1XH5A

Crystal structures of protein kinase b selective inhibitors in complex with protein kinase a and mutants
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Design and crystal structures of protein kinase B-selective inhibitors in complex with protein kinase A and mutants
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 111
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xh5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xh5A02
3OT3A 5J87A 5BUEA 3OVVA 2XYUA 2X7GA 2X6EA 4BKJA 2VO6A 3TIZA 4I41A 4ZY6A 2X7FA 1YI6A 5CSXA 5M07A 2G2IA 4ANQA 4K18A 4IE9A 4Q5HA 5CU4A 3VNTA 3OEZA 4UMPA 3EN9A 3VHKA 3P9JA 2XF0A 3NGAA 4C8BA 4UX9A 2JBPA 2IW9A 3E64A 4ACHA 2OZAA 5HTIA 5AR2A 2BMCA 1SMHA 3UE4A 4I24A 3ZLWA 1JSTA 3GU4A 4YHJA 2JAMA 3F7WA 4D4SA 2NRUA 3R02A 3VAPA 3SOCA 3UVRA 4AUAA 4FODA 2DWBA 4FSWA 3IG7A 4FT0A 3RPRA 4AGWA 3FI2A 2IZTA 5IQIA 3HMMA 3FMNA 3R2YA 4XYFA 4DLIA 4FKIA 4QD6A 1Q61A 2B4SB 5E8WA 3DBEA 2CLXA 1GIHA 2BDFA 3ORMA 4NM5A 4XG9A 2YFXA 3S3IA 5HE1A 4A4XA 2W5AA 3JXWA 3LQ8A 5JKGA 4FIGA 3N4UA 2R3PA 3ZLYA 3LJ2A 4BWPA 2RKUA 4R8QA 2BIYA 1YI3A 2UW0A 3LFFA 3PWYA 4E7WA 4ENXA 5GJGA 5CNNA 1R3CA 5EQYA 2HENA 3PIXA 4Z7GA 4UWYA 2G15A 2YM6A 4L9IA 3TJDA 4B4LA 4IZ7A 1JKKA 4EK4A 2BR1A 2WMRA 5JFWA 4PPBA 2C1AA 4X0MA 5CAVA 4CCUA 3SD0A 2HK5A 4GFGA 3UOLA 1KSWA 5CENA 5DBXA 4HYUA 3KY2A 3MY5A 2HW7A 4CFMA 5BQ0A 4RIWB 3QQGA 5DRDA 4CSVA 1M17A 4CVAA 2BKZA 1WBOA 4I92A 3F2AA 3HUBA 3FDNA 4FUXA 4GIIA 1TQPA 5HX8A 2XK4A 4XG7A 5HCZA 5EM8A 2Z2WA 4NL0A 5LWNA 1ZWSA 2CGVA 3O71A 5HZNA 4D28A 3PXYA 5GIOE 5HLWA 4AA0A 4BDGA 4O7SA 4DFBA 3ACJA 4BZNA 3FI8A 4MXAA 4EJ7A 4L52A 4E4XA 4BCOA 5L2SA 3PYYA 1J1BA 3UO4A 5M4IA 1R78A 2YM4A 3F69A 2PVMA 3GC0A 3VBQA 5LVMA 3U6HA 4ZS4A 1KE8A 2CSNA 4QMQA 4AW2A 5EW8A 2XUUA 3QZHA 4O7NA 2X6DA 4RLLA 4RBLA 4E1ZA 3VBXA 3LFEA 5KX8A 5HIDA 4C59A 4HGTA 1UV5A 5C8KA 4HVDA 5AMNA 5AP2A 4ITIA 3AC4A 4FL3A 3W2QA 3PWDA 4C34A 4DEAA 3UOJA 3VUMA 3ZEPA 4R78A 4QYGA 2QODA 1Q97A 2V5QA 4C35A 4USEA 4IDVA 2XRWA 4BVUA 4O82A 2WQEA 5IU2A 1MQ4A 2E9NA 2V55A 3C4WA 3VRYA 4ERWA 5I3OA 5AAEA 5KO1A 2PPQA 4CFNA 4YJUA 2CCIA 3FZOA 5HO7A 5IA1A 4BCHA 3PY1A 5DT3A 5HG9A 3F2RA 4AZFA 4LQMA 2OIQA 4FGBA 5TOZA 4RFYA 5KBQA 1YWVA 3A8WA 3OP5A 4AE6A 2CHLA 2WFYA 2YACA 4GRBA 3VS7A 4FOBA 3V8TA 2UZBA 3MWUA 3PUPA 4KSQA 1REKA 1M14A 3CLYA 4FSYA 5IA4A 3FMMA 2BALA 4FK6A 4L7SA 3EFWA 4XP3A 5HBHA 4EBWA 3BPRA 2W4KA 3MN3A 1V0PA 2R3JA 4E93A 3NNVA 3ULZA 5FP5A 5AP0A 3AC8A 3RHXA 5A4LA 2QI8A 4IW0A 4X2FA 3LFAA 4FSTA 2PYWA 1CDKA 5ETAA 4CYIA 3DCVA 4EKLA 3VJNA 1SVGA 2GMXA 3RAHA 2QOIA 2BZKB 4IANA 4PDSA 3AXWA 2PZ5A 2C3LA 3BHHA 3IK3A 3W2OA 1BYGA 4LV5A 1ZRZA 4A06A 5AP5A 3JVSA 4X3JA 1T46A 3DBDA 3FQHA 3G5DA 4IDTA 2OW3A 5ETCA 2P4IA 2JEDA 5BVOA 1PHKA 4QP6A 3EN6A 3ZMMA 3QKKA 1W0XC 2WU6A 2XNNA 4X3FC 5AR3A 5IISA 3W2SA 4L46A 4DFUA 1BKXA 2J6MA 3F3UA 3FXWA 5CXHA 5F95A 2QHNA 2W4JA 4IZYA 4U42A 5HLPA 4DINA 3HMNA 4C2WA 4YMJA 2X9FA 3QQLA 4WNPA 1HOWA 3HAVA 1H0VA 3JY0A 4TTHB 5AX3A 2VNWA 2J0JA 3R00A 4EC9A 4MYGA 3BWJA 4QQ5A 4IVDA 3BWFA 3V5LA 1M7NA 3MA3A 4M15A 4F6SA 2JGZA 5JZJA 3P5KA 5EHLA 1W98A 4PL5A 4DAWA 4ZSAA 5IQCA 3HDMA 3LCDA 2JFLA 1I09A 4EOJA 4F6UA 2O64A 3Q9YA 5K4JA 3A2CA 3AD6A 1PXLA 2GU8A 4M0ZA 4IQ6A 3FLSA 1Q3WA 2JITA 2QU6A 3M42A 3MIAA 5DNRA 4HGEA 4O81A 4TN6A 3CTHA 5KBRA 1NY3A 4KKHA 5JN2A 1BX6A 4L3LA 3LHJA 3GENA 4W4YA 4BTKA 3L9NA 4PMTA 4RGJA 4E5WA 3KXHA 3N4VA 4G5JA 3BIZA 2OK1A 4KSPA 2CKEA 4H3BA 5CEIA 4E8AA 5LOHA 3COIA 3ORTA 4JBPA 3FZRA 3ODYX 5IA5A 3DAEA 2F4JA 5C4LA 5EK7A 3H30A 1YXVA 5TO8A 4CGAA 3OTVA 4JX7A 4B6LA 1FVRA 1UU3A 4BDFA 1YDTE 2A19B 5JQ8A 4K33A 3VBWA 3W2CA 2WMUA 4I21A 3OOMA 4E5BA 3SDJA 5LQFA 2JD5A 3FYKX 3DBFA 4D4RA 4CKRA 3BLRA 1P4OA 1W84A 2G2FA 3FMKA 2CN8A 4KD1A 2HZNA 4A9TA 4BF2A 5IA0A 4EOOA 3ZC6A 4L42A 2FB8A 1CM8A 2XMYA 2ZV9A 3BV3A 4FSZA 4IIRA 5LCJA 4AAAA 2X9EA 3R01A 3OMVA 3W10A 4AW0A 3MFSA 5AP1A 1WBTA 3L1SA 5J9LA 3DJ5A 2XZSA 3MW1A 5FWKK 4ZMEA 3LM0A 3CTQA 3HP5A 4EHEA 1ZZLA 2XNEA 3GU8A 4MHAA 3LXKA 4A4LA 5HE3A 2VWYA 1OITA 2WPAA 3EN4A 3LVPA 4KBAA 4PUZA 4Q2AA 4PL4A 5L8JA 2IPXA 2Y9QA 4BRXA 5ACKA 4X3FA 3O0GA 3RAWA 4QMMA 4XBUA 2JLDA 2JKQA 3VULA 3WIKA 5A54A 3ZXTA 4EOMA 3GNIB 5IEYA 3OW4A 3O23A 2BTSA 2QR8A 2ZDUA 4IB3A 1YWRA 2V7AA 3R9DA 4EWHA 2WAJA 3QAME 5H2UA 2XCHA 3V3VA 2PWLA 3LLTA 3QYWA 3U51A 3BI6A 4ZZNA 4G1WA 2I0HA 3G15A 1YHSA 4NFNA 2ITTA 4IVBA 4JQ7A 1Q4LA 3PIZA 3JYAA 3NUXA 4KNBA 4W8EA 5TT7A 5IUIA 3NAYA 4FG8A 4QMZA 5I9WA 2Y0AA 3ZSHA 2YAKA 4OBPA 4BC6A 4JIAA 2ITWA 4WKQA 2GNFA 1FINA 2NP8A 5EM7A 3QLFA 1PF8A 4FT7A 4EOQA 4UXLA 2PZPA 2BHHA 4FTRA 4D2PA 3PSDA 3KVWA 5DHJA 4JI9A 3E93A 3R8ZA 1PXIA 3L9MA 3QD0A 4BCQA 3OCSA 2J90A 4ZS0A 4QMTA 4YU2A 4ACMA 3NIEA 5EFQA 3L8PA 3I60A 1Y57A 3MGYA 3TNIA 1WVWA 3CKWA 1OUKA 5TF9A 4GU6A 1XJDA 3QTIA 4DC2A 4HYIA 4O7YA 3WZUA 3EQIA 4FV5A 5CI7A 4XEYA 5EYKA 3KRLA 4U81A 4LMUA 4EHVA 4EL9A 2UVYA 3CGFA 2Y4IC 2ERKA 2E9UA 1BL7A 3FL5A 1Y6BA 1P2AA 4CQEA 1E9HA 3C4EA 1YI4A 5IUHA 3OUKA 2IVVA 4NU1A 5EHOA 1PXOA 1VR2A 2C0OA 2CPKE 3R1YA 4LRJA 4F65A 1OBDA 3UMXA 2J9MA 3B8QA 5E91A 3SW4A 3NWWA 4OTGA 4Y83A 5F20A 4BKYA 