1XH5A

Crystal structures of protein kinase b selective inhibitors in complex with protein kinase a and mutants
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Design and crystal structures of protein kinase B-selective inhibitors in complex with protein kinase A and mutants
pubmed doi rcsb
source organism Bos taurus
total genus 111
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xh5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xh5A02
1Y8YA 4A07A 3QD0A 2YDKA 4IADA 4CNHA 1SM2A 2QOCA 5CX9A 2A27A 1XH6A 5DT3A 4KIKB 2YHVA 3QTWA 5DIAA 3QFVA 3UBDA 3L8PA 5LJJA 4O81A 4BGHA 3WZUA 3UC3A 3E63A 3FWQA 2ERKA 2W99B 5E8WA 5ETFA 4BFMA 3QLGA 5AX9A 1NVSA 2WQOA 4KRDA 3FMKA 1UWJA 5AIRA 2R3QA 4ZP5A 5CT0A 2KULA 3GU6A 2PSQA 4FSTA 4G1WA 5EM6A 5GJFA 5D7AA 5AUZA 2WTVA 3I0OA 3R8VA 2GNHA 3CKWA 4AA4A 1YOJA 4XBUA 4IB0A 4CV8A 1VEBA 4OTGA 3AMBA 4QNYA 3VBVA 3ZSGA 3QQUA 2JD5A 3MW1A 5GJGA 5KMOA 4G9RA 5HHWA 4ZJIA 2UZNA 2C5NA 5I0BA 4FGRA 4AW0A 3K3IA 4W9XA 2X2KA 3V51A 3AD4A 3VS7A 5AUXA 4DGNA 3AT4A 4BCHA 5GIPE 4OUCA 1P5EA 4RWLA 5TKDA 4ASZA 3I6UA 4BIDA 2O5KA 1ZZLA 3P0MA 4IWOA 3R7GA 3QRJA 4P7EA 4PPBA 2ZM1A 3GCUA 3CPCA 2PVLA 3AC8A 4FKSA 3C4ZA 4IWQA 4RFMA 5LVNA 4FTRA 5CAVA 2J5FA 3WF8A 4FVQA 2EXMA 4MCVA 3E64A 3ZLSA 4QQJA 2X4ZA 2Y9QA 5A46A 4F99A 2YFXA 3UZRA 3PLSA 2XK4A 2X8IA 1BKXA 2X39A 1YHWA 3WI6A 4JRNA 1UNHA 4NTSA 2GNFA 2Y7JA 4I3ZA 4PMPA 2V5QA 3FKOA 2JDVA 3EZRA 4OTIA 5AV1A 3DKOA 4WRGA 4CD0A 4EKKA 5BQ0A 4WG3A 3LMGA 3DAJA 3RBWA 1JBPE 4H39A 4I22A 1Y6BA 2UW3A 4KUJA 4LOQA 2BVAA 5K4IA 3PDTA 5E91A 3BYVA 5HNIX 4DFUA 4PUZA 2PHKA 3PVWA 2WB8A 3BU3A 3MWUA 1XJDA 3ORKA 4XV3A 3LVPA 5ETCA 5FEQA 3SG8A 4YC3A 2HIWA 3OTVA 2OG8A 3LCDA 2BKZA 4YZCA 3R8UA 3FMHA 4LQMA 5AR8A 3F88A 4R77A 2QO2A 4K0YA 4LV5A 2WU6A 4U3ZA 2ITYA 1GZNA 4XX9A 5TR6A 3LKMA 3EMGA 3LE6A 3RAKA 3GU5A 2YM5A 1WVXA 2HOGA 3AG9A 4ZK5A 1KOBA 3QQFA 5JZNA 3W55A 2HY0A 4F7SA 3C0GA 5BNJA 4R1YA 2W17A 5C8NA 3DOGA 2WMUA 3NPCA 4XV1A 3F2AA 5J7HA 2UZOA 4R7BA 2ESMA 3F66A 3RAIA 2WTDA 4PMTA 2B0QA 4BDIA 3GFWA 4A9UA 4C2VA 2Y6MA 4BIBA 4FV0A 3ORZA 3QGYA 2FSOX 2ITWA 3C4FA 4AT5A 4Z7GA 2C3KA 4EK4A 2OZAA 5M51A 3LFDA 3QCSA 4JQEA 4L8MA 4MF0A 2XIKA 3F2RA 3DFAA 5J9LA 3JPVA 1UU9A 1H0WA 5L2QA 3RPRA 5G1XA 4EI4A 2BZHB 2JAVA 4BTKA 3ZHPC 3CD3A 2KTYA 3COIA 