2XNBA 2HELA 3DT1A 3O96A 2R3KA 4PTCA 5AUTA 3U9NA 4GMYA 3UG2A 5E4HA 3V5TA 4EQCA 3OCBA 2FVDA 4HGTA 3DJ5A 4AX8A 4C4IA 5HGIA 2B7AA 5T68A 2CLXA 4IBMA 4V05A 2I7QA 1PXJA 4XP3A 5CF5A 2NO3A 1M7QA 4CGAA 3JXWA 3R9HA 4L9IA 3HLLA 3QC4A 5KNJA 5B0XA 2BIKB 4F6SA 1KE5A 3E62A 4WIHA 3PVWA 2JGZA 3QD0A 3R1SA 1M2RA 4D0XA 3GC7A 4BZDA 4DH8A 3MA6A 3MFTA 4YLLA 2OI4X 1IG1A 3C50A 3L1SA 4FUXA 3NAYA 4K2RA 4IXPA 3W2OA 4EH6A 5JGDA 5HU9A 5CWZA 2OXDA 2ETMA 3FZ1A 2C3LA 4DEBA 3PJ3A 4HYUA 4HPTE 5TKDA 2QQ7A 4IAYA 3GCQA 4U3ZA 2H34A 3ZC6A 1KE6A 3AGMA 3MVJA 2R3IA 2QR7A 3HA8A 1DAYA
chains in the Genus database with same CATH superfamily
3QTWA 5CAVA 4MXYA 4UMUA 5CF8A 1V0PA 2PZ5A 1KE9A 1VYZA 1PXIA 2PVMA 3DBFA 2KULA 4FIIA 4PTEA 3NNXA 1UWJA 4RWJA 5GJFA 3OWKA 4H36A 3HX4A 3UOHA 5ITAA 3I0OA 3ULZA 3WZKA 3EQPA 2Y8OA 4YBKA 3EWHA 4CKJA 3FMJA 3DJ6A 1JKTA 3FQEA 3BYOA 2WHBA 4KS7A 4BKJA 2X2MA 2FYSA 1VYWA 3TWJA 3RWQA 1XBBA 4IWPA 4M69A 2E9VA 3RVGA 1JOWB 4Q9SA 5FUTA 2E9PA 2JC6A 1W2DA 1I09A 4B7TA 2FB8A 4ENYA 4DA5A 3A4PA 4XMOA 2YM8A 4FTCA 3PP1A 4PF4A 1ZRZA 3EH9A 3SXRA 4MWIA 4QDVA 3CD3A 4OTFA 3RAHA 3PZEA 5A14A 2V7AA 4QTBA 3TNPC 2J51A 2XJ2A 2F7EE 4JBOA 2HZ4A 3IW6A 1PMUA 2W1GA 3TV4A 5A6NA 3F3UA 4P5QA 4QYHA 4WNMA 2HIWA 3QQUA 4LL0A 3Q3BA 4YJUA 4EOJA 2WIHA 2CKQA 3W32A 4LRKA 4G3FA 3PG1A 4ERWA 5KMNA 4L46A 4QPMA 2VX3A 2IZRA 3QWKA 4LRJA 4AXEA 4FTOA 4MQ2A 3RAWA 4BGHA 3H9RA 5HTIA 1YOJA 1FPUA 2GNLA 4DT9A 3PFYA 2OSCA 2E9NA 2ZB1A 3D94A 4B0GA 3ORNA 4RX8A 3FLYA 4YJSA 5GZ8A 5F1ZA 2XK9A 5CY3A 3LIJA 3U8WA 4O0WA 3BYVA 4JMQA 3Q52A 4QNYA 4Q5HA 4QPSA 1P4FA 3ZHPC 1KOAA 2QO2A 1BL6A 4S34A 1H27A 2W1ZA 2YAAA 3GOKA 5J9YA 5K4IA 4J95A 5DVRA 3HL7A 1ATPE 4PNIA 3OWJA 4L68A 1WZYA 3WE8A 4ANBA 4F7NA 1H1SA 1GIHA 5AP6A 1W8CA 3TNQB 4BR3A 4GFMA 4QMLA 5CQWA 5CAOA 3PPZA 