4QMUA

Mst3 in complex with jnj-7706621, 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1h-1,2,4-triazol-3-yl}amino)benzenesulfonamide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
286
Chain Sequence
b'GMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmuA01
3F2RA 4I22A 5HO8A 4CQEA 2WMVA 4FYNA 5E91A 2BZKB 4Y83A 1JSUA 4G3CA 5KMOA 1CKJA 1O9UA 1WBTA 5KMKA 4O6EA 3FY0A 4ARKA 3DBDA 5L2IA 4O0XA 5FXQA 3V5LA 5AAGA 2YM7A 4FF8A 1PXJA 3NLBA 4WO5A 4IFGA 1IAJA 2OH0E 3KC3A 1TQIA 3OUKA 2OH4A 3MFUA 3VS6A 2W06A 3SRVA 2BAQA 1UWJA 2YAAA 4FTUA 3TZ8A 2WZJA 4ANQA 4LGGA 3OW3A 4EOSA 3SC1A 4CV9A 4GJ3A 4BCIA 4WUNA 5JFXA 5HLWA 2J9MA 2FYSA 3VHKA 1Q41A 4L67A 5C4LA 2HAKA 4DG2E 4OTDA 4DEBA 4DFYA 3QXPA 4XV3A 3SHEA 3AT4A 1QPCA 2Q83A 2EB2A 4AWIA 3R8MA 1OPLA 3OD6X 3HDNA 1Q8UA 2UW8A 3QD2B 4U6RA 5CXZA 3KF7A 4FL3A 4TT7A 3P79A 4FSUA 5AV4A 2VTOA 4FT7A 1J1CA 1QCFA 1CTPE 2E9UA 4ZY5A 3DAJA 1SVEA 4FTOA 2Z02A 4DTBA 3EHAA 2ZB1A 3H9RA 4NFNA 5GZ9A 5D7VA 2PL0A 3NAXA 4KKGA 4QMXA 4EZ3A 4M7IA 3WIGA 5C1QB 2QNJA 2XKDA 5FXRA 5D9HA 3ALOA 4NW6A 4IX6A 2F9GA 4N6YA 4Z16A 5EHLA 5L8JA 4GYIA 4M13A 4OTWA 2X2KA 1JBPE 1ZYDA 3KL8A 4PL5A 4R5SA 5D11A 4AOTA 5KMMA 3C4ZA 1UU8A 4MXXA 3P1AA 2SRCA 3V6SA 2X7GA 4NKAA 3BQCA 3H4JA 4I1ZA 3BZ3A 3R01A 5FP5A 3BHHA 1OM1A 3GEQA 3A7IA 3BEGA 4FL1A 4HZRA 5EDPA 2XRWA 3PIXA 4EKLA 5BX0A 3G6HA 4FZFB 5M4UA 3VBVA 3DFAA 4X2NA 3NRMA 3OXZA 1WBOA 4DC2A 4C3RA 2WPAA 4DFXE 3SD0A 5CAPA 4LG4A 3UVRA 4WNMA 4MNEA 1ZRZA 3KRXA 3FMHA 2XCKA 2Z7QA 1A9UA 4C36A 4XMOA 4GU9A 4FNWA 4IWOA 1G3NA 4N57A 4P5ZA 4RIWB 4ZOGA 2OU7A 4D4RA 3DCVA 3OXTA 4CT2A 3HZTA 4J1RA 4AFJA 5D41A 3B8RA 3O8UA 3BYVA 4BTKA 3MB7A 1Q8WA 2VX1A 4D2SA 1KUTA 4EOIA 4I5HA 4RG0A 5M06A 3DKGA 4FG7A 2Y0AA 3NZ0A 4IEBA 4O21A 4PTGA 5LOHA 1LEWA 2ZMDA 3EJ1A 3IK3A 4BGGA 4EL9A 3UODA 4C58A 2XK6A 4RMZA 5C27A 3UPXA 3GFEA 1FGIA 4MWIA 5DRBA 4ZSJA 1UA2A 3DV3A 2IN6A 2R0IA 4DGGA 2GSFA 3KRLA 3D14A 4O22A 3EN9A 4UXQA 5AR5A 5C8NA 5HLNA 4AZVA 4GL9A 3JR1A 4B7TA 2CHLA 1DI9A 4YSJA 1W0XC 3EFWA 4IADA 4XP2A 3SOCA 4BYJA 3QQGA 4O7WA 4GJ2A 3DOGA 5C26A 5J9ZA 5CEMA 3OXIA 3PJCA 4NM5A 4MF0A 4EWHA 2W5HA 2I0HA 2XF0A 4FVQA 5IDNA 1PF8A 2IVSA 3P5KA 2YDKA 3GT8A 3O17A 4O7SA 4A4LA 3GBZA 4ZS0A 3E8NA 5BUJA 2XM9A 1XR1A 4TYHB 5GJGA 3U55A 3R30A 4KSQA 2WMXA 5B2MA 2P4IA 2WAJA 3I4BA 3HNGA 4I5CA 3RK7A 4FV7A 4EHEA 5ETCA 1W83A 5TKDA 4JLCA 2QR8A 2XYNA 4CYIA 3ITZA 2OFVA 2IVTA 5J9LA 3VBWA 4BWXA 3ZO3A 3NAYA 1HCLA 3MV5A 4LRKA 4S30A 5HEZA 4LGHA 4A9TA 2OIBA 4YZCA 5AR3A 5AR4A 5IEYA 4GG5A 1JQHA 3WOWA 5FTQA 2EXCX 2F2CB 1YI4A 2GFCA 4FSNA 4C8BA 3QHWA 4QMNA 5F20A 4E5AX 4QMZA 4V0GB 1M7NA 3ERKA 3KXXA 3ZRKA 3BCEA 2UVYA 2NRYA 1OKWA 3ORKA 3MA3A 5F4NA 3Q60A 3O7LB 3QTRA 3D4QA 2R3IA 2C68A 4B4LA 4DEIA 2PVYA 2I0EA 4O96A 4YC3A 3WZDA 4ZSEA 2PY3A 3R00A 4V04A 5DR2A 5KMIA 3DZQA 2DYLA 3A7JA 4IAAA 3LXPA 2YN8A 4CG9A 5H3QA 3FZRA 2ZV8A 4ERKA 4AOIA 3CEKA 3OROA 5HIEA 4OTIA 3I5NA 4J71A 3G51A 4RBLA 4QP3A 5LWMA 2WOTA 3KEXA 5CU6A 4U97A 1MQBA 3HYHA 2C4GA 1WBSA 3PLSA 4QTDA 3FMDA 5HCXA 2V62A 3E62A 3FLYA 3K3JA 4NSTA 3F7WA 4O0YA 3G33A 3KMUA 4BIDA 4GKHA 4ZTSA 4Y95A 5A6OA 3Q9XA 1RJBA 3QCQA 1XH8A 4AG8A 3I7BA 4JR3A 1BMKA 4PY1A 4ZXTA 4YZDA 1KE8A 2PVKA 5IZFA 3WF7A 1NVQA 4F9YA 2ZAZA 5FXSA 5A9UA 3U6HA 3GU6A 1KV2A 3EL8A 3C4XA 1NT2A 2G01A 4ACGA 2VTAA 4GRBA 5TOZA 5J5TA 3A60A 5E9EA 3Q9WA 4C02A 4BI2A 4G5PA 2I40A 3E5AA 3ZU7A 3ZC6A 2OZAB 2UUEA 3O51A 4IDTA 2C5XA 4M14A 5AUWA 4ENXA 4E93A 4E20A 1O6KA 1ZZLA 4OUCA 4RIWA 1WBNA 4ACHA 5M51A 2GNHA 4IZYA 3AOXA 4I6BA 5CANA 3Q32A 1UKIA 2J5FA 5DGZA 4AW5A 3NNVA 3G0EA 3LXKA 3PJ3A 3R8PA 3O23A 5B2KA 1I09A 4NH1A 4O6LA 4QYFA 3RNIA 1Y57A 4EHGA 1Q8ZA 4YZBA 5KO1A 1J3HA 3O0GA 5AIRA 4P90A 3ZO1A 2XEZA 3ATSA 1CKPA 4F6UA 1OUYA 4PUZA 1ZMUA 3GC9A 2G9XA 4Y73A 3IOKA 1Q3DA 3T8OA 4EYJA 4FKLA 4L42A 5EOBA 4LRJA 4DEAA 4F0GA 4QMSA 1R1WA 4FV8A 5AP5A 5KE0A 4EH8A 5AEPA 2IO6A 3MB6A 4F9CA 5IEXA 4ALVA 1J7IA 4UN0C 2A4LA 5HVJA 3OZ6A 3FC1X 5DIAA 3PY0A 3LCTA 4BYIA 4EOPA 3PRIA 3V51A 2XH5A 3A62A 3EQBA 2OLCA 3DXNA 3EFJA 3FBVA 5CASA 4S32A 4NUSA 4CZTA 2B53A 1KE9A 2JLDA 3ZLYA 1XH9A 5KCVA 4H39A 4BB4A 5M08A 3VRYA 4F7SA 1XBBA 4RX8A 4TYHA 4QMVA 3L8XA 4W4WA 2NP8A 5DR6A 5HNGA 3FXWA 4FZ7A 1Q24A 3UIMA 5LCJA 4PP9A 5IQGA 4FNXA 2WD1A 4G2FA 4U9AA 2XNMA 3SQQA 1VR2A 4QMWA 4GFOA 4ENYA 4H1JA 2YM6A 5DMZA 4PDPA 3BBWA 3TZMA 4MD7E 4G5JA 4AE6A 2YFXA 3QQFA 2CN8A 4O0UA 4LMNA 4YLLA 2W5AA 4V01A 1REJA 5E92A 4EZ7A 3PP1A 2C6LA 2NNWB 3JUHA 1XH4A 2JDRA 3PJ8A 3VBXA 3FLNC 4UMRA 2EXMA 2PZPA 2BDFA 4V0GA 2EXEA 4FTKA 3ZFXA 5HGIA 5EM7A 4KA3A 1ERKA 4L43A 2C3KA 3HMNA 4I92A 3FLQA 3AC1A 4RA4A 1M7QA 3I0QA 4J53A 4U3ZA 3PDTA 4XS2A 3DTCA 4U8ZA 3MY1A 2IW9A 1J91A 4PMMA 3LQ8A 3HGKA 2C5OA 4JDJA 1HOWA 1O6LA 2AYPA 1GJOA 3CY3A 3MY0A 4KIQA 3R9HA 2X8IA 5K0KA 5K3YA 4E3CA 4F08A 4FZDB 3L8PA 2OXYA 3HEGA 3D9VA 3B8QA 3L8SA 2JAVA 3LFBA 5EW9A 4X0MA 4BDFA 3E87A 4IHPA 4F6WA 3Q6UA 2ETMA 2HY0A 3MH2A 4MD8E 4IANA 3CKWA 4EK4A 4FIEA 2B54A 2XS0A 3CP9A 2ITPA 5AP0A 2GQRA 1OKVA 3MESA 4TWNA 3D94A 4RJ7A 5DG5A 4R3PA 5I4NA 2C6DA 4XP0A 3DB6A 3F3UA 4QTEA 3PA3A 2C69A 2FB8A 