4FTMA 2R3JA 3KULA 5CEOA 5I9XA 3MJ1A 3ITZA 5AAEA 5KX8A 2R3GA 4RIYA 4U80A 4FBXA 3LW0A 2YZAA 4JDHA 4OTRA 5CEKA 4K1BA 3A7FA 5LCJA 2F9GA 1J7IA 3VULA 5ANGA 3QUDA 4ZLYA 2QI8A 3UPZA 4F0IA 2B9FA 3SAYA 1YXTA 4PTCA 2YAAA 3TTIA 2J0MB 3BHTA 5FM2A 3EN9A 1FOTA 3NIZA 3V6SA 4E6AA 3UIBA 1YI4A 2J9MA 3Q60A 4UZDA 2VNWA 2VTQA 4X7QA 5FLFA 4AZWA 2ZB0A 5CENA 2CPKE 4BTJA 4DC2A 5KKRB 4Y46A 5IKWA 3HAVA 4AUAA 3PE2A 1DM2A 3GXLA 2I0VA 2BTSA 2X8EA 4Z16A 4QRCA 2BZIB 4DEDA 4APCA 1SYKA 1YI3A 2I0HA 3FKNA 4EHZA 3HV7A 1BLXA 4USDA 4CYJA 3UZTA 1ZMUA 3FMNA 2WTJA 4O7SA 4RC3A 4U43A 2X81A 3OEFX 4B0GA 3NUYA 4CMTA 4ZZOA 5BYLA 1GJOA 3VUKA 4U9AA 3FHRA 4J1RA 3VUIA 2HWOA 2VD5A 2W1ZA 3MVLA 5EW8A 5AP6A 4MK0A 5HCXA 3QZHA 4ANQA 3OWPA 2H9VA 2E9OA 4ANOA 2XKCA 2AYPA 3TXOA 5JN2A 4RX5A 4FKIA 4YZ9A 3T9IA 3R71A 2JDRA 3WYXA 5EG3A 5AP1A 4B99A 4ZJVA 3RINA 2J51A 3KL8A 1J1CA 2XM8A 3ZEPA 4D28A 2BKKA 1M52A 3PG3A 4HGSA 3A4OX 4FIEA 4H3PA 4JOAA 3NGAA 4UEUA 4EH5A 4PDPA 4F09A 4RJ8A 4D55A 4G9CA 4FSQA 4LMNA 3PZHA 4XYFA 1SVEA 5FTQA 4FTAA 4JQ8A 5IU2A 4RVKA 5L6OA 5B2KA 4DF3A 2PVJA 3MFUA 4H1JA 3H30A 4L52A 4PX6A 5CAUA 3F3VA 4ZOGA 4FT7A 5CXZA 3F3TA 2XNEA 3FXWA 2XEYA 3QA0A 4N0SA 2OI4X 1X8BA 4ACCA 2VTLA 1Q62A 3PVGA 4EUUA 3QC4A 4NW5A 5CF4A 3ZBXA 1UWHA 1MP8A 4XG2A 3KK9A 1H08A 4R8QA 2QOQA 3HV6A 2PZRA 4U7ZA 3TZMA 4R5SA 1ZOHA 4UX9A 3LMIA 3RPVA 2XIXA 4N70A 1NW1A 2X9EA 4APPA 3ROCA 3OXIA 1PXLA 3FXXA 4CZTA 4KS8A 5EI2A 4YJSA 1A48A 3DKCA 4NCTC 4UY9A 4M66A 2O3PA 3UIUA 3TKHA 5LVMA 4I5HA 2I6LA 1H4LA 4G3GA 2VO0A 5HG9A 4J53A 1CM8A 3F5GA 3U8WA 3DBEA 4MH7A 4QMSA 2QCSA 2YDIA 3BV3A 3EL7A 1OVEA 4WG5A 4TWCA 3C4EA 3AMAA 2XZSA 2OXXA 3FZSA 4IW0A 1AGWA 2HW7A 2BFYA 2UZWE 4HJOA 4I5CA 4PY1A 3VBYA 3KRWA 3UO5A 2XF0A 4OGRA 4BVUA 1GNGA 4AX8A 4IE9A 1Q61A 2CDZA 4AAAA 5FUTA 4MF1A 1UNLA 4JJRA 4L45A 3NWWA 3RPSA 4R5YA 5BYYA 4QYFA 4C34A 3NZ0A 4X2KA 3CXWA 3P1AA 3PJ8A 3ZCLA 1OL7A 3KREA 3GBZA 4RIWA 3RAHA 4MTAA 4I1ZA 2GFCA 4L3LA 5F4NA 2PE0A 4FNYA 3ULIA 4DFLA 3ZLWA 4EOSA 1JSTA 1R1WA 2B9JA 3CC6A 3OP5A 4TY1A 4R1VA 4HGTA 3R0TA 2P2IA 2WZJA 3OW3A 1XH7A 2QOHA 1HCLA 2F4JA 2PMLX 2WMBA 3IDPA 3Q9XA 1ZZ2A 2R3HA 3ZU7A 4BDJA 2XVDA 3AC1A 4KIKA 2RF9A 4IZ5A 3RTPA 1QPEA 2Y4IB 4UWBA 4DINA 3D2IA 4GUEA 4K77A 3A7JA 4JIAA 4LOPA 3C4CA 2I0EA 2YIQA 3BYSA 5IA0A 4NL0A 3TDVA 2IJMA 3BHHA 3EJ1A 