2UV2A 5M57A 4IWPA 2ZOQA 3QZGA 4K11A 5FTQA 4D1XA 2NPQA 4HPTE 4YBKA 3TJCA 4O7WA 5IZFA 3ITZA 4FKWA 4I5MA 3S1HA 4O7TA 5DEYA 1CSNA 2OZAB 3GQIA 2VO7A 2FO0A 1LP4A 3TV6A 4D2VA 3PA5A 1U4DA 3AT4A 2EXEA 3PLSA 4XS2A 5FRIA 2AC5A 3VS2A 4DITA 3IS5A 5HBEA 2H34A 4FICA 3VN9A 4KA3A 4WD5A 5C1QB 4FNXA 1FBNA 1M7QA 5EM5A 4H05A 4Y73A 4BICA 4IAIA 2KULA 5ANEA 3PPKA 4BCIA 2GPHA 4FT9A 4YHFA 3DB6A 4DEGA 4M69A 3D94A 2BUJA 2OIDA 3L8XA 3CP9A 3A4OX 4UMTA 3PA3A 4TYHA 5HBJA 4IX3A 5DH3A 3BV2A 2I40A 2J7TA 1JKTA 3NUAA 3IQ7A 5A4EA 2OG8A 3Q6WA 3QF9A 4FBXA 2OICA 2C6KA 2HWPA 2QCSA 3II5A 4GH2A 3D9VA 5E8XA 4O2PA 3GXLA 3L9LA 2FSTX 3MB7A 3PRIA 1R39A 4I6FA 4II5A 4ZMFA 3NNWA 4WHZA 1E1VA 4FMQA 2XEZA 4R6VA 3BU5A 4CTBA 4FSMA 4KRCA 4QYHA 3LPBA 4MXXA 2GS2A 3V8SA 3EB0A 4CKJA 2WTDA 5IQAA 5H8BA 3R2BA 5D7AA 4QPMA 4Q9ZA 1ND4A 3R9RA 3QA8A 4Y72A 4DGNA 4QMOA 4IM2A 5HCYA 4G3GA 3VW6A 4UB7A 3NCGA 4PTCA 3LMHA 2Y6MA 2XIYA 3FJQE 4W9XA 2YM8A 4TXCA 1V0BA 5GHVA 2GQSA 4XP0A 3FEGA 2PY3A 1JNKA 4F1OA 3H9RA 4U0IA 3ULIA 1VEBA 2WU7A 2XNOA 3VUHA 4BBMA 4L43A 4TNBA 5AUWA 3M11A 3RKBA 4FYOA 4O0XA 3NAXA 4DG2E 1H8FA 3ZRMA 4O6LA 4KIPA 4BDEA 3UOKA 1QPDA 4MXZA 2QU5A 2ITOA 3WF6A 4NM7A 4NWMA 3EL7A 3GGFA 2ACXA 5HEZA 4Q9SA 5A4CA 3HVCA 5C8MA 4ZJVA 1ZOGA 5AUUA 4RIWA 5JMSA 4YTIA 3O17A 2QO2A 3QC9A 4KS7A 3U6JA 3HZTA 4I6HA 5BVFA 4EEVA 2HAKA 3V5TA 4PNKA 2E2BA 2J5FA 3QTZA 4H36A 4JX3A 1PY5A 3KXXA 1M2QA 3LOKA 3QTWA 3MESA 4FEXA 5H9BA 4DA5A 2GTNA 2J51A 3TM0A 3RCJA 3MFTA 5CSPA 2GNGA 3BZ3A 2Z7RA 4E5AX 3UYTA 4GSBA 4HPUE 1V1KA 3AC3A 4DYMA 1U54A 2QOKA 1O6KA 3BYOA 4BIBA 4C0TA 5EH0A 5M44A 3C51A 3LLAA 3FI4A 4YLLA 4QTCA 4TPTA 2W1GA 3A4PA 4DE4A 3LAUA 4YC8A 3QC4A 4IAKA 2QG7A 3R8MA 4BDBA 1Q99A 3Q96A 1O9UA 3CR0A 3BYVA 4XJ0A 3SQQA 4ANMA 4HVGA 3KK8A 4OT5A 1URWA 1SVEA 3ANQA 3R7GA 4K9YA 3ZBFA 2WTKC 3COMA 5FP6A 2Z7QA 3P79A 3GB2A 4QTEA 3Q52A 4JRVA 4DTKA 4IAFA 1Y6AA 4BCMA 4FTMA 5KKRC 4ANNA 2YCRA 4L01A 4DH3A 4O27B 2HY0A 3A7IA 2P2HA 5AR4A 3VIDA 3PTGA 3MB6A 2IO6A 3CCNA 3CQWA 4FEVA 1OL1A 2UZDA 3W55A 3RPSA 3UGCA 2GHLA 1NVSA 2UZTA 3U4WA 4HYHA 2WTJA 3ZCLA 2PSQA 2PHKA 2C5YA 3MSSA 3AC2A 5CVHA 1H01A 2BROA 3R7YA 5G1XA 5HIBA 3EWHA 2OJJA 2F7EE 4O7LA 1KE6A 4QQJA 4QNYA 3EIDA 2F7ZE 4JNWA 4G9CA 4W4VA 4D2WA 4C4GA 3UC4A 3PVBA 3VVHA 3SW7A 4QMVA 3NEWA 4WG3A 4G6LA 3EL8A 2R3IA 3F2NA 5J95A 2F57A 4WO5A 4GK2A 3NMUF 4OTPA 3F3TA 3C0HA 3GU5A 1WBPA 4EH4A 4JQEA 4E3CA 1QPEA 5KE0A 2X1NA 2LAVA 1GZNA 2EB2A 3EFJA 3IPHA 4WT6A 5CZIA 5HO8A 3QYZA 1H1WA 3L8SA 4QMLA 4O96A 3RAIA 1FOTA 2B9FA 3QA0A 4L68A 4EWQA 4CV9A 2VTRA 3P7BA 4K8AA 4MVFA 3P1AA 4BDCA 4XLVA 2X7OA 3E3BX 4O86A 1XBBA 4YC6A 1W82A 4YJVA 4IAZA 4O1PA 5IQDA 5JFXA 3BGZA 3ZO3A 5ITAA 2EU9A 2Y8OA 3I5NA 3ODZX 2XJ1A 2DUVA 4YJPA 3PXKA 4RIYA 4Y5HA 1ZY4A 2XM9A 4HGLA 5L6PA 4Z55A 4G31A 3GCVA 1A48A 4GUBA 3OWPA 3QTXA 2ITNA 3OXTA 3ORKA 5AJQA 2B55A 3EYHA 3F66A 3I6WA 3PG1A 3UG1A 5HLNA 3TTJA 4RWLA 4EZ5A 2B9JA 3UZTA 3HRFA 4FV2A 4RJ4A 3R7IA 3GOPA 4J8NA 4OTWA 4S33A 2BDWA 5M56A 3V01A 3UPZA 1UU7A 2R0IA 2XK9A 3DPKA 4X3FB 5D11A 5DVRA 2B1PA 3VS1A 2JIUA 1R0EA 3R7OA 3O50A 4BIDA 1H08A 4FTJA 4O7ZA 2IG7A 5CU3A 4ACGA 4ALVA 3UBDA 5CSVA 2YM7A 3NYVA 3PJ1A 4NM0A 1ERKA 2QONA 3OXZA 3NNXA 4MX9A 1BMKA 5EI6A 3E8CA 4NCTC 2QHMA 3EQPA 3IW7A 1DM2A 4X7QA 2W1DA 2NRYA 3ELJA 5AR5A 3FQSA 3OUNB 1S9IA 3D2IA 4C4HA 5FXRA 1ZMVA 3F5XA 5KMOA 5ICPA 4EK6A 3DXNA 5HQ0A 5C01A 2PVJA 4ZSGA 2ZYBA 1Q41A 4L53A 1S9JA 4ID7A 1MUOA 1PYXA 4GW8A 4J7BA 4CTCA 2UVZA 4HZSA 2E9OA 4LOQA 4MH7A 3GEQA 3A8XA 3CS9A 3MFRA 4O0WA 3AD5A 4C61A 3OF0A 2XEYA 4EBVA 3ZTXA 3ZH8A 1OPJA 5C26A 3H0YA 4IWDA 4QQCA 4C36A 1YQJA 3VC4A 1W7HA 5JGDA 5E92A 2EXMA 2PVHA 3AOXA 2ZM1A 2B9HA 2OSCA 4FZAB 4GIHA 2B53A 4PL3A 4QMYA 3SHEA 4UYNA 3EZRA 1OPKA 4DGLC 5DIAA 2OBJA 2R3GA 4J98A 5L2TA 1K2PA 4TL0A 1FMKA 3KB7A 4I3ZA 3V8WA 1MQBA 4ZTSA 1XO2B 4AGDA 1AGWA 3C50A 1ZYLA 3FKLA 3GQLA 5CEPA 3GUBA 1UWJA 4O38A 4M8TA 2CNUA 2PZYA 2UW6A 3PZEA 5AWMA 5A6NA 3FBVA 3QXPA 2W06A 4PP9A 4I5CA 2H6DA 2ZAZA 3Q4TA 4YGAA 3Q60A 2XK8A 4DTAA 3NUYA 4RA5A 1XBAA 5AIRA 4NW5A 3UNZA 3UP7A 2W1ZA 4WG5A 4F0FA 4BY9E 4YJQA 3NRMA 5AR7A 3TEIA 3OCGA 3A7GA 1LUFA 3DNEA 4R7IA 3MPMA 3F7ZA 2WMVA 4AE9A 2R3QA 2R4BA 3H0ZA 4RJ8A 4A9RA 3R63A 4A9SA 4MBIA 1I44A 4QMSA 2WGJA 4AN3A 3NNUA 5I9YA 3NUUA 5DRBA 1YXSA 2FVDA 3C5IA 4J99A 4WRSA 4ZJIA 3LXNA 3R9HA 3PP0A 5EDPA 4NTTA 4QP1A 4FIHA 4RJ7A 4M69B 2Z60A 4O0SA 4YJTA 1J7IA 2QO9A 3ATSA 4H3PA 4TYHB 5FEEA 3F88A 3KL8A 4L45A 4D0XA 4CV8A 3AMAA 1RQQA 3I7CA 5A6OA 2W1HA 5AUYA 2XKFA 4C4IA 4I94A 5KZIA 3TNQB 2PL0A 4P2KA 3VUDA 4AW1A 2GQRA 2XM8A 3NW5A 3UIXA 4HNFA 1WVXA 3GC8A 2C0IA 4IBMA 5BX0A 5B0XA 1OGUA 2XK3A 1DAWA 3O2MA 4OTRA 3DXPA 2PUPA 2BFYA 4PDYA 5M08A 2FYSA 4HVSA 3ZZEA 3K5UA 5J79A 2PMNX 5CEQA 4BDDA 3IDBA 4IXPA 5IH4A 4XOZA 3HV5A 2ZB1A 3E87A 5HD7A 4GJ3A 4QYYA 2C6IA 3VS4A 3OC1A 4QO9A 1KE9A 4K77A 3ZRLA 3DDQA 3IGGA 4O0YA 4R7BA 3DKGA 1IR3A 3QHWA 4QTBA 5BVNA 4W4XA 4BYJA 4AQCA 5FTOA 2PVRA 2XNMA 4IADA 2AUHA 2BKKA 3NVMB 4O22A 3PFQA 3T3VA 5KMIA 3CGOA 3ORLA 3SV0A 3TXOA 2Y4IB 2YM5A 1Q5KA 3LIJA 4FV7A 4M13A 4EI4A 5CF6A 4AX8A 1KUTA 4EH2A 2EWAA 3B2TA 3H4JA 4BCFA 3Q4UA 