2XKFA 4YLKA 2GNFA 1FVVA 1Z5MA 3KCKA 3WF9A 3QD4A 3F69A 4B8LA 5F1ZA 3MBLA 5JGAA 3DBCA 4Z7GA 4Z3VA 3PLAE 4XRJA 5BVDA 2Z7RA 4ONAA 5A4LA 4USEA 4IM3A 5IUIA 5M57A 4UMQA 3MVHA 4N4SA 3O2MA 3QRIA 4PTEA 2R3HA 3F5XA 2OO8X 2PK9A 1H25A 5L4QA 4C4HA 1J7LA 3VBYA 3HP5A 1ZOHA 3MFTA 3CXWA 2VTLA 3LFEA 4C3PA 4QPAA 2XCHA 5JFWA 2VAGA 2CKQA 3ZDUA 4FEQA 1GAGA 4FV5A 4HOKA 2OZAA 3EIDA 2QOIA 3OF0A 3SA0A 2X81A 4HVDA 3Q6WA 5DFPA 2IVVA 2YZLA 4CT1A 1ZYSA 4I21A 4AZSA 3N4VA 2VTIA 4BBFA 4RQKA 5E8YA 4IACA 1XBAA 1DS5A 2VTHA 3LCDA 3PXYA 4J96A 3VBQA 4H05A 1FINA 4L9IA 5HX8A 3HV3A 3NVKI 2WTCA 3RVGA 2GHGA 4F1MA 3F5GA 4YJVA 4GG7A 5AX3A 3DS6A 2QOFA 2X4ZA 1M2QA 3SAYA 4F65A 4C4JA 1YKRA 5AAFA 2YIYA 4UZDA 4RJ5A 1B38A 4DEEA 1OL7A 1XJDA 4OT5A 3RGFA 4FZAB 3CGFA 2W1GA 4ZTNA 4QYEA 4DEGA 4EK6A 4RJ6A 4CFVA 3SDJA 4QYGA 3LFDA 4CV8A 1P4FA 4LL5A 5EH0A 2OXXA 3TKIA 5J1VA 2V5QA 1Q97A 4IW0A 4W9WA 2RG5A 1PJKA 1YOLA 4RQVA 4BDAA 4P5QA 2BAKA 5CI6A 2BFYA 4ANLA 4G31A 3RINA 3ORZA 2ITZA 3EN7A 2YIWA 3MY5A 4MK0A 3W33A 3LZBA 2GNIA 3VQUA 4WUAA 3E8EA 5JRSA 4C59A 2F2UA 2UW4A 2UZBA 3ANQA 3LVPA 1JKLA 1GY3A 5T3QA 2W05A 3UQGA 1YDTE 4D5KA 4HGLA 2FSTX 4S34A 3RMFA 3TNWA 5LVOA 2V0DA 2UW7A 1TQMA 2PMOX 5AMNA 4FICA 5HLPA 1QPDA 1JVPP 4V05A 3COMA 4A7CA 2X8DA 5BMMA 4F9BA 5KNJA 2A0CX 4OAUC 4LUDA 4BKZA 2IZRA 3VUHA 5HTBA 3FXXA 4CCUA 3V8WA 1WZYA 4RWJA 5DPVA 2BRHA 3D2KA 5HHWA 4BI1A 3VO3A 2NPQA 4GVAA 5EG3A 3VUMA 3MFSA 3COKA 3MS9A 3R21A 4FBXA 4RWLA 4BDBA 4M0YA 1A48A 4KS8A 3W18A 5F94A 4IJ9A 4C7TA 5JQ8A 4P4CA 3VS1A 5L2SA 4QMYA 2HZNA 3BGPA 1PXNA 2XKCA 3C4EA 5FTOA 3F5PA 2C5NA 4BFMA 4UB7A 3CLYA 4L3JA 1U59A 5CEKA 2ZDTA 5H8BA 3DK3A 4OLIA 2RFDA 2BALA 3CIKA 4O83A 3E8DA 3C5UA 3E92A 2J50A 4BCKA 3PXQA 4LV5A 3UJGA 4YTFA 3IW7A 1Y6BA 1ZLTA 2JDSA 4DITA 3ULIA 3HV6A 3E7VA 4E73A 5KBRA 5C01A 2GS2A 1IRKA 3DK7A 4JIKA 3P7BA 4ALWA 3U4WA 3U51A 4D4YA 4LFIA 4RFYA 5CENA 1YXXA 2R3QA 4TNBA 4I6HA 3TT0A 3CPCA 4FOCA 4BZDA 4FKOA 4U40A 4EOLA 3ZCLA 3GGFA 4Z55A 4W4VA 2CGUA 2W1HA 1JOWB 3FHRA 3C5IA 1RQQA 3VNTA 4E5BA 3QBNA 4FKJA 2OICA 4C2WA 3FKOA 2WMTA 1P4OA 4RC2A 3EOCA 4UYNA 4FV0A 3JXWA 2NRUA 2QHNA 3BU6A 4JRVA 2X9EA 3BI6A 4FNZA 3LHJA 3UOKA 5E8WA 1KSWA 2VGPA 4L68A 3NUAA 4JIAA 2VWZA 3TTIA 4C4FA 3ZUUA 4XV1A 4UY9A 2XKEA 1OL6A 5B7VA 1YWRA 4QP4A 1GZKA 4FTIA 2W0JA 4FKRA 5HNBA 5TF9A 3PSBA 4O7RA 4UMTA 4E4XA 5FEQA 3FSKA 4GH2A 4MF1A 3P08A 2ZM1A 5AUUA 4BDKA 4TRLA 3BU5A 3PA4A 5EYCA 2I1MA 4KBAA 2DUVA 4ZSGA 2QURA 1U4DA 2DS1A 3E93A 4IE9A 1OBGA 4I0TA 5GJFA 4IB0A 4FEUA 3GFWA 2W1EA 4D9UA 1V0OA 1FMKA 4HYIA 4LQMA 2O0UA 3AMYA 3HV5A 3EQFA 4NZWB 2WTWA 2J7TA 1Y6AA 4HYHA 4IB3A 3VS3A 3W2CA 2BRNA 4ACMA 3KN5A 3PA5A 4O0SA 4WG3A 4BDIA 5EQPA 3QD0A 3QTIA 3TEIA 4AZFA 5GZAA 1YQJA 4NL0A 1WBPA 2C6EA 4RVKA 2GNGA 3GNIB 3ALNA 3HKOA 4FTRA 2OWBA 1PXPA 5DT0A 4MBLA 3NNWA 4JXFA 4O1PA 1H27A 3FMLA 4RZWA 5EI8A 3KY2A 4C4EA 3IONA 1OGUA 3QLGA 3SW4A 4EH6A 4LL0A 5LVPA 4IIRA 4LV8A 1Q3WA 4YR8A 2OF2A 4FKUA 4MWHA 5ANJA 1IG1A 4G16A 2OJFE 4R5YA 1X8BA 2G2IA 4BDEA 3C0GA 4NJDA 1U5QA 3K54A 3RNYA 1OUKA 2VWIA 3O7LD 4LGDA 3GP0A 3TACA 2O8YA 3BHTA 4TYEA 2WGJA 3HMIA 3QFVA 1FPUA 4BCJA 3LQ3A 4E6QA 3RAHA 3HL7A 3NDMA 3QCXA 4IC8A 4ANOA 3R7IA 4BCQA 4O7VA 2WB8A 4U5JA 3A4PA 4JDKA 1U46A 4D1ZA 4F0FA 3FHIA 4CLJA 1YDRE 5CSWA 2EVAA 5L3AA 1IA8A 2P3GX 2R3LA 3OFMA 5JGBA 5IA3A 2OFUA 4OT6A 2QKRA 3UMWA 1DAYA 3CSVA 2A27A 3MSSA 4FKTA 4QO9A 4CGAA 2ZM4A 2F7EE 3TDVA 3CBLA 1SZMA 3K5VA 4F99A 4FX3A 3W10A 3LXNA 4M12A 4CQGA 5HIDA 3U8WA 3DNDA 4DFNA 3EN4A 3JPVA 3K5UA 3MJ1A 2UW0A 4IZ7A 4L8MA 3VUDA 3IW8A 5CLPA 4FUYA 5CVHA 3ZMMA 1REKA 4EOKA 4AXAA 1UWHA 4A4OA 3W2OA 2B4SB 1H1QA 3PWYA 2HYYA 1BL7A 4YLJA 4E6DA 3JY0A 4I94A 4C4IA 3FZOA 3R22A 5CF6A 1L8TA 4U80A 4UWCA 3CE3A 2PVNA 4L3PA 3IKAA 5AX9A 1V1KA 3BBTB 2VNYA 5CEIA 3WILA 3OBGA 4G3FA 5T68A 3B2WA 3QRUA 4PF4A 4RX5A 3W8QA 2I6LA 3RZBA 3RK9A 3NGAA 2YM8A 3N4TA 4EYMA 2YZAA 2PVMA 4IDVA 4FTCA 4JAIA 5AR7A 2W17A 3HDMA 3R1SA 4G9CA 4D1SA 4O0RA 3V04A 1WVXA 4F6SA 4LI5A 2UV2A 4AQCA 3BIZA 2JFLA 5KZ0A 3NUYA 4QP1A 2ITTA 2GFSA 2QO7A 3F9NA 4WKQA 3E3PA 3Q5ZA 4QNYA 5AM6A 3VF8A 5A6NA 4RJ3A 4YHJA 3MH3A 2YIRA 2YAKA 4J52A 3MGYA 4CSVA 5I9UA 4EH7A 3Q4CA 2GS6A 1VEBA 4U45A 1OPKA 3RAIA 3QZFA 5HKMA 2ZV7A 3BX5A 4OAVB 4RZVA 3COIA 4AGUA 4CNHA 3MVMA 5EQEA 5HG7A 3CTHA 4ZLYA 1OIUA 2WQBA 1K9AA 2ITQA 2WKMA 1XH7A 3LPBA 4OR5A 4ZS4A 4A9RA 3R9NA 2J0KA 1PXIA 2CNVA 3KULB 3E7OA 4I3ZA 4DLJA 4QYYA 4CKJA 5ETIA 1W8CA 4DN5A 2X6EA 3WE4A 3KB7A 2QLQA 3UNJA 4OGRA 4X21A 2B9IA 1Q61A 4FG8A 3S95A 4NWMA 3PVGA 4FGRA 2E9NA 3FI3A 2BHHA 4JG6A 4UV0A 2CCHA 2W96B 2C6IA 4R78A 4O91A 2JBOA 2Y6MA 4FT0A 3UYSA 4F64A 3EH9A 4PNKA 2F49A 3C0IA 5CU0A 3DXPA 4O27B 2CNQA 3E64A 4YO6A 4HVSA 4PP7A 2BCJA 3QYWA 3QRKA 1YHWA 4AGDA 5CEPA 3OWJA 4NM0A 4BVUA 2GQSA 3PPKA 1Z9XA 3DT1A 4O0VA 1DM2A 2JKOA 3DNEA 3WARA 5KMLA 5L2TA 1XWSA 4XJ0A 3ZEPA 5GZ8A 2A19B 3ETAA 4HCTA 5I9YA 3GCPA 3EYHA 4IX4A 3ZO2A 3GQLA 5IH6A 1R0PA 1KE5A 1OIQA 3ORTA 3C0HA 4RFMA 4ZTQA 4RIYB 4DLIA 3PPZA 4X6QC 3EQCA 1RW8A 3ODYX 4MXZA 3NX8A 5GHVA 3MN3A 4G9RA 3LM0A 3UGCA 5LMBA 1F5QA 1FQ1B 2OIQA 3I5ZA 4EH9A 4JS8A 2PMLX 