4QMUA

Mst3 in complex with jnj-7706621, 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1h-1,2,4-triazol-3-yl}amino)benzenesulfonamide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
286
Chain Sequence
GMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmuA01
3V5PA 1ZMWA 5EQEA 2WEVA 3I79A 4NKAA 3A7FA 4FTNA 4LOPA 2EWAA 1W83A 4IAAA 2FVDA 4G3FA 4GJ2A 3MN3A 2RF9A 3WILA 3R7OA 4YR8A 2YM7A 3U55A 4CCUA 1BUHA 3OUKA 4GT4A 5C03A 3RZBA 3SX9A 3CGOA 1REJA 4FC0A 4O22A 1OIQA 4JBQA 2PVMA 3R1QA 4EHZA 3A4OX 3FLZA 2BZJA 1UA2A 4R8QA 3BE9A 4RJ5A 3DXPA 3ITZA 4KKEA 3IOPA 4IHPA 4BCQA 4YJRA 3W2RA 2QHNA 2A4LA 2J0MB 4FIHA 5HEZA 4UV0A 3V5QA 1J7LA 4YBKA 5AV1A 3E3PA 5HG7A 3UIXA 1KE8A 4Z7GA 2PUPA 3MVHA 4NM5A 4I93A 2JGZA 3TIZA 5CU0A 2WQNA 3UOLA 3R01A 4GCJA 2PVFA 4TYEA 1MQBA 4TYHA 4U42A 4YJUA 4O7SA 1PMUA 3JVRA 2GNLA 2W1ZA 3M42A 1YXTA 4F6WA 4O0RA 2Y4PA 1XH9A 3OT8A 3PZHA 5A9UA 1JAMA 2E9OA 3II5A 1W98A 4FTKA 5FTQA 5TO8A 4ZTHA 2IVUA 3L8PA 2ONLC 4O86A 3BGPA 3SXFA 1GZOA 5AMNA 2VX0A 3BQCA 2PMLX 4FVPA 4FTCA 4KA3A 5EW9A 4RBLA 2F7ZE 4CXAA 2C5YA 4W4VA 3CTHA 3DU8A 3TIYA 4JNWA 3FHIA 4AOIA 5M07A 3ZBFA 3VUMA 5H2UA 4S31A 1RE8A 4CG9A 3NX8A 3VQUA 5DVRA 2IVTA 4FVQA 3KMUA 2FYSA 3FZPA 2HWOA 2YLFA 4X3FB 5HOAA 4CCBA 4D1ZA 4OAUC 4Q9ZA 2JDVA 4DBXA 5BQ0A 2VWIA 4F1TA 5T3QA 3ZH8A 4IANA 1OMWA 5HO8A 1YHSA 3L9MA 3BHYA 3C9WA 1NVQA 3FWQA 3W10A 3ANRA 3UGCA 1ZY5A 3VUDA 1T45A 2DQ7X 1M2RA 1OL6A 3QZGA 3O7LB 2YAKA 3C7QA 3PTGA 1S9IA 3BPRA 3IDPA 4MCVA 3F3WA 5HVJA 4BCPA 3K2LA 2QOKA 2W9FB 5AR5A 4BHNA 4DF3A 2HY0A 1KE5A 1JKTA 4AA0A 4DA5A 1M2PA 2RFDA 3WE8A 4ACMA 4ACCA 1NT2A 5IH6A 1H1WA 2UW6A 4R5YA 4JX7A 5DE2A 2XM9A 4I3ZA 4E4MA 3O71A 3OWLA 4HNIA 4CKRA 3PY0A 4TYGA 4M67A 3SG8A 4IH8A 4MXCA 1OUYA 4IC8A 1YOMA 5IUIA 1AQ1A 2YISA 5FM3A 2HZIA 4L44A 1FVVA 4TWOA 2WD1A 3MBLA 2ZMCA 3PVGA 3FLSA 1BL6A 1JOWB 3LQ8A 3Q52A 2JDSA 4CD0A 3VF9A 1OPLA 2PVRA 3I5ZA 3F2NA 5ANJA 4DGLC 4EH4A 1OKZA 4GFGA 4RIXB 4L42A 2BFXA 2QOHA 5EOBA 3QGWA 3BU5A 4YLLA 4J95A 4N0SA 4QPAA 4V0GA 3SA0A 2WZJA 3P78A 4YTHA 2C6IA 4PNIA 4O7YA 5JH6A 4HGLA 2C3LA 2YABA 1Q5KA 3OHTA 4QMWA 4CRSA 4EK4A 5L6PA 2VO7A 4FEWA 2X2LA 3UQCA 1J7UA 5DT4A 4O0WA 4BL1A 2P2HA 5LCJA 1SMHA 2XNBA 3Q4UA 4LG4A 1XWSA 3HL7A 4PNKA 2R3QA 4O7WA 3AD6A 2BALA 1WZYA 5CX9A 2WTKC 3QXPA 3ORZA 2ETKA 4KKHA 3PXFA 3D0EA 4JAJA 1OUKA 2VWWA 3Q4TA 4E6CA 2Y4IB 5K0KA 3RWQA 4D4SA 1P4FA 2BAQA 1Q97A 4E26A 3DLZA 1ZYLA 3KXHA 2UZVA 3CBLA 3QTRA 4JBPA 3UYTA 4CMTA 2VWUA 4BBEA 5ANKA 4C02A 1YVJA 4GFOA 5ICPA 1CKPA 4FZ6A 5LVLA 4DFZE 3KKVA 2LAVA 3E64A 2Y6OA 3VS2A 4BTMA 2HXLA 4DC2A 3ZU7A 4NM0A 2BTRA 3KXZA 5E8YA 3VBQA 4OTGA 4I23A 3MPTA 3V6RA 1H01A 2J4ZA 5AV4A 2XA4A 4QTAA 4FKOA 3S4QA 1YWRA 3R02A 1SVHA 2V7AA 2QNJA 3HUCA 5HGIA 3R8ZA 4AWIA 4MQ2A 1PKGA 3FSKA 3NEWA 5CU4A 1CDKA 3NYXA 3S95A 3PIZA 4LGGA 4U41A 4DH7A 3GUBA 4PTCA 3WF9A 5BVDA 2XB7A 5I9YA 5E8TA 1NXKA 3MFTA 4XCUA 3CPBA 1LUFA 4GS6A 4M15A 1OIYA 3FKLA 3O0GA 5HNIX 2C5NA 4WNKA 3VWAA 1Q24A 5LARA 1UVRA 4WRSA 3H9RA 4EQUA 4C36A 3OCTA 5D12A 1A06A 5D1JA 3EQGA 4GH2A 4F0FA 2BAJA 1DS5A 3L9LA 1ZYJA 2W0JA 3Q9ZA 4EQCA 4JRNA 3BWJA 3G5DA 4W9XA 2C5VA 4U3YA 2YIRA 5HZNA 4ARKA 3EFKA 4C4JA 3OROA 3G6GA 2J7TA 4IZYA 4JOAA 1PXJA 2O3PA 5LQFA 4GIHA 5F94A 3U9NA 3SW7A 3ENMA 4QNAA 3IW6A 4D5HA 5DIAA 3TKHA 1YI6A 3G90X 4FV8A 4FV1A 2C6DA 3PWDA 4IB5A 5C9CA 4YGAA 5AR3A 3R7EA 5JFVA 3OXZA 4USEA 1PYXA 4R3RA 1J3HA 2W96B 4E8AA 4GYGA 2HYYA 5HTIA 5TF9A 4FKRA 3MYGA 2F2UA 5EKOA 3TN8A 4X2GA 2LGCA 4JX3A 2QQ7A 3G15A 4Y46A 4IVAA 3OEFX 1Z5MA 2WMSA 5HHWA 2UZWE 2VTQA 3GT8A 5DG5A 3F3UA 3L1SA 3R7GA 3VBXA 5IU2A 3PJ1A 4KABA 5HG5A 3W18A 4D4RA 3LFSA 2YIQA 3VNTA 2B55A 2QI8A 2GMXA 4TRLA 4TWNA 4DFUA 2BRGA 3GXLA 4QMNA 2YERA 1K9AA 4K2RA 3FUPA 2XNPA 4UY9A 5IKWA 4DFXE 3A61A 4IBMA 5ETIA 4FA2A 5ETFA 2UZUE 4Y8DA 4D9UA 4K77A 3FMLA 3MIAA 4R3PA 3OFMA 4JIAA 4HPTE 3AXWA 4PX6A 3G0FA 4RQVA 4DITA 1NA7A 3GOKA 3VS7A 4XMOA 3LJ1A 1Y8GA 4J52A 4C7TA 2VWBA 2UW8A 4RRVA 4I5CA 3RKBA 3UPZA 5FG8A 1ZYSA 3RM6A 3SVVA 4BKYA 5DHJA 1Q8YA 2YM4A 4XV2A 4CMUA 4AZTA 2UVZA 3CC6A 1Y91A 5JSMA 4IWPA 5J87A 2A2AA 2XNGA 3QC9A 5EKNA 2OJ9A 4EBWA 4JL9A 2WPAA 5FQDC 3W2OA 3IOKA 4EC9A 3QTSA 3E5AA 4UXLA 4WSYA 3DFCB 2GQGA 4M0ZA 4AW1A 2ZB1A 5GZ8A 4GK4A 2PPQA 2ONLA 3QF9A 3RK7A 3D5WA 4XV3A 1YI4A 4FK3A 2E9VA 3V8TA 4RVLA 1ERKA 2WOUA 4AT3A 2R5TA 4O0TA 2Y7JA 4B8MA 4QP7A 3E88A 1P2AA 4J96A 4UALA 4IIRA 4CV9A 3LLAA 2I1MA 3AT2A 4X2NA 4WD5A 3DZOA 4EH8A 4QMQA 3UP7A 3PJ8A 2ITYA 5DT0A 5G6VA 5IEYA 3QGYA 3TNWA 4ITHA 3RAIA 3UG1A 1WBVA 2BPMA 3PFQA 3C0GA 4JQ7A 4WUAA 3HRCA 4YLKA 4M14A 2RL5A 1UNLA 3A99A 3FMDA 3LJ2A 5AR2A 5DOSA 3AT3A 5CASA 2R0UA 4XV9A 3F66A 2WFYA 3IONA 3QX4A 4MNEA 2Z7QA 2IW9A 4O7TA 3A8XA 3NUPA 3EN6A 4G6LA 5AUTA 4M66A 5HE2A 2QODA 4LV8A 3UMWA 1XJDA 3QCYA 4G9RA 4L00A 4YC3A 1PMVA 5AUVA 2XJ0A 4J7BA 4OTHA 4BZOA 4DEGA 1UNHA 3L9NA 3V51A 4U79A 3Q5IA 2F9GA 4I22A 3PVBA 3D5UA 3MH0A 2J0JA 2XCKA 3ACKA 4LL5A 3VO3A 3VUHA 3KC3A 3A8WA 4E20A 3O7LD 4V04A 4YC6A 2BHHA 3SXSA 3K3IA 4QMYA 3RCDA 4IM2A 3D9VA 3RPRA 1O6YA 4IVBA 3CE3A 3QZHA 4XH6A 1J91A 2GFCA 3REPA 2X9EA 1VEBA 