4NT4A 3LCKA 5TE0A 2ZM4A 3A7HA 4JDKA 2GNLA 2X0GA 1JVPP 3AQVA 5H3QA 5E90A 4JRNA 3KCFA 2JKKA 5CVFA 4DH8A 3QRIA 4P4CA 4W8DA 1UKHA 4J52A 4CZTA 4ZEGA 3I7BA 1HCKA 3OBGA 5A4QA 3CPBA 3ETAA 5AV4A 3T9TA 4JOAA 1UU8A 3ERKA 3TACA 4J71A 3FSKA 4KKGA 5E1SA 4E26A 1JBPE 4JBOA 2OXYA 5CU0A 5IH6A 4FNYA 2PULA 2X8EA 1GJOA 3R21A 5CZHA 4YBJA 5FM2A 4IX6A 3VHEA 4DGMA 1REJA 3SXSA 1H0WA 5EM6A 5LVLA 3U9NA 1CKIA 2QQ7A 4NJDA 2WXVA 1T45A 4GYIA 1PKDA 1Z57A 3FLZA 4HGSA 3Q5IA 3I5ZA 3EJ1A 2OF4A 3H9FA 3IECA 4G6OA 4I23A 5E8YA 5CT0A 4BI2A 4JBVA 1U54B 3QWJA 5HGIA 4N70A 3U87A 5HD4A 4WSYA 4I5HA 5LVNA 1ZAOA 2YHVA 4DG0E 1PMVA 2DS1A 2X2MA 4FUYA 4PNIA 1JSVA 4E6QA 3I0OA 1F5QA 4Z7HA 2YIQA 5ANIA 5HVYA 4MWIA 5KMKA 3LFSA 3HEGA 2XIZA 2PMLX 3BX5A 4WG4A 3G51A 2OFVA 4V01A 2VTQA 4CMUA 4D2RA 1YVJA 3DAKA 1OM1A 3O7LB 5K0XA 4KABA 5CQWA 4D55A 2VZ6A 1A06A 5C8NA 2UW5A 2O5KA 1BLXA 4FVRA 1WBWA 1XR1A 1O6YA 3L9PA 4X2NA 4ANSA 5J9YA 4ANOA 3ZUVA 2I0VA 4OAUC 4GKIA 3BU6A 3QTRA 2R9SA 2C47A 4FL2A 4TYGA 4DBNA 4YJSA 4F0GA 1DI9A 4IHPA 5FDXA 3FYJX 3F6XA 3LXLA 4JLCA 4CMTA 5IA3A 3UO5A 3LJ0A 4NJ3A 3DQWA 5EYDA 4K0YA 5HICA 3IW8A 3V6SA 4O91A 4RQKA 2VWZA 4IZ5A 1EH4A 5F9EA 3NUSA 3CQUA 3WZJA 5AA9A 4QP9A 4UYAA 4H58A 4ANLA 3MFUA 2EXCX 4RVLA 4I4FA 3S2PA 4UV0A 2R3KA 5EI2A 2W1CA 5HIEA 2QOQA 3LFBA 3NVKI 1W8CA 3EN7A 2VU3A 5HNIX 2JIVA 4JR3A 3BCEA 4AZSA 3QGWA 2C6OA 3Q4ZA 2PE1A 2WOUA 4DEEA 5LMKC 1H4LA 3IOPA 4QMNA 3DGKA 4WSQA 2QOOA 4JL9A 1Q8ZA 4Q5EA 3WF9A 3WYYA 1MRYA 2ETMA 3NZ0A 2XJ2A 2Z7SA 5M53A 2R3NA 3RINA 3OFMA 3BHTA 2C5XA 3NR9A 4AWIA 3FHIA 1O6LA 1OB3A 2G01A 2W9FB 2I7QA 4IVAA 4YNOA 3DTWA 4GYGA 5IDPA 3JVRA 2QNJA 1OKVA 3AD4A 4MXCA 4EOPA 3ENHA 3IDCA 4RX9A 4APPA 3DOGA 5JK3A 4FV1A 4OUCA 4HCTA 2UW4A 4JG8A 1UVRA 4L44A 4WUNA 4O0RA 5IQEA 2J2IB 5H8EA 3TWJA 2CNVA 3E7OA 2F9GA 2WTCA 4RIYB 3ZDIA 3ZOSA 1RW8A 4EH9A 3UQCA 4F1TA 4FTQA 4FTKA 2WTKB 1OI9A 5L2WA 2P0CA 3SG8A 3HX4A 4BDJA 3KU2A 5B2MA 2A0CX 4OTDA 4L7FA 2Q0NA 3TL8A 4AZWA 4AA5A 2X2LA 4YJRA 4H39A 1U5QA 4QMPA 4QP3A 5KKRB 4F08A 2J0MB 4DTBA 4CFFA 4ZLZA 5CU2A 4O84A 3BLHA 3RPVA 5B2LA 2XRUA 4PV0A 3ZM9A 4UMUA 3BQRA 4MD9E 4EOSA 4F63A 2XK7A 4BGGA 5I3RA 4MQ1A 4FOCA 4L8MA 2CN5A 4FKRA 4IH8A 2X39A 3DA6A 4NFMA 3PLAE 4BI1A 3H9OA 3U8WA 4RWIA 4TKSA 2YLEA 2WMXA 3RWQA 4ALWA 3Q3BA 3GOKA 5KMJA 1ZZ2A 1H27A 4GUEA 1SNXA 4XP2A 5J7BA 4JBQA 3VF8A 3BU3A 4QPSA 4E6AA 4EUUA 5EW3A 3DLSA 1KE7A 5AAGA 3CY2A 3UODA 3VJOA 3I81A 1OL5A 2C69A 3NW7A 4BZDA 1IAHA 4KBCA 2J50A 5FBNC 1H00A 5LMKA 5LWMA 3CD8A 4CMOA 3EKKA 3ENMA 3HP2A 4RC3A 5M4FA 3P86A 4TWOA 4J53A 5AV1A 1TQIA 2W4OA 3DFCB 3HV4A 5CF8A 2JDRA 3WZDA 4UMRA 3C4ZA 3KMMA 3WF7A 3IW5A 3E3PA 4NW6A 3E8NA 1P14A 2XNBA 4Y5QA 3R7UA 5KMLA 5ANOA 1PYEA 4QRCA 3ZDUA 4ACCA 4F1MA 3BEAA 5JFSA 4GS6A 4RPVA 3FMEA 3ACKA 3F61A 3D83A 5ANJA 4CFUA 3FWQA 4R5YA 2YISA 4C58A 3QRTA 4ZY5A 5DR6A 3QZFA 5L6WL 5K5NA 4RIXB 2XIKA 5K5XA 4AG8A 5L2IA 4G3CA 4M84A 3PSCA 4O1OA 2B9IA 4D1SA 3BKBA 1IAJA 3BE9A 5A9UA 1P4FA 4R77A 3Q2JA 3TZ8A 5BYZA 3V5JA 3B2WA 4RQVA 4IB5A 4FTLA 4S2ZA 2HXQA 4FEQA 4E20A 3G90X 2BIKB 4R3RA 3A7FA 2OF2A 3P4KA 4Z3VA 3OZ6A 5GIPE 3RPYA 4CRLA 1FMOE 1Y8YA 4AT3A 2PK9A 3NUNA 4X2KA 2RG5A 3B8RA 4RFMA 4NEUA 3QX4A 5AIKA 5AUZA 3VBTA 4FA2A 3RBWA 1GZOA 3ZUTA 3EYGA 1H1QA 3DKFA 5EI8A 3ZSIA 4C62A 4V04A 3QALE 2R3FA 2ITVA 2GHMA 2C5VA 2O8YA 4XHKB 2UZVA 3TN8A 2XB7A 1CKJA 4BKZA 2JFMA 3DU8A 2WQMA 5T68A 2REIA 2UUEA 3G9NA 4MK0A 3C1XA 5K3YA 1G5SA 3RGFA 3LCOA 3SXRA 3DAJA 5C03A 3SKCA 4JR7A 4JQ8A 4F70A 3RNYA 2IZUA 4OLIA 1H26A 4QTDA 3R7EA 4YZNA 2X8DA 1YKRA 3QLGA 3ZUUA 4MXYA 5AUXA 4CLJA 3QBNA 1YXUA 4BCNA 2W05A 4UWBA 1DI8A 2PMIA 4FTCA 4P5QA 1CKPA 4EKKA 4EQMA 5DEWA 3RZFA 2BRBA 2PZIA 4R3PA 3RI1A 5CS6A 5J1VA 4EHZA 2BZJA 4I6QA 3D5WA 1WMKA 3PJ8A 4U3YA 4O21A 2WTIA 4D2SA 4FZ7A 3W33A 5HTCA 1OPLA 2YLFA 2YCQA 4PDPA 4PP7A 3UIUA 5CAOA 2PTKA 2I1MA 2WB8A 3HMOA 3UC3A 3WZEA 4EQUA 2YWPA 1JKSA 2V22A 4MEDA 1OECA 1VZOA 5EKOA 3V5WA 3D15A 4RJ5A 3VS5A 4EH8A 2AYPA 4NIFB 2NO3A 3C0IA 4AACA 2WIPA 2R2PA 4MAOA 5L8KA 4FV8A 4Y95A 1XH9A 5G6VA 2XNGA 1PW2A 3HL7A 5AP3A 1WCCA 4K6ZA 5KHXA 4U43A 3D5XA 2QVSE 3CJFA 5E8SA 4GVAA 3LMGA 2WOTA 2FA2A 1M2RA 3LFDA 2ERZE 3BLQA 4OW8A 1GZKA 5C9CA 3UQFA 3N4TA 2XJ0A 1PXJA 4O0VA 4C7TA 2IW8A 4DEDA 5IQGA 1YDRE 2HXLA 1Q24A 2O65A 3C7QA 4RVKA 5CWZA 4BCPA 3COHA 3U54A 2ITXA 4M7IA 3FC1X 4UN0C 2EUFB 2PE0A 1H1SA 1WBVA 3D7TA 4OBOA 4N4SA 4CXAA 2ZMCA 3FKOA 3PY0A 4IWQA 3C13A 3UVPA 3FLNC 2DYLA 4GCJA 4AFEA 2R3OA 3FMLA 3T9IA 4OAVB 4GT5A 3LKMA 4PPAA 2BDJA 4CD0A 3QU0A 3PXZA 5E4HA 1H1PA 5JFVA 5M09A 4X6RA 4YUQA 3K54A 4YJOA 4RMZA 2W0JA 2BFXA 2ZV8A 3EQCA 4MD8E 3CIKA 3S4QA 1OIUA 3R6XA 3RK5A 4KINA 3ZC5A 3UZRA 4BBFA 5AX9A 2X4ZA 3LZBA 3OCBA 2A1AB 2UW8A 4WBOA 1H07A 4AW5A 2Q83A 4UZDA 4DBXA 3DJ7A 3ORNA 5HU3A 4FTUA 4IACA 4G2FA 5CX9A 5BVDA 1Q62A 4B0GA 3FZSA 4LMNA 3WF8A 3MI9A 4C38A 3DDPA 4IX5A 3FPQA 3MH0A 5IEVA 5JZNA 1YXXA 2PUIA 4QYEA 4TW9A 3MH1A 3G6GA 4G34A 4DFYA 3QRKA 4LV8A 5H8GA 3WIGA 3WILA 3EFKA 1FVVA 1B38A 1MP8A 2WQBA 1QCFA 3QKLA 4IZAA 4I0RA 1Q8UA 2ZV7A 4F9YA 4GK3A 3GVUA 1YOLA 1OL7A 3QUEA 4ITJA 5BMMA 4FIJA 4EJNA 4FKJA 4U7ZA 2YCSA 1H24A 5A4TA 5HG7A 