2E9PA 2WMSA 3ZUVA 3ROYA 1L3RE 4WNOA 4HGEA 4YBJA 3GENA 3GXLA 3LKMA 3H9OA 1MRYA 2YACA 3VBTA 4FEWA 4PPCA 4R1YA 3F2AA 2BKKA 5CVFA 4G6OA 4X2FA 2XP2A 5JH6A 3WE8A 3FQSA 4XX9A 4MX9A 4CG8A 4RT7A 1Q99A 2O3PA 2HXLA 3TNHA 5L2QA 4C57A 4RLLA 4GVJA 3FUPA 4FV4A 4NEUA 3LAUA 5FG8A 3LE6A 4GUBA 4KS7A 4BC6A 4HVGA 4AACA 1IA9A 3PZEA 4JG8A 3PSDA 3NIZA 3G5DA 4XOYA 3DBFA 3GC8A 5FP6A 4D2RA 5CEOA 5AV1A 3QUEA 4I0SA 4KBKA 3V5WA 3IG7A 5G1XA 2YIQA 5HG9A 4MXCA 3ZYAA 3FI2A 4CEGA 3QTXA 4C37A 4BDHA 4U42A 4TW9A 3RM6A 4USDA 5G6VA 1CKIA 4NKSA 4PDSA 2PVFA 3BGQA 2XBAA 4PRJA 1R39A 4AW1A 3FKNA 2VWVA 5AFVA 3NCZA 2PSQA 4ASXA 4NYEA 5D7AA 3GOKA 5ANOA 3V3VA 4R7IA 3G0FA 1U5RA 4O0WA 4RSSA 4YJSA 3RI1A 2IZTA 3BHVA 2Y4IC 2W9FB 3BELA 2VWBA 5AP2A 4IX5A 4ZMFA 3DJ7A 3AGLA 5KBQA 3LIJA 3BPRA 2GHMA 3NUUA 1JAMA 2R3JA 4CRSA 4S33A 2XBJA 3UIUA 3W2PA 3IW6A 3A99A 5HQ0A 2IG7A 4PDYA 4QTAA 4CVAA 5TE0A 3DGKA 3QGWA 4LOPA 4S31A 1Q4LA 2QOOA 5HCYA 4TYGA 2ZV9A 3CTQA 3TKUA 4MBIA 4AFEA 3LM5A 4J8MA 2JIUA 2QU6A 5E8XA 3AC3A 2WELA 1TQPA 3HV4A 3M1SA 1ZOGA 3FKLA 3SVVA 1UNGA 3BWFA 2BIYA 5B2LA 1B6CB 5H2UA 2OXDA 3G90X 4HGSA 1A06A 3QALE 3R2YA 3CQUA 5HO7A 5IH4A 2XK3A 2WEIA 3Q4TA 5IISA 3FJQE 3EZRA 4FTLA 5LMKA 5M4CA 3R2BA 2RF9A 4OTQA 2VTNA 3KULA 1K3AA 3PE2A 4I6QA 4EUTA 2R7BA 2Y4IB 4YPSA 5IQEA 3LFNA 1W82A 3ORMA 4D58A 4NCTC 5BYYA 3WF8A 2WTKC 4L00A 5HE1A 4C61A 3D5VA 2PUPA 1NVRA 2BDJA 1WBVA 3NMUF 4RWKA 3CCNA 4KKHA 2XVDA 3RAWA 3TG1A 3UG2A 5EOLA 3MDYA 3UC3A 2VTPA 3ENMA 3MIAA 4KNBA 4YJRA 4L53A 3WBLA 1YXSA 1OZ1A 4QTCA 4X2JA 5DHJA 3HUCA 5IQIA 4Q5EA 5CXHA 2C3IB 3C4FA 1VYWA 5CWZA 2X7OA 2YM4A 3AXWA 3TNIA 3H0ZA 4ITHA 3P86A 4YTHA 5I0BA 2IWIA 3FYJX 4JBOA 4Q5HA 2YCQA 3QQJA 1R3CA 4ZLOA 4FV3A 3FZ1A 3KRJA 2G15A 2O63A 3EZVA 1E9HA 4OTRA 3LFCA 3MJ2A 1YRPA 2XJ1A 1E1VA 2CMWA 1LR4A 1AD5A 1YWVA 4QP2A 3OTVA 3AT2A 1XH6A 1V0PA 4RIYA 4I6FA 3AQVA 2J51A 4FT5A 3BYUA 4DG3E 5LMAA 4M15A 4PMTA 3U54A 5CS6A 5AM7A 1UNHA 2GTMA 3KXGA 4W4XA 5AV0A 3QGYA 2WTKB 1ZYLA 3ZHPC 4QOXA 4PV0A 5JZJA 5AA8A 3TL8A 3DDPA 3JS2A 5DBXA 2XJ0A 3KXZA 5AJQA 3KQ7A 3DLSA 2HWPA 2PYWA 3QCSA 5IQDA 3EWHA 3L9PA 1H28A 2GCDA 4AX8A 2W1ZA 3VN9A 2LAVA 4E26A 2BZIB 3OBJA 4PPBA 2VTQA 4AT3A 3GOPA 3KK8A 2HOGA 2Y8OA 4IMYA 1XBCA 4DGMA 4ACDA 5JEBA 5H9BA 3UO6A 4ZZOA 4FIJA 2PMIA 3EYGA 4UMUA 4XOZA 4B99A 4EORA 4MEDA 4HVIA 2OJJA 4M97A 2BTSA 4XRLA 5E8UA 1URCA 3B2TA 5L6PA 3R8VA 2KTYA 1TVOA 2QD9A 3JVRA 3FI4A 3PXRA 4I20A 5K4IA 2OIDA 5FQDC 3MPAA 4FTAA 3IW4A 1OB3A 5IKWA 2W4JA 3BWJA 3FMMA 3VVHA 2CKOA 2CGXA 2J2IB 4R8QA 4EJ7A 4WNKA 4KINA 4XBUA 5K0XA 1SNXA 1VZOA 3PPJA 4GUEA 1PYXA 4NIFB 3ELJA 4AZTA 2OI4X 3Q53A 3OG7A 5CALA 4YHTA 5C8KA 4NJ3A 5JK3A 4DT9A 4RJ4A 1P5EA 4GT5A 3UOHA 3I81A 1AGWA 4LRMA 4EUUA 5I9WA 3PSCA 3ATTA 4L6QA 3VS5A 3Q2MA 1WFCA 2FSMX 1OI9A 4OTGA 3KN6A 4XG8A 2C1BA 4PQNA 3HP2A 3EKNA 3FMEA 3FQHA 3FXZA 4BCPA 2PMNX 3OEZA 1GNGA 3NSZA 1ZY5A 2RFNA 3ZZEA 3NYXA 4YC6A 3CY2A 2OK1A 3ZLWA 5M44A 4BWKA 3LFAA 4FT9A 4YTCA 3ZS5A 2P33A 4TTHB 2BZHB 4R7BA 4Y85A 5D12A 1M2RA 1Q8YA 2VWYA 3H0YA 5T6KA 5TO8A 4IJPA 5FBOA 5GIOE 3FAAA 2QR7A 3AGMA 2B9FA 3EQGA 4BWPA 4B8MA 5IDPA 4JQEA 3Q9ZA 2W1IA 3F61A 2ZYBA 3NNXA 4D28A 5CAOA 3FL5A 4K77A 2ETKA 5FLFA 4I4EA 5FWKK 4GKIA 4A07A 2R64A 2WQEA 3LQ5A 2R3PA 4FC0A 4ZJIA 4D4SA 2PE1A 4BIBA 3VW8A 2HCKA 4ANSA 2YERA 3SXFA 4WA9A 2I7QA 3ORNA 2GPHA 3QKLA 5DE2A 1FOTA 2OG8A 3ZRLA 5KKRC 1LPUA 2R3KA 2CDZA 2F57A 3KFAA 3RALA 4MHAA 3DA6A 3RJCA 5AA9A 2PVRA 3SOAA 1OL5A 3MW1A 3ZH8A 4XG2A 4D2TA 4W8DA 3KGAA 4YZNA 4UZHA 3NNUA 3R7YA 3NYOA 3UP2A 3OY3A 3QCYA 1NXKA 4NU1A 3I6UA 4EK8A 3VS0A 4W9XA 3R7VA 4QMQA 2B1PA 4RVTA 3PJ2A 4FKQA 2I0YA 3LFSA 5DWRA 2QG5A 2Z2WA 4EKKA 2BR1A 4RX9A 3FMKA 2ACXA 3G9LX 1MP8A 2W7XA 3PVWA 1M2PA 3HUBA 4IH8A 5AR8A 5ITAA 3ZM9A 4OW8A 1YOMA 2BFXA 4HNIA 4FA2A 1OL1A 3CC6A 5AIKA 5J8IA 1DAWA 2PULA 4DCEA 3P9JA 3QUPA 3UVPA 3KVWA 4NCTA 4PL4A 5GIPE 3QF9A 2HELA 5KKRB 4QD6A 4IM0A 1XHAA 2Y7JA 4EBVA 2YLEA 4GIHA 3LOKA 4FKVA 4FYOA 4QTBA 3RAKA 2VO6A 3S00A 5DYJA 4BCMA 4XG3A 3CJGA 4EOJA 4BDJA 5HESA 1Q5KA 2C5VA 3PY3A 5ANGA 2B9JA 2FVDA 2XNPA 5HORA 5IQBA 3UBDA 3QTQA 3OC1A 4JAJA 2OJIA 4M84A 4O1OA 5IA4A 4GSBA 1YI6A 4H3PA 4II5A 3VS2A 4O2PA 5IA2A 4F63A 2XNEA 5ICPA 5JRQA 4UMPA 4E4NA 5CSVA 4BHNA 4C0TA 4GU6A 5C9CA 4HW7A 3LJ1A 3QZIA 4JBQA 2PTKA 4E4LA 1XO2B 2OBJA 1SM2A 3KVXA 3VJNA 3WYYA 3V01A 3GUBA 3C50A 2PVLA 4I93A 3KXNA 4RVMA 3HRFA 4F7LA 4LMUA 2XK9A 4JRNA 2YCRA 4BZNA 1B39A 3MFRA 2HWOA 1OKYA 5BVKA 3LXLA 4NIFA 4ERWA 2BRGA 5EW3A 1WVWA 3N51A 4H3BA 3AC5A 3HMOA 4DH5A 4BICA 2PUUA 1MQ4A 4I41A 2PPQA 3VW6A 5CT0A 5CVGA 3ZBFA 3PRFA 5I9ZA 4CFNA 3D7ZA 4MKCA 4RWIA 5CTPA 1FBNA 2YJSA 2ZVAA 2R0UA 3SX9A 3S2PA 1H4LA 4BGQA 3F7ZA 3DPKA 2W1FA 1AQ1A 5BVEA 5CEQA 4IWPA 4D55A 4DG0E 3OS3A 5CZIA 4A06A 1JKSA 3VQHA 3ZSGA 3NWWA 3QKKA 4PMSA 2VWUA 2VD5A 1H08A 2R3FA 3CS9A 3HRBA 2E9OA 3DU8A 4P2KA 3NS9A 1UVRA 1CM8A 4OBOA 3TV7A 3TV6A 5LARA 3HMPA 4HCUA 4ZP5A 3THBA 4QMOA 4XV2A 4UXLA 2GU8A 4BZOA 2Q0BA 4C34A 2Q0NA 2W1DA 3AD6A 3EFLA 2YHVA 3PFQA 3M11A 4UEUA 3RPYA 5KHWA 4Y5HA 4M0ZA 4FOBA 3UIXA 3EQIA 5HE0A 4HGTA 5M07A 3L9NA 2YLFA 3OOGA 4QNAA 