1BYGA 3SHEA 2C6KA 2RFNA 4IZ5A 2WTJA 3KFAA 2X7FA 4CLJA 1B38A 4U40A 4DGOA 5IA5A 5A3XA 3DB8A 4KKGA 4PL3A 3TKHA 1KUTA 4PWNA 2WMBA 5KMOA 4KRDA 4P2KA 1KE8A 3ODYX 3AKJA 5CEKA 3SVVA 5EQEA 4AXDA 5HEZA 1NVSA 4UYAA 4AFEA 5CANA 2E9UA 2GDOA 1OKVA 4MF1A 4AZWA 3KVXA 3LPBA 4W4XA 4GCJA 4QO9A 3A8XA 3UQCA 2OFVA 2QKWB 2OFUA 3BGQA 1UKIA 4XS2A 3W0PA 4I4EA 1OI9A 2XNOA 3Q2JA 1ZYJA 2JBOA 3N4UA 2JEDA 3P1AA 3PDTA 3RAIA 2HZIA 4RPVA 3LKMA 4YLJA 3E88A 3RMFA 3AD6A 5TR6A 4ZY5A 4MNEB 3OZ6A 3R8UA 2R4BA 4JG6A 2IZUA 4IVAA 5CVFA 2YERA 2WZJA 4D2VA 3MB6A 4G1WA 4MTAA 1H01A 3EN6A 4MD9E 4M84A 3RINA 2ZJWA 3HMIA 4S32A 3U4UA 4GEOA 4LG4A 4G5PA 5L8JA 3RGFA 4JVGA 4J1RA 4RX5A 3QTIA 4X3FA 3OFMA 4L8MA 3IQ7A 4F64A 2C1AA 3DBEA 3QBNA 3QCXA 4FVPA 4K8AA 3QKMA 4QPAA 5IEVA 5FTQA 3TDVA 3FL4A 4A9YA 5GINE 5CSXA 2J7TA 3ZRMA 4BVUA 3NUXA 4RC4A 4V0GA 5IA0A 4XV1A 4FK6A 5CZIA 4F7LA 4TN6A 2BROA 4EI4A 3EHAA 4IX4A 1UA2A 2QLUA 2R3LA 2WQMA 4RFYA 3E7VA 4BJJA 3FPMA 1H26A 1FOTA 4YZ9A 2RFSA 4QMNA 3VUMA 3EN9A 2XRUA 1T45A 1PW2A 4O2ZA 3ROCA 4DAWA 4I92A 3QD3A 4RJ6A 3CPCA 4AFJA 2Y0AA 4D4SA 1OVEA 4CVAA 3R71A 3NYXA 1RE8A 2G15A 3F7WA 2XVDA 5M57A 4E93A 1JWHA 1UKHA 4H3QA 3EFJA 4D2PA 2PVLA 1XR1A 2C4GA 4XCUA 5BYZA 4JDIA 2BALA 2P3GX 2PVHA 2ZM4A 4X2KA 4HVSA 3MGYA 4I1ZA 1J91A 3KXHA 3SG9A 1R39A 1FMOE 5DRDA 3V5QA 3R21A 5J1WA 2C6MA 2BZHB 1DI9A 5M44A 3DZOA 5KCVA 5EQYA 4BHZA 2BZKB 3ZRKA 4ITHA 4TT7A 3SDJA 2FO0A 3FY2A 3KULA 3VBXA 4DTKA 3E8DA 5BNJA 1CKJA 4K0YA 2HW6A 3CY3A 3ACJA 4CFXA 4YSMA 4GKIA 2C6DA 4EZ3A 4NL0A 3VS6A 1PXLA 3FKLA 3DQWA 3KCFA 1UV5A 3DA6A 2HZNA 2J2IB 3KMMA 4PDOA 3ZZEA 5IQIA 2B0QA 2W0JA 4FOBA 4L3LA 4MEDA 5LMBA 2JDTA 4DBNA 4V01A 5IQDA 1QL6A 4Y8DA 5HG7A 3R6XA 4ZAUA 4CKRA 4DCEA 1OIUA 4KIOA 2AEGA 3BHHA 5DR6A 2J9MA 2B52A 3IOKA 5IUHA 3NW5A 4IWQA 3RCDA 