5JSMA 1APME 4OTFA 1BI8A 3DT1A 5F94A 3RWPA 3TIYA 5I5ZA 5IPJA 5CTPA 2BAKA 4QTAA 2VTIA 4TYJA 2ETKA 3O8TA 2B0QA 5D7VA 3UDBA 4QMXA 4EONA 3EN5A 3IGOA 5A46A 5FM3A 4YZ9A 3Q5ZA 4BBEA 4GEOA 4M97A 3ZSGA 5CAQA 3DY7A 5AFVA 1PMNA 4DT8A 3DXQA 2H96A 2O63A 4ZSJA 3KXMA 1J3HA 2VUWA 4E4MA 5I0BA 2C4GA 4D9TA 3BBWA 2WMSA 5JT2A 3HAMA 3RVGA 1UWHA 4PX6A 3K3JA 5KZ0A 4YSMA 4TWPA 4PPCA 3PZHA 3EHAA 5HKMA 4DG3E 4EZ7A 2YZAA 5L6OA 3N9XA 3DS6A 1JAMA 3NCZA 3PXRA 3HMIA 5CALA 3F5PA 3WYXA 5HG5A 2CKPA 3JPVA 5AUTA 4B8MA 1ZARA 5M55A 3D5UA 3GBZA 2PE2A 2YJRA 3I6UA 5CSWA 3QD4A 5DWRA 4XG6A 5GJDA 4YPSA 3QGYA 3EQHA 2QC6A 4O0UA 4F9AA 3OWJA 1XH8A 2C3IB 2JDOA 2PVLA 3BYUA 4NH1A 3R8LA 3RALA 3VS6A 2YIWA 3P7AA 4IC7A 1SYKA 3O7LD 5D1JA 4F7NA 1WVYA 3OBJA 4FKUA 4L6QA 4D0WA 2JDTA 5HORA 1A9UA 1SM2A 1G3NA 2AC3A 4H1MA 2WD1A 4RJ6A 1NVRA 4G3FA 3FLYA 4FT5A 2RFNA 4RVTA 5A3XA 3ZZWA 4YZCA 3HGKA 5LMAA 2OKRA 4C33A 1GNGA 1QMZA 1JPAA 4O6EA 3TZMA 2ZMDA 4BCGA 1KE5A 4J1RA 3WARA 3G9LX 4ZLYA 5I9UA 2YERA 2QG5A 3EQDA 3ZEWA 4RIOA 3RK9A 3ZFYA 4EH5A 4P5ZA 3FAAA 3K5VA 5JRQA 2QOFA 3Q2MA 3OWLA 4L00A 4KIOA 4AOJA 4AZVA 1VYWA 3VUIA 2I0YA 3MVMA 1OUYA 3LW0A 2RIOA 3O8PA 3CPCA 4TZRA 4A4OA 3KCKA 1LPUA 4CKIA 1QL6A 4I93A 5EG3A 1M52A 2W99B 4IB0A 4AOIA 5BUIA 3ORZA 1Y91A 2R5TA 4N6ZA 5DR9A 5E8VA 5E8UA 5B2KA 2VTNA 4I1ZA 4U6RA 4RX7A 5FXSA 3EQGA 3RM7A 3SRVA 5HHWA 4EHGA 3NSZA 2Z8CA 4ITHA 3QQFA 4A07A 3D0EA 2XK6A 3MPTA 4CYJA 5CAUA 1PRYA 5AM7A 2YM3A 3E7VA 2ONLC 3MVJA 1BI7A 4RRVA 5ETFA 3LFQA 4M67A 3V04A 5I9XA 4DFNA 4DCAA 2HZ4A 3TNWA 1ZYJA 3MTFA 3MV5A 1B6CB 4QQTA 3IO7A 4C3PA 4TYIA 3HV3A 1Q3DA 3VBVA 5J7HA 3DLZA 3F82A 1K3AA 3FZ1A 4MBLA 4PTEA 4BTFA 1ZYSA 3I79A 2OJIA 2FH9A 4GFMA 1J7UA 3FUPA 4JDIA 1OL2A 4S32A 3EFLA 4V05A 5E8TA 3OW3A 4ZTHA 3CD3A 1OIQA 4CFWA 3UTOA 1DAYA 5EYMA 4FTIA 4ZTNA 4UMQA 4O7RA 5DLSA 2VRXA 2IVSA 3RP9A 1B39A 4HOKA 3SLSA 3UJGA 3UVQA 2ZB0A 2YIRA 3QQJA 3E8DA 1U46A 3PVUA 2IW6A 3RCDA 5KCVA 2VTAA 4BB4A 2JBOA 3HA6A 5M4CA 2HIWA 3O51A 3R73A 4FX3A 4UBAA 4QMWA 4ZTRA 4FKGA 4UXQA 5KNJA 3BEGA 3S00A 3KQ7A 3TNHA 2V7OA 5CEMA 2C5OA 2NNWB 2G2HA 2B7AA 4RIXA 1YHWA 3DTCA 4FSRA 2YZLA 2YA9A 4YP8A 4U3ZA 4A9YA 1U5RA 4CFVA 3HKOA 3MYGA 1G8AA 2OZOA 4WOVA 5IQFA 4JVGA 2F2CB 4BDIA 5IH5A 3AGMA 3ZS5A 4ASEA 4F09A 4E73A 4PMPA 4ZTLA 2BZIB 1YW2A 2VAGA 4DGGA 1HCLA 1KV2A 4U79A 1WBSA 4OR5A 2OI4X 4CZUA 1KOBA 2XS0A 4CLIA 5LXMA 3RM6A 2FSMX 1OIRA 3D14A 4KB8A 2BRMA 3RK7A 3Q53A 4MNEB 3PJCA 3V5PA 4V0GB 4Y46A 2IZSA 5ETIA 3VUGA 2EVAA 4PWNA 1CTPE 3FSFA 4FKTA 3PVWA 4PMSA 4ZIMA 3NIZA 2C6LA 4NCTA 3ORIA 3W16A 3NS9A 4AZTA 4JJRA 1WZYA 2QOCA 4U9AA 4PRJA 3QTSA 1PXNA 4J8MA 4U97A 4ZSEA 4D4YA 3QD2B 3F5GA 4FF8A 4EH3A 5JRSA 3OCTA 4FNWA 4ZLOA 2VWWA 1GIJA 1BL6A 2C1BA 3C4XA 4FKLA 4YZBA 3UYSA 3C5UA 3SC1A 2HWOA 4IAYA 3PRFA 2XVDA 3GP0A 4D9UA 2QURA 5IMEA 3CC6A 1SVHA 2W7XA 5T6KA 5BYYA 4IVCA 3FXZA 4DT9A 3WZKA 3GFEA 4FSQA 4YLJA 3E5AA 2BZHB 3ZRKA 1GZ8A 5BVKA 2C6TA 4MBJA 2YJSA 2QR7A 4E6CA 3SX9A 4ZTMA 1L8TA 2VO0A 1YOMA 4IFGA 5HU9A 2VWVA 4FG7A 4YSJA 5CXZA 2YABA 4O2ZA 3D7TB 3Q6UA 1CMKE 3ZYAA 5BMSA 3BRBA 3FY2A 4MXOA 4XRJA 1TKIA 2WQNA 5FEQA 3PE2A 5EKNA 2WNTA 4DFZE 1ZYCA 5J1WA 3V6RA 5IQBA 2VTTA 5AP7A 1Y8GA 3UQGA 3DNDA 4AU8A 4YR8A 4RA4A 2XKCA 3KFAA 4NIFA 2I6LA 3AC1A 4M66A 3C4CA 3VW8A 4C37A 3PVGA 1IASA 4XV1A 1Z9XA 5I9VA 2RGPA 3EKNA 4GFOA 5IEXA 3PJ3A 1GY3A 2OLCA 4M0YA 2HW6A 4IB1A 2G1TA 3NUPA 3HA8A 1YDSE 3HV7A 3QL8A 3R1QA 4JT3A 2PZRA 2RFEA 3RPOA 2E9VA 3WE8A 2GNIA 2Y7JA 3FQEA 4FG9A 4X6QC 1ZLTA 3ZLSA 5AADA 3OS3A 4C02A 4ZXTA 3GC9A 2VN9A 3HYHA 4XBRA 2LGCA 4CG8A 3VRZA 4ORKA 4BWXA 4IWOA 3REPA 2KTYA 2GNJA 2YEXA 3CQEA 3GCUA 1URCA 1OKYA 3O8UA 3LCSA 3EQBA 1P5EA 3R83A 2VX3A 2Y4PA 3WI6A 4P90A 4CT1A 3SVVA 3ZM4A 3H10A 5ANKA 4KUJA 2QOBA 2YDKA 5CNOA 2VWIA 4YLKA 2ITZA 2UZEA 4YNEA 2WMBA 4FV9A 4LGHA 3D4QA 4FR4A 1Q8WA 5AV0A 3IW6A 4RX8A 3WOWA 5IQHA 4XG8A 2ITYA 5C27A 2WKMA 4QP2A 5CI6A 3LJ1A 5JGBA 4M12A 3CBLA 3VF9A 4G3DA 2UZNA 2VTHA 3PPZA 4H1JA 2XBJA 2VV9A 3R0TA 4XG2A 5D12A 2VO3A 3V51A 5A14A 3HDNA 3MJ1A 3QUPA 4FTTA 4N6YA 3TNPC 2R3LA 1UNHA 3DFAA 1KWPA 3TV4A 3R22A 5FTGA 3AGLA 3W18A 4EOLA 3I4BA 3IONA 3KN6A 2IN6A 4R5SA 2IJMA 1ZY5A 5LMBA 2WTVA 3H3CA 4DFXE 4GT4A 3WF5A 4CQGA 5L8LA 4OTQA 4RJ3A 3LFCA 3D7ZA 4FK3A 1VYZA 3CXWA 4R3CA 5CASA 2E9PA 4MKCA 4LOOA 4PQNA 3WE4A 4DEIA 3MA6A 5CVGA 3TUCA 4F0IA 1YRPA 4G16A 3QTQA 1PMEA 3QCSA 3KRXA 4CEGA 3C4FA 2R3HA 4JG6A 5DYJA 3KA0A 5AM6A 3K2LA 3MDYA 3PIYA 3DKCA 1Z5MA 4TY1A 3TI1A 3IOKA 1H1RA 5ANGA 3GCPA 2WHBA 3DKOA 2ZVAA 3DZOA 4B7TA 2WMQA 2F7XE 4M68A 3BHYA 3R8UA 2OJGA 1H28A 1G8SA 3LE6A 4LGDA 3KULA 4FIIA 3A62A 5HE0A 4KIQA 3T8OA 2XYNA 3R30A 3GCSA 2Z7LA 4AOTA 3HNGA 3SA0A 4GVJA 3OY1A 3QCYA 4HZRA 3DBCA 4QP4A 4HCUA 2GDOA 3RTPA 1UA2A 2UW3A 1SNUA 4P7EA 5FD2A 3EQRA 2IVTA 4NUSA 4NKAA 4F9CA 3R8PA 3A7JA 2R7IA 4CT2A 4ZZOA 4EH7A 5TR6A 3GCQA 4IEBA 4CNHA 4F99A 3PY3A 3AMYA 3QRUA 3VBYA 4YPDA 2VTSA 3CSVA 4CZYB 1OBGA 1STCE 4TT7A 3TUDA 3UIBA 1R0PA 5FEDA 1PXKA 3SG9A 4AP7A 2BAJA 3KRJA 2Z02A 5EOLA 1UNGA 4LL0A 2YDIA 4ZSLA 3VQUA 4F7SA 2HOGA 2CMWA 4JXFA 3HRBA 4KWPA 4FGRA 4DCEA 4HW7A 4I0TA 3LMIA 3V5QA 3Q4CA 2ITUA 2VGPA 