3VUKA 4BCJA 5AAEA 4DEBA 2G2IA 3IW4A 4O91A 1E1XA 3ZBXA 2OSCA 3LM5A 4MD7E 3NVMB 4X0MA 3FEGA 3K5UA 1GZNA 3TJCA 1J1BA 2Q0NA 2GFSA 4EJNA 4FKTA 5GJGA 4G5JA 3SRVA 5AR4A 3IECA 1IRKA 4N6YA 1W82A 3TJDA 3PPKA 4D9TA 5B7VA 4GU9A 1R0EA 4ANLA 4O0SA 3LQ5A 4EH2A 2J5FA 2W1HA 4TXCA 1M52A 3AC1A 1H07A 4Y5HA 2WB8A 2I0HA 4CZYB 4BF2A 4JDIA 4U5JA 4CEGA 3KRJA 4HGEA 4R5SA 3W1FA 4D1XA 1L8TA 3KRXA 4OT5A 4CFXA 2XYUA 5AAGA 3KXMA 2W99B 3I4BA 1OBGA 4BCGA 5LMAA 3LAUA 3Q5ZA 4MXOA 2R3MA 4RJ6A 4YZNA 2PVYA 4TN6A 3WOWA 4IW0A 2UZBA 3BGZA 3GU7A 4FNXA 2X9FA 4LFIA 4L3LA 4DN5A 3OW3A 1WBOA 2XVDA 2YA9A 3JPVA 2YWPA 3ATTA 1ZAOA 2F49A 3DKCA 2CNVA 2WTCA 5M57A 4E4XA 2BROA 2QOOA 2BZHB 2YM6A 4F0IA 4BDHA 5CU2A 4ZTLA 1H24A 3M11A 4UMPA 3IGOA 3QQFA 4IVDA 1JVPP 4MEDA 3QQUA 3IG7A 5DR9A 5FXRA 3HMMA 3NNWA 4FV2A 2B54A 5AJQA 1R78A 1UNGA 3BIZA 4ALUA 1WCCA 4C4IA 3ZLXA 3QQLA 5EW8A 2QO2A 4ACDA 5IA1A 3CTQA 3ODZX 5K0XA 3C4ZA 3R8MA 1WFCA 3UNKA 4DFNA 3MTLA 4A9YA 5LMKC 4BC6A 1U54A 4ITIA 3V8SA 4BWXA 3LM0A 4D0XA 1PHKA 4F7NA 4G31A 1V0OA 4ZY5A 2UW3A 4BVUA 2ACXA 2CMWA 4YHTA 2JKKA 2QVSE 3MB7A 4UWCA 4BDDA 4C33A 4EEVA 5CSPA 4J53A 5JRSA 2X8EA 3OEZA 3F6XA 3ZOSA 4TPTA 1SM2A 5KE0A 4E5BA 2JBPA 3CTJA 2I6LA 3PPJA 3E8EA 3R1NA 2WU6A 4AFJA 4M69A 4CFMA 3R8LA 4E6QA 2GCDA 1H08A 4YLJA 3HEGA 2GHMA 5A4LA 3PJCA 3PWYA 4JRVA 1ZARA 4CKJA 4OT6A 2NO3A 3LQ3A 4FEXA 2G01A 1OBDA 4HPUE 5HE0A 4GUBA 3UODA 4F08A 5K9IA 4FV5A 3ENHA 4EL9A 2NP8A 4TYJA 4UX9A 3JVSA 3ZRMA 1CTPE 2BKZA 1IA8A 4QYHA 2Z2WA 5CLPA 3GCVA 3NS9A 4ASZA 4ZLZA 4WT6A 3OBGA 3IK3A 3SG9A 5HBHA 4F70A 1Q8ZA 2OW3A 1WBSA 3W2SA 2OKRA 5FGKA 1I44A 3QAME 4RZWA 3AGLA 2C47A 4U97A 5IA3A 2RGPA 4IFCA 4FKGA 4K18A 3RHXA 2WQMA 3W2PA 3LLTA 1QPEA 1Y6AA 3NAXA 2VTRA 2ITPA 1KV1A 4LM5A 3PA5A 5HIDA 2GS6A 2V5QA 3H10A 4NT4A 3PPZA 2JIUA 1EH4A 3OBJA 3BYMA 2WQEA 3G51A 2WMAA 1B39A 4GK2A 5HG8A 5JRQA 3HV7A 4FZ7A 4DCEA 5A4CA 5CVGA 4DH1A 5D9HA 3R83A 3ORXA 1B6CB 2V22A 3SGCA 2VTSA 3BLRA 5HU3A 4C37A 4CT1A 2C3JA 2PK9A 4MVFA 2Z7LA 3AMYA 5H3QA 4PWNA 3BU3A 4EOPA 4C4EA 4IXPA 3U8WA 3QYZA 2OIBA 3LMIA 1FVRA 4I6QA 4RC3A 4YJVA 1JWHA 4GL9A 5HI2A 2QU5A 5BUIA 3NCGA 1JNKA 3S00A 4DH5A 3RZFA 3QCQA 4WRGA 4BZDA 2BHEA 5KX8A 2PVKA 3ID6C 4II5A 4QMXA 1PF8A 3G9NA 4CSVA 4QTBA 5B0XA 4CFFA 2IZSA 3FZOA 1W7HA 4IAYA 4M97A 4WG5A 4HGSA 3MS9A 3OWJA 4RJ7A 4EI4A 5KBQA 3HX4A 3UZTA 1P14A 2PZYA 1R1WA 2WMTA 4RWKA 3C50A 4R78A 2O63A 5I5ZA 5ANEA 3BZ3A 5TT7A 3IO7A 3EZRA 4G3EA 3TCPA 3GFEA 5LVOA 3PP1A 3O8TA 2J50A 4D2WA 3VUGA 4H36A 4IQ6A 1ZZ2A 4IWQA 3ULIA 3ORLA 1F3MC 5EYMA 3TZMA 2RFNA 4EWHA 3S3IA 3EMGA 3ZS5A 4BTFA 3DK7A 4TYHB 1F0QA 2XK6A 4PL5A 5DN3A 3JY0A 3IPHA 3LFQA 4X2JA 1SNXA 5CSXA 4FR4A 3RGFA 4UB7A 4B8LA 4KKGA 5AP0A 4J99A 3V8WA 3ZC6A 1SZMA 3HUBA 4IDTA 5FTOA 3MGYA 3ZZEA 3NYVA 4L68A 4ZS0A 4FK6A 5HX6A 4FV7A 4P5ZA 5CNNA 5I9VA 5C4KA 1OVEA 3DQWA 4CQGA 5KMIA 4FODA 1M17A 5M55A 5M44A 3D7ZA 5C4LA 5BX0A 2GPHA 3DBFA 4F7JA 4R6VA 2QCSA 2UW7A 2C30A 3QFVA 4DYMA 2UV2A 2C1BA 2QG5A 3W2CA 2GHGA 1FMOE 2XMYA 2O5KA 1Q4LA 3EIDA 3H3CA 3DTCA 3FLYA 2XBJA 4F99A 3OW4A 3LPBA 5K4IA 2ERZE 4YO6A 3SKCA 1Q41A 5D7AA 2CKEA 3SOAA 4C4GA 5JKGA 2BRBA 4JS8A 3SC1A 4APCA 3FKNA 5GIOE 5HICA 5IPJA 2Z7RA 4L8MA 4PDPA 1OZ1A 3CQEA 4I6HA 3EN5A 4PV0A 3R63A 4GEOA 4FX3A 4ZTMA 2UZOA 4L01A 5LVNA 2REIA 3E7OA 4XG6A 4JDKA 4XP3A 2FB8A 1G8AA 5D7VA 4DTBA 4BICA 3D15A 3GQLA 4FTQA 2YIYA 4LV5A 1R3CA 4L3JA 4D2VA 2BDFA 2OJFE 3OP5A 1YWVA 3QHWA 4FKVA 2XP2A 2UW9A 4BDAA 5M4FA 2FUMA 5HQ0A 1IG1A 4HJOA 4A7CA 1ZOGA 2UVYA 3DV3A 4KS7A 4F9AA 5KKRC 3QWJA 1LEWA 3UE4A 4AN9A 4AZWA 4RWJA 1R0PA 3ETAA 2PMIA 3KRWA 3V5TA 3V5LA 3PA3A 3RPOA 3QTQA 4M8TA 2NNWB 4FKJA 3LXNA 3KVWA 5EM5A 3HAMA 3SHEA 5F20A 5C8NA 2R2PA 3U4WA 2GNHA 2R3KA 3FI8A 5HBJA 4M0YA 4EYMA 3UC3A 2P4IA 2BMCA 4A4XA 1J1CA 3PLSA 4F0GA 3EZVA 1PRYA 2QG7A 3NR9A 4YJQA 2WMQA 4V0GB 5CEQA 2GNFA 1RJBA 2PZ5A 2P33A 2ZV2A 4NW6A 4AXAA 4D58A 5AX3A 2QHMA 3F5PA 2VNYA 2Z8CA 4FG9A 2CCHA 3FL4A 3UYSA 4BCKA 3MPMA 2YIWA 3NUSA 5KMNA 2HZNA 4GV1A 1PMEA 4BDGA 3RWPA 4DLJA 4EKLA 4DH8A 5HLWA 4QQ5A 4G6OA 4LGHA 2F57A 3C4CA 5DBXA 4FT0A 4EK5A 2VTTA 2OF2A 3W8QA 3MVMA 4G34A 4RA4A 4RWIA 2C69A 4BCOA 4Z7HA 2X1NA 5C1QB 1U59A 2GTMA 3NNXA 3NW6A 3TXOA 3GU8A 3WARA 2YJRA 4KIQA 4AGDA 4S2ZA 5GZAA 4CYIA 5HE1A 3RK5A 1UU3A 2PTKA 3R8UA 3FLWA 3CXWA 5IISA 5LMKA 2F2CB 2V62A 3CD3A 5FEEA 4O27B 1LEZA 2JIIA 1A9UA 2RG5A 5BYZA 5CAVA 3NUAA 1QMZA 1JSUA 3O17A 2VNWA 4Z9LA 1PKDA 5FDPA 2ZMDA 4MHAA 4NFMA 5AR7A 3S2PA 5CU6A 2XUUA 2XIYA 4PTEA 5FLFA 4EOQA 5BVNA 2BAKA 2ZM1A 3TWJA 5HNBA 2B9FA 3NW5A 4JVGA 3TG1A 3GC9A 3RPYA 2QO9A 2R3OA 4QPSA 1QPJA 5JQ5A 3O2MA 4I94A 3AC4A 3DY7A 3R7IA 5EM7A 5DYJA 4MTAA 2BCJA 3I7BA 1SNUA 1JLUE 4F09A 3ET7A 3U6HA 4GUEA 4E1ZA 1DAWA 3SAYA 4FZFB 1YDSE 3BHVA 2IW6A 2QONA 2HENA 2UUEA 3EQPA 3FLQA 4FV0A 3OOGA 4QRCA 4CZTA 4P4CA 3BV2A 4ZZOA 4KBAA 3EKKA 3F2RA 1DAYA 4F65A 4DFLA 3R1SA 4NK9A 1CSNA 3E3BX 3RMFA 1GY3A 2JKOA 2JKMA 1JQHA 4QP6A 3CJFA 4NFNA 4DLIA 1IASA 5CQWA 4OTDA 1M7NA 4J1RA 4DT9A 3LCDA 2CLXA 4ZJJA 4EOIA 3RJCA 4DTAA 4JBVA 4DEDA 3PG3A 4ONAA 3VS1A 3ZCLA 4TL0A 2CGXA 3DBQA 4FSQA 4EOJA 4FKIA 5HCXA 