3Q96A 4EYJA 4FVQA 2UZWE 1OIRA 3F82A 3ZDUA 5AP3A 5AV2A 3TEIA 3MIYA 2OGVA 4NTTA 2OH0E 4B6LA 4E5BA 4IC8A 2GHMA 1OL2A 4AZSA 4FKUA 4P5ZA 3F5UA 5KMKA 1K9AA 1XH9A 2YIXA 3BV3A 3SA0A 3O71A 5HG9A 3R73A 3P5JC 2WD1A 4AGUA 2PPQA 3H9FA 4JQ7A 4X2FA 3LFCA 5LJJA 1P14A 5HX8A 3JPVA 2UW9A 2YAKA 3NYVA 3R1YA 2UZDA 3V04A 2PE0A 4I5MA 2XNPA 4F9YA 5IQBA 2VTHA 5LVOA 3Q4CA 3NNVA 4FOCA 4FV4A 4PPCA 3AMAA 4E4MA 5A4CA 4HGSA 3S00A 3GQLA 2QO9A 2QU5A 4S30A 4C7TA 1IAJA 4FV1A 3AG9A 2OXYA 2PE1A 4LYNA 4CT2A 5DA3A 2OZOA 5DRBA 4RA5A 1WCCA 4D1ZA 5L6WL 2JAVA 3QYWA 5IZFA 4X6QC 3W0NA 4BCPA 5CNOA 5HZNA 4NEUA 4DHFA 4F9AA 4FSZA 3C0GA 4TWOA 1PJKA 1TKIA 2A0CX 5HO6A 5TOZA 3UBDA 5JEBA 2JIVA 4MX9A 2UW5A 3QRJA 4LI5A 4NM5A 4XG6A 3VHKA 2X1NA 3WZJA 3JR1A 2YISA 3LMGA 4DFUA 4D2TA 4O0YA 3MTLA 3ORLA 4FL3A 2VNWA 1H1WA 4F0IA 4GKHA 3QRUA 4FNYA 2W17A 4D1XA 2R9SA 3LCTA 4RIOA 3UE4A 2C3JA 3AMBA 2G01A 3JY0A 2R3RA 2PVYA 4BI2A 4DEDA 1FVVA 3KXMA 2NNWB 4NW6A 4XV3A 3W0SA 2REIA 2X7OA 3VONA 3GU5A 4EJ7A 5FTGA 3NR9A 4Y72A 3FMNA 2QODA 3UOJA 2R64A 4V04A 5CU4A 4QD6A 5H8BA 2RL5A 2UUEA 3BI6A 4XJ0A 3TT0A 4YZNA 4HVGA 4KINA 4NTSA 4RJ3A 4ZMFA 4TYHB 1HCKA 1TVOA 4MVFA 1RJBA 4CCUA 3SRVB 3ZMMA 3OEFX 4QMTA 2R3JA 3ROYA 2WELA 2IN6A 2BDFA 4D5HA 2C6IA 2OK1A 4KSQA 3WZDA 3SW4A 5K5XA 1PMEA 3DKFA 4F1MA 4RIXA 4KD1A 3GBZA 4IVBA 5EHLA 5HKMA 3DPKA 3PUFC 4JDKA 4RX9A 4K33A 3EQIA 2VTLA 4YZMA 2R3GA 3NW6A 4X0MA 3C4ZA 2WQNA 3DXPA 4WOVA 4R78A 3TV6A 1AQ1A 4QTDA 4DE4A 5FGKA 2XK4A 4C3FA 1Y6AA 4W9XA 4ZXTA 3FMKA 3TUDA 3IS5A 1TQPA 3OT8A 3N4VA 3PXYA 3G15A 4YTCA 3BEAA 3R9NA 3UIBA 3BYUA 2VNYA 4F9CA 1TZDA 4MCVA 1ZWSA 3ZLSA 5IG1A 4XP2A 5L6PA 2OJ9A 4DHIB 4YU2A 1XO2B 2ZV8A 2W1HA 4FSRA 4ZP5A 1H08A 5EW9A 2IVVA 3QRKA 4A9TA 4B8MA 4A06A 3HDMA 1CKPA 4BB4A 2VN9A 3D0EA 3H30A 3N51A 4CKIA 3PZHA 1BUHA 