2CNUA 4DE4A 3RPSA 2C3LA 4XUFA 5E1EA 2VZ6A 3CD3A 4TY1A 2JIVA 5KX8A 4ASDA 5CQUA 4RC3A 2BPMA 3D5WA 2R4BA 1VJYA 3NW7A 4KWPA 2J0MB 2W5BA 3L1SA 3ZO4A 4P7EA 1H8FA 4XG7A 4L7FA 4WSYA 4KBCA 2YABA 3KRWA 3F66A 2WMUA 1BUHA 1I44A 1GZOA 4J7BA 2HZIA 4BL1A 2RG6A 4X3JA 2XIYA 2W9ZB 3GCVA 4K8AA 5FM3A 5AWMA 4MBJA 2JKQA 2XMYA 3ACKA 5CU3A 5HBHA 2VO3A 3RPVA 2BKZA 5CF4A 4QQJA 3RHXA 5HCZA 1S9JA 2YA9A 2XK7A 4MH7A 4CMOA 1WVYA 3ROCA 2C0IA 4I23A 3W2QA 1U54B 3QLFA 4CMTA 2ONLC 4KSPA 5BQ0A 3SV0A 4K18A 2H9VA 3OWKA 4UALA 3D5UA 4DH1A 5ANEA 4EH2A 4C62A 2W1CA 1SVGA 1ZYJA 4NM7A 3ET7A 4K11A 4GK2A 4FSWA 2WMRA 5AAEA 4MYGA 4FKIA 4Q9SA 2IZSA 3WYXA 1BI8A 4MXYA 4DBXA 4WNPA 5EYMA 2O65A 3MA6A 5EDRA 5J7HA 4F0IA 5JFVA 4FSYA 1BYGA 5LVLA 4BN1A 3R0TA 2VN9A 3CD8A 3GU7A 5I9XA 4AT4A 4D0WA 5HG5A 2J90A 4XNEA 3ZEWA 4BCOA 5CSXA 2QG7A 4TL0A 3NEWA 3UOJA 3AD5A 3R1YA 5CT7A 5CY3A 3UNKA 2VTTA 2YM5A 3DB8A 5AUXA 4CD0A 3UE4A 3VAPA 5IMEA 5CU4A 5EHYA 5A4CA 3H3CA 4EK5A 2PHKA 2PUIA 5J9YA 4EC9A 1TKIA 4WT6A 5M4FA 1EH4A 2VWWA 5E8VA 2J0IA 2UZOA 4FUXA 2JBPA 4EZ5A 5BUEA 4F70A 3Q96A 5BYLA 5GNKA 4MQ2A 1KE7A 3FZSA 3UQFA 2ITNA 3PY1A 5HE2A 4A9SA 2CGVA 4IM2A 4ZK5A 4EI4A 4EQCA 3FV8A 5CF5A 1SVHA 5L6WL 2H96A 2FUMA 3PIZA 5AP1A 5CNOA 3HAMA 3DXQA 3QA8A 2UZNA 2C47A 4JJRA 3F5UA 3I7CA 2JFMA 4U0IA 2GNJA 4DTAA 1V0BA 2QODA 3DQWA 4HZSA 4QP8A 4RGJA 4DGOA 4XH6A 1QPJA 4DA5A 5ANDA 4Y72A 1GZ8A 3BLQA 1PXMA 1H07A 2WTVA 3JYAA 3OWLA 5EYDA 5C03A 5JKGA 3OCSA 3FWQA 5IUGA 2QO9A 2VX3A 2WFYA 1OVEA 1H1SA 3WZJA 3ZDIA 4X6RA 3DBEA 2YCFA 3TIYA 2E9VA 4FEVA 3C13A 5J95A 3NUXA 3T9TA 4DFBA 3NCGA 3QHRA 4IAZA 3NYNA 2QOLA 5C8MA 5J7BA 3UPZA 1NA7A 2EU9A 3PJ1A 3UP7A 4BKYA 4CZUA 2VTSA 5HI2A 1PW2A 2X2LA 4IWQA 4K2RA 3TCPA 1RDQE 1H0VA 4IWDA 3CPBA 4LOOA 2BTRA 1IAHA 2J4ZA 4IB1A 3RZFA 4MXAA 3CKXA 2JAMA 3DAKA 2VRXA 4FSZA 4JT3A 4MD9E 3IECA 3TIZA 3R9DA 3R73A 5E8ZA 4ZSLA 4CZYB 4DEDA 5CU2A 3QTUA 2ERKA 3S3IA 4C33A 3QL8A 5JT2A 4MNEB 4FNYA 5DVRA 3TXOA 3BE2A 5EQYA 2C0TA 3P4KA 3SGCA 1JSVA 3BKBA 4HYUA 1YXVA 4RC4A 4FODA 5BYZA 3VC4A 3IPHA 4USFA 2ITYA 5FEDA 1UU9A 4FVRA 4HPTE 3LFQA 2XB7A 2J0JA 4C3FA 2P2IA 2H34A 1BKXA 3POZA 2UZTA 2UZLA 3C4CA 3GCSA 3MTFA 4ZJJA 5IA1A 5E8SA 4HJOA 2ZMCA 4D2PA 1Q8TA 2FSLX 1GOLA 4ITJA 5DT3A 3BHYA 3ID6C 4KUJA 4DH8A 4KAOA 2A2AA 3UOLA 4NFMA 5TR6A 2YEXA 3QTWA 3GU5A 3R7OA 4UWYA 2GTNA 4FSTA 4KRDA 3RCJA 5HVKA 5LVNA 5HD4A 3NPCA 2X8EA 5KMJA 3R6XA 5FGKA 3BRBA 3GC7A 4CFWA 1SMHA 3A2CA 1URWA 3OTUA 3WZKA 3NUSA 3LJ2A 4IB5A 4J97A 4C38A 4EQUA 3AD4A 2PVJA 1IR3A 1MRUA 4X7QA 4E8AA 1ZMVA 1PMEA 5CF8A 1U54A 3FLSA 3KA0A 3JVSA 3W2RA 4CFUA 3M2WA 4FL2A 1GZNA 5IH5A 4FKWA 3QQKA 4O0TA 2PZYA 5B0XA 3NW6A 1H01A 3D7TB 3QAME 2GMXA 4XG6A 2ERZE 4BR3A 3DKOA 2GS7A 3MH1A 4DINA 4DH3A 2AUHA 4FSQA 4KIOA 4PX6A 3N4UA 2W4OA 4FV1A 4TZRA 4CTCA 4DBNA 5LWNA 5IQAA 4C35A 4FTQA 4XCUA 3EN5A 1O6YA 2QOKA 3W32A 4Q9ZA 4JR7A 5IF1A 5A14A 1PMUA 2QC6A 4KIPA 4WBOA 2YM3A 3OT8A 4YP8A 4CFXA 3LW0A 4FGBA 4ZSAA 4TWOA 4U43A 3UYTA 4Z7HA 3RKBA 5J5SA 4FKGA 3Q2JA 3A7GA 4AA0A 1UKHA 2XIRA 4RIXB 5HOAA 3ULZA 1E1XA 4H58A 5TT7A 3W16A 4AN9A 3KRRA 5L2WA 4AW0A 1F3MC 3BHUA 3PVBA 2PE2A 4BTMA 2ONLA 2VTJA 4U44A 4EH3A 4ZEGA 1ZAOA 1PKGA 3O96A 3ZM4A 3CJFA 4NW5A 1FVRA 3REPA 3FMJA 3QQLA 4MXOA 4AP7A 1YI3A 4F09A 4MQ1A 1HCKA 3EQRA 4OBPA 3C1XA 1PXLA 2PE0A 2WMBA 2WQOA 5KMNA 4AGCA 4R3RA 2CKEA 5HU3A 3QTZA 2XA4A 4O7TA 4BDGA 1GIHA 1H24A 3GCQA 2ZB0A 4KKEA 3PXFA 3DFCB 4G3EA 2C6MA 1YHSA 3GCUA 4JX7A 5AP6A 3ZFYA 4FEXA 4D0XA 4XG4A 2WNTA 4C2VA 2C6TA 2JGZA 3H30A 4X3FC 4YURA 4PTCA 4U79A 3R8LA 4CTBA 3DDQA 4LOQA 5IPJA 2DWBA 2HW7A 4O7LA 3HV7A 2J0LA 1NVSA 1YVJA 3OHTA 4JOAA 3DTWA 3QZHA 4DGLC 4E1ZA 3Q5IA 2B7AA 1YWNA 4FG9A 2P2HA 2GDOA 2V7AA 4O2ZA 4YJUA 4N0SA 4FIIA 2XK4A 1FVTA 5JFSA 3BGZA 3HLLA 3PUPA 4M67A 2C6KA 2H8HA 3UC4A 4MCVA 2WMQA 3AC4A 5AP3A 1KE6A 1GIJA 2OJGA 3UO5A 3BLRA 1PKDA 4RPVA 4ANNA 1ZOEA 1ZY4A 2JITA 4ZZMA 4JI9A 5DA3A 5D10A 4GYGA 3DKFA 3WZEA 4DYMA 3I1AA 4FTJA 4TPTA 3TN8A 3QU0A 2RKUA 4QP6A 3QA0A 5CSPA 4YO4A 4EK3A 4L3LA 1UU3A 3QC9A 4FSRA 1UNLA 5CAUA 5DT4A 3ZXZA 3NIEA 1YDSE 1OPJA 5M53A 1ATPE 4GS6A 4QMLA 3TV4A 3OVVA 4H3QA 2X6DA 3ZBXA 3LMIA 4BCGA 2HZ4A 4X3FB 1H1RA 5CNNA 4GIIA 2IJMA 2BROA 2Z7LA 3R83A 3R9RA 3E63A 2CSNA 5EM8A 4EWQA 3ORLA 4IFCA 4M68A 2P0CA 1QPEA 1LEZA 1NY3A 3PVUA 4TYJA 3ZFMA 3BQRA 3CTJA 4NTTA 5HBEA 5ACBC 2PZIA 4TXCA 5ANIA 4JG7A 3VS4A 5EM5A 2R3GA 3V5PA 3T9IA 1YW2A 2G1TA 2JD5A 3KCFA 4QRCA 3N9XA 1T46A 3OW4A 2UW3A 3VHEA 2C1AA 4PL3A 4HVHA 4BTFA 3VUTA 2G2HA 3LJ0A 3IOPA 3RCDA 3O8TA 4X2GA 4CRLA 1LUFA 3UIBA 2VUWA 3IDCA 4QQTA 4AW2A 4IAKA 1PMVA 1OIRA 4RLKA 3A8XA 4EQMA 4WRSA 4TYIA 3ZSIA 2LGCA 4TWPA 2UZWE 3TUDA 3T3UA 3KKVA 2IZUA 3ANRA 3MPMA 5JZNA 4CKRA 4HYSA 3LLTA 4OTHA 5KUPA 1OKZA 4BF2A 1IEPA 2XYUA 3SXRA 4M3QA 3TI1A 4L46A 4ASZA 2XEYA 3D5XA 3HA8A 3HECA 4WRGA 5LXMA 3TJDA 4GW8A 3IQ7A 3RHKA 5A4QA 3D7TA 3F3WA 3FLZA 3KMWA 4FK3A 4QP7A 2X9FA 4YJPA 4IVCA 3SW7A 3IS5A 3L8VA 4FIFA 1JKTA 3IDBA 4BCHA 2PWLA 1OBDA 5BVWA 2DQ7X 5DH3A 2B0QA 2VU3A 4A9UA 2QLUA 4AOJA 3P7CA 4I4FA 4FVPA 3FYKX 1R78A 2QOHA 2YJRA 4DEHA 3QC4A 3DY7A 3KREA 4ORKA 2QI8A 