3OWPA 2AC3A 4XS2A 4FE2A 2EXEA 4CQEA 4PF4A 4YHJA 4EH9A 2BZIB 2X2KA 3FZ1A 5HTCA 3QD4A 4U44A 3EWHA 4YJSA 4LOOA 3HRFA 3LFDA 1MP8A 4MBJA 4QP4A 3RHKA 2J6MA 5JZJA 3F7WA 4U43A 5A3XA 3KREA 2W4JA 3NIZA 2GQRA 5JEBA 3TI1A 3I81A 4QMMA 3CGFA 2WOTA 2IG7A 4FOBA 2UVXA 4V05A 2BZKB 4IB3A 4EH5A 4O7NA 3DA6A 3FYJX 3RAWA 3ZSHA 5AIRA 4A07A 1DM2A 2R3JA 3FPQA 5EHYA 4C4FA 5A4TA 4J71A 3DXQA 1YOJA 3BHHA 5GIPE 4NKSA 3DZQA 5AUXA 1H25A 4N70A 3VIDA 2WHBA 3UOJA 2CKPA 1AD5A 4FBXA 4FSMA 2OXXA 4IJ9A 5CEPA 4EOSA 3BI6A 5CF6A 3D4QA 2XNMA 2R3NA 2JAMA 5IH5A 3UZRA 3RK9A 3I60A 2PY3A 3CPCA 5DMZA 3JS2A 3FHRA 1FVTA 2I40A 3DJ5A 4FG7A 2YCQA 4PPAA 4YZMA 4QYEA 5CT0A 4BDEA 2JIVA 4I0SA 3UDBA 3JYAA 1P4OA 3CLYA 2W5HA 3CKWA 2VX3A 4G16A 4LRKA 5KMLA 4EQMA 3KULA 2P0CA 4F1OA 2VTOA 3MA3A 1URWA 5DNRA 1MRYA 3EHAA 2YWVA 1OB3A 3KFAA 2G15A 4C35A 1QCFA 1WBNA 5FUTA 2C0OA 3UTOA 2V7OA 4E73A 5IZFA 2J51A 2VAGA 1ZOHA 1XH6A 2G1TA 2VGOA 3TDVA 2XEYA 4G1WA 1OPJA 2EB2A 5I0BA 3GP0A 2EUFB 2ZM3A 1YI3A 3DDPA 3HP2A 3HV5A 2R7IA 2YHVA 4HGTA 4RFZA 4ZMEA 4H3BA 4QP9A 4L52A 3UO4A 4NWMA 2OXYA 4UBAA 3C4WA 2OF4A 3AOXA 5G1XA 3QBNA 2W9ZB 3RVGA 3ZO1A 3C4EA 3QD0A 1KV2A 4RGJA 2GTNA 4YPDA 3RTPA 3UZPA 3LOKA 4PL4A 1MUOA 2R4BA 4FL3A 3BKBA 3H9OA 4FSZA 2JBOA 2R7BA 1FGKA 4I92A 2Y6MA 1WBTA 4YURA 5D41A 5J7HA 3EQBA 3ORIA 5A6NA 1CKJA 4L9IA 3EFJA 1Q99A 5J5SA 2FH9A 4JDJA 4FTRA 4LMUA 3AC2A 3WZDA 5FDXA 3W2QA 5JN2A 3QKKA 4NEUA 4FTMA 3Q53A 4RJ3A 4AACA 3C0IA 4AZFA 3D7TA 2BR1A 3HDMA 2HAKA 3FV8A 3CQUA 1H28A 1ZYDA 3LZBA 4UMRA 3QUDA 1YXSA 1OL5A 4KNBA 3LFNA 3NNUA 5EHLA 5K4JA 3QA0A 3ZTXA 3LHJA 4L45A 5EDRA 3ZUVA 2YDKA 2WIPA 5DFPA 2X7OA 4MNEB 4EBVA 1ZRZA 1GZKA 5J9YA 1Y6BA 4ZZNA 4KSQA 4Q5HA 4E6DA 5IQHA 1OKVA 2WNTA 3FSFA 4HYIA 4QP1A 4TY1A 4XX9A 3CS9A 4HZSA 4UXQA 3N4VA 3QLFA 3AMAA 4FTUA 4ZY4A 5T6KA 2C0TA 4DE4A 5I9XA 4F9CA 4XRLA 2OZAA 2B4SB 3N4TA 4BZNA 1OITA 1E9HA 1WVYA 3PZEA 3L8VA 3R1YA 3F5UA 3SV0A 5J8IA 4ZSGA 3D2IA 4C3RA 3JY9A 3C13A 1O6KA 3ELJA 3FZTA 5AP2A 4O7LA 3O23A 3UQGA 5J9LA 4O0XA 1BL7A 4DG2E 5BPYA 1LPUA 4HVIA 4EONA 5CF5A 2XJ2A 4ZSLA 3ZDUA 4GW8A 5IA5A 4FMQA 2RFEA 4QQJA 1U4DA 1QL6A 3F3VA 3O8UA 4MBLA 3U9CA 2ZAZA 5EW3A 1APME 4DHFA 4H39A 2KULA 3SRVB 4CLJA 4XG3A 2JITA 5H8EA 4ZMFA 1E1VA 3R2YA 2FO0A 4ZOGA 3VJOA 4AA5A 2BRHA 4FIJA 3PUPA 4OLIA 3WIGA 2YM8A 3NGAA 3LXPA 4AW5A 2B7AA 2FA2A 2ITZA 3OS3A 4WBBB 4BCMA 4O1PA 3OMVA 4LRJA 3NW7A 5AIKA 3RI1A 5EYKA 2CJMA 3P7BA 4OBOA 4CZUA 4DGMA 5L6OA 5M53A 4BYIA 1SYKA 3Q4CA 5HG9A 3GI3A 3R9DA 2ZV8A 3A7HA 4U0IA 5M51A 2XH5A 3D5VA 4R1YA 4AS0A 3HMPA 2GS2A 3EJ1A 3AC3A 4JI9A 3IW8A 4FKLA 4C38A 4HW7A 4XNEA 4BBFA 1PXLA 2WTIA 4H1MA 2WTKB 5HO7A 4QQCA 2BTSA 2OIQA 1XKKA 3MY1A 5ANOA 4EORA 3TUCA 5C8MA 2PZRA 2CGVA 4X7QA 2V55A 3DBCA 4IM3A 4CVAA 3Q3BA 2PVJA 1PY5A 4RLKA 4YU2A 3KEXA 5FEQA 1T46A 4FIGA 2BVAA 2J0IA 3VS0A 5IQCA 4MNFA 3V5WA 4D5KA 4NJ3A 3HZTA 5IG1A 3ZZWA 3DKGA 2CSNA 3U6JA 1TQMA 1A48A 3I0OA 4KS8A 4JG6A 4FTJA 3ORMA 2BRNA 1JBPE 1YOLA 5E8XA 4GKHA 2XNOA 1FQ1B 2VTIA 2VTHA 3R00A 4I24A 4TWPA 4WBOA 1Q8WA 1U54B 3ACJA 3R9HA 2HZ4A 2VD5A 2YZAA 4WIHA 2EXMA 4HCTA 3ZLWA 3LCKA 4S34A 4Q5EA 2BUJA 2E2BA 5ANIA 3M1SA 4ACGA 2Z02A 4RT7A 3BYSA 4OBPA 4D28A 1SVGA 3GCUA 2EU9A 3R9NA 3R71A 4N57A 3RINA 1YXVA 4J8NA 2WTDA 4M69B 1K3AA 5FD2A 3RAHA 3EQHA 4X3JA 3AC5A 4MX9A 3QTWA 3FXWA 3FI3A 3L9PA 4DEHA 4O0VA 5DGZA 2WTJA 3TKUA 4LRMA 4BYJA 4O2PA 4I4FA 1OL1A 4F9YA 4XUFA 4OTPA 2I0YA 5JFXA 4NYEA 5DT3A 5CSHA 4XLVA 1OKYA 1BLXA 2OFVA 4JXFA 3PLAE 3BYOA 2WMRA 4QP3A 4G6NA 5DWRA 4BWKA 4C34A 4IAFA 3KCKA 4W8EA 1XH7A 3TNQB 3MH2A 3AD5A 3DOGA 4OTQA 1KOAA 3E92A 2UW4A 4ZP5A 2C6MA 2CGWA 2OWBA 2UZEA 2GU8A 3AQVA 3QQJA 3VBTA 4NUSA 1FMKA 4ZSJA 3G9LX 3HDNA 4L53A 3P5KA 3TL8A 3WIKA 2IO6A 5L8JA 4YJPA 5AADA 3P4KA 1WBPA 3P08A 1V0PA 2CDZA 4GSBA 3KK9A 1PXPA 2DUVA 5E9EA 2X39A 3UC4A 4ERKA 3GCSA 4R7HA 5A14A 2YAAA 2XK9A 4EKKA 3PP0A 3HV3A 3UO6A 4O6EA 3DJ7A 3NYNA 5D10A 3FMKA 2WGJA 4OTIA 5CEMA 3HVCA 5IDPA 4ANNA 2XEZA 3AG9A 3D83A 3MESA 3MW1A 2RKUA 4UYNA 2C6OA 2ITOA 2OH4A 2YDJA 3R30A 1ZMUA 3MV5A 4FSYA 3VBYA 3GU4A 5HLNA 4CV8A 4FYOA 4ALVA 4IDVA 2ZOQA 3EL8A 5IQIA 5IQDA 3T3VA 2W1FA 1XO2B 2E9PA 3DAJA 3KMMA 4A9RA 3R04A 3KF4A 2E9UA 3BRBA 3SOCA 2J90A 2W1GA 4JJRA 4EH7A 5CVFA 4KINA 5KNJA 2VGPA 3ZMMA 1PMNA 4A9UA 4KRCA 5M08A 2JDTA 4ZLYA 2ITXA 3D5XA 3LW0A 4D1SA 3A2CA 4GG5A 5KZIA 4YJOA 2WIHA 4RIYA 2Y8OA 3RPVA 2B9IA 2JFMA 5J95A 5AM7A 3QA8A 2YCRA 3R21A 3ZEWA 3DTWA 5F95A 5FBOA 4BI1A 3AMBA 5HO6A 3VJNA 3TV7A 4FYNA 4ENXA 1BI8A 5HCZA 5ACBC 3SDJA 4KIKA 4F64A 5CXHA 1GIJA 1GIHA 4JQEA 4MQ1A 4X6RA 5CZHA 4GT3A 3UVQA 4AGCA 4AW0A 3VBVA 4EH6A 4APPA 4RSSA 5L4QA 1YHVA 2XNEA 2FSLX 3PXZA 4I0RA 4KIPA 3UPXA 1ZYCA 5HIEA 2OJIA 3PIYA 4FV6A 4B99A 4XEYA 4OAVB 5DH3A 3V01A 1Z57A 4IX3A 2JAVA 4PMMA 5A6OA 4O2ZA 2G2HA 3D94A 4AN3A 3LMGA 5DR2A 4PTGA 2AYPA 1CKIA 4ZAUA 1SVEA 3BQRA 3LXKA 3BYUA 1U5RA 3NUYA 4G9CA 5CEIA 3WF6A 5GINE 4ZTQA 3FJQE 2AUHA 3HKOA 3MWUA 4HYHA 1B38A 1TQPA 2JDRA 4QYGA 4Y72A 4EOMA 4BKJA 3EYHA 2BIKB 4JT3A 3W33A 4QMLA 3MY0A 2SRCA 3LFAA 3KA0A 3MH1A 1H00A 4XP0A 4ANSA 4LI5A 2W5AA 1H1RA 1L3RE 4BB4A 4A4OA 3E93A 