4IW0A 5HHWA 3IDBA 4XBUA 4F99A 2XEZA 1JPAA 4L67A 4GV1A 4USFA 3KF7A 3F5PA 3NIEA 2EXEA 3PVGA 3QUDA 5EK7A 3OWPA 3R8PA 3R83A 3KGAA 3ORMA 4FZDB 4MF0A 1UWHA 4FTTA 4YJNA 4AW2A 3KU2A 5JRQA 3C5UA 4OAUC 2FSTX 4FNWA 5D7AA 3LFDA 3GU6A 1MRUA 3R63A 3ETAA 1S9JA 3HYHA 3KN6A 4JAJA 3W2SA 2RFEA 4DDIA 3QQFA 4BZNA 5ACKA 3WYYA 3QUPA 4FT0A 3AC8A 4AT3A 3CQWA 2PUNA 3A2CA 4C2WA 4FTKA 2BVAA 4MXZA 2XMYA 5AUYA 4JX3A 3UP2A 2YWVA 3VULA 4AWIA 3TN8A 4L00A 5AV4A 4YUQA 3O0GA 5KBRA 2XB7A 3GU4A 3ZSGA 4B4LA 4C4JA 5GHVA 5EOLA 4ZK5A 3GGFA 3TTIA 4DFXE 3A61A 3OOGA 3OBGA 1T46A 1WBOA 2W5AA 2WEVA 5L2QA 4CQEA 3UJGA 4E8AA 4FIFA 4G9RA 4KUJA 5BUJA 5ETCA 4BTKA 5LMKC 2ITOA 3FEGA 2WB8A 3O5AA 2W99B 3FHIA 4UBAA 4J71A 4GL9A 4NFMA 4XG3A 2OKRA 2PVKA 3RKBA 3UPZA 1BMKA 3C51A 4FKIA 4NKSA 3REPA 2CN8A 3HUBA 2BAKA 4IM2A 3EFWA 3K2LA 2I0HA 3DBQA 1Q5KA 4J98A 3FZSA 3VO3A 3LFAA 3RK9A 3G0EA 4YO4A 3BL7A 4EK8A 4L44A 4BDEA 3NNWA 5IISA 4W4VA 5HE0A 1GNGA 4BBFA 2FSOX 3O17A 1Q41A 2AC3A 4RBLA 1KE7A 2CCHA 3ATTA 3VBVA 4R8QA 3ZS5A 1BX6A 3V5LA 4IDTA 4EOQA 4O82A 3ZONA 3LJ2A 4EHVA 3VBQA 4F0GA 3G0FA 5AAFA 3ZEWA 4U45A 3G5DA 5EKNA 2I40A 2WQOA 4LM5A 3DDQA 1LEWA 3OROA 4JQEA 4C0TA 4D28A 4AP7A 2XKCA 1J3HA 2VX1A 4KKEA 1ERKA 4IDVA 3UGCA 3VUTA 3AT2A 3NAXA 4C02A 4O83A 1OECA 3SXFA 1FMKA 2XKEA 3AD5A 5LVMA 2R0UA 5IF1A 2J4ZA 4BIEA 2GS6A 4R5YA 4GFOA 5DR9A 2QVSE 1HCLA 1URWA 3BHYA 3OMVA 4FTJA 2BKZA 3VS1A 4JOAA 3TNHA 3MSSA 4E4NA 2F7XE 2XP2A 4S2ZA 3QGWA 4TTHB 4IZAA 4USDA 2XNGA 3PUPA 5DMZA 4EHEA 4TRLA 4ZLYA 2YIYA 3UVPA 3KREA 2H6DA 2V0DA 2Q0BA 3MY0A 5IQFA 2H9VA 5CEMA 2YM6A 3ULIA 3FE3A 2CCIA 2Z7LA 4BFMA 2ITWA 4ZS4A 3Q4ZA 2JFLA 4C59A 5FQDC 5JT2A 1R0PA 3Q04A 4RVLA 3A7FA 3CJGA 2XKFA 1OB3A 3VS5A 4AACA 2QC6A 4GRBA 4GG5A 5CEOA 1OM1A 5K0KA 4O7SA 5GIPE 4NCTC 3PA3A 5C26A 3DFAA 