3UMXA 3P78A 1LP4A 3Q3BA 3F6XA 3PP0A 5DRDA 4AA4A 1IASA 3C4WA 2BIKB 3C9WA 4AS0A 4B0GA 4FTMA 3TNQB 2KULA 3QTSA 4CKIA 4RFZA 4F7JA 2CN5A 4IAIA 3U4UA 3II5A 1PHKA 4RIXA 4F1OA 3KXHA 5I3OA 2JDTA 4MAOA 5HTIA 2ITWA 1RE8A 4XEYA 2PU8A 3FZPA 4BY9E 3G2FA 4EC8A 2V7OA 3QX4A 3HA6A 3V8SA 3FEGA 4UYAA 3IO7A 4W8EA 4K9YA 3KU2A 3LFFA 3R02A 2NO3A 2QOCA 4BDDA 2ETRA 3EB0A 3MVJA 3V5JA 4CLIA 4E4MA 2X4FA 3FI8A 2WU7A 3GI3A 4BIEA 2YITA 3NVMB 3POOA 2WEVA 2XIZA 4GK3A 1MUOA 2JDOA 2Y9QA 1CSNA 3ZC5A 1OITA 2R3MA 3D2IA 3PG1A 4R3CA 2H6DA 4PMPA 5E1SA 3SKCA 4KABA 3OOMA 4EH5A 3U6IA 4J95A 1XQZA 1G8SA 1P14A 1BL6A 4L44A 3TDWA 3ORXA 5AUVA 1M17A 5BNJA 3H9FA 4K0YA 2UW5A 3QYZA 4KD1A 2X2MA 4CFFA 1ZMWA 2UZUE 3W55A 4EEVA 2IPXA 4WBBB 3U6JA 4G1WA 2WTDA 4YJQA 2B52A 3D83A 2JKKA 3LMGA 2BHEA 2YWVA 5CQWA 1OECA 2FSOX 5DI1A 3DKCA 4CCBA 4W4YA 1BX6A 3UVQA 2WMWA 2WU6A 4QPSA 3VS7A 2YIXA 4IX3A 4QQCA 4XP3A 4Y5QA 3ZOSA 3FLWA 4M69B 2AC3A 4UBAA 2QQ7A 4G34A 4K6ZA 5CSHA 3BV3A 3WIKA 1PYEA 3MWUA 2EWAA 5HX6A 5EFQA 5D1JA 3P0MA 5BUIA 4QMMA 2QHMA 3DQXA 5I5ZA 5CAQA 4XV9A 3VIDA 5HE3A 3QZGA 5AP7A 1SYKA 3TZ7A 3WF6A 2JC6A 1ZXEA 2VTRA 2ZM3A 4CMUA 2C3JA 4X3FA 4R6VA 2R3RA 3VUIA 1JWHA 3R71A 5ETFA 3FZTA 2VX0A 2BAJA 3UZPA 3KK9A 3D15A 3R9OA 3HVCA 3EQDA 4QT1A 3V6RA 2ITOA 4G3DA 5ACKA 3VULA 5FM2A 4AF3A 5IUHA 4Z9LA 1JNKA 4HCVA 1YHVA 5HVYA 1NW1A 1JLUE 3BYMA 2ZOQA 2WIHA 3NUPA 4GT4A 4GT3A 2CPKE 3R1NA 2OSCA 3E88A 5JMSA 4QPMA 2XUUA 3FDNA 4QMPA 5EW8A 2UZVA 5A46A 2I0VA 5IQCA 2ITXA 5JN2A 2JKMA 5CI7A 5L8LA 2G2FA 2WO6A 3F2NA 5BVFA 5IQHA 3RK5A 2UW9A 2ITUA 1ZARA 3A8WA 1Q62A 3LCSA 1OIYA 3Q52A 4H36A 1CDKA 4ITIA 4PWNA 4TN6A 4NM3A 4APCA 4E5WA 1BLXA 4E6CA 3A7FA 5BVNA 3QQUA 2VV9A 2XNGA 3BV2A 3QXOA 4O82A 4XLVA 3ORPA 3VJOA 2VTMA 3QQHA 2ZJWA 3A61A 4QMTA 2C30A 4IZAA 5KZIA 4TNDA 4WOVA 5CX9A 3TM0A 4DFZE 4GCJA 4F9AA 4RX7A 4IZ5A 2BILB 4ZJVA 2R2PA 3LMHA 4ZLZA 3NYVA 5LQFA 1QL6A 2UVXA 3GB2A 5E7RA 2ZV2A 3DBQA 1KOBA 4BHZA 3JY9A 2F4JA 3ZSHA 4D5HA 1XH5A 4ANBA 2PZ5A 4Y46A 5AV3A 2HXQA 4DT8A 3QRJA 1WBWA 2XM8A 4KIKB 3S0OA 4FKPA 3R8ZA 4M8TA 4IVAA 5HU9A 3DK6A 5I3RA 2REIA 3IGOA 2VNWA 3FPQA 4A9YA 3UNZA 4B6LA 3DAEA 4O81A 2FA2A 2B9HA 4WHZA 5E90A 4YZMA 5AUTA 2QVSE 4YGAA 4AZEA 4CFMA 3U9CA 3PWDA 4YPDA 1YOJA 4O7NA 4GFGA 1ZYCA 3RBWA 5JGDA 2IVUA 4F7NA 5LJJA 3E3BX 4FE2A 3VUKA 2WTJA 2R9SA 5BVOA 5IMXA 5LCKA 4ZTMA 4UX9A 3MVLA 4AT5A 2GQGA 4FMQA 4JQ7A 1KOAA 2WQMA 4R1VA 4XLIA 3V8TA 5IA0A 2PUNA 3UZTA 4XBRA 2C6OA 3RM7A 2Z8CA 4RVLA 4KRCA 4TKSA 2HENA 5H8GA 4EOQA 2J5EA 4EONA 2PVHA 2FO0A 4BKJA 4FR4A 5LVMA 3C51A 1H1WA 5E4HA 1G5SA 3BYOA 3FL4A 3NW5A 2GNLA 3BLHA 5I9VA 2QONA 1H1PA 4KB8A 4R7HA 3ORIA 2BUJA 2RFSA 5ETAA 4N6ZA 2WMAA 4WG5A 5CAVA 3OMVA 4FT3A 4JBVA 2CJMA 2WOUA 4LYNA 1JKKA 2C0OA 1FMOE 4BBMA 1H0WA 2VWXA 4PPAA 4RA5A 4D4VA 2RIOA 4ZAUA 3NUNA 4HPUE 3F3TA 3RPOA 2XJ2A 3OCBA 4EBWA 3WZUA 4BCFA 3EFKA 3PE1A 2R7IA 4DAWA 3MYGA 1F0QA 4AGWA 2YDJA 3R1QA 3FE3A 4YNOA 4YHFA 2OGVA 4FKSA 4RRVA 4QYHA 3SXSA 3ZUTA 4AA5A 4M69A 3ZLXA 3R8UA 3Q4ZA 4EHZA 5JQ5A 4O7ZA 4G6LA 2OZOA 1J7UA 2ITVA 5IU2A 2UW6A 4YTIA 3ZLSA 5A54A 1SNUA 4A4XA 4DHFA 5HO6A 2RGPA 1OMWA 2XIKA 1ZZ2A 4I24A 5HICA 4JL9A 4F4PA 2BZJA 4NK9A 1P2AA 5FUTA 3ZONA 4YUQA 5FTGA 3QD3A 3ZTXA 4GEOA 3GU8A 3I79A 2OJ9A 5J79A 1KWPA 4DFLA 4HNFA 3UO4A 4I5MA 2HW6A 2QU5A 3UQCA 4IQ6A 4J8NA 4FV2A 4DGNA 4EH4A 2Z7SA 2F7ZE 4ASEA 3GQIA 5EM6A 1PRYA 1G8AA 3OP5A 3W2SA 3ODZX 5M4IA 4X2KA 3LLAA 3AG9A 4BI0A 5FDPA 4AN2A 5F95A 3S4QA 3AC2A 4BDCA 4PDOA 3L9MA 1KV1A 3RPRA 4ZZNA 3I6WA 1XKKA 3COHA 2UZEA 4QQ5A 3V5QA 1W7HA 4FZ6A 5FEEA 4WIHA 3WI6A 4QMUA 2QKWB 2Y6OA 4YJNA 2AC5A 5HD7A 5DEYA 3MIYA 3P23A 3G9NA 3R7EA 4JNWA 3UG1A 3G15A 2XIXA 5AUZA 2XNNA 4ZTHA 4Y8DA 2X39A 3VWAA 1R0EA 3F3ZA 3Q04A 2CCIA 2VO0A 4C4GA 2CLQA 2BVAA 2XZSA 3GU4A 1T45A 2R3OA 4F1TA 3BYSA 5HZNA 5CYIA 3EMGA 1S9IA 2GHLA 3F88A 3KXMA 2UZDA 3O50A 3ZZWA 5FBNC 4WD5A 2FH9A 3EQPA 3FY2A 3O71A 2JEDA 2X1NA 2V22A 3EL7A 3Q9YA 4YJOA 5EYKA 1WMKA 2BRMA 3PZHA 4IAYA 2CGWA 2VGOA 3Q4UA 2RFEA 2X0GA 2V55A 4BBEA 3CQEA 4BGHA 1H00A 5IEVA 4KIKA 4DFUA 2J6MA 3ACJA 3A7HA 2JIIA 4MNFA 3TTJA 2WHBA 2WXVA 2O2UA 2W99B 5EK7A 5M56A 5FD2A 5DEWA 3ENHA 2F7XE 1Y8YA 3FQEA 4G17A 4JX3A 4L01A 4IVBA 5JSMA 2OW3A 1APME 1M52A 3C7QA 3OUNB 3QWKA 3HRCA 3DJ6A 2QO2A 1ZWSA 2QOBA 3QRTA 2O64A 2XNOA 4D9TA 5K5NA 2QCSA 3VRZA 2EB3A 5AV2A 1Y91A 4OTPA 4DH7A 4K1BA 1WAKA 2ESMA 2X7FA 3EKKA 2ZDUA 3D0EA 3E8CA 2VO7A 3AMBA 3QX2A 4FV9A 5EKOA 3R28A 3HAVA 2E2BA 2YISA 2PZRA 3BU3A 5ANKA 4B9DA 4FTNA 1CMKE 3W8LA 5K9IA 3KF4A 4U81A 4CYJA 1MRVA 3EQHA 3UZRA 4IAFA 4ALUA 4IBMA 4RIOA 5AADA 1YXUA 2BRBA 3QWJA 4LUEA 2QOQA 4AN3A 2YDIA 2IW8A 3DLZA 5J87A 3A4OX 4S2ZA 1PMNA 3QUDA 5J1WA 4MTAA 5DOSA 2R3NA 4AAAA 5DN3A 4K33A 5F9EA 2XNBA 3U9NA 4ANMA 3IGGA 3L9LA 5DR9A 4ZY6A 1K2PA 2XK8A 3R7UA 3HMMA 4ZMEA 3R63A 4L45A 1VYZA 4AU8A 5BPYA 3OCGA 3PG3A 2HK5A 2OF4A 4WG4A 2C5YA 5E8TA 4BCNA 3AMAA 4R77A 3F3VA 4PNIA 3DZOA 4EOMA 4JDIA 3I0OA 5IA5A 2WQNA 3SG8A 4EJNA 4NT4A 3SRVB 3OCTA 4L7SA 3V5TA 2HY81 4RJ8A 3F82A 5EI2A 3RWQA 4I5PA 2W4KA 3K2LA 1UU7A 1M14A 4EOOA 3EN6A 4U7ZA 5A4TA 3MTLA 3HX4A 4EHVA 