3KGAA 4OT6A 4G9RA 4UALA 2J0KA 1PJKA 1MRVA 5FGKA 1ATPE 2OGVA 4U45A 5EDQA 4NYEA 1XH5A 2XKEA 3FKNA 3ORPA 4ZY4A 3Q9ZA 1J1CA 4WNMA 3W8QA 5BNJA 3HLLA 3PP1A 2GFCA 4HYSA 2VNYA 4USDA 3ZFMA 3NYNA 5EDRA 2SRCA 2O0UA 5D10A 4O0TA 4RT7A 3BHUA 5HVJA 4BDAA 3P7CA 4GU9A 4KAOA 1FQ1B 3ALOA 1F3MC 4BL1A 4YTCA 5IMXA 4O83A 2C3JA 3MVLA 4FZ6A 2O2UA 4FKOA 5M51A 2WMTA 2C30A 5I4NA 3BYSA 4YTHA 3NYXA 2VTMA 4KBKA 5K0KA 4AS0A 3TCPA 4TYEA 3SRVB 2Q0BA 3BQCA 2GTMA 3PSBA 3QWKA 5HOAA 5IUGA 3MBLA 2F49A 3QQKA 2W1IA 3KREA 4G3EA 4U80A 3ZFXA 2IZRA 3F5UA 5DR2A 5EW9A 3RMFA 3ORXA 2X8IA 3HMPA 4OTIA 4JAJA 4DF3A 3QCQA 2BRNA 3QRJA 4ZTQA 3FC2A 4NK9A 5GZ9A 3EZVA 4AGUA 3MJ2A 5BYLA 3FMDA 4BDKA 4XRLA 2GFSA 5CAPA 2JAVA 3W2PA 2VGOA 4KKEA 1JLUE 5M06A 3CJGA 5AUVA 4DH7A 4FVQA 4MQ2A 3AMBA 3OTUA 5E7RA 3VUKA 2BILB 4FVPA 2BCJA 4EK3A 2OJFE 1OZ1A 3KF4A 2C0TA 3MS9A 3QFVA 4WBBB 3VO3A 2C6EA 4FI1A 4XUFA 4EOKA 3TUBA 4N57A 4QYFA 3C9WA 4LUDA 5LARA 5CYIA 2WZJA 2C3KA 2XCKA 4CFXA 1NXKA 4EUTA 2PVFA 2WMWA 3IDPA 3NX8A 4YZMA 4AT5A 2ITPA 4FTOA 5JH6A 3UPXA 3P08A 3N51A 5EQPA 4FZFB 2W9ZB 5C4KA 5T3QA 2ZDTA 4ERKA 4HCVA 2UZOA 5KMMA 4EK5A 3W32A 4Y8DA 5FG8A 2V62A 4PMMA 5DOSA 3S0OA 4JDJA 5DGZA 4ASZA 4FNZA 2HYYA 4GT3A 4W4WA 1OMWA 3ROYA 5LVPA 1IA8A 4WIHA 2XIXA 4FV4A 2HELA 4N0SA 1JOWB 3ET7A 3ZLXA 4C3FA 3GI3A 3BELA 5IF1A 4QPAA 1NT2A 3Q9WA 2CCHA 2WEVA 5EQEA 3R28A 3P0MA 5HCXA 4D1ZA 3ZO2A 4EQCA 4FKQA 3TDVA 4S34A 3JUHA 4BTJA 4XNEA 2VD5A 4KIKA 3ZBXA 4EYJA 3KC3A 4LUEA 5CT7A 4EYMA 1Q8YA 5AP4A 4GKHA 5HO6A 5CY3A 4WUAA 3R9OA 4AF3A 3M2WA 4D5HA 3QQUA 4AN2A 2X2KA 5F1ZA 4GG5A 2QKWB 4DFLA 4XX9A 4AN9A 4BIEA 2UW7A 4H3QA 4ARKA 4YURA 3KVXA 3QHRA 3R1NA 4F9BA 2RFDA 4BHNA 5DT0A 4MCVA 2FGIA 4HVHA 3FZTA 3LQ3A 4RLKA 3CY3A 3FMJA 3QD3A 4IC8A 5GJFA 4DH1A 4BZOA 4K2RA 5K9IA 4DGOA 2QLUA 1XWSA 3BBTB 4C4JA 2GCDA 5FQDC 3BHVA 4EC8A 3OG7A 5J5SA 5LVOA 3BGQA 1LEWA 3R04A 5GINE 5HI2A 3QTUA 4IJPA 4D4VA 5JGAA 4D58A 1AD5A 2GQGA 2BAQA 2P2IA 2OIBA 3DB8A 3FMHA 2P3GX 4NTSA 3RJCA 1OKZA 3FI3A 3TTIA 1F0QA 4LGGA 1OVEA 2ESMA 5DG5A 4ZAUA 5D9HA 2JKMA 2BVAA 3IKAA 4U41A 4J95A 4HNIA 2P55A 4DEHA 5AP6A 1FGIA 1GAGA 2QD9A 5JQ5A 3SGCA 5CU6A 3OD6X 4MNEA 5DE2A 3CTJA 4L3JA 4V0GA 2BRGA 3PPJA 3A61A 5BPYA 4YTFA 2J4ZA 5AV2A 3QKMA 3VS3A 5EHYA 3QUDA 5LCKA 1XHAA 3KXZA 2XIRA 4L3PA 4E4LA 4EK8A 2W1EA 2YN8A 3U6IA 1FVTA 2OU7A 4R7HA 2JC6A 5E9EA 4BI0A 2QLQA 2C5NA 2WMAA 4G17A 3THBA 4QT1A 2QKRA 3NW6A 3R8VA 2XBAA 5M4UA 4FTAA 1UNLA 4R1VA 4XV3A 3U9CA 2CGUA 3HV6A 4EOIA 3A99A 4XMOA 3FL4A 4C4FA 4C57A 2R7BA 2UVXA 4DN5A 4TRLA 3LQ5A 3DV3A 2CKOA 3OXIA 2CGWA 3G0EA 4FZDB 2YITA 1BUHA 2R3MA 3LXPA 3NDMA 1WFCA 3HECA 4BWKA 2CNQA 3PA4A 4KS8A 4ONAA 3KRWA 4A7CA 4ENYA 4DHFA 5AV3A 2I0EA 1J91A 3PE1A 3QCXA 3NYOA 4U5JA 3HUCA 4RWJA 3KRRA 2OXXA 3E8EA 4FSNA 4CG9A 2JDVA 2W5HA 3E63A 3AC5A 3OT8A 1AQ1A 3Q32A 3GC7A 2YDJA 4GMYA 4YZDA 5EOBA 3MPAA 3RNIA 5CEOA 3G0FA 3EH9A 3KK9A 4PTGA 3ROCA 2GHGA 4BFMA 4S30A 3FLWA 2CJMA 3TZ9A 1RDQE 2C68A 3DQXA 5K4IA 3C0GA 2A2AA 4NM3A 2OXDA 3CKXA 4AXAA 2BTRA 4CCBA 2A27A 3W8LA 2CGXA 3FV8A 4FTNA 1YWNA 3EOCA 3O96A 5E1EA 5ACBC 2R64A 4M3QA 2ZM3A 5IA2A 3BYMA 3MIYA 4A9UA 2OWBA 4F4PA 2R3RA 4FYNA 2PVKA 3NLBA 4IMYA 2HZIA 2GS6A 4Y85A 3U4UA 4IX4A 4LYNA 2UZUE 4LL5A 4FT3A 5FLFA 3ZXZA 5BUJA 4FC0A 3POOA 2VTLA 3AT3A 4DEBA 4LFIA 4F7JA 4X2JA 4MF1A 5KMNA 3E62A 4TNDA 4BN1A 4AA4A 4GV1A 3GU6A 2PVYA 4BYIA 4EH6A 3RHKA 4F64A 2XH5A 3F3WA 1IRKA 4C4EA 5AEPA 1IA9A 5J8IA 3FZPA 1XH6A 3VWAA 4FEUA 4RFZA 1FPUA 2W96B 5FXQA 4XV9A 5IKWA 2W5BA 4F9WA 3PDTA 1LEZA 1X8BA 3KULB 4F6WA 3GFWA 4AFJA 4D2TA 3TZ7A 4RZWA 4YC3A 3M1SA 5DT4A 3LFNA 2YCFA 4IFCA 4XG3A 4I20A 4ZZMA 3VUTA 3Q04A 4E4NA 5DN3A 4NZWB 5AR8A 3R71A 4J97A 3OY3A 2OFUA 4B9DA 4IM0A 3AT2A 4EZ3A 3UG2A 1ZMWA 2ZV2A 3MH2A 5GNKA 5E8ZA 3DBQA 3TG1A 1FGKA 4F7LA 3G2FA 4CRSA 3CE3A 4QOXA 3UP2A 4XLIA 1KV1A 3F3ZA 3K3IA 1JSUA 4PF4A 3MY0A 4FL1A 3ZO1A 1E1XA 2CKQA 2J0IA 1ZOEA 4RZVA 2VX0A 3SXFA 1W83A 3FY0A 2X81A 1GOLA 4ACDA 1PMUA 3I1AA 1LR4A 4JG7A 4X21A 4JS8A 3NPCA 4R1YA 5BVEA 2J0LA 5CQUA 3DJ6A 4U44A 4BTMA 1TQMA 4ZOGA 4FEWA 1YXTA 1RJBA 3UO6A 2HCKA 4RG0A 4PY1A 2B54A 4DLJA 4OTHA 5HNBA 3TT0A 3DK3A 3GU7A 4UWCA 5CF4A 4JIKA 4ALUA 1ZYDA 3QXOA 1MRUA 5L3AA 2X4FA 3FPMA 2WO6A 3PG3A 4NSTA 2F2UA 3EMGA 4TWNA 4XG4A 3JR1A 5J5TA 3IW4A 5AAFA 4BGQA 4UZHA 1IEPA 3DK6A 4ANBA 1DS5A 3P23A 4QP7A 3BE2A 1OIYA 5JEBA 1WBNA 5BVWA 2VWUA 3Q9XA 1OL6A 4RVMA 1YHVA 5HX6A 3I0QA 4BGHA 2XNPA 4D5KA 1UKIA 1KOAA 4FV0A 2RF9A 3R9NA 4LOPA 3W1FA 5FBOA 3E88A 1OKWA 2H9VA 2VTJA 3POZA 5CSHA 4ASXA 3UMWA 3OROA 2JDSA 2VX1A 4BCJA 2CDZA 3GT8A 4IM3A 4BDHA 3TKIA 3PXQA 2FUMA 2OH0E 3TV7A 4MTAA 4S31A 2BRHA 1QPJA 4LG4A 5HVKA 5AA8A 2W1FA 4LM5A 4W9WA 2CLQA 2ETRA 2YIXA 1YOJA 1VJYA 3LM5A 4GL9A 1QPCA 4I4EA 4FKPA 4MNFA 4ZP5A 1RE8A 3ZHPC 4USFA 5CEKA 1NA7A 4LRKA 3MH3A 3OHTA 5J9ZA 2XP2A 4U8ZA 2YWVA 2XKDA 3AG9A 3L8VA 3QQHA 3S95A 4YO4A 3TKUA 1ZXEA 4GG7A 3MVHA 4X2GA 1XQZA 3FLQA 5L2QA 3UOHA 4RC4A 1U59A 5GZ8A 2WQOA 5TKDA 2Y6OA 4C2VA 1JWHA 2RL5A 2OJ9A 1XH4A 3PXFA 1V0OA 4L67A 3JY9A 1XH7A 2C6DA 2IWIA 4FSUA 4IJ9A 2UW9A 4UEUA 4M14A 4ZJJA 4FIEA 5FUTA 3OWKA 4B8LA 4YJNA 4FIFA 