4IACA 2XF0A 3QF9A 4MBJA 2YDIA 3HVCA 3EN5A 3WYXA 5FEQA 3EYHA 5EM5A 2VO6A 4MWHA 2YJRA 4RJ8A 2X0QA 1O6YA 1BLXA 3ATSA 3PSBA 3SX9A 2PVRA 5JKGA 2BAQA 4ENXA 3TUCA 4CFWA 4FTNA 3DS6A 2ONLC 4YTIA 4YP8A 4O0XA 2YACA 3D7ZA 3EQDA 4HZRA 2E9OA 3LVPA 4MBIA 4FG8A 4G16A 3OWLA 4ZIMA 3UIXA 4IEBA 4DC2A 3N9XA 2GHGA 1DAWA 4BZOA 3ENHA 2EUFB 4EH5A 3O8PA 3OTUA 4PL5A 3VHEA 3W0MA 1Q97A 2CJMA 5C03A 4E5AX 3FJQE 4O4FA 4RG0A 2BHEA 3DV3A 3IGOA 3S3IA 3W2PA 4D4VA 2X2LA 4AAYA 4KABA 3QQLA 5IQEA 2A2AA 3TL8A 2CNVA 4OTHA 3QXOA 4R7HA 1VLRA 3LOKA 2W1CA 5AP2A 3FPQA 4XLVA 1Q99A 3LM0A 1W2CA 4Z7GA 2IW6A 4RMZA 1GZKA 3QD2B 4QQ5A 5HX6A 3KQ7A 3HDNA 3Q9ZA 3D5XA 1UU8A 1URCA 1YVJA 2OICA 2W7XA 4QT1A 4O0UA 4N57A 1STCE 2R3FA 3GU7A 3R7OA 5D12A 2YITA 3BE9A 4XLIA 3W2RA 3ZBFA 4U8ZA 3CTQA 4UWCA 4NH1A 5CI7A 4O0SA 4UMTA 1UVRA 4DT8A 1MQ4A 5A4LA 3F6XA 5AJQA 2ZM1A 4C3PA 1JAMA 3A8WA 2R3HA 3CTHA 4RFMA 3FQSA 1V0BA 4R1YA 3IO7A 5HVJA 3FZTA 3FLWA 4O38A 4O7ZA 2PTKA 3F3WA 3DKCA 4Y73A 4BDIA 3IDPA 2JKMA 4X6RA 3L9MA 4NK9A 4F70A 2IVSA 4AF3A 1ZMUA 4M68A 2OF2A 3D4QA 4HJOA 3CY2A 3QLGA 4PUZA 3V3VA 1YWRA 3OC1A 1E1VA 4JNWA 3RPSA 1OZ1A 2B9HA 3W16A 3UC3A 3PXKA 4EH3A 1B6CB 4KNBA 5M4FA 5FTOA 5HLPA 2IW9A 3SV0A 1QPCA 4U9AA 3TNIA 3QTXA 4I0TA 1BI8A 4E20A 1TQMA 3BKBA 5LVLA 3LHJA 5EI8A 3QGYA 1PYXA 1JKSA 4QEBA 4UWYA 2I0VA 2ITZA 2UVXA 2WMWA 4XX9A 2J6MA 4IZYA 5HG8A 3ZCLA 1XWSA 3NS9A 2ZDTA 4UV0A 2C3IB 4C4FA 4DG0E 4FC0A 3DK3A 2X2KA 3HRBA 3MBLA 4FTRA 4HGEA 4UWBA 4AXCA 3MN3A 2PULA 1Y6BA 3KKVA 3ZFYA 3Q2MA 4C62A 2YEXA 3MESA 4IH8A 4UZHA 3PPKA 3WOWA 1U54B 2XJ0A 5CF6A 2QOCA 3WILA 2ZB0A 4MQ1A 2VZ6A 3W8QA 4CG8A 4TWNA 4I0SA 4QMQA 3FZPA 3VVHA 5AUWA 3QA8A 4D2SA 5M09A 1YWNA 2A27A 3ERKA 4BTFA 4ZSGA 4KIKB 4QYGA 3MTFA 3T3UA 4IAAA 1JSUA 1IRKA 1OL6A 3I81A 4K18A 1WAKA 5HU3A 5KMMA 2WKMA 