4GK4A 4FI1A 1DI8A 4YMJA 3ZRMA 3FMNA 2HIWA 4CXAA 3PTGA 4FV6A 2P55A 3GC0A 2YWPA 3OY1A 2WTIA 4O86A 1H26A 4D2VA 4U41A 1PY5A 4FIHA 5M55A 3TWJA 4NTSA 4QP9A 2UVZA 4IC7A 3TZ9A 1OL2A 4IXPA 4E6AA 3OT3A 1JPAA 3VF9A 2R5TA 5GJDA 1UV5A 5FRIA 1Z57A 2XRUA 4DCAA 4H1MA 2BMCA 5M09A 5AUYA 4IVDA 2Z60A 4D1XA 4WSQA 5L8KA 4XHKB 4FIGA 4N70A 3NR9A 5DNRA 4FSMA 3TUCA 3CR0A 1J1BA 4GFMA 3TUBA 2RL5A 5HIBA 3SLSA 2OKRA 4ID7A 1WCCA 5AP4A 4TWCA 3TJCA 5CZHA 4E7WA 4OTFA 4AUAA 2B55A 5K4JA 4YZ9A 3TNPC 5A4EA 1W98A 4AZWA 5HTCA 1PXOA 2FGIA 4YBKA 5KHXA 3MI9A 4GV1A 4MVFA 4OBQA 3I60A 3PXZA 4ZIMA 1FGKA 1QMZA 5EHOA 3VUGA 5BMSA 5HBJA 3W1FA 3MPTA 5GINE 3WF5A 3LCOA 4G3GA 4U3YA 5EDQA 4Q2AA 5FDXA 4F9WA 4UWBA 3AT3A 3AC8A 3FC2A 4YSMA 3RWPA 3KMMA 4FTTA 2Y4PA 3OWPA 5EI6A 3MH0A 5H8EA 2IW6A 2BDWA 4M66A 1JSTA 4ZTLA 5DLSA 5L6OA 3O8PA 3G6GA 4I0RA 1ND4A 3T3VA 3DJ5A 4G6NA 3CGOA 4JQ8A 1Y8GA 3OEFX 3GVUA 3TKHA 3UDBA 3M42A 5IQFA 3H10A 3BEAA 4O38A 5IG1A 3PXKA 3FSFA 4J98A 1BI7A 4O7YA 2HZ0A 3IW5A 3QKMA 2O5KA 4GMYA 4YJTA 3FPMA 4DTKA 4JBPA 5HNIX 2YCSA 3UTOA 1W84A 3U87A 2JDVA 4JDHA 4AE9A 4BRXA 3S1HA 4YC8A 2WIPA 3LCKA 3K3IA 4APPA 5K5XA 3BE9A 5C4KA 5AR2A 3IDPA 5A3XA 5HG8A 2CLXA 1STCE 3RTPA 4BTJA 4O84A 4JVGA 4XG9A 3P7AA 3SG9A 3R04A 5EKNA 2RSVA 3RP9A 4FK6A 2CKPA 4ACCA 4DF3A 1YXTA 3ZXTA 1GIIA 4J99A 1PXKA 4XYFA 4YU2A 4D2WA 3PIYA 3CQWA 5LMKC 4LM5A 4ZY4A 4L52A 4ZTRA 2EUFB 4YNEA 3R7GA 2A1AB 3PYYA
chains in the Genus database with same CATH superfamily
3F2RA 4I22A 5HO8A 4CQEA 2WMVA 4FYNA 5E91A 2BZKB 4Y83A 4I6LA 1JSUA 4G3CA 5KMOA 1CKJA 1O9UA 1WBTA 5KMKA 4O6EA 3FY0A 4ARKA 3DBDA 5L2IA 4O0XA 5FXQA 3V5LA 5AAGA 2YM7A 4FF8A 1PXJA 3NLBA 4WO5A 4IFGA 1IAJA 2OH0E 3KC3A 2IEWA 1TQIA 3OUKA 2OH4A 3MFUA 3VS6A 2W06A 3SRVA 2BAQA 1UWJA 2YAAA 4FTUA 3TZ8A 2WZJA 4ANQA 4LGGA 3OW3A 4EOSA 3SC1A 4CV9A 4GJ3A 3PFYA 4BCIA 4WUNA 5JFXA 5HLWA 2J9MA 2FYSA 3VHKA 1Q41A 4L67A 5C4LA 2HAKA 4DG2E 4OTDA 4DEBA 4DFYA 3QXPA 4XV3A 3SHEA 3AT4A 1QPCA 2Q83A 2EB2A 4AWIA 3R8MA 1OPLA 3OD6X 3HDNA 1Q8UA 2UW8A 3QD2B 4U6RA 5CXZA 3KF7A 4FL3A 4TT7A 3P79A 4AXDA 4FSUA 5AV4A 2VTOA 4FT7A 1J1CA 1QCFA 1CTPE 2E9UA 4ZY5A 3DAJA 1SVEA 4FTOA 2Z02A 4DTBA 3EHAA 2ZB1A 3H9RA 4NFNA 5GZ9A 5D7VA 2PL0A 3NAXA 4KKGA 4QMXA 4EZ3A 4M7IA 3WIGA 5C1QB 2QNJA 2XKDA 5FXRA 5D9HA 3ALOA 4NW6A 4IX6A 2F9GA 4N6YA 4Z16A 5EHLA 5L8JA 4GYIA 4M13A 4OTWA 2X2KA 1JBPE 1ZYDA 3KL8A 4PL5A 4R5SA 5D11A 4AOTA 5KMMA 3C4ZA 1UU8A 4MXXA 3P1AA 2SRCA 3V6SA 2X7GA 4NKAA 3BQCA 3H4JA 4I1ZA 3BZ3A 3R01A 5FP5A 3BHHA 1OM1A 3GEQA 3A7IA 3BEGA 4FL1A 4HZRA 5EDPA 2XRWA 3PIXA 4EKLA 5BX0A 3G6HA 4FZFB 5M4UA 3VBVA 3DFAA 4X2NA 3NRMA 3OXZA 1WBOA 4DC2A 4C3RA 2WPAA 4DFXE 3SD0A 2AQXA 2X0OA 5CAPA 4LG4A 3UVRA 4WNMA 4MNEA 1ZRZA 3KRXA 3FMHA 2XCKA 2Z7QA 1A9UA 4C36A 4XMOA 4GU9A 4FNWA 4IWOA 1G3NA 4N57A 4P5ZA 4RIWB 4ZOGA 2OU7A 4D4RA 3DCVA 3OXTA 4CT2A 3HZTA 4J1RA 4AFJA 5D41A 3B8RA 4EJ7A 4QDVA 3O8UA 3BYVA 4BTKA 3MB7A 1Q8WA 2VX1A 4D2SA 1KUTA 1VLRA 4EOIA 4I5HA 4RG0A 5M06A 3DKGA 4FG7A 2Y0AA 3NZ0A 4IEBA 4O21A 4PTGA 5LOHA 1LEWA 2ZMDA 3EJ1A 3IK3A 4BGGA 4EL9A 3UODA 4C58A 2XK6A 4RMZA 5C27A 3UPXA 3GFEA 1FGIA 4MWIA 5DRBA 4ZSJA 1UA2A 3DV3A 2IN6A 2R0IA 4DGGA 2GSFA 3KRLA 3D14A 4O22A 3EN9A 4UXQA 5AR5A 5C8NA 5HLNA 4AZVA 4GL9A 3JR1A 4B7TA 2CHLA 4AXCA 1DI9A 4YSJA 1W0XC 3EFWA 4IADA 4XP2A 3SOCA 4BYJA 3QQGA 4O7WA 4GJ2A 3DOGA 5C26A 5J9ZA 5CEMA 3OXIA 3PJCA 4NM5A 4MF0A 4AXFA 4EWHA 2W5HA 2I0HA 2XF0A 4FVQA 5IDNA 1PF8A 2IVSA 3P5KA 2YDKA 3GT8A 3O17A 4O7SA 4A4LA 3GBZA 4ZS0A 3E8NA 5BUJA 2XM9A 1XR1A 4TYHB 5GJGA 3U55A 3R30A 4KSQA 2WMXA 5B2MA 2P4IA 2WAJA 3I4BA 3HNGA 4I5CA 3RK7A 4FV7A 4EHEA 5ETCA 1W83A 5TKDA 4JLCA 2QR8A 2XYNA 4CYIA 3ITZA 2OFVA 2IVTA 5J9LA 3VBWA 4BWXA 3ZO3A 3NAYA 1HCLA 3MV5A 4LRKA 4S30A 5HEZA 4LGHA 4A9TA 2OIBA 1ST4A 4YZCA 5AR3A 5AR4A 5IEYA 4GG5A 1JQHA 3WOWA 5FTQA 2EXCX 2F2CB 1YI4A 2GFCA 4FSNA 4C8BA 3QHWA 4QMNA 5F20A 4E5AX 4QMZA 4V0GB 1M7NA 3ERKA 3KXXA 3ZRKA 3BCEA 2UVYA 2NRYA 1OKWA 3ORKA 3MA3A 5F4NA 3Q60A 3O7LB 3QTRA 3D4QA 2R3IA 2C68A 4B4LA 4DEIA 2PVYA 2I0EA 4O96A 4YC3A 3WZDA 4ZSEA 2PY3A 3R00A 4V04A 5DR2A 5KMIA 3DZQA 2DYLA 3A7JA 4IAAA 3LXPA 2YN8A 4CG9A 5H3QA 3FZRA 2ZV8A 4ERKA 4AOIA 3CEKA 3OROA 5HIEA 4OTIA 3I5NA 4J71A 3G51A 4RBLA 4QP3A 5LWMA 2WOTA 3KEXA 5CU6A 4U97A 1MQBA 3HYHA 2C4GA 1WBSA 3PLSA 4QTDA 3FMDA 5HCXA 2V62A 3E62A 3FLYA 3K3JA 4NSTA 3F7WA 4O0YA 3G33A 3KMUA 4BIDA 4GKHA 4ZTSA 4Y95A 5A6OA 3Q9XA 1RJBA 3QCQA 1XH8A 4AG8A 3I7BA 4JR3A 1BMKA 4PY1A 4ZXTA 4YZDA 1KE8A 2PVKA 5IZFA 3WF7A 1NVQA 4F9YA 2ZAZA 5FXSA 5A9UA 3U6HA 3GU6A 1KV2A 3EL8A 3C4XA 1NT2A 2G01A 4ACGA 2VTAA 4GRBA 5TOZA 5J5TA 3A60A 5E9EA 3Q9WA 4C02A 4BI2A 4G5PA 2I40A 3E5AA 3ZU7A 3ZC6A 2OZAB 2UUEA 3O51A 4IDTA 2C5XA 4M14A 5AUWA 4ENXA 4E93A 4E20A 1O6KA 1ZZLA 4OUCA 4RIWA 1WBNA 4ACHA 5M51A 2GNHA 4IZYA 3AOXA 2X0QA 4I6BA 3Q32A 1UKIA 2J5FA 5CANA 5DGZA 4AW5A 3NNVA 3G0EA 3LXKA 3PJ3A 3R8PA 3O23A 5B2KA 1I09A 4NH1A 4O6LA 4QYFA 3RNIA 1Y57A 4EHGA 1Q8ZA 4YZBA 5KO1A 1J3HA 3O0GA 5AIRA 4P90A 3ZO1A 2XEZA 2XANA 3ATSA 1CKPA 4F6UA 1OUYA 4PUZA 1ZMUA 3GC9A 2G9XA 4Y73A 3IOKA 1Q3DA 3T8OA 4EYJA 4FKLA 4L42A 