4FNWA 1VYWA 3QRKA 2H9VA 4UZHA 5E1SA 4O7RA 1FGIA 4BWPA 4EZ3A 4W4WA 4NIFA 5CS6A 3NMUF 2YN8A 3BHTA 4X2FA 2OG8A 3WZUA 3A60A 3ORPA 4G3GA 4A9SA 3FC2A 2VTLA 2ZDUA 3R2BA 2PUNA 5AWMA 5BUJA 5GHVA 4IACA 5F4NA 2IZTA 3F61A 4DEIA 4P5QA 1AGWA 2GNIA 3F88A 4BI2A 3U6IA 3PSBA 4AZEA 4BCHA 4MF0A 3KVXA 4FNZA 3KN5A 1R39A 4D55A 3FAAA 5E7RA 4FEQA 1WVWA 1UKIA 3G0EA 3WZJA 5IF1A 3B8QA 4XG4A 3R7UA 3OT3A 1UWJA 4AGUA 5HIBA 1IAHA 3DNDA 1J7IA 2WMBA 4AZVA 5T68A 4AG8A 3OZ6A 2YM5A 4FI1A 3P23A 1YWNA 4MWIA 2WEIA 3BX5A 4R3CA 5EI6A 3F3ZA 4C58A 5IMXA 1GOLA 4P90A 4CRLA 2GSFA 4RIWA 1YW2A 3MJ1A 4I5PA 3R8VA 2QLQA 4AX8A 4V01A 2OO8X 4U80A 1XHAA 3I6UA 5DA3A 1O9UA 2WQOA 2C0IA 2CGUA 4XV1A 1PW2A 1KE6A 4MKCA 3WYYA 5IUGA 3ERKA 4RVKA 2VTNA 4M7IA 5AX9A 4GK3A 4ZTSA 1BI7A 1XBBA 3CKXA 4MYGA 3PIXA 1UWHA 5KMKA 4DGGA 5CEKA 4XG8A 3HMIA 4I21A 4G3CA 3VS4A 4C57A 1VYZA 4RJ4A 4BCNA 4D4VA 4QMOA 2ITUA 2JLDA 4OUCA 3H30A 3NLBA 3VQHA 2WTVA 3EQCA 1G3NA 3P0MA 5IQEA 2HWPA 3COKA 3FKOA 4RZVA 2OIDA 4F63A 2VZ6A 4OW8A 4IADA 3FDNA 3LKMA 2XS0A 2HZ0A 4IE9A 4O83A 4ASDA 3GB2A 2YDIA 4FT5A 5KBRA 3DT1A 4AAAA 3KRRA 1U46A 3OOMA 4LMNA 2VU3A 3BYVA 4YSMA 2XK3A 3CQWA 3EN9A 3QTUA 4P7EA 3VVHA 4AA4A 2VTJA 3R28A 2EXCX 3R22A 3T8OA 4R7IA 3FMEA 3T9TA 5LXMA 3FMNA 2X2MA 5LWMA 4E93A 4RX5A 4FTOA 4C3PA 2A19B 2BFYA 3TNHA 1FINA 2C6EA 4GMYA 2PMNX 3HLLA 4ANMA 5E8ZA 5ETCA 2H34A 2IZUA 3DKOA 3P86A 5IEVA 5LVPA 1S9JA 2GNGA 4KWPA 3MTFA 3TV6A 2XBAA 4I4EA 2IN6A 4FKUA 1RW8A 4TW9A 4ACHA 4FTTA 3ZFMA 2BDWA 3VS5A 3L8XA 3PA4A 3TDWA 2IZRA 1Q8UA 3OCGA 4ZEGA 3TZ8A 2A1AB 3VHEA 4S30A 4Y95A 1PJKA 1FPUA 4MBIA 5FP5A 3ZRLA 4BTJA 5L8LA 1GAGA 4AOTA 4XG7A 3QQHA 5KUPA 3GFWA 1Y57A 4AN2A 3UOKA 3IQ7A 3A7IA 2PULA 4PL3A 4FL1A 4FUYA 1UU9A 3D14A 5FP6A 4DH3A 1XR1A 3DB8A 4FIIA 4I0TA 4YNEA 4WKQA 3OTVA 4WOVA 5JZNA 3OG7A 1IA9A 5K5XA 2W1IA 3R8PA 4IAZA 3F82A 4E5AX 1VJYA 3EQRA 3LIJA 3ODYX 4CFNA 1KOBA 3T3UA 5L3AA 3AD4A 3PE1A 5M09A 1ZOEA 3GQIA 4RG0A 5L2SA 3MFUA 2OI4X 3GEQA 4XG2A 4IFGA 4O21A 3UVPA 4Z3VA 5HD4A 2R3GA 2WU7A 2PYWA 1H1SA 2VTMA 2PL0A 2Q83A 3ZO3A 4DGOA 3KF7A 2DYLA 3S0OA 5E4HA 2QOCA 4IX6A 5CEOA 4PP9A 2UZDA 4OTFA 4ZSAA 5B2LA 1GNGA 3DNEA 4IX4A 3LCSA 4YTIA 5M4CA 3MY5A 1H8FA 4BBMA 5BUEA 2VUWA 2VV9A 1NVSA 3N9XA 4M3QA 4X3FC 2QC6A 3QTIA 2OICA 4MK0A 2WO6A 2YEXA 3PG1A 3K5VA 2WKMA 4N6ZA 1OKWA 2B9HA 4NZWB 3EQDA 3PXKA 4RC4A 5JK3A 4IZAA 1XH5A 4F9WA 4TNBA 4FEUA 5HORA 4MXAA 4U6RA 2X6DA 1JSTA 3LFCA 3VUTA 4R7BA 5IH4A 2XCHA 2J9MA 4R1VA 5AAFA 4AF3A 2F4JA 5M4IA 5EYDA 3MFRA 4ANOA 2WXVA 4RX7A 5ANGA 3VN9A 2ZV7A 3PVUA 4O0YA 4UMTA 4KBCA 4XHKB 3Q04A 3BHUA 5CSVA 4RFYA 4GU6A 2O8YA 4HOKA 4YUQA 1GIIA 2XKCA 4IB0A 4QYYA 5KCVA 5EDPA 3AT4A 4C2WA 3NWWA 3FY2A 3RM7A 2XKDA 4TNDA 4EHEA 3M2WA 4BN1A 4ZXTA 2H8HA 2IVSA 3WF8A 5KHXA 3O8PA 1OM1A 3KXXA 3QTXA 3VF8A 4D2TA 1V0BA 3TM0A 4AW2A 5KMMA 1ZZLA 5EQPA 4G2FA 3BBWA 4I20A 3EFWA 5CF8A 2VWVA 3P7CA 1NW1A 2PWLA 3DAEA 5BMMA 5BVKA 5C01A 3KULB 3POOA 5EHOA 2ETMA 2J5EA 4E3CA 4YSJA 5LJJA 1UKHA 2O2UA 2PVNA 2YFXA 4Z16A 3ANQA 4GKIA 2PUIA 4EC8A 4YJTA 4FL2A 5DRDA 5H9BA 5CF4A 4ALWA 3MFSA 5AUZA 1W84A 2YCSA 2OH0E 4FT3A 3F2AA 2DS1A 4QQTA 3OXIA 5EH0A 4UWBA 4YTFA 3COHA 4GIIA 3UNJA 3ZFXA 5GJDA 1I09A 2X7FA 3WZKA 4EUUA 3Q9WA 4FT9A 1WBWA 4H3QA 4P2KA 2X6EA 3FBVA 3NUNA 5CT7A 5EI2A 3NCZA 5TE0A 2WELA 4PPBA 4FSRA 4F9BA 1GZ8A 5BVFA 3BLHA 3E63A 3UIBA 3H0YA 4EHGA 3LVPA 5HE3A 5F9EA 2R0IA 3KK8A 4O7ZA 1JSVA 4JAIA 4O1OA 3RNIA 4K0YA 3ATSA 4XOZA 1O6LA 2O65A 1X8BA 4QP8A 5DRBA 4PP7A 4FKQA 1W8CA 3VUIA 4QNYA 3BELA 2Y4IC 4HZRA 4AT5A 3U51A 1M7QA 2Z60A 4XRJA 3QYWA 2UZNA 4HCUA 2GQSA 3NUUA 1QPDA 3G6HA 5ITAA 1G8SA 1H1QA 3GENA 5EI8A 5DEYA 4G3DA 3FXXA 3ZUTA 4C61A 3C51A 5D11A 5EFQA 5J79A 3LMHA 3GGFA 2ZM4A 4NW5A 3D7TB 4ZSEA 4CKIA 2JEDA 4W8DA 2R64A 5CTPA 4F7LA 4F7SA 3FL5A 4GVJA 2UW5A 2YJSA 5I9ZA 4BR3A 5C27A 3EKNA 4PDOA 5I9WA 4RC2A 5AFVA 2XK7A 3QRUA 2ESMA 3AGMA 4BCFA 4XG9A 3ALOA 4BI0A 3MI9A 3HMNA 4DG0E 4C8BA 1XH8A 1XBCA 2QKWB 3C0HA 4W4YA 2CKOA 2YZLA 3DCVA 4DINA 1YDRE 3VULA 2G2FA 4MXYA 4UMUA 4WHZA 3HECA 2JDOA 3ZO4A 2R3IA 3MPAA 3Q6WA 1Q61A 4TKSA 2X4ZA 5CI6A 4AE9A 5J7BA 1YXXA 2OZAB 2PZPA 4ASXA 2JC6A 1NVRA 3HA6A 2VTPA 1BX6A 2XZSA 4KSPA 4J97A 4TZRA 5AV0A 4DEAA 1IAJA 1OPKA 3ZM4A 2A0CX 5KKRB 2FGIA 3FPMA 4A06A 2HW7A 3BGQA 3N51A 4YTCA 5KMOA 3QUEA 2WMXA 4ZS4A 3O51A 4FZAB 4MD9E 3RALA 2QURA 5CWZA 3ZO2A 2PSQA 5AP5A 1F5QA 4FTAA 3N4UA 4HVSA 4FEVA 4BDFA 5I3OA 1RQQA 3PE2A 3UQFA 5E8VA 1IEPA 3FY0A 4K9YA 3DKFA 4TWCA 2X8IA 3B8RA 3EL7A 3GCPA 4AOJA 3Q2MA 1LR4A 2GS7A 4NCTC 3PRIA 3QRTA 3PXRA 2QR8A 3ZFYA 4PDYA 2XJ1A 3DDQA 4EZ5A 3P7AA 3G33A 5J9ZA 2OBJA 4ZJVA 3DBDA 4M68A 1UU7A 2QOLA 3GBZA 4NM3A 4KAOA 2W1DA 5HTBA 4ANQA 5CENA 3CR0A 5K5NA 2H6DA 1OIUA 4DT8A 2W1EA 4LGDA 3A4PA 4QMTA 1H0VA 2YIXA 3BWFA 4IC7A 4WUNA 1KSWA 4FGRA 4DG3E 2ZVAA 5L8KA 3KL8A 4YBJA 4NU1A 3FQSA 4BRXA 3LCOA 4L7SA 4XLIA 4FF8A 3RP9A 2PE0A 3O96A 3Q60A 4IAKA 4LYNA 3RBWA 3TT0A 2ITWA 2HIWA 4OBQA 2X81A 3NYOA 3T9IA 3DB6A 4FG8A 4FSWA 3NAYA 4PPCA 2FSMX 3CJGA 3EFLA 5J1WA 3FE3A 3DAKA 1TQIA 4FSNA 3V5JA 3HV4A 3QU0A 4Q2AA 4ZIMA 2A27A 4KIOA 4DCAA 5HBEA 2CNUA 3EN4A 