3R2YA 2RG5A 1NXKA 2ITUA 2ZDUA 2CGXA 4ALVA 5FLFA 5AM6A 2IW8A 4E5WA 3DNEA 4CYIA 2W4JA 2YJSA 4N0SA 5HNIX 5AMNA 2JAMA 2VWZA 3K5UA 3L9PA 4FKLA 4TYGA 4KRCA 4U6RA 3PSDA 3K5VA 4F08A 2BFYA 3FMEA 4LDTA 1DS5A 4FKVA 4BDDA 3RALA 2HAKA 4CFFA 4YR8A 4FSWA 4ZSEA 3AKLA 2RSVA 2X4ZA 3IW5A 3QTRA 1Q3WA 2NYAA 3COKA 3C4CA 5M07A 2XCHA 5LVPA 4FIHA 3LLAA 2YIQA 3NUYA 3PG3A 4DFNA 4RJ5A 2WTWA 4XP0A 4FKPA 4RVTA 5CXZA 4O81A 1Q61A 1XJDA 2UZBA 4OTIA 1YXXA 2F2CB 4FSMA 4QP3A 4XH6A 4KS8A 4HW7A 1ZZLA 2O5KA 3TIYA 3O7LD 1M14A 3IKAA 3PTGA 4GT3A 4H1JA 5JQ8A 3EQRA 1O6KA 3D5WA 3G9LX 3ITZA 2OJIA 5GJDA 3R9OA 3VBYA 3VC4A 3Q32A 3WF5A 1XKKA 3RWPA 4DGGA 4BRXA 1H07A 2R3QA 4BCQA 2EB3A 4CZYB 4XV2A 2C6TA 2XKDA 1UU3A 2F7ZE 2VWUA 3NIZA 4FTUA 2GS2A 2YM7A 4QMXA 4ZEGA 5T3QA 4AW5A 3FMHA 2O63A 3EN7A 4GVJA 4M3QA 4LUEA 1P4OA 4LGDA 4YZDA 5BPYA 3AC1A 4NIFB 4BI1A 4AE9A 2CGVA 4OT5A 5DE2A 2C69A 3VF9A 4O7NA 2BMCA 5I3RA 2IO6A 3SG8A 3FYKX 2Z60A 4Q2AA 5J8IA 4Z16A 3DAEA 2X8IA 1PF8A 3FLQA 4QTCA 3QZFA 2G2IA 4ZLOA 1ST0A 2XAMA 4OT6A 4UMQA 4RT7A 3GENA 4G34A 4DEEA 4M14A 2FUMA 2YFXA 4F0FA 1E9HA 4PY1A 3LFNA 2BRMA 4L7FA 2QG5A 4LOOA 4U41A 4XBRA 3R7IA 2CKOA 3UNKA 4MXOA 4ASEA 4KBCA 1OUYA 3F7ZA 3H10A 3GU8A 2W9FB 2ZVAA 4RGJA 3EB0A 1PKDA 1YXVA 4XNEA 2YHVA 4XHKB 2XK7A 1ND4A 3CGOA 1APME 1ZYSA 3BLQA 3D7TB 4YHFA 3HEGA 2BR1A 3EIDA 4WRSA 4F7SA 1WBSA 1KWPA 4GG7A 2QURA 4WA9A 3KMUA 3LCSA 4TYHA 5E90A 1QMZA 3R0TA 3PE1A 3EOCA 5CVHA 2Z2WA 4IB1A 2ZMDA 3SRVA 3F66A 4F4PA 1REKA 2YWPA 5AM7A 4PRJA 2P2IA 2IZTA 4Y46A 4U81A 5BVFA 5HBHA 3WE4A 5JQ5A 5C1QB 3PVUA 3MFSA 3HGKA 2PK9A 3ID6C 3WZUA 2X9FA 4JDJA 3TZ7A 1LR4A 1R3CA 4ZTQA 4RVMA 4AA5A 2WXVA 1SYKA 5LCJA 3ENMA 3PRFA 4FKWA 3LE6A 4AS0A 1JLUE 3EQGA 3R8MA 2AYPA 5CSPA 1ZMVA 1OGYA 3QKKA 4DCAA 4YJPA 4O4CA 1NY3A 3EQCA 1H1QA 4AN2A 