5EOBA 4LRJA 4DEAA 4F0GA 4QMSA 1R1WA 4FV8A 5AP5A 5KE0A 4EH8A 5AEPA 2IO6A 3MB6A 4F9CA 5IEXA 4ALVA 1J7IA 4UN0C 2A4LA 5HVJA 3OZ6A 3FC1X 5DIAA 3PY0A 3LCTA 4BYIA 4EOPA 3PRIA 3V51A 2XH5A 3A62A 3EQBA 2OLCA 3DXNA 3EFJA 3FBVA 5CASA 3TMOA 4S32A 4NUSA 4CZTA 2B53A 1KE9A 2JLDA 3ZLYA 1XH9A 5KCVA 4H39A 4BB4A 5M08A 3VRYA 4F7SA 1XBBA 4RX8A 4TYHA 4QMVA 3L8XA 4W4WA 2NP8A 5DR6A 5HNGA 3FXWA 4FZ7A 1Q24A 3UIMA 5LCJA 4PP9A 5IQGA 4FNXA 2WD1A 4G2FA 4U9AA 2XNMA 3SQQA 1VR2A 4QMWA 4GFOA 4ENYA 4H1JA 2YM6A 5DMZA 4PDPA 3BBWA 3TZMA 4MD7E 4G5JA 4AE6A 2YFXA 3QQFA 2CN8A 4O0UA 4LMNA 4YLLA 2W5AA 4V01A 1REJA 5E92A 4EZ7A 3PP1A 2C6LA 2NNWB 3JUHA 1XH4A 2JDRA 3PJ8A 3VBXA 3FLNC 4UMRA 2EXMA 2PZPA 2BDFA 4V0GA 2EXEA 4FTKA 3ZFXA 5HGIA 5EM7A 4KA3A 1ERKA 4L43A 2C3KA 3HMNA 4I92A 3FLQA 3AC1A 4RA4A 1M7QA 3I0QA 4J53A 4U3ZA 3PDTA 4XS2A 3DTCA 4U8ZA 3MY1A 2IW9A 1J91A 4PMMA 3LQ8A 3HGKA 2C5OA 4JDJA 1HOWA 1O6LA 2AYPA 1GJOA 3CY3A 3MY0A 4KIQA 3R9HA 2X8IA 5K0KA 5K3YA 4E3CA 4F08A 4FZDB 3L8PA 2OXYA 3HEGA 3D9VA 3B8QA 3L8SA 2JAVA 3LFBA 5EW9A 4X0MA 4BDFA 3E87A 4IHPA 4F6WA 3Q6UA 2ETMA 2HY0A 3MH2A 4MD8E 4IANA 3CKWA 4EK4A 4FIEA 2B54A 2XS0A 3CP9A 2ITPA 5AP0A 2GQRA 1OKVA 3MESA 4TWNA 3D94A 4RJ7A 5DG5A 4R3PA 5I4NA 2C6DA 4XP0A 3DB6A 3F3UA 4QTEA 3PA3A 2AEGA 2C69A 2FB8A 2XKFA 4YLKA 2GNFA 1FVVA 1Z5MA 3KCKA 3WF9A 3QD4A 3F69A 4B8LA 5F1ZA 3MBLA 5JGAA 3DBCA 4Z7GA 4Z3VA 3PLAE 4XRJA 5BVDA 2Z7RA 4ONAA 5A4LA 4DHIB 4USEA 4IM3A 5IUIA 5M57A 4UMQA 3MVHA 4N4SA 3O2MA 3QRIA 4PTEA 2R3HA 3F5XA 2OO8X 2PK9A 1H25A 5L4QA 4C4HA 1J7LA 3VBYA 3HP5A 1ZOHA 3MFTA 3CXWA 2VTLA 3LFEA 4C3PA 4QPAA 2XCHA 5JFWA 2VAGA 2CKQA 3ZDUA 4FEQA 1GAGA 4FV5A 4HOKA 2OZAA 3EIDA 2QOIA 3OF0A 3SA0A 2X81A 4HVDA 3Q6WA 5DFPA 2IVVA 2YZLA 4CT1A 1ZYSA 4I21A 4AZSA 3N4VA 2VTIA 4BBFA 4RQKA 5E8YA 4IACA 1XBAA 1DS5A 2VTHA 3LCDA 3PXYA 4J96A 3VBQA 4H05A 1FINA 4L9IA 5HX8A 3HV3A 3NVKI 2WTCA 3RVGA 2GHGA 4F1MA 3F5GA 4YJVA 4GG7A 5AX3A 3DS6A 2QOFA 2X4ZA 1M2QA 3SAYA 4F65A 4C4JA 1YKRA 5AAFA 2YIYA 4UZDA 4RJ5A 1B38A 4DEEA 1OL7A 1XJDA 4OT5A 3RGFA 4FZAB 3CGFA 2W1GA 4ZTNA 4QYEA 4DEGA 4EK6A 4RJ6A 4CFVA 3SDJA 4QYGA 3LFDA 4CV8A 1P4FA 4LL5A 5EH0A 2OXXA 3TKIA 5J1VA 2V5QA 1Q97A 4IW0A 4W9WA 2RG5A 1PJKA 1YOLA 4RQVA 4BDAA 4P5QA 2BAKA 5CI6A 2BFYA 4ANLA 4G31A 3RINA 3ORZA 3W0NA 2ITZA 3EN7A 2YIWA 3MY5A 4MK0A 3W33A 3LZBA 2GNIA 3VQUA 4WUAA 3E8EA 5JRSA 4C59A 2F2UA 2UW4A 2UZBA 3ANQA 3LVPA 1JKLA 1GY3A 5T3QA 1W2DA 2W05A 3UQGA 1YDTE 4D5KA 4HGLA 2FSTX 4S34A 3RMFA 3TNWA 5LVOA 2V0DA 2UW7A 1TQMA 2PMOX 5AMNA 4FICA 5HLPA 1QPDA 1JVPP 4V05A 3COMA 4A7CA 2X8DA 5BMMA 4F9BA 5KNJA 2A0CX 4OAUC 4LUDA 4BKZA 2IZRA 3VUHA 5HTBA 3FXXA 4CCUA 3V8WA 1WZYA 4RWJA 5DPVA 2BRHA 3D2KA 5HHWA 4BI1A 3VO3A 2NPQA 4GVAA 5EG3A 3VUMA 3MFSA 3COKA 3MS9A 3R21A 4FBXA 4RWLA 4BDBA 4M0YA 1A48A 4KS8A 3W18A 5F94A 4IJ9A 4C7TA 5JQ8A 4P4CA 3VS1A 5L2SA 4QMYA 2HZNA 3BGPA 1PXNA 2XKCA 3C4EA 5FTOA 3F5PA 2C5NA 4BFMA 4UB7A 3CLYA 1XMMA 4L3JA 1U59A 5CEKA 2ZDTA 5H8BA 3DK3A 4OLIA 2RFDA 1ST0A 2BALA 3CIKA 4O83A 3E8DA 3C5UA 3E92A 2J50A 4BCKA 3PXQA 2A98A 4LV5A 3UJGA 4YTFA 3IW7A 1Y6BA 1ZLTA 2JDSA 4DITA 3ULIA 3HV6A 3E7VA 4E73A 5KBRA 5C01A 2GS2A 1IRKA 3DK7A 4JIKA 3P7BA 4ALWA 3U4WA 3U51A 1XMLA 4D4YA 4LFIA 4RFYA 5CENA 1YXXA 2R3QA 4TNBA 4I6HA 3TT0A 3CPCA 4FOCA 4BZDA 4FKOA 4U40A 4EOLA 3ZCLA 3GGFA 4Z55A 4W4VA 2CGUA 2W1HA 1JOWB 3FHRA 3C5IA 1RQQA 3VNTA 4E5BA 3QBNA 4FKJA 2OICA 4C2WA 3FKOA 2WMTA 1P4OA 4RC2A 4AAYA 3EOCA 4UYNA 4FV0A 3JXWA 2NRUA 2QHNA 3BU6A 4JRVA 2X9EA 3BI6A 4FNZA 3LHJA 3UOKA 5E8WA 1KSWA 2VGPA 4L68A 3NUAA 4JIAA 2VWZA 3TTIA 4C4FA 3ZUUA 4XV1A 4UY9A 2XKEA 1OL6A 5B7VA 1YWRA 4QP4A 1GZKA 4FTIA 2W0JA 4FKRA 5HNBA 5TF9A 3PSBA 4O7RA 4UMTA 4E4XA 5FEQA 3FSKA 4GH2A 4MF1A 3P08A 2ZM1A 5AUUA 4BDKA 4TRLA 3BU5A 3PA4A 5EYCA 2I1MA 4KBAA 2DUVA 4ZSGA 2QURA 1U4DA 2DS1A 3E93A 4IE9A 1OBGA 4I0TA 5GJFA 4IB0A 4FEUA 3GFWA 2W1EA 4D9UA 1V0OA 1FMKA 4HYIA 4LQMA 2O0UA 3AMYA 3HV5A 3EQFA 4NZWB 2WTWA 2J7TA 1Y6AA 4HYHA 4IB3A 3VS3A 3W2CA 2BRNA 4ACMA 3KN5A 3PA5A 4O0SA 4WG3A 4BDIA 5EQPA 3QD0A 3QTIA 3TEIA 4AZFA 5GZAA 1YQJA 4NL0A 1WBPA 2C6EA 4RVKA 2GNGA 3GNIB 3ALNA 3HKOA 4FTRA 2OWBA 1PXPA 5DT0A 4MBLA 3NNWA 4JXFA 4O1PA 1H27A 3FMLA 4RZWA 5EI8A 3KY2A 4C4EA 3IONA 1OGUA 3QLGA 3SW4A 4EH6A 4LL0A 5LVPA 4IIRA 4LV8A 1Q3WA 4YR8A 2OF2A 4FKUA 4MWHA 5ANJA 1IG1A 4G16A 2OJFE 4R5YA 1X8BA 2G2IA 4BDEA 3C0GA 4NJDA 1U5QA 3K54A 3RNYA 1OUKA 2VWIA 3O7LD 4LGDA 3GP0A 3TACA 2O8YA 3BHTA 4TYEA 2WGJA 3HMIA 3QFVA 1FPUA 4BCJA 3LQ3A 4E6QA 3RAHA 3HL7A 3NDMA 3QCXA 4IC8A 4ANOA 3R7IA 4BCQA 4O7VA 2WB8A 4U5JA 3A4PA 4JDKA 1U46A 4D1ZA 4F0FA 3FHIA 4CLJA 1YDRE 5CSWA 2EVAA 5L3AA 1IA8A 2P3GX 2R3LA 3OFMA 5JGBA 5IA3A 2OFUA 4OT6A 2QKRA 3UMWA 1DAYA 3CSVA 2A27A 3MSSA 4FKTA 4QO9A 4CGAA 2ZM4A 2F7EE 3TDVA 3CBLA 1SZMA 3K5VA 4F99A 4FX3A 1TZDA 3W10A 3LXNA 4M12A 4CQGA 5HIDA 3U8WA 3DNDA 4DFNA 3EN4A 3JPVA 3K5UA 3MJ1A 2UW0A 4IZ7A 4L8MA 3VUDA 3IW8A 5CLPA 4FUYA 5CVHA 3ZMMA 1REKA 4EOKA 4AXAA 1UWHA 4A4OA 3W2OA 2B4SB 1H1QA 3PWYA 2HYYA 1BL7A 4YLJA 4E6DA 3JY0A 4I94A 4C4IA 3FZOA 3R22A 5CF6A 1L8TA 4U80A 4UWCA 3CE3A 2PVNA 4L3PA 3IKAA 5AX9A 