5A4QA 1YDTE 3BV3A 5HNGA 3OF0A 4IWDA 2PU8A 4C62A 3Q4ZA 2QU6A 3VC4A 4XBUA 1KWPA 5HX8A 4PMPA 2PVHA 4H05A 3UIMA 3CD8A 5B2MA 2WAJA 5CVHA 2HW6A 4F1MA 2QR7A 4K11A 2PE2A 4W4XA 4Z55A 1PXMA 2P55A 2PMOX 3F5GA 3PSCA 4GFMA 4B7TA 1OI9A 5AA9A 4EOOA 4X21A 1OGUA 2C6KA 4FSUA 4HVDA 2OJGA 3R9RA 4YNOA 2FSTX 3B2TA 4IM0A 4S32A 4O7VA 3QLGA 2BRMA 4PRJA 5GZ9A 3IW7A 4KUJA 3QRIA 4EK6A 5HVYA 3RCJA 4BDKA 3W8LA 4NSTA 1KUTA 3U4UA 2PVLA 1CM8A 4DFBA 4NM7A 3K54A 1CMKE 2OU7A 4J98A 2XNNA 4MH7A 3IW5A 5AV3A 4BKZA 4ORKA 2BDJA 3FYKX 4NH1A 4FTLA 4NJDA 3E7VA 4YZCA 2XIZA 3EQIA 3I1AA 5TKDA 2QOBA 3WF5A 4QTEA 2AC5A 3NSZA 3W55A 2OFUA 3DK3A 5HU9A 1U5QA 4IB1A 4RFMA 3U87A 5A54A 4X3FA 4YP8A 4DGNA 5IA4A 3QCSA 5BMSA 1M2QA 4IJPA 5HD7A 5K3YA 3IDCA 3P79A 1NY3A 3S1HA 1ZWSA 4WA9A 3R6XA 4JQ8A 4PQNA 3ZUUA 5BVWA 3SD0A 1XQZA 1FOTA 3HP5A 2ITQA 3FQHA 3HA8A 1Y8YA 4M84A 4FKWA 5FXSA 3QC4A 3B2WA 3KB7A 4FV4A 2C68A 3EQFA 3VHKA 4EYJA 4RX8A 3DJ6A 3FI2A 2R3LA 1XH4A 3KXGA 4KB8A 3VRYA 4CTBA 2YITA 2QD9A 5H8GA 4EH3A 4EUTA 1PXKA 4PY1A 3FQEA 4G5PA 4RVTA 5AP6A 5C8KA 5A4EA 2C5XA 2NPQA 3SW4A 3BCEA 2CN8A 3QXOA 3ORTA 5CYIA 4LL0A 2CN5A 3VRZA 3C4FA 1BYGA 2C6TA 2DWBA 3TEIA 4EHVA 1VZOA 1ND4A 5DEWA 5I3RA 4UMQA 2ITTA 4LOQA 3NVKI 5LCKA 3ZC5A 5BNJA 3OXTA 1STCE 3QUPA 5FEDA 5AV2A 5AA8A 4E4NA 5E8SA 1TVOA 2XK4A 4AFEA 4RIXA 5CNOA 4M12A 2VWYA 1OL7A 5HCYA 1TKIA 5LVMA 2QOIA 2Y9QA 2V0DA 3UJGA 3TTIA 4EZ7A 4QTCA 4JG8A 5IQGA 4CFUA 3R73A 1MRUA 3ZLYA 4AGWA 3QQGA 4BDIA 2XK8A 3EN7A 4BGHA 4DFYA 5IQFA 5JGAA 3MB6A 4RIYB 1ATPE 3DGKA 4FGBA 5E90A 2HCKA 4BGGA 5FM2A 4BCIA 1JKKA 3EH9A 4JG7A 5M06A 4YZDA 4L46A 1MQ4A 2JFLA 3QWKA 2WMUA 3LFBA 5JT2A 4RVMA 2R3PA 4QTDA 3NDMA 4RA5A 4JDHA 5DR6A 4AQCA 4BDBA 4KIKB 4PMSA 5KZ0A 3BU6A 4F6SA 1ZLTA 3H4JA 2J0LA 4E4LA 2O64A 2W4KA 3PY1A 4IEBA 4CT2A 4Q9SA 5AUYA 2B1PA 4RWLA 3HGKA 4D2SA 5CALA 4TT7A 3R9OA 4FICA 4AE6A 1OL2A 3F69A 5CAUA 3MDYA 3QL8A 5DI1A 4H1JA 3ORNA 4QD6A 4YZBA 3BLQA 3V04A 3EOCA 5LOHA 4USFA 5F1ZA 1WMKA 3UP2A 1WVXA 2VO0A 3G2FA 3NUXA 4O0UA 4U9AA 1Q8TA 3PVWA 2ITVA 3QKMA 3W16A 4AU8A 3Q9XA 4R77A 4BTKA 5EOLA 1Q3DA 2ZYBA 4AP7A 4CMOA 4QMVA 4IMYA 2YCFA 5CAPA 5CY3A 3COMA 3VS6A 3GNIB 2XM8A 3MJ2A 3F9NA 4S33A 2G9XA 1Q62A 3PY3A 4LUEA 4UZDA 3UG2A 4EWQA 3RNYA 3KMWA 1UV5A 4F4PA 1H26A 4YJNA 4XBRA 3KGAA 3HNGA 4Y5QA 2I0VA 4DBNA 2E9NA 3GU6A 5E91A 4O84A 1HCKA 4NIFB 5EDQA 4C59A 3PYYA 4N4SA 2OK1A 3P1AA 5L2TA 4O96A 4I41A 3OCSA 2XIRA 3SLSA 3PRFA 4UEUA 3ZXTA 3OD6X 4JBOA 2PE1A 4OR5A 4IZ5A 5I9UA 4RPVA 4WNPA 2X0GA 3LXLA 4HYSA 5CZIA 4BGQA 4U8ZA 2W05A 3GCQA 3FI4A 3OUNB 4IVCA 4QO9A 3V3VA 4I5HA 3QCXA 1JKLA 2EVAA 4B9DA 2GHLA 1YKRA 5B2KA 4CNHA 4PMTA 5HVKA 2ZDTA 3QZIA 3EB0A 3OTUA 3H0ZA 1M14A 3HRBA 1KE9A 4NCTA 4CTCA 2IW8A 3UO5A 4E7WA 3ZSGA 5I4NA 5EG3A 4XP2A 3WYXA 5ANDA 3HV6A 2YLEA 4FIFA 4RIWB 3E8NA 3QRJA 1G5SA 2VN9A 5L6WL 3VS3A 4EK8A 3QALE 3ZSIA 4Y83A 3LJ0A 4K8AA 4O81A 2ZV9A 3MVLA 4BIDA 4D2RA 3L8SA 5AP4A 3ZDIA 5IQBA 3MSSA 4U40A 3E8CA 3MA6A 2C3IB 3PSDA 4I6FA 5L2QA 5E8WA 1UU8A 4G17A 2OGVA 3I0QA 5J5TA 2XKFA 4A4LA 5KMJA 5KO1A 3C5IA 3JR1A 4FT7A 4EOLA 3NPCA 4WG4A 4YPSA 2F7EE 2FSOX 4NTSA 4AZSA 4CFWA 3Q2JA 3DBEA 4CYJA 3BE2A 4OTRA 4H3PA 2BIYA 2QKRA 3IKAA 5HKMA 3ZRKA 2Z7SA 2X8DA 3BBTB 1RDQE 4BFMA 5JFSA 4CLIA 3QX2A 3KRLA 3OWKA 2WQBA 3BEAA 5JQ8A 2HOGA 2VWXA 4NTTA 4E6AA 5CANA 4GVAA 1DI9A 4GRBA 5E92A 3A62A 3PJ3A 3LFFA 1DI8A 3CCNA 5ACKA 3C1XA 1P5EA 3I7CA 4L67A 2VRXA 5GJFA 4YMJA 2EB3A 4BIEA 3TKIA 5FRIA 4WO5A 1YQJA 3RAKA 4F6UA 3VW8A 4K33A 4GT5A 2R3FA 3DK6A 3NIEA 3ROCA 3WI6A 5IUHA 1H0WA 4FSTA 1K2PA 5A46A 2CHLA 2P3GX 3DFAA 5TR6A 4D2PA 3CEKA 1Z9XA 2WMVA 3ZYAA 4C3FA 5IQAA 5BVEA 2OXDA 5M4UA 4I6BA 3KCFA 3GC8A 3MVJA 2PZIA 3OVVA 1YRPA 1PXIA 4QMZA 3UMXA 2J2IB 4CGAA 2C6LA 3UNZA 5EYCA 4FV9A 3OCBA 4RX9A 2RFSA 3CIKA 1YHWA 3EYGA 2QOQA 3P9JA 5JFWA 2R9SA 1PXNA 2X4FA 4ANBA 4IZ7A 4EJ7A 1IR3A 2HXQA 4J8MA 3Q9YA 3FZRA 1YXUA 4M13A 3WF7A 5J1VA 3MIYA 5CSWA 2Q0BA 4YO4A 2VO6A 1V1KA 2C5OA 3LCTA 5BVOA 3WBLA 5IA2A 4FNYA 2B53A 5BYLA 4X2KA 1VR2A 2ZJWA 3R0TA 2WMWA 4QMPA 4B6LA 4X6QC 4YZ9A 3SXRA 2IJMA 5JMSA 2KTYA 3BEGA 1PXOA 3LFEA 3FC1X 4FZDB 5CAOA 4FIEA 2OLCA 3FMHA 4RLLA 2HELA 4QP2A 4AUAA 3CY2A 4RJ8A 5EM6A 4YHFA 3TUBA 2ETRA 2O0UA 4ZJIA 3FMJA 4PUZA 3DQXA 1KE7A 5CXZA 5CAQA 5H8BA 4AT4A 4C0TA 2F7XE 3KU2A 3PXYA 4USDA 4BDCA 3QZFA 4L6QA 2YM3A 3PDTA 4JLCA 4PDSA 3TV4A 4RIOA 2YACA 3DXNA 3ALNA 5CI7A 3ZXZA 2W17A 4BIBA 5EK7A 4D4YA 4DAWA 1PYEA 2HK5A 4L7FA 4GG7A 3FMMA 3PJ2A 2CCIA 4UWYA 3HMOA 4OGRA 3E62A 3GU5A 4RQKA 3TZ9A 3WZEA 4ZTRA 1HCLA 1QPCA 3COIA 2W7XA 3AC8A 4ZZMA 1LP4A 4A9TA 4KD1A 2GNJA 3VW6A 2QO7A 4ASEA 2HY81 4XOYA 4MXXA 5L2WA 5ETAA 5EM8A 1H27A 3TNIA 3LE6A 3GVUA 4TTHB 5AR8A 3TZ7A 5LMBA 2CNQA 2RG6A 3IS5A 3VBWA 3ZLSA 5EQYA 4CG8A 2H96A 3Q32A 3IDBA 4IAIA 4WSQA 4XJ0A 3JUHA 2QOFA 4QOXA 5GNKA 4K1BA 3Q96A 5AEPA 4ERWA 3CP9A 3SQQA 4LUDA 2OZOA 3HYHA 3KQ7A 3QTZA 3E8DA 4MXZA 5BYYA 4HYUA 4GJ3A 4HVGA 3QD3A 5FTGA 5AUUA 2J0KA 2UZTA 2XYNA 1GJOA 4E5WA 2W06A 1FBNA 4ENYA 2R3RA 2C4GA 3F7ZA 4U45A 2B0QA 4I5MA 5IMEA 2BKKA 5E1EA 2XIKA 3QD2B 4WNOA 4UN0C 1W0XC 1ZMVA 3GC0A 4IX5A 4W9WA 3MH3A 