3P78A 3ALNA 5EYCA 2UZLA 1J7LA 3G6HA 3T3UA 2VWXA 5LJJA 1GIIA 2JIIA 4LI5A 5ANDA 5HG8A 3RAKA 4Z9LA 3KEXA 2BPMA 4GK4A 3KXGA 1TVOA 4WA9A 2YIYA 2GNHA 4WNKA 3KF7A 3G33A 3KMUA 4BCKA 1NW1A 2OH4A 2PMOX 4Z16A 3F3VA 3FHRA 3ZU7A 2RFSA 2WTWA 3ATTA 5IDNA 4MD7E 3FE3A 4RC2A 3TDWA 4RSSA 4MF0A 2HZ0A 4DH5A 5B7VA 2QOHA 2J5EA 5DMZA 4GJ2A 3WBLA 1PXPA 4QNAA 2WELA 3MTLA 5CANA 4IAAA 4KIKB 4BHZA 2VTOA 4QP8A 2BHEA 4QMUA 3KKVA 4UY9A 4AT4A 4E6DA 2C6MA 5KUPA 3R7VA 4WNOA 1IG1A 2IVUA 3F9NA 4RWKA 3SOAA 4ZK5A 2FSLX 1M2PA 2HY81 4RX5A 3BGPA 1Q8TA 2PUNA 4EORA 3TKHA 5CLPA 2GS7A 4FV3A 4XCUA 4FE2A 4O7VA 3HRCA 4FV6A 5HTBA 1SZMA 1ZOHA 3A60A 2QOLA 3ID6C 2H8HA 5F4NA 3FXXA 5DPVA 4JAIA 2UZWE 3JS2A 2RG6A 2ZJWA 3OOGA 4I0SA 5DFPA 2ITQA 5I9ZA 2R0UA 4AZEA 2RSVA 2VTPA 3UNJA 4LRMA 4FKVA 4K1BA 3QZIA 4HJOA 5HNGA 1PKGA 2FSOX 5DI1A 4G6NA 3VS0A 5IG1A 4XOYA 1UU9A 2EB3A 5D41A 3OEFX 3SAYA 1JKLA 1XBCA 3LCTA 2PVNA 2WEIA 3ZONA 3DK7A 2YAAA 4G5PA 1NVQA 2A4LA 4NKSA 3W2RA 4MWHA 2W17A 4PDOA 3KXNA 1JQHA 1K9AA 4I22A 3KN5A 3CEKA 4WRGA 3COKA 2DQ7X 3UIMA 2ONLA 2V0DA 4B99A 1H25A 2WIHA 4BR3A 4YO6A 3MY1A 5CF5A 3DZQA 5HESA 4KRDA 2PU8A 4YHTA 4APCA 3KMWA 4I6BA 3R1SA 3VQHA 1PXMA 5GZAA 2B52A 3ZO4A 4C3RA 3UZPA 3PJ2A 1L3RE 4I5PA 2VWBA 2PUUA 4OBQA 2P33A 5HE2A 3RZBA 3D5VA 2O3PA 1XKKA 2GSFA 5FDPA 5KHWA 5L4QA 1R1WA 4JDHA 1WAKA 4ASDA 3UNKA 2JKOA 3D2KA 4OGRA 4XH6A 5DA3A 4J96A 2G9XA 3QX2A 4XV2A 4FKSA 2OO8X 2XA4A 3EQFA 3U55A 3E92A 1ZMUA 3ANRA 4U40A 4AGCA 4HVIA 2QO7A 4TWCA
chains in the Genus database with same CATH superfamily
3OT3A 5J87A 5BUEA 3OVVA 2XYUA 2X7GA 2X6EA 4BKJA 2VO6A 3TIZA 4I41A 4ZY6A 2X7FA 1YI6A 5CSXA 5M07A 2G2IA 4ANQA 4K18A 4IE9A 4Q5HA 5CU4A 3VNTA 3OEZA 4UMPA 3EN9A 3VHKA 3P9JA 2XF0A 3NGAA 4C8BA 4UX9A 2JBPA 2IW9A 3E64A 4ACHA 2OZAA 5HTIA 5AR2A 2BMCA 1SMHA 3UE4A 4I24A 3ZLWA 1JSTA 3GU4A 4YHJA 2JAMA 3F7WA 4D4SA 2NRUA 3R02A 3VAPA 3SOCA 3UVRA 4AUAA 4FODA 2DWBA 4FSWA 3IG7A 4FT0A 3RPRA 4AGWA 3FI2A 2IZTA 5IQIA 3HMMA 3FMNA 3R2YA 4XYFA 4DLIA 4FKIA 4QD6A 1Q61A 2B4SB 5E8WA 3DBEA 2CLXA 1GIHA 2BDFA 3ORMA 4NM5A 4XG9A 2YFXA 3S3IA 3W0RA 5HE1A 4A4XA 2W5AA 3JXWA 3LQ8A 5JKGA 4FIGA 3N4UA 2R3PA 3ZLYA 3LJ2A 4BWPA 2RKUA 4R8QA 2BIYA 1YI3A 2UW0A 3LFFA 3PWYA 4E7WA 4ENXA 5GJGA 5CNNA 1R3CA 5EQYA 2HENA 3PIXA 4Z7GA 4UWYA 2G15A 2YM6A 4L9IA 3TJDA 4B4LA 4IZ7A 1JKKA 4EK4A 2BR1A 2WMRA 5JFWA 4PPBA 2C1AA 4X0MA 5CAVA 4CCUA 3SD0A 2HK5A 4GFGA 3UOLA 1KSWA 5CENA 5DBXA 4HYUA 3KY2A 3MY5A 2HW7A 4CFMA 5BQ0A 4RIWB 3QQGA 5DRDA 4CSVA 1M17A 4CVAA 2BKZA 1WBOA 4I92A 3F2AA 3HUBA 4DDIA 3FDNA 4FUXA 4GIIA 1TQPA 5HX8A 2XK4A 4XG7A 5HCZA 5EM8A 2Z2WA 4NL0A 5LWNA 1ZWSA 3BL9A 2CGVA 3O71A 5HZNA 4D28A 3PXYA 5GIOE 5HLWA 4AA0A 4BDGA 4O7SA 4DFBA 3ACJA 4BZNA 3FI8A 4MXAA 4EJ7A 4L52A 4E4XA 4BCOA 5L2SA 3PYYA 1J1BA 3UO4A 5M4IA 1R78A 2YM4A 3F69A 2PVMA 3GC0A 3VBQA 5LVMA 3U6HA 4ZS4A 1KE8A 2CSNA 4QMQA 4AW2A 5EW8A 2XUUA 3QZHA 4O7NA 2X6DA 4RLLA 4RBLA 4E1ZA 3VBXA 3LFEA 5KX8A 5HIDA 4C59A 4HGTA 1UV5A 5C8KA 4HVDA 5AMNA 5AP2A 4ITIA 3AC4A 4FL3A 3W2QA 3PWDA 4C34A 4DEAA 3UOJA 3VUMA 3ZEPA 4R78A 4QYGA 2QODA 1Q97A 2V5QA 4C35A 4USEA 4IDVA 2XRWA 4BVUA 4O82A 2WQEA 5IU2A 1MQ4A 2E9NA 2V55A 3C4WA 3VRYA 4ERWA 5I3OA 5AAEA 5KO1A 2PPQA 4CFNA 3W0OA 4YJUA 2CCIA 3FZOA 5HO7A 5IA1A 4BCHA 3PY1A 5DT3A 5HG9A 3F2RA 4AZFA 4LQMA 2OIQA 4FGBA 5TOZA 4RFYA 5KBQA 1YWVA 3A8WA 3OP5A 4AE6A 2CHLA 2WFYA 2YACA 4GRBA 3VS7A 4FOBA 3V8TA 2UZBA 3MWUA 3PUPA 4KSQA 1REKA 1M14A 3CLYA 4FSYA 5IA4A 3FMMA 2BALA 4FK6A 4L7SA 3EFWA 4FRFA 4XP3A 5HBHA 4EBWA 3BPRA 2W4KA 3MN3A 1V0PA 2R3JA 4E93A 3NNVA 3ULZA 5FP5A 5AP0A 3AC8A 3RHXA 5A4LA 2QI8A 4IW0A 4X2FA 3LFAA 4FSTA 2PYWA 1CDKA 5ETAA 4CYIA 3DCVA 4EKLA 3VJNA 1SVGA 2GMXA 3RAHA 2QOIA 2BZKB 4IANA 4PDSA 3AXWA 2PZ5A 2C3LA 3BHHA 3IK3A 3W2OA 1BYGA 4LV5A 1ZRZA 4BJJB 4A06A 5AP5A 3JVSA 4X3JA 1T46A 3DBDA 3FQHA 3G5DA 4IDTA 2OW3A 5ETCA 2P4IA 2JEDA 5BVOA 1PHKA 4QP6A 3EN6A 3ZMMA 3QKKA 1W0XC 2WU6A 2XNNA 4X3FC 5AR3A 5IISA 3W2SA 4L46A 1XMMA 4DFUA 1BKXA 2J6MA 3F3UA 3FXWA 5CXHA 5F95A 2QHNA 2W4JA 4IZYA 4U42A 5HLPA 4DINA 3HMNA 4C2WA 2AQXA 4YMJA 2X9FA 3QQLA 4WNPA 1HOWA 3HAVA 1H0VA 3JY0A 4TTHB 5AX3A 2VNWA 2J0JA 3R00A 4EC9A 4MYGA 3BWJA 4QQ5A 4IVDA 3BWFA 3V5LA 1M7NA 3MA3A 4M15A 4F6SA 2JGZA 5JZJA 3P5KA 5EHLA 1W98A 4PL5A 4DAWA 4ZSAA 5IQCA 3HDMA 2XALA 3LCDA 2JFLA 1I09A 4EOJA 4F6UA 2O64A 3Q9YA 5K4JA 3A2CA 3AD6A 1PXLA 2GU8A 4M0ZA 4IQ6A 3FLSA 1Q3WA 2JITA 2QU6A 3M42A 3MIAA 5DNRA 4HGEA 4O81A 4TN6A 3CTHA 5KBRA 1NY3A 4KKHA 5JN2A 1BX6A 4L3LA 3LHJA 3GENA 4W4YA 4BTKA 3L9NA 4PMTA 4RGJA 4E5WA 3KXHA 3N4VA 4G5JA 3BIZA 2OK1A 4KSPA 2CKEA 4H3BA 5CEIA 4E8AA 5LOHA 3COIA 3ORTA 4JBPA 3FZRA 3ODYX 5IA5A 3DAEA 2F4JA 5C4LA 5EK7A 3H30A 1YXVA 5TO8A 4CGAA 3OTVA 4JX7A 4B6LA 1FVRA 1UU3A 4BDFA 1YDTE 2A19B 5JQ8A 4K33A 3VBWA 3W2CA 2WMUA 4I21A 3OOMA 4E5BA 3SDJA 5LQFA 2JD5A 3FYKX 3DBFA 4D4RA 4CKRA 3BLRA 1P4OA 1W84A 2G2FA 3FMKA 2CN8A 4KD1A 2HZNA 4A9TA 4BF2A 5IA0A 4EOOA 1G8KA 3ZC6A 4L42A 2FB8A 1CM8A 2XMYA 2ZV9A 3BV3A 4FSZA 4IIRA 5LCJA 4AAAA 2X9EA 3R01A 3OMVA 3W10A 4AW0A 3MFSA 5AP1A 1WBTA 3L1SA 5J9LA 3DJ5A 2XZSA 3MW1A 5FWKK 4ZMEA 3LM0A 3CTQA 3HP5A 4EHEA 