1V1KA 3BBTB 2VNYA 5CEIA 3WILA 3OBGA 4G3FA 5T68A 3B2WA 3QRUA 4PF4A 4RX5A 3W8QA 2I6LA 3RZBA 3RK9A 3NGAA 2YM8A 3N4TA 4EYMA 2YZAA 2PVMA 4IDVA 4FTCA 4JAIA 5AR7A 2W17A 3HDMA 3R1SA 4G9CA 4D1SA 4O0RA 3V04A 1WVXA 4F6SA 4LI5A 2UV2A 4AQCA 3BIZA 2JFLA 5KZ0A 3NUYA 4QP1A 2ITTA 2GFSA 2QO7A 3F9NA 4WKQA 3E3PA 3Q5ZA 4QNYA 5AM6A 3VF8A 5A6NA 4RJ3A 4YHJA 3MH3A 2YIRA 2YAKA 4J52A 3MGYA 4CSVA 5I9UA 4EH7A 3Q4CA 2GS6A 1VEBA 4U45A 1OPKA 3RAIA 3QZFA 5HKMA 2ZV7A 3BX5A 4OAVB 4RZVA 3COIA 4AGUA 4CNHA 3MVMA 5EQEA 5HG7A 3CTHA 4ZLYA 1OIUA 2WQBA 1K9AA 2ITQA 2WKMA 1XH7A 3LPBA 4OR5A 4ZS4A 4A9RA 3R9NA 2J0KA 1PXIA 2CNVA 3KULB 3E7OA 4I3ZA 4DLJA 4QYYA 4CKJA 5ETIA 1W8CA 4DN5A 2X6EA 3WE4A 3KB7A 2QLQA 3UNJA 4OGRA 4X21A 2B9IA 1Q61A 4FG8A 3S95A 4NWMA 3PVGA 4FGRA 2E9NA 3FI3A 2BHHA 4JG6A 4UV0A 2CCHA 2W96B 2C6IA 4R78A 4O91A 2JBOA 2Y6MA 4FT0A 3UYSA 4F64A 3EH9A 4PNKA 2F49A 3C0IA 5CU0A 3DXPA 4O27B 2CNQA 3E64A 4YO6A 4HVSA 4PP7A 2BCJA 3QYWA 3W0SA 1W2CA 3QRKA 1YHWA 4AGDA 5CEPA 3OWJA 4NM0A 4BVUA 2GQSA 3PPKA 1Z9XA 3DT1A 4O0VA 1DM2A 2JKOA 3DNEA 3WARA 5KMLA 5L2TA 1XWSA 4XJ0A 3ZEPA 5GZ8A 2A19B 3ETAA 4HCTA 5I9YA 4AXEA 3GCPA 3EYHA 4IX4A 3ZO2A 3GQLA 5IH6A 1R0PA 1KE5A 1OIQA 3ORTA 3C0HA 4RFMA 4ZTQA 4RIYB 4DLIA 3PPZA 4X6QC 3EQCA 1RW8A 3ODYX 4MXZA 3NX8A 5GHVA 3MN3A 4G9RA 3LM0A 3UGCA 5LMBA 1F5QA 1FQ1B 2OIQA 3I5ZA 4EH9A 4JS8A 2PMLX 2E9PA 2WMSA 3ZUVA 3ROYA 1L3RE 4WNOA 4HGEA 4YBJA 3GENA 3GXLA 3LKMA 3H9OA 1MRYA 2YACA 3VBTA 4FEWA 4PPCA 4R1YA 3F2AA 2BKKA 5CVFA 4G6OA 4X2FA 3BL9A 2XP2A 5JH6A 3WE8A 3FQSA 4XX9A 4MX9A 3VONA 4CG8A 4RT7A 1Q99A 2O3PA 2HXLA 3TNHA 5L2QA 4C57A 4RLLA 4GVJA 3FUPA 4FV4A 4NEUA 3LAUA 5FG8A 3LE6A 4GUBA 4KS7A 4BC6A 4HVGA 4AACA 1IA9A 3PZEA 4JG8A 3PSDA 3NIZA 3G5DA 4XOYA 3DBFA 3GC8A 5FP6A 4D2RA 5CEOA 5AV1A 3QUEA 4I0SA 4KBKA 3V5WA 3IG7A 5G1XA 2YIQA 5HG9A 4MXCA 3ZYAA 3FI2A 4O4CA 4CEGA 3QTXA 4C37A 4BDHA 4U42A 4TW9A 3RM6A 4USDA 5G6VA 1CKIA 4NKSA 4PDSA 2PVFA 3BGQA 3W0RA 2XBAA 4PRJA 1R39A 4AW1A 3FKNA 2VWVA 5AFVA 3NCZA 2PSQA 4ASXA 4NYEA 5D7AA 3GOKA 5ANOA 3V3VA 4R7IA 3G0FA 1U5RA 4O0WA 4RSSA 4YJSA 3RI1A 2IZTA 3BHVA 2Y4IC 2W9FB 3BELA 2VWBA 5AP2A 4IX5A 4ZMFA 3DJ7A 3AGLA 5KBQA 3LIJA 3BPRA 2GHMA 3NUUA 1JAMA 2R3JA 4CRSA 4S33A 2XBJA 3UIUA 3W2PA 3IW6A 3A99A 5HQ0A 2IG7A 4PDYA 4EQCA 4QTAA 4CVAA 5TE0A 3DGKA 3QGWA 4LOPA 4S31A 1Q4LA 2QOOA 5HCYA 4TYGA 2ZV9A 3CTQA 3TKUA 4MBIA 4AFEA 3LM5A 4J8MA 2JIUA 2QU6A 5E8XA 3AC3A 2WELA 1TQPA 3HV4A 3M1SA 1ZOGA 3FKLA 3SVVA 1UNGA 3BWFA 2BIYA 5B2LA 1B6CB 5H2UA 2OXDA 3G90X 4HGSA 1A06A 3QALE 3R2YA 3CQUA 5HO7A 5IH4A 2XK3A 2WEIA 3Q4TA 5IISA 3FJQE 3EZRA 4FTLA 5LMKA 5M4CA 3R2BA 1G8JA 2RF9A 4OTQA 2VTNA 3KULA 1K3AA 3PE2A 4I6QA 4EUTA 2R7BA 2Y4IB 4YPSA 5IQEA 3LFNA 1W82A 3ORMA 4D58A 4NCTC 5BYYA 3WF8A 2WTKC 4L00A 5HE1A 4C61A 3D5VA 2PUPA 1NVRA 2BDJA 2IF8A 1WBVA 3NMUF 4RWKA 3CCNA 4KKHA 2XVDA 3RAWA 3TG1A 3UG2A 5EOLA 3MDYA 3UC3A 2VTPA 3ENMA 3MIAA 4KNBA 4YJRA 4L53A 3WBLA 1YXSA 1OZ1A 4QTCA 4X2JA 5DHJA 3HUCA 5IQIA 4Q5EA 5CXHA 2C3IB 3C4FA 1VYWA 5CWZA 2X7OA 2YM4A 3AXWA 3TNIA 3H0ZA 4ITHA 3P86A 4YTHA 5I0BA 2IWIA 3FYJX 4JBOA 4Q5HA 2YCQA 3QQJA 1R3CA 4ZLOA 4FV3A 3FZ1A 3KRJA 2G15A 2O63A 3EZVA 1E9HA 4OTRA 3LFCA 3MJ2A 1YRPA 2XJ1A 1E1VA 2CMWA 1LR4A 1AD5A 1YWVA 4QP2A 3OTVA 3AT2A 1XH6A 1V0PA 4RIYA 4I6FA 3AQVA 2J51A 4FT5A 3BYUA 4JMQA 4DG3E 5LMAA 4M15A 4PMTA 3U54A 5CS6A 5AM7A 1UNHA 2GTMA 3KXGA 4W4XA 5AV0A 3QGYA 2WTKB 1ZYLA 3ZHPC 4QOXA 4PV0A 5JZJA 5AA8A 3TL8A 3DDPA 3JS2A 5DBXA 2XJ0A 3KXZA 5AJQA 3KQ7A 3DLSA 3UDTA 2HWPA 2PYWA 3QCSA 5IQDA 3EWHA 3L9PA 1H28A 2GCDA 4AX8A 2W1ZA 3VN9A 2LAVA 4E26A 2BZIB 3OBJA 4PPBA 2VTQA 4AT3A 3GOPA 3KK8A 2HOGA 2Y8OA 4IMYA 1XBCA 4DGMA 4ACDA 5JEBA 5H9BA 3UO6A 4ZZOA 4FIJA 2PMIA 3EYGA 4UMUA 4XOZA 4B99A 4EORA 4MEDA 4HVIA 2OJJA 4M97A 2BTSA 4XRLA 5E8UA 1URCA 3B2TA 5L6PA 3R8VA 2KTYA 1TVOA 2QD9A 3JVRA 3FI4A 3PXRA 4I20A 5K4IA 2OIDA 5FQDC 3MPAA 4FTAA 3IW4A 1OB3A 5IKWA 2W4JA 3BWJA 3FMMA 3VVHA 2CKOA 2CGXA 2J2IB 4R8QA 4DDGA 3AKJA 4WNKA 4KINA 4XBUA 5K0XA 1SNXA 1VZOA 3PPJA 4GUEA 1PYXA 4NIFB 3ELJA 4AZTA 2OI4X 3Q53A 3OG7A 5CALA 4YHTA 5C8KA 4NJ3A 5JK3A 4DT9A 4RJ4A 1P5EA 2XARA 4GT5A 3UOHA 3I81A 1AGWA 4LRMA 4EUUA 5I9WA 3PSCA 3ATTA 4L6QA 3VS5A 3Q2MA 1WFCA 2FSMX 1OI9A 4OTGA 3KN6A 4XG8A 2C1BA 4PQNA 3HP2A 3EKNA 3FMEA 3FQHA 3FXZA 4BCPA 2PMNX 3AKKA 3OEZA 1GNGA 3NSZA 1ZY5A 2RFNA 3ZZEA 3NYXA 4YC6A 3CY2A 2OK1A 3ZLWA 5M44A 4BWKA 3LFAA 4FT9A 4YTCA 3ZS5A 2P33A 4TTHB 2BZHB 4R7BA 4Y85A 5D12A 1M2RA 1Q8YA 2VWYA 3H0YA 5T6KA 5TO8A 4IJPA 5FBOA 5GIOE 3FAAA 2QR7A 3AGMA 2B9FA 3EQGA 4BWPA 4B8MA 5IDPA 4JQEA 3Q9ZA 2W1IA 3F61A 2ZYBA 3NNXA 4D28A 3ML1A 5CAOA 3FL5A 4K77A 2ETKA 5FLFA 4I4EA 5FWKK 4GKIA 4A07A 2R64A 2WQEA 3LQ5A 2R3PA 4FC0A 4ZJIA 4D4SA 2PE1A 4BIBA 3VW8A 2HCKA 4ANSA 2YERA 3SXFA 4LV7A 4WA9A 2I7QA 3ORNA 2GPHA 3QKLA 5DE2A 1FOTA 2OG8A 3ZRLA 5KKRC 4BJJB 1LPUA 2R3KA 2CDZA 2F57A 3KFAA 3RALA 4MHAA 3DA6A 3RJCA 5AA9A 2PVRA 3SOAA 1OL5A 3MW1A 3ZH8A 4XG2A 4D2TA 4W8DA 3KGAA 4YZNA 4UZHA 3NNUA 3R7YA 3NYOA 3UP2A 3OY3A 3QCYA 1NXKA 4NU1A 3I6UA 4EK8A 3VS0A 4W9XA 3R7VA 4QMQA 2B1PA 4RVTA 3PJ2A 4FKQA 2I0YA 3LFSA