4DTKA 4NL0A 4BY9E 2BILB 2JD5A 3UBDA 3KXNA 2R3HA 1JPAA 3R7YA 2NRYA 4FTIA 3QKLA 3PXQA 4I1ZA 4LQMA 2WTWA 4FVRA 4OTWA 4ZK5A 3DLSA 2CKQA 1ZXEA 3W32A 3O50A 3TTJA 4EOKA 1ZY4A 2X7GA 4B4LA 3F5XA 4IWOA 1URCA 3JXWA 4WNMA 5JGBA 4FUXA 4JR7A 4MD8E 3ZHPC 4KBKA 5HESA 2XRUA 4Y73A 4QYFA 4QPMA 3NZ0A 5DPVA 3ROYA 3WE4A 4K6ZA 4MF1A 4U7ZA 2ERKA 2QLUA 3RPSA 4D0WA 4ID7A 3FXZA 3ZONA 3UIUA 3F3TA 3C4XA 5AM6A 3UVRA 4C2VA 4O38A 5M56A 2XRWA 2XF0A 2VX1A 2C3KA 2CLQA 4UYAA 3ZEPA 2JKQA 4FOCA 4H58A 2GDOA 3D2KA 3NNVA 2IVVA 5IDNA 5CQUA 4ZTNA 5JGDA 5KHWA 3ORKA 5CU3A 4QMSA 2OJJA 3ZM9A 3KN6A 5TOZA 3QHRA 5AP3A 3A7JA 5AP7A 3TNPC 2RSVA 4XYFA 3NRMA 5DLSA 5E8UA 3VAPA 3R7VA 3U54A 1H4LA 2IPXA 4Y85A 3GOPA 4CFVA 2IWIA 3UOHA 1BKXA 3GC7A 2UW0A 4O6LA 4BDJA 4C4HA 4EK3A 4HVHA 1HOWA 2PHKA 2ZB0A 5LWNA 4QT1A 2VWZA 1H1PA 3K3JA 4RMZA 3THBA 4HCVA 4L43A 3TUDA 2B9JA 3POZA 2UZLA 2W5BA 3CY3A 3IGGA 5L2IA 4ZY6A 4TYIA 1OECA 5FWKK 1MRVA 4JIKA 3DS6A 4GYIA 2VTAA 4ZLOA 4O82A 3Q6UA 2B52A 5IA0A 3HAVA 2NRUA 1JKSA 4QMUA 3TACA 3V6SA 4U81A 4JR3A 3H9FA 2VO3A 3A7GA 3OY1A 4MAOA 5FBNC 2I0EA 4KRDA 1WAKA 4YC8A 1REKA 4HNFA 3E87A 4FKPA 2I7QA 5HLPA 1BMKA 5AUWA 3FLNC 2XKEA 5AP1A 1XBAA 2CPKE 4B0GA 3I6WA 5IEXA 3QQKA 4U3ZA 3ULZA 2C1AA 2ITNA 4FKSA 4FV3A 3DPKA 3OC1A 2Y0AA 3CSVA 4MWHA 2RIOA 3FZSA 4L3PA 3KY2A 4DEEA 4WG3A 3C5UA 4ITJA 4BHZA 5C26A 2P2IA 2W4OA 2PUUA 1OIRA 2W1CA 5FXQA 2XIXA 3I5NA 3OY3A 1Q3WA
chains in the Genus database with same CATH superfamily
3V5PA 1ZMWA 5EQEA 2WEVA 3I79A 4NKAA 3A7FA 4FTNA 4LOPA 2EWAA 1W83A 4IAAA 2FVDA 4G3FA 4GJ2A 3MN3A 2RF9A 3WILA 3R7OA 4YR8A 2YM7A 3U55A 4CCUA 1BUHA 3OUKA 4GT4A 5C03A 3RZBA 3SX9A 3CGOA 1REJA 4FC0A 4O22A 1OIQA 4JBQA 2PVMA 3R1QA 4EHZA 3A4OX 3FLZA 2BZJA 1UA2A 4R8QA 3BE9A 4RJ5A 3DXPA 3ITZA 4KKEA 3IOPA 4IHPA 4BCQA 4YJRA 3W2RA 2QHNA 2A4LA 2J0MB 4FIHA 5HEZA 4UV0A 1TZDA 3V5QA 1J7LA 4YBKA 5AV1A 3E3PA 5HG7A 3UIXA 1KE8A 4Z7GA 2PUPA 3MVHA 4NM5A 4I93A 2JGZA 3TIZA 5CU0A 2WQNA 3UOLA 3R01A 4GCJA 2PVFA 4TYEA 1MQBA 4TYHA 4U42A 4YJUA 4O7SA 1PMUA 3JVRA 2GNLA 2W1ZA 3M42A 1YXTA 4F6WA 4O0RA 2Y4PA 1XH9A 3OT8A 3PZHA 5A9UA 1JAMA 2E9OA 3II5A 1W98A 4FTKA 5FTQA 5TO8A 4ZTHA 2IVUA 3L8PA 2ONLC 4O86A 3BGPA 3SXFA 1GZOA 5AMNA 2VX0A 3BQCA 2PMLX 4FVPA 4FTCA 4KA3A 5EW9A 4RBLA 2F7ZE 4CXAA 2C5YA 4W4VA 3CTHA 3DU8A 3TIYA 4JNWA 3FHIA 4AOIA 5M07A 3ZBFA 3VUMA 5H2UA 4S31A 1RE8A 4CG9A 3NX8A 3VQUA 5DVRA 2IVTA 4FVQA 3KMUA 2FYSA 3FZPA 2HWOA 2YLFA 4X3FB 5HOAA 4CCBA 4D1ZA 4OAUC 4Q9ZA 2JDVA 4DBXA 5BQ0A 2VWIA 4F1TA 5T3QA 3ZH8A 4IANA 1OMWA 4F78A 5HO8A 1YHSA 3L9MA 3BHYA 3C9WA 1NVQA 3FWQA 3W10A 3ANRA 3UGCA 1ZY5A 3VUDA 1T45A 2DQ7X 1M2RA 1OL6A 3QZGA 3O7LB 2YAKA 3C7QA 3PTGA 4QDVA 3VONA 1S9IA 3BPRA 3IDPA 4MCVA 3F3WA 5HVJA 4BCPA 3K2LA 2QOKA 2W9FB 5AR5A 4BHNA 4DF3A 2HY0A 1KE5A 1JKTA 4AA0A 4DA5A 1M2PA 2RFDA 3WE8A 4ACMA 4ACCA 1NT2A 5IH6A 1H1WA 2UW6A 1W2FA 4R5YA 4JX7A 5DE2A 2XM9A 4I3ZA 4E4MA 3O71A 3OWLA 4HNIA 4CKRA 3PY0A 4TYGA 4M67A 3SG8A 4IH8A 4MXCA 1OUYA 4IC8A 1YOMA 5IUIA 1AQ1A 2YISA 5FM3A 2HZIA 4L44A 1FVVA 4TWOA 2WD1A 3MBLA 2ZMCA 3PVGA 3P5JC 3FLSA 1BL6A 1JOWB 3LQ8A 3Q52A 2JDSA 4CD0A 3VF9A 1OPLA 2PVRA 3I5ZA 3F2NA 5ANJA 4DGLC 4EH4A 1OKZA 4GFGA 4O4EA 4RIXB 4L42A 2BFXA 2QOHA 5EOBA 3QGWA 3BU5A 3AKJA 4YLLA 4J95A 4N0SA 4QPAA 4V0GA 3SA0A 2WZJA 3P78A 4YTHA 2C6IA 4PNIA 4O7YA 5JH6A 4HGLA 2C3LA 2YABA 1Q5KA 3OHTA 4QMWA 4CRSA 4EK4A 5L6PA 2VO7A 4FEWA 2X2LA 3UQCA 1J7UA 5DT4A 4O0WA 4BL1A 2P2HA 5LCJA 1SMHA 2XNBA 3Q4UA 4LG4A 1XWSA 3HL7A 4PNKA 2R3QA 4O7WA 3AD6A 2BALA 1WZYA 5CX9A 2WTKC 3QXPA 3ORZA 2ETKA 4KKHA 3PXFA 3D0EA 4JAJA 1OUKA 2VWWA 3Q4TA 4E6CA 2Y4IB 5K0KA 3RWQA 4D4SA 1P4FA 2BAQA 1Q97A 4E26A 3DLZA 1ZYLA 3KXHA 2UZVA 3CBLA 3QTRA 4JBPA 3UYTA 4CMTA 2VWUA 4BBEA 5ANKA 4C02A 1YVJA 4GFOA 5ICPA 1CKPA 4FZ6A 5LVLA 4DFZE 3KKVA 2LAVA 3E64A 2Y6OA 3VS2A 4BTMA 2HXLA 4DC2A 3ZU7A 4NM0A 2BTRA 3KXZA 5E8YA 3VBQA 4OTGA 2XALA 4I23A 3MPTA 3V6RA 1H01A 2J4ZA 5AV4A 2XA4A 4QTAA 4FKOA 3S4QA 1YWRA 3R02A 1SVHA 2V7AA 2QNJA 3HUCA 5HGIA 3R8ZA 4AWIA 4MQ2A 1PKGA 3FSKA 3NEWA 5CU4A 1CDKA 3NYXA 3S95A 3PIZA 4MUQA 4LGGA 4U41A 4DH7A 3GUBA 4PTCA 3WF9A 5BVDA 2XB7A 5I9YA 5E8TA 1NXKA 3MFTA 4XCUA 3CPBA 1LUFA 4GS6A 4M15A 1OIYA 3FKLA 3O0GA 5HNIX 2C5NA 4WNKA 3VWAA 1Q24A 5LARA 1UVRA 4WRSA 3H9RA 4EQUA 4C36A 3OCTA 5D12A 1A06A 5D1JA 3EQGA 4GH2A 4F0FA 2BAJA 1DS5A 3L9LA 1ZYJA 2W0JA 3Q9ZA 4EQCA 4JRNA 3BWJA 3G5DA 4W9XA 2C5VA 4U3YA 2YIRA 5HZNA 4ARKA 3EFKA 4C4JA 3OROA 3G6GA 2J7TA 4IZYA 4JOAA 1PXJA 2O3PA 5LQFA 4GIHA 5F94A 3U9NA 3SW7A 3ENMA 4QNAA 3IW6A 4D5HA 5DIAA 4BJJA 3TKHA 1YI6A 3G90X 4FV8A 4FV1A 2C6DA 3PWDA 4IB5A 5C9CA 4YGAA 5AR3A 3R7EA 5JFVA 4AXCA 3OXZA 4USEA 1PYXA 4R3RA 1J3HA 2W96B 4O4CA 4E8AA 4GYGA 2HYYA 5HTIA 5TF9A 4FKRA 3MYGA 2F2UA 5EKOA 3TN8A 4X2GA 2LGCA 4JX3A 3W0MA 2QQ7A 3G15A 4Y46A 4IVAA 3OEFX 1Z5MA 2WMSA 5HHWA 2UZWE 2VTQA 3GT8A 5DG5A 3F3UA 3L1SA 3R7GA 3VBXA 5IU2A 3PJ1A 4KABA 5HG5A 3W18A 4D4RA 3LFSA 2YIQA 3VNTA 2B55A 2QI8A 2GMXA 4TRLA 4TWNA 4DFUA 2BRGA 3GXLA 4QMNA 2YERA 1K9AA 4K2RA 3FUPA 2XNPA 4UY9A 5IKWA 4DFXE 3A61A 4IBMA 5ETIA 4FA2A 5ETFA 2UZUE 4Y8DA 4D9UA 