4U42A 2C5VA 5E8YA 4P4CA 3BU6A 2VUWA 4HPUE 4EK4A 3NX8A 2DS1A 1JBPE 4DITA 1Q3DA 2Y9QA 3ZUUA 3V8WA 4CFVA 1BI7A 3NLBA 2XBJA 4NT4A 5B7VA 4BBEA 1WBPA 2O3PA 3Q53A 1MP8A 1REJA 5I3OA 3GCUA 4WG3A 3G51A 4BCIA 4NKAA 3AC4A 3V5WA 4WO5A 4BWXA 4FEWA 4BI0A 4FV7A 3LFFA 4BDCA 4BCNA 4TKSA 3MV5A 4FRFA 5ANGA 1MQBA 5TE0A 4AGCA 3FSKA 4E3CA 2WMQA 3I79A 5HESA 3L9LA 3HV4A 3AKKA 4QP7A 3R02A 3QTSA 2YIWA 5EOBA 4XOZA 2X39A 4GT5A 3PY3A 4YNOA 5IQHA 4WG5A 2P55A 5L2WA 2IVUA 4PPBA 2PMNX 3NZ0A 2HY0A 3BLRA 3BLHA 4UN0C 5JK3A 3KXGA 2X81A 4UEUA 5FRIA 4D0WA 3F2NA 2JDVA 3KY2A 1G3NA 4WSYA 3W0RA 2R0IA 4QYYA 3WBLA 2FH9A 3W8LA 3RHKA 2BTRA 2HK5A 4YHTA 4O7YA 4O1OA 1W2FA 1VJYA 3OBJA 3ZO3A 3OUNB 3VQUA 3RNYA 4DFYA 4MNFA 4E6AA 3PLAE 4LQMA 1Q8ZA 4ALWA 5M4IA 2XM9A 4BDHA 2ACXA 3OXZA 3TZ9A 3VAPA 1WVXA 2O64A 3I0QA 2W5BA 4IIRA 3NVMB 4F6UA 3VW6A 2YLEA 5E9EA 3I5ZA 4JAIA 3DNDA 2OW3A 3CKXA 3QFVA 3MWUA 3RBWA 2EU9A 3T9IA 1Q8UA 3BBTB 3FMMA 3VBWA 3RTPA 4EHZA 1YXTA 1OKYA 4MXXA 2FA2A 1XH7A 4O0RA 3U51A 2ZAZA 3U9CA 1H28A 4BKZA 1U5QA 3VUGA 5I9YA 4GK3A 5J9LA 3UPXA 4BCGA 3COMA 3E64A 2OU7A 1SZMA 3PJ2A 2XNMA 3PIYA 4AT4A 3G6GA 3MPTA 3UDSA 3PJ8A 3EZVA 3QQKA 4QQCA 4C57A 4BIDA 4RIYB 3EQHA 4PPAA 3MH0A 3QX4A 4NW5A 3SKCA 2JKOA 5L2SA 5E8SA 5C4KA 3MPAA 3UOKA 2WTCA 3E92A 2V62A 5DR2A 1YOLA 3QHRA 4M8TA 2RG6A 2XBAA 4MHAA 3SXSA 5FDPA 4CFUA 2C0TA 2XH5A 5ANJA 1FGIA 3FAAA 3PA4A 4A4LA 4YURA 4FE2A 5EFQA 1OPJA 4MAOA 4B9DA 5IMXA 3Q5ZA 4M15A 4BHNA 3LQ8A 3V8SA 4E26A 3IECA 5ETFA 3L8PA 2QONA 2ITQA 2XRWA 2V5QA 3MFRA 5HORA 5I9XA 5K0XA 3L9NA 4YBJA 3CTJA 5CU3A 4FIEA 4PQNA 5DH3A 3COHA 3WF6A 2E2BA 3QALE 2RKUA 3NEWA 3VRYA 5E8XA 5AAEA 5K3YA 4C4GA 2P2HA 4LV7A 2ITYA 3NUSA 5EQPA 1F5QA 5CSHA 4CT1A 3EFKA 4G17A 3C4XA 4QP2A 4LMUA 1W82A 4R1VA 5L8KA 3P86A 2EXMA 3RJCA 4FK3A 1GZ8A 