1ZZLA 2XNEA 3GU8A 4MHAA 3LXKA 4A4LA 5HE3A 2VWYA 1OITA 2WPAA 3EN4A 3LVPA 4KBAA 4PUZA 4Q2AA 4PL4A 5L8JA 2IPXA 2Y9QA 4BRXA 5ACKA 4X3FA 3O0GA 3RAWA 4QMMA 4XBUA 2JLDA 2JKQA 3VULA 3WIKA 5A54A 3ZXTA 4EOMA 3GNIB 5IEYA 3OW4A 3O23A 2BTSA 2QR8A 2ZDUA 4IB3A 1YWRA 2V7AA 3R9DA 4EWHA 2WAJA 3QAME 5H2UA 2XCHA 3V3VA 2PWLA 3LLTA 3QYWA 3U51A 3BI6A 4ZZNA 4G1WA 2I0HA 3G15A 1YHSA 4NFNA 2ITTA 4IVBA 4JQ7A 1Q4LA 3PIZA 3JYAA 3NUXA 4KNBA 4W8EA 5TT7A 4FJVA 5IUIA 3NAYA 4FG8A 4QMZA 5I9WA 2Y0AA 3ZSHA 2YAKA 4OBPA 4BC6A 4JIAA 2ITWA 4WKQA 2GNFA 1FINA 2NP8A 5EM7A 3QLFA 1PF8A 4FT7A 4EOQA 4UXLA 2PZPA 2BHHA 4FTRA 2IEWA 4D2PA 3PSDA 3KVWA 5DHJA 4JI9A 3E93A 3R8ZA 1PXIA 3L9MA 3QD0A 4BCQA 3OCSA 2J90A 4ZS0A 4QMTA 4YU2A 4ACMA 3NIEA 5EFQA 3L8PA 3I60A 1Y57A 3MGYA 3TNIA 1WVWA 3CKWA 1OUKA 5TF9A 4GU6A 1XJDA 3QTIA 4DC2A 4HYIA 4O7YA 3WZUA 3EQIA 4FV5A 5CI7A 4XEYA 5EYKA 3KRLA 4U81A 4LMUA 4EHVA 4EL9A 2UVYA 3CGFA 2Y4IC 2ERKA 2E9UA 1BL7A 3FL5A 1Y6BA 1P2AA 2IF8A 1E9HA 3C4EA 1YI4A 4CQEA 3OUKA 2IVVA 4NU1A 5EHOA 1PXOA 1VR2A 2C0OA 2CPKE 3R1YA 4LRJA 4F65A 1OBDA 3UMXA 2J9MA 3B8QA 5E91A 3SW4A 3NWWA 4OTGA 4Y83A 5F20A 4BKYA 2UV2A 5M57A 4IWPA 2X0QA 2ZOQA 3QZGA 4K11A 5FTQA 4D1XA 2X0OA 2NPQA 4HPTE 4YBKA 3TJCA 4O7WA 5IZFA 3ITZA 4FKWA 4I5MA 3S1HA 4O7TA 5DEYA 1CSNA 2OZAB 3GQIA 2VO7A 2FO0A 1LP4A 3TV6A 4D2VA 3PA5A 1U4DA 3AT4A 2EXEA 3PLSA 4XS2A 5FRIA 2AC5A 3VS2A 4DITA 3IS5A 5HBEA 2H34A 4FICA 3VN9A 4KA3A 4WD5A 5C1QB 4FNXA 1FBNA 1M7QA 5EM5A 4H05A 4Y73A 4BICA 4IAIA 2KULA 5ANEA 3PPKA 4BCIA 2GPHA 4FT9A 4YHFA 3DB6A 4DEGA 4M69A 3D94A 2BUJA 2OIDA 3L8XA 3CP9A 3A4OX 4UMTA 3PA3A 4TYHA 5HBJA 4IX3A 5DH3A 3BV2A 2I40A 2J7TA 1JKTA 3NUAA 3IQ7A 5A4EA 2OG8A 3Q6WA 3QF9A 4FBXA 2OICA 2C6KA 2HWPA 4DDGA 2QCSA 3II5A 4GH2A 3D9VA 5E8XA 4O2PA 3GXLA 3L9LA 2FSTX 3MB7A 3PRIA 1R39A 4I6FA 4II5A 4ZMFA 3NNWA 4WHZA 1E1VA 4FMQA 2XEZA 4R6VA 3BU5A 4CTBA 4FSMA 4KRCA 4QYHA 3LPBA 4MXXA 2GS2A 3V8SA 3EB0A 4CKJA 2WTDA 5IQAA 5H8BA 3R2BA 5D7AA 4QPMA 4Q9ZA 1ND4A 3R9RA 3QA8A 4Y72A 4DGNA 4QMOA 4IM2A 5HCYA 4G3GA 3VW6A 4UB7A 3NCGA 4PTCA 3LMHA 2Y6MA 2XIYA 3FJQE 4W9XA 2YM8A 4TXCA 1V0BA 5GHVA 2GQSA 4XP0A 3FEGA 2PY3A 1JNKA 4F1OA 3H9RA 4U0IA 3ULIA 1VEBA 2WU7A 2XNOA 3VUHA 4BBMA 4L43A 4TNBA 5AUWA 3M11A 3RKBA 4FYOA 4O0XA 3NAXA 4DG2E 1H8FA 3ZRMA 4O6LA 4KIPA 4BDEA 3UOKA 1QPDA 4MXZA 2QU5A 2ITOA 3WF6A 4NM7A 4NWMA 3EL7A 3GGFA 2ACXA 5HEZA 4Q9SA 5A4CA 3HVCA 5C8MA 4ZJVA 1ZOGA 5AUUA 4RIWA 5JMSA 4YTIA 3O17A 2QO2A 3QC9A 4KS7A 3U6JA 3HZTA 4I6HA 5BVFA 4EEVA 1TFFA 2HAKA 3V5TA 4PNKA 2E2BA 2J5FA 3QTZA 4H36A 4JX3A 1PY5A 3KXXA 1M2QA 3LOKA 3QTWA 3MESA 4FEXA 5H9BA 4DA5A 2GTNA 2J51A 3TM0A 3RCJA 3MFTA 5CSPA 2GNGA 3BZ3A 2Z7RA 4E5AX 3UYTA 4GSBA 4HPUE 1V1KA 3AC3A 4DYMA 1U54A 2QOKA 1O6KA 3BYOA 4BIBA 4C0TA 5EH0A 5M44A 3C51A 3LLAA 3FI4A 4YLLA 4QTCA 4TPTA 2W1GA 3A4PA 4DE4A 3LAUA 4YC8A 3QC4A 4IAKA 2QG7A 3R8MA 4BDBA 1Q99A 3Q96A 1O9UA 3CR0A 3BYVA 4XJ0A 3SQQA 4ANMA 4HVGA 3KK8A 4OT5A 1URWA 1SVEA 3ANQA 3R7GA 4K9YA 3ZBFA 2WTKC 3COMA 5FP6A 2Z7QA 3P79A 3GB2A 4QTEA 3Q52A 4JRVA 4DTKA 4IAFA 1Y6AA 4BCMA 4FTMA 5KKRC 4ANNA 2YCRA 4L01A 4DH3A 4O27B 2HY0A 3A7IA 2P2HA 5AR4A 3VIDA 3PTGA 3MB6A 2IO6A 3CCNA 3CQWA 4FEVA 1OL1A 2UZDA 4MUQA 3W55A 3RPSA 3UGCA 2GHLA 1NVSA 2UZTA 3U4WA 4HYHA 2WTJA 3ZCLA 2PSQA 2PHKA 2C5YA 3MSSA 3AC2A 5CVHA 1H01A 2BROA 3R7YA 5G1XA 5HIBA 3EWHA 2OJJA 2F7EE 4O7LA 1KE6A 4QQJA 4QNYA 3EIDA 2F7ZE 4JNWA 4G9CA 4W4VA 4D2WA 4C4GA 3UC4A 3PVBA 3VVHA 3SW7A 4QMVA 3NEWA 4WG3A 4G6LA 3EL8A 2R3IA 3F2NA 5J95A 2F57A 4WO5A 4GK2A 3NMUF 4OTPA 4BJJA 3F3TA 3C0HA 3GU5A 1WBPA 4EH4A 4LV7A 4JQEA 4E3CA 1QPEA 5KE0A 2X1NA 2LAVA 1GZNA 2EB2A 3EFJA 3IPHA 4WT6A 5CZIA 5HO8A 3QYZA 1H1WA 3L8SA 4QMLA 4O96A 3RAIA 1FOTA 2B9FA 3QA0A 4L68A 4EWQA 4CV9A 2VTRA 3P7BA 4K8AA 4MVFA 3P1AA 4BDCA 4XLVA 2X7OA 3E3BX 4O86A 1XBBA 4YC6A 1W82A 4YJVA 4IAZA 4O1PA 5IQDA 5JFXA 4O4DA 3BGZA 3ZO3A 5ITAA 2EU9A 2Y8OA 3I5NA 3ODZX 2XJ1A 2DUVA 4YJPA 3PXKA 4RIYA 4Y5HA 1ZY4A 2XM9A 4HGLA 5L6PA 4Z55A 4G31A 3GCVA 1A48A 4GUBA 3OWPA 3QTXA 2ITNA 3OXTA 3ORKA 5AJQA 2B55A 3EYHA 3F66A 3I6WA 3PG1A 3UG1A 5HLNA 3TTJA 4RWLA 4EZ5A 2B9JA 3UZTA 3HRFA 4FV2A 4RJ4A 3R7IA 3GOPA 4J8NA 4OTWA 4S33A 2BDWA 5M56A 3V01A 3UPZA 1UU7A 2R0IA 2XK9A 3DPKA 4X3FB 5D11A 5DVRA 2B1PA 3VS1A 2JIUA 1R0EA 3R7OA 3O50A 4BIDA 1H08A 4FTJA 4O7ZA 2IG7A 5CU3A 4ACGA 4ALVA 3UBDA 5CSVA 2YM7A 3NYVA 3PJ1A 4NM0A 1ERKA 2QONA 3OXZA 3NNXA 4MX9A 1BMKA 5EI6A 3E8CA 4NCTC 2QHMA 3EQPA 3IW7A 1DM2A 4X7QA 4O4EA 2W1DA 2NRYA 3ELJA 5AR5A 3FQSA 3OUNB 1S9IA 3D2IA 4C4HA 5FXRA 1ZMVA 3F5XA 5KMOA 5ICPA 4EK6A 3DXNA 5HQ0A 5C01A 2PVJA 4ZSGA 2ZYBA 1Q41A 4L53A 1S9JA 4ID7A 1MUOA 1PYXA 4GW8A 4J7BA 4CTCA 2UVZA 4HZSA 2E9OA 4LOQA 4MH7A 3GEQA 3A8XA 3CS9A 3MFRA 4O0WA 3AD5A 4C61A 3OF0A 2XEYA 4EBVA 3ZTXA 3ZH8A 1OPJA 5C26A 3H0YA 4IWDA 4QQCA 4C36A 1YQJA 3VC4A 1W7HA 5JGDA 5E92A 2EXMA 2PVHA 3AOXA 2ZM1A 2B9HA 2OSCA 4FZAB 4GIHA 2B53A 4PL3A 4QMYA 3SHEA 4UYNA 3EZRA 1OPKA 4DGLC 5DIAA 2OBJA 2R3GA 4J98A 5L2TA 1K2PA 4TL0A 1FMKA 3KB7A 4I3ZA 3V8WA 1MQBA 4ZTSA 1XO2B 4AGDA 1AGWA 3C50A 1ZYLA 3FKLA 3GQLA 5CEPA 3GUBA 3AKKA 1UWJA 4O38A 4M8TA 2CNUA 2PZYA 