4K77A 3FMLA 3MIAA 4R3PA 3OFMA 4JIAA 4HPTE 3AXWA 4PX6A 3G0FA 4RQVA 4DITA 1NA7A 3GOKA 3VS7A 4XMOA 3LJ1A 1Y8GA 4J52A 4C7TA 2VWBA 2UW8A 4RRVA 4I5CA 3RKBA 3UPZA 5FG8A 1ZYSA 3RM6A 3SVVA 4BKYA 5DHJA 1Q8YA 2YM4A 4XV2A 4CMUA 4AZTA 2UVZA 3CC6A 1Y91A 5JSMA 4IWPA 5J87A 2A2AA 2XNGA 3QC9A 5EKNA 2OJ9A 4EBWA 4JL9A 2WPAA 5FQDC 3W2OA 3IOKA 4EC9A 3QTSA 3E5AA 4UXLA 4WSYA 3DFCB 2GQGA 4M0ZA 4AW1A 2ZB1A 5GZ8A 4GK4A 2PPQA 2ONLA 3QF9A 3RK7A 3D5WA 4XV3A 1YI4A 4FK3A 2E9VA 3V8TA 4RVLA 1ERKA 2WOUA 4AT3A 2R5TA 4O0TA 2Y7JA 4B8MA 4QP7A 3E88A 1P2AA 4J96A 4UALA 4IIRA 4CV9A 3LLAA 2I1MA 3AT2A 4X2NA 4WD5A 3DZOA 4EH8A 4QMQA 3AKLA 3UP7A 3PJ8A 2ITYA 5DT0A 5G6VA 5IEYA 3QGYA 3TNWA 4ITHA 3RAIA 3UG1A 1WBVA 2BPMA 3PFQA 3C0GA 4JQ7A 4WUAA 3HRCA 4YLKA 4M14A 2RL5A 1UNLA 3A99A 3FMDA 3LJ2A 5AR2A 5DOSA 3AT3A 5CASA 2R0UA 4XV9A 3F66A 2WFYA 3IONA 3QX4A 4MNEA 2Z7QA 2IW9A 4O7TA 3A8XA 3NUPA 3EN6A 4G6LA 5AUTA 4M66A 5HE2A 2QODA 4LV8A 3UMWA 1XJDA 3QCYA 4G9RA 4L00A 4YC3A 1PMVA 5AUVA 2XJ0A 4J7BA 4OTHA 4BZOA 4DEGA 1UNHA 3L9NA 3V51A 4U79A 3Q5IA 2F9GA 4I22A 3PVBA 3D5UA 3MH0A 2J0JA 2XCKA 3ACKA 4LL5A 3VO3A 3VUHA 3KC3A 3A8WA 4E20A 3O7LD 4V04A 4YC6A 2BHHA 3SXSA 3K3IA 4QMYA 3RCDA 4IM2A 3D9VA 3RPRA 3W0QA 1O6YA 4IVBA 3CE3A 3QZHA 4XH6A 1J91A 2GFCA 3REPA 2X9EA 1VEBA 3VUKA 4BCJA 5AAEA 4DEBA 2G2IA 3IW4A 4O91A 1E1XA 3ZBXA 2OSCA 3LM5A 4MD7E 3NVMB 4X0MA 3FEGA 3K5UA 1GZNA 3TJCA 1J1BA 2Q0NA 2GFSA 4EJNA 4FKTA 5GJGA 4G5JA 3SRVA 5AR4A 3IECA 1IRKA 4N6YA 1W82A 3TJDA 3PPKA 4D9TA 5B7VA 4GU9A 1R0EA 4ANLA 4O0SA 3LQ5A 4EH2A 2J5FA 2W1HA 4TXCA 1M52A 3AC1A 1H07A 4Y5HA 2WB8A 2I0HA 4CZYB 4BF2A 4JDIA 4U5JA 4CEGA 3KRJA 4HGEA 4R5SA 3W1FA 4D1XA 1L8TA 3KRXA 4OT5A 4CFXA 2XYUA 5AAGA 3KXMA 2W99B 3I4BA 1OBGA 4BCGA 5LMAA 3LAUA 3Q5ZA 4MXOA 2R3MA 4RJ6A 4YZNA 2PVYA 4TN6A 3WOWA 4IW0A 2UZBA 3BGZA 3GU7A 4FNXA 2X9FA 4LFIA 4L3LA 4DN5A 3OW3A 1WBOA 2XVDA 2YA9A 3JPVA 2YWPA 3ATTA 1ZAOA 2F49A 3DKCA 2CNVA 4AAYA 2WTCA 5M57A 4E4XA 2BROA 2QOOA 2BZHB 2YM6A 4F0IA 4BDHA 5CU2A 4ZTLA 1H24A 3M11A 4UMPA 3IGOA 3QQFA 4IVDA 1JVPP 4MEDA 3QQUA 3IG7A 5DR9A 5FXRA 3HMMA 3NNWA 4FV2A 2B54A 5AJQA 1R78A 1UNGA 3BIZA 4ALUA 1WCCA 4C4IA 3ZLXA 3QQLA 5EW8A 1W2DA 2QO2A 4ACDA 5IA1A 3CTQA 3ODZX 5K0XA 3C4ZA 3R8MA 1WFCA 3UNKA 4DFNA 3MTLA 4A9YA 5LMKC 4BC6A 1U54A 4ITIA 3V8SA 4BWXA 3LM0A 4D0XA 1PHKA 4F7NA 4G31A 1V0OA 4ZY5A 2UW3A 4BVUA 2ACXA 2CMWA 4YHTA 2JKKA 2QVSE 3MB7A 4UWCA 4BDDA 4C33A 4EEVA 5CSPA 4J53A 5JRSA 2X8EA 3OEZA 3F6XA 3ZOSA 4TPTA 1SM2A 5KE0A 4E5BA 2JBPA 3CTJA 2I6LA 3PPJA 3E8EA 3R1NA 2WU6A 4AFJA 4M69A 4CFMA 3R8LA 4E6QA 2GCDA 1H08A 4YLJA 3HEGA 2GHMA 5A4LA 3PJCA 3PWYA 4JRVA 1ZARA 4CKJA 4OT6A 3ML1A 2NO3A 3LQ3A 4FEXA 2G01A 1OBDA 4HPUE 5HE0A 4GUBA 3UODA 4F08A 5K9IA 4FV5A 3ENHA 4EL9A 2NP8A 4TYJA 4UX9A 3JVSA 3ZRMA 1CTPE 2BKZA 1IA8A 4QYHA 2Z2WA 5CLPA 3GCVA 3NS9A 4ASZA 4ZLZA 4WT6A 3OBGA 3IK3A 3SG9A 5HBHA 4F70A 1Q8ZA 2OW3A 1WBSA 3W2SA 2OKRA 5FGKA 1I44A 3QAME 4RZWA 3AGLA 2C47A 4U97A 5IA3A 2RGPA 4IFCA 4FKGA 4K18A 3RHXA 2WQMA 3W2PA 3LLTA 1QPEA 1Y6AA 3NAXA 2VTRA 2ITPA 1KV1A 4LM5A 3PA5A 5HIDA 2GS6A 2V5QA 3H10A 4NT4A 3PPZA 2JIUA 1EH4A 3OBJA 3BYMA 2WQEA 3G51A 2WMAA 1B39A 4GK2A 5HG8A 5JRQA 3HV7A 4FZ7A 4DCEA 5A4CA 5CVGA 4DH1A 5D9HA 3R83A 3ORXA 1B6CB 2V22A 3SGCA 2VTSA 3BLRA 5HU3A 4C37A 4CT1A 2C3JA 2PK9A 4MVFA 2Z7LA 3AMYA 5H3QA 4PWNA 3BU3A 4EOPA 4C4EA 4IXPA 3U8WA 3QYZA 2OIBA 3LMIA 1FVRA 4I6QA 4RC3A 4YJVA 1JWHA 4GL9A 5HI2A 2QU5A 5BUIA 3NCGA 1JNKA 3S00A 4DH5A 3RZFA 3QCQA 4WRGA 4BZDA 2BHEA 5KX8A 2PVKA 3ID6C 4II5A 4QMXA 1PF8A 3G9NA 4CSVA 4QTBA 5B0XA 4CFFA 2IZSA 3FZOA 1W7HA 4IAYA 4M97A 4WG5A 4HGSA 3MS9A 3OWJA 4RJ7A 4EI4A 5KBQA 3HX4A 3UZTA 1P14A 2PZYA 1R1WA 2WMTA 4RWKA 3C50A 4R78A 2O63A 5I5ZA 5ANEA 3BZ3A 5TT7A 3IO7A 3EZRA 4G3EA 3TCPA 3GFEA 5LVOA 3PP1A 3O8TA 2J50A 2X0QA 3VUGA 4D2WA 4H36A 4IQ6A 1ZZ2A 4IWQA 3ULIA 3ORLA 1F3MC 5EYMA 3TZMA 2RFNA 4EWHA 3S3IA 3EMGA 3ZS5A 4BTFA 3DK7A 4TYHB 1F0QA 2XK6A 4PL5A 5DN3A 3JY0A 3IPHA 3LFQA 4X2JA 1SNXA 5CSXA 4FR4A 3RGFA 4UB7A 4B8LA 4KKGA 5AP0A 4J99A 3V8WA 3ZC6A 1SZMA 3HUBA 4IDTA 5FTOA 3MGYA 3ZZEA 3NYVA 4L68A 4ZS0A 4FK6A 5HX6A 4FV7A 4P5ZA 5CNNA 5I9VA 5C4KA 1OVEA 3DQWA 4CQGA 5KMIA 4FODA 1M17A 5M55A 5M44A 3D7ZA 5C4LA 5BX0A 2GPHA 3DBFA 4F7JA 4R6VA 2QCSA 2UW7A 2C30A 3QFVA 4DYMA 2UV2A 2C1BA 2QG5A 3W2CA 2GHGA 1FMOE 2XMYA 2O5KA 1Q4LA 3EIDA 3H3CA 3DTCA 3FLYA 2XBJA 4F99A 3OW4A 3LPBA 5K4IA 2ERZE 4YO6A 3SKCA 1Q41A 5D7AA 2CKEA 3SOAA 4C4GA 5JKGA 2BRBA 4JS8A 3SC1A 4APCA 3FKNA 5GIOE 5HICA 5IPJA 2Z7RA 4L8MA 4PDPA 1OZ1A 3CQEA 4I6HA 3EN5A 4PV0A 1G8JA 3R63A 4GEOA 4FX3A 4ZTMA 2UZOA 4L01A 5LVNA 2REIA 3E7OA 4XG6A 4JDKA 4XP3A 2FB8A 1G8AA 5D7VA 4DTBA 4BICA 3D15A 3GQLA 4FTQA 2YIYA 4LV5A 1R3CA 4L3JA 4D2VA 2BDFA 2OJFE 3OP5A 1YWVA 3QHWA 4FKVA 2XP2A 2UW9A 4BDAA 5M4FA 2FUMA 5HQ0A 1IG1A 4HJOA 4A7CA 1ZOGA 2UVYA 3DV3A 4KS7A 4F9AA 5KKRC 3QWJA 1LEWA 3UE4A 4AN9A 4AZWA 4RWJA 1R0PA 3ETAA 2PMIA 3KRWA 3V5TA 3V5LA 3PA3A 3RPOA 3QTQA 4M8TA 2NNWB 4FKJA 3LXNA 3KVWA 5EM5A 3HAMA 3SHEA 5F20A 5C8NA 2R2PA 3KIOC 3U4WA 2GNHA 2R3KA 3FI8A 5HBJA 4M0YA 4EYMA 3UC3A 2P4IA 2BMCA 4A4XA 1J1CA 