5CT0A 1KSWA 3OCGA 3Q6WA 3BYMA 1G8JA 2ESMA 3LJ0A 3ORZA 5M4UA 4L53A 4ZTNA 2PZPA 1H25A 4QYFA 3R04A 1PHKA 4FKSA 3ZZWA 1YI3A 1A9UA 2I0EA 5CSWA 4DGNA 2HZ0A 2JDOA 3P7CA 4H3BA 3VJNA 4OTDA 1J7UA 5AUXA 3BBWA 5IH4A 3IK3A 3BU5A 3RK5A 1GZNA 1XBAA 1R1WA 3DK7A 2GQRA 2R5TA 4DFZE 4EZ7A 2PZRA 2XK6A 3FUPA 3TTJA 4ANQA 4MBLA 3O8UA 5ANEA 5AV1A 1S9IA 1PMNA 1OKZA 4Z55A 5C8NA 2A98A 4D2WA 3U55A 2CKPA 4KAOA 4BBMA 4FJVA 1A06A 4O4DA 5IA1A 4ZTRA 3UO4A 3BLAA 1XQZA 2ETKA 2ITPA 2UZTA 4NM3A 2HWPA 2PYWA 3P0MA 5EDRA 2B53A 3UC4A 5FD2A 4PDPA 5C8MA 4CMTA 5J87A 1YDTE 1GZOA 1OGUA 3CEKA 5IDNA 4KWPA 4K77A 3MH3A 3PY0A 3BGPA 5HVKA 5FBNC 5BVWA 5L2IA 3LMIA 5L4QA 2PL0A 4KBKA 3EZRA 3POOA 3RP9A 2BCJA 3DTWA 3P7BA 2QI8A 4EQMA 5M56A 1RDQE 1LP4A 3BE2A 1L3RE 3O51A 3BQRA 3LFEA 4DF3A 3WZEA 5EM8A 3R28A 4BCJA 3VWAA 3UYTA 5KO1A 2R7IA 5EYCA 4D4RA 3NYNA 5H8GA 1SVHA 2QLQA 2PZIA 4JBPA 4O21A 3VS4A 4RJ7A 4Z9LA 3RPOA 3E93A 3IOPA 2JDRA 3ZO2A 1KOBA 3KB7A 2B55A 3NWWA 3ZRLA 3SC1A 4CG9A 1CMKE 2PMLX 5EH0A 2BFXA 4EOIA 2J0MB 2Z7SA 3GVUA 3W55A 5F9EA 3GT8A 4A9RA 2PUUA 5F95A 3TZMA 3ZSIA 4YHJA 5J79A 4GW8A 2ITXA 4ASDA 2WMRA 3EN4A 5K9IA 1JSTA 3NNUA 5FXQA 4YTHA 4ZZNA 4JG7A 3PXRA 3QTUA 4WT6A 4EUTA 3IPHA 5CEIA 5KX8A 4PTGA 4U97A 4HYIA 1Q8TA 2YA9A 3PYYA 2C6LA 2GFCA 2EVAA 3FDNA 2CDZA 2QR8A 5AX3A 3I4BA 4NSTA 2J0LA 2WMTA 1NVQA 3AC5A 4IB5A 4M13A 3KA0A 3PXQA 4JX7A 4XV9A 3UZRA 5EDQA 4C33A 4OTRA 1YHSA 2UVYA 4YTFA 3U54A 3ZLWA 3D5VA 4PDYA 1WBVA 4KB8A 5M08A 3S4QA 4GU6A 3I6UA 3VUIA 3QL8A 3UQFA 4IMYA 4QMPA 5AP1A 3TG1A 1ZYCA 2J90A 1NT2A 1YQJA 1OIQA 3O8TA 2IEWA 3LAUA 4FKJA 4MK0A 5E1SA 5TF9A 3ZEPA 4EWQA 2YZAA 4FTQA 3NPCA 4EYMA 3SLSA 4DH5A 3WI6A 5LWMA 3D2IA 4FV3A 4G9CA 1PKGA 2ITNA 1Q24A 5D9HA 4BDJA 3EKNA 3VS7A 2Y4IB 4H58A 3ORXA 4KIQA 3DB6A 4W9WA 4UZDA 4Y85A 3HA6A 5JMSA