2UW6A 3PZEA 5AWMA 5A6NA 3FBVA 3QXPA 2W06A 4PP9A 4I5CA 1W2CA 2H6DA 2ZAZA 3Q4TA 4YGAA 3Q60A 2XK8A 4QDEA 4DTAA 3NUYA 4RA5A 1XBAA 5AIRA 4NW5A 3UNZA 3UP7A 2W1ZA 4WG5A 4F0FA 4BY9E 4YJQA 3NRMA 5AR7A 3TEIA 3OCGA 3A7GA 1LUFA 3DNEA 4R7IA 3MPMA 3F7ZA 2WMVA 4AE9A 2R3QA 2R4BA 3H0ZA 4RJ8A 4A9RA 3R63A 4A9SA 4MBIA 1I44A 4QMSA 2WGJA 4AN3A 3NNUA 5I9YA 3NUUA 5DRBA 1YXSA 2FVDA 3C5IA 3NFGB 4J99A 4WRSA 4ZJIA 3LXNA 3R9HA 3PP0A 5EDPA 4NTTA 4QP1A 4FIHA 4RJ7A 4M69B 2Z60A 4O0SA 4YJTA 1J7IA 2QO9A 3ATSA 4H3PA 4TYHB 5FEEA 3F88A 3KL8A 4L45A 4D0XA 4CV8A 3AMAA 1RQQA 3I7CA 5A6OA 2W1HA 5AUYA 2XKFA 4C4IA 4I94A 3BLAA 5KZIA 3TNQB 2PL0A 4P2KA 3VUDA 4AW1A 2GQRA 2XM8A 3NW5A 3UIXA 4HNFA 1WVXA 3GC8A 2C0IA 4IBMA 5BX0A 5B0XA 1OGUA 2XK3A 1DAWA 3O2MA 4OTRA 3DXPA 2PUPA 2BFYA 4PDYA 5M08A 2FYSA 4HVSA 3ZZEA 3K5UA 5J79A 1TZDA 2PMNX 5CEQA 3IDBA 4IXPA 4BDDA 5IH4A 4XOZA 3HV5A 2ZB1A 3E87A 5HD7A 4GJ3A 4QYYA 2C6IA 3VS4A 3OC1A 4QO9A 1KE9A 4K77A 3ZRLA 3DDQA 3IGGA 4O0YA 4R7BA 3DKGA 1IR3A 3QHWA 4QTBA 5BVNA 4W4XA 4BYJA 4AQCA 5FTOA 2PVRA 2XNMA 4IADA 2AUHA 2BKKA 3NVMB 4O22A 3PFQA 3T3VA 5KMIA 3CGOA 3ORLA 3SV0A 3TXOA 2Y4IB 2YM5A 1Q5KA 3LIJA 4FV7A 4M13A 4EI4A 5CF6A 4AX8A 1KUTA 4EH2A 2EWAA 3B2TA 3H4JA 4BCFA 3Q4UA 4NT4A 3LCKA 5TE0A 2ZM4A 3A7HA 4JDKA 2GNLA 2X0GA 1JVPP 3AQVA 5H3QA 5E90A 4JRNA 3KCFA 2JKKA 5CVFA 4DH8A 3QRIA 4P4CA 4W8DA 1UKHA 4J52A 4CZTA 4ZEGA 3I7BA 1HCKA 3OBGA 5A4QA 3CPBA 3ETAA 5AV4A 3T9TA 4JOAA 3AKLA 1UU8A 3ERKA 3TACA 4J71A 3FSKA 4KKGA 5E1SA 4E26A 1JBPE 4JBOA 2OXYA 5CU0A 5IH6A 4FNYA 2PULA 2X8EA 1GJOA 3R21A 5CZHA 4YBJA 5FM2A 4IX6A 3VHEA 4DGMA 1REJA 3SXSA 1H0WA 5EM6A 5LVLA 2XAMA 3U9NA 1CKIA 2QQ7A 4NJDA 2WXVA 1T45A 4GYIA 1PKDA 1Z57A 3FLZA 4HGSA 3Q5IA 3I5ZA 3EJ1A 2OF4A 3H9FA 3IECA 4G6OA 4I23A 5E8YA 5CT0A 4BI2A 4JBVA 1U54B 3QWJA 5HGIA 4N70A 3U87A 5HD4A 4WSYA 4I5HA 5LVNA 1ZAOA 2YHVA 4DG0E 1PMVA 2DS1A 2X2MA 4FUYA 4PNIA 1JSVA 4E6QA 3I0OA 1F5QA 4Z7HA 2YIQA 5ANIA 5HVYA 4MWIA 5KMKA 3LFSA 3HEGA 2XIZA 2PMLX 3BX5A 4WG4A 3G51A 2OFVA 4V01A 2VTQA 4CMUA 4D2RA 1YVJA 3DAKA 1OM1A 3O7LB 5K0XA 4KABA 5CQWA 4D55A 2VZ6A 1A06A 5C8NA 2UW5A 2O5KA 1BLXA 4FVRA 1WBWA 1XR1A 1O6YA 3L9PA 4X2NA 4ANSA 5J9YA 4ANOA 3ZUVA 2I0VA 4OAUC 4GKIA 3BU6A 3QTRA 2R9SA 2C47A 4FL2A 4TYGA 4DBNA 4YJSA 4F0GA 1DI9A 4IHPA 5FDXA 3FYJX 3F6XA 3LXLA 4JLCA 4CMTA 5IA3A 3UO5A 3LJ0A 4NJ3A 3DQWA 5EYDA 4K0YA 5HICA 3IW8A 3V6SA 4O91A 4RQKA 2VWZA 4IZ5A 1EH4A 5F9EA 3NUSA 3CQUA 3WZJA 5AA9A 4QP9A 4UYAA 4H58A 4ANLA 3MFUA 2EXCX 4RVLA 4I4FA 3S2PA 4UV0A 2R3KA 5EI2A 2W1CA 2A98A 5HIEA 2QOQA 3LFBA 3NVKI 1W8CA 3EN7A 2VU3A 5HNIX 2JIVA 4JR3A 3BCEA 4AZSA 3QGWA 2C6OA 3Q4ZA 2PE1A 2WOUA 4DEEA 5LMKC 1H4LA 3IOPA 4QMNA 3DGKA 4WSQA 2QOOA 4JL9A 1Q8ZA 4Q5EA 3WF9A 3WYYA 1MRYA 2ETMA 3NZ0A 2XJ2A 2Z7SA 5M53A 2R3NA 3RINA 3OFMA 3UDTA 3BHTA 2C5XA 3NR9A 4AWIA 3FHIA 1O6LA 1OB3A 2G01A 2W9FB 2I7QA 4IVAA 4YNOA 3DTWA 2XARA 4GYGA 5IDPA 3JVRA 2QNJA 1OKVA 3AD4A 4MXCA 4EOPA 3ENHA 3IDCA 4RX9A 4APPA 3DOGA 5JK3A 4FV1A 4OUCA 4HCTA 2UW4A 4JG8A 1UVRA 4L44A 4WUNA 4O0RA 5IQEA 2J2IB 5H8EA 3TWJA 2CNVA 3E7OA 2F9GA 2WTCA 4RIYB 3ZDIA 3ZOSA 1RW8A 4EH9A 3UQCA 4F1TA 4FTQA 4FTKA 2WTKB 1OI9A 5L2WA 2P0CA 3SG8A 3HX4A 4BDJA 3KU2A 5B2MA 2A0CX 4OTDA 4L7FA 2Q0NA 3TL8A 4AZWA 4AA5A 2X2LA 4YJRA 4H39A 1U5QA 4QMPA 4QP3A 5KKRB 4F08A 2J0MB 4DTBA 4CFFA 4ZLZA 5CU2A 4O84A 3BLHA 3RPVA 5B2LA 2XRUA 4PV0A 3ZM9A 4UMUA 3BQRA 4MD9E 4EOSA 4F63A 2XK7A 4BGGA 5I3RA 4MQ1A 4FOCA 4L8MA 2CN5A 4FKRA 4IH8A 2X39A 3DA6A 4NFMA 3PLAE 4BI1A 3H9OA 3U8WA 4RWIA 4TKSA 2YLEA 2WMXA 3RWQA 4ALWA 3Q3BA 3GOKA 5KMJA 1ZZ2A 1H27A 4GUEA 1SNXA 4XP2A 5J7BA 4JBQA 3VF8A 3BU3A 4QPSA 4E6AA 4EUUA 5EW3A 3DLSA 1KE7A 5AAGA 3CY2A 3UODA 4O4CA 3VJOA 3I81A 1OL5A 2C69A 3NW7A 4BZDA 1IAHA 4KBCA 2J50A 5FBNC 1H00A 5LMKA 5LWMA 3CD8A 4CMOA 3EKKA 3ENMA 3HP2A 4RC3A 5M4FA 3P86A 4TWOA 4J53A 5AV1A 1TQIA 2W4OA 3DFCB 3HV4A 5CF8A 2JDRA 3WZDA 4UMRA 3C4ZA 3KMMA 3WF7A 3IW5A 3E3PA 4NW6A 3E8NA 1P14A 2XNBA 4Y5QA 3R7UA 1ST0A 5KMLA 5ANOA 1PYEA 4QRCA 3ZDUA 4ACCA 4F1MA 3BEAA 5JFSA 4GS6A 4RPVA 3FMEA 3ACKA 3F61A 3D83A 5ANJA 4CFUA 3FWQA 4R5YA 2YISA 4C58A 3QRTA 4ZY5A 5DR6A 3QZFA 5L6WL 5K5NA 4RIXB 2XIKA 5K5XA 4AG8A 5L2IA 4G3CA 4M84A 3PSCA 4O1OA 2B9IA 4D1SA 3BKBA 1IAJA 3BE9A 5A9UA 1P4FA 4R77A 3Q2JA 3TZ8A 5BYZA 3V5JA 3B2WA 4RQVA 4IB5A 4FTLA 4S2ZA 2HXQA 4FEQA 4E20A 3G90X 2BIKB 4R3RA 3A7FA 2OF2A 3P4KA 4Z3VA 3OZ6A 5GIPE 3RPYA 4CRLA 1FMOE 1Y8YA 4AT3A 2PK9A 3NUNA 4X2KA 2RG5A 3B8RA 4RFMA 4NEUA 3QX4A 5AIKA 5AUZA 3VBTA 4FA2A 3RBWA 1GZOA 3ZUTA 4AAYA 3EYGA 1H1QA 3DKFA 5EI8A 3ZSIA 4C62A 4V04A 1W2FA 3QALE 2R3FA 2ITVA 2GHMA 2C5VA 2O8YA 4XHKB 2UZVA 3TN8A 2XB7A 1CKJA 4BKZA 2JFMA 3DU8A 2WQMA 5T68A 2REIA 2UUEA 3G9NA 4MK0A 3C1XA 5K3YA 1G5SA 3RGFA 3LCOA 3SXRA 3DAJA 5C03A 3SKCA 4JR7A 4JQ8A 4F70A 3RNYA 2IZUA 4OLIA 1H26A 4QTDA 3R7EA 4YZNA 2X8DA 1YKRA 3QLGA 3ZUUA 4MXYA 5AUXA 4CLJA 3QBNA 1YXUA 4BCNA 2W05A 4UWBA 1DI8A 2PMIA 4FTCA 4P5QA 1CKPA 4EKKA 4EQMA 5DEWA 3RZFA 2BRBA 2PZIA 4R3PA 3RI1A 5CS6A 5J1VA 4EHZA 2BZJA 4I6QA 3D5WA 1WMKA 3PJ8A 4U3YA 4O21A 2WTIA 4D2SA 4FZ7A 3W33A 5HTCA 1OPLA 2YLFA 2YCQA 4PDPA 4PP7A 3UIUA 5CAOA