3PLSA 4F0GA 3EZVA 1PRYA 2QG7A 3NR9A 4YJQA 2WMQA 4V0GB 5CEQA 2GNFA 1RJBA 2PZ5A 2P33A 2ZV2A 4NW6A 4AXAA 4D58A 5AX3A 2QHMA 3F5PA 2VNYA 2Z8CA 4FG9A 2CCHA 3FL4A 3UYSA 4BCKA 3MPMA 2YIWA 3NUSA 5KMNA 2HZNA 4GV1A 1PMEA 4BDGA 3RWPA 4DLJA 4EKLA 4DH8A 5HLWA 4QQ5A 4G6OA 3UDTA 4LGHA 2F57A 3C4CA 5DBXA 4FT0A 4EK5A 2VTTA 2OF2A 3W8QA 3MVMA 4G34A 4RA4A 4RWIA 2C69A 4BCOA 4Z7HA 2X1NA 4QDEA 5C1QB 1U59A 2GTMA 3NNXA 3NW6A 3TXOA 3GU8A 3WARA 2YJRA 4KIQA 4AGDA 4S2ZA 5GZAA 4CYIA 5HE1A 3RK5A 1UU3A 2PTKA 3R8UA 3FLWA 3CXWA 5IISA 5LMKA 2F2CB 2V62A 3CD3A 5FEEA 4AXFA 4O27B 1LEZA 2JIIA 1A9UA 2RG5A 5BYZA 5CAVA 3NUAA 1QMZA 1JSUA 3O17A 2VNWA 4Z9LA 1PKDA 5FDPA 2ZMDA 4MHAA 4NFMA 5AR7A 3S2PA 5CU6A 2XUUA 2XIYA 4PTEA 5FLFA 4EOQA 5BVNA 2BAKA 2ZM1A 3TWJA 5HNBA 2B9FA 3NW5A 4JVGA 3TG1A 3GC9A 3RPYA 2QO9A 2R3OA 4QPSA 1QPJA 5JQ5A 3O2MA 4I94A 3AC4A 3DY7A 3R7IA 5EM7A 5DYJA 4MTAA 2BCJA 3I7BA 1SNUA 1JLUE 4F09A 3ET7A 3U6HA 4GUEA 4E1ZA 1DAWA 3SAYA 4FZFB 1YDSE 3BHVA 2IW6A 2QONA 2HENA 2UUEA 3EQPA 3FLQA 4FV0A 3OOGA 4QRCA 4CZTA 4P4CA 3BV2A 4ZZOA 4KBAA 3EKKA 3F2RA 1DAYA 4F65A 4DFLA 3R1SA 4NK9A 1CSNA 3E3BX 3RMFA 1GY3A 2JKOA 2JKMA 1JQHA 4QP6A 3CJFA 4NFNA 4DLIA 1IASA 5CQWA 4OTDA 1M7NA 4J1RA 4DT9A 3LCDA 2CLXA 4ZJJA 4EOIA 3RJCA 4DTAA 4JBVA 4DEDA 3PG3A 4ONAA 3VS1A 3ZCLA 4TL0A 2CGXA 3DBQA 4FSQA 4EOJA 4FKIA 5HCXA 3OWPA 2AC3A 4XS2A 4FE2A 2EXEA 4CQEA 4PF4A 4YHJA 4EH9A 2BZIB 2X2KA 3FZ1A 5HTCA 3QD4A 4U44A 3EWHA 4YJSA 4LOOA 4BJJB 3HRFA 3LFDA 1MP8A 4MBJA 4QP4A 3RHKA 2J6MA 5JZJA 3F7WA 4U43A 5A3XA 3KREA 2W4JA 3NIZA 2GQRA 5JEBA 3TI1A 3I81A 4QMMA 3CGFA 2WOTA 2IG7A 4FOBA 2UVXA 4V05A 2BZKB 4IB3A 4EH5A 4O7NA 3DA6A 3FYJX 3RAWA 3ZSHA 5AIRA 4A07A 1DM2A 2R3JA 3FPQA 5EHYA 4C4FA 5A4TA 4J71A 3DXQA 1YOJA 3BHHA 5GIPE 4NKSA 3DZQA 5AUXA 1H25A 4N70A 3VIDA 2WHBA 3UOJA 2CKPA 1AD5A 4FBXA 4FSMA 2OXXA 4IJ9A 5CEPA 4EOSA 3BI6A 5CF6A 3D4QA 2XNMA 2R3NA 2JAMA 5IH5A 3UZRA 3RK9A 3I60A 2PY3A 3CPCA 5DMZA 3JS2A 3FHRA 1FVTA 2I40A 3DJ5A 4FG7A 2YCQA 4PPAA 4YZMA 4QYEA 5CT0A 4BDEA 2JIVA 4I0SA 3UDBA 3JYAA 1P4OA 3CLYA 2W5HA 3CKWA 2VX3A 4G16A 4LRKA 5KMLA 4EQMA 3KULA 2P0CA 4F1OA 2VTOA 3MA3A 1URWA 5DNRA 1MRYA 3EHAA 2YWVA 1OB3A 3KFAA 1VLRA 2G15A 4C35A 1QCFA 1WBNA 5FUTA 2C0OA 3UTOA 2V7OA 4E73A 5IZFA 2J51A 2VAGA 1ZOHA 1XH6A 2G1TA 2VGOA 3TDVA 2XEYA 4G1WA 1OPJA 2EB2A 5I0BA 3GP0A 2EUFB 2ZM3A 1YI3A 3DDPA 3HP2A 3HV5A 2R7IA 2YHVA 4HGTA 4RFZA 4ZMEA 4H3BA 4QP9A 4L52A 3UO4A 4NWMA 2OXYA 4UBAA 3C4WA 2OF4A 3AOXA 5G1XA 3QBNA 2W9ZB 3RVGA 3ZO1A 3C4EA 3QD0A 1KV2A 4RGJA 2GTNA 4YPDA 3RTPA 3UZPA 3LOKA 4PL4A 1MUOA 2R4BA 4FL3A 3BKBA 3H9OA 4FSZA 2JBOA 2R7BA 1FGKA 4I92A 2Y6MA 1WBTA 4YURA 5D41A 5J7HA 3EQBA 3ORIA 5A6NA 1CKJA 4L9IA 3EFJA 1Q99A 5J5SA 2FH9A 4JDJA 4FTRA 4LMUA 3AC2A 3WZDA 5FDXA 3W2QA 5JN2A 3QKKA 4NEUA 4FTMA 3Q53A 4RJ3A 4AACA 3TYKA 3C0IA 4AZFA 3NFFB 3D7TA 2BR1A 3HDMA 2HAKA 3FV8A 3CQUA 1H28A 1ZYDA 3LZBA 4UMRA 3QUDA 1YXSA 1OL5A 4KNBA 3LFNA 3NNUA 5EHLA 5K4JA 3QA0A 3ZTXA 3LHJA 4L45A 5EDRA 3ZUVA 2YDKA 2WIPA 5DFPA 2X7OA 4MNEB 4EBVA 1ZRZA 1GZKA 5J9YA 1Y6BA 4ZZNA 4KSQA 4Q5HA 4E6DA 5IQHA 1OKVA 2WNTA 3FSFA 4HYIA 2X0PA 4QP1A 4TY1A 4XX9A 3CS9A 4HZSA 4UXQA 3N4VA 3QLFA 3AMAA 4FTUA 4ZY4A 5T6KA 2C0TA 4DE4A 5I9XA 4F9CA 4XRLA 2OZAA 2B4SB 3N4TA 4BZNA 1OITA 1E9HA 1WVYA 3PZEA 3L8VA 3R1YA 3F5UA 3SV0A 5J8IA 4ZSGA 3D2IA 4C3RA 3JY9A 3C13A 1O6KA 3ELJA 3FZTA 5AP2A 4O7LA 3O23A 3UQGA 5J9LA 4O0XA 1BL7A 4DG2E 5BPYA 1LPUA 4HVIA 4EONA 5CF5A 2XJ2A 4ZSLA 3ZDUA 4GW8A 5IA5A 4FMQA 2RFEA 4QQJA 1U4DA 1QL6A 3F3VA 3O8UA 4MBLA 3U9CA 2ZAZA 5EW3A 1APME 4DHFA 4H39A 2KULA 3SRVB 4CLJA 4XG3A 2JITA 5H8EA 4ZMFA 1E1VA 3R2YA 2FO0A 4ZOGA 3VJOA 4AA5A 2BRHA 4FIJA 3PUPA 4OLIA 3WIGA 2YM8A 3NGAA 3LXPA 4AW5A 2B7AA 2FA2A 2ITZA 3OS3A 4WBBB 4BCMA 4O1PA 3OMVA 4LRJA 3NW7A 5AIKA 3RI1A 5EYKA 2CJMA 3P7BA 4OBOA 4CZUA 4DGMA 5L6OA 5M53A 4BYIA 1SYKA 3Q4CA 5HG9A 3GI3A 3R9DA 2ZV8A 3A7HA 4U0IA 5M51A 2XH5A 3D5VA 4R1YA 4AS0A 3HMPA 2GS2A 3EJ1A 3AC3A 4JI9A 3IW8A 4FKLA 4C38A 4HW7A 4XNEA 4BBFA 1PXLA 2WTIA 4H1MA 2WTKB 5HO7A 4QQCA 2BTSA 2OIQA 2XAOA 1XKKA 3MY1A 5ANOA 4EORA 3TUCA 5C8MA 2AEGA 2PZRA 2CGVA 4X7QA 2V55A 3DBCA 4IM3A 4CVAA 3Q3BA 2PVJA 1PY5A 4RLKA 4YU2A 3KEXA 5FEQA 1T46A 4FIGA 2BVAA 2J0IA 3VS0A 5IQCA 4MNFA 3V5WA 4D5KA 4NJ3A 3HZTA 5IG1A 3ZZWA 3DKGA 2CSNA 3U6JA 1TQMA 1A48A 3I0OA 4KS8A 4JG6A 4FTJA 3ORMA 2BRNA 1JBPE 1YOLA 5E8XA 4GKHA 2XNOA 1FQ1B 2VTIA 2VTHA 3R00A 4I24A 4TWPA 4WBOA 1Q8WA 1U54B 3ACJA 3R9HA 2HZ4A 2VD5A 2YZAA 4WIHA 2EXMA 4HCTA 3ZLWA 3W0SA 3LCKA 4S34A 3W0OA 4Q5EA 2BUJA 2E2BA 5ANIA 3M1SA 4ACGA 2Z02A 4RT7A 3BYSA 4OBPA 4D28A 1SVGA 3GCUA 2EU9A 3R9NA 3R71A 4N57A 3RINA 1YXVA 4J8NA 2WTDA 4M69B 1K3AA 5FD2A 3RAHA 3EQHA 4X3JA 3AC5A 4MX9A 3QTWA 3BLAA 3FXWA 3FI3A 3L9PA 4DEHA 4O0VA 5DGZA 2WTJA 3TKUA 4LRMA 4BYJA 4O2PA 4I4FA 1OL1A 4F9YA 4XUFA 4OTPA 2I0YA 5JFXA 4NYEA 5DT3A 5CSHA 4XLVA 1OKYA 1BLXA 2OFVA 4JXFA 2XARA 3BYOA 3PLAE 2WMRA 4QP3A 4G6NA 5DWRA 4BWKA 4C34A 4IAFA 3KCKA 4W8EA 1XH7A 3TNQB 3MH2A 3AD5A 3DOGA 4OTQA 1KOAA 3E92A 2UW4A 4ZP5A 2C6MA 2CGWA 2OWBA 2UZEA 2GU8A 3AQVA 3QQJA 3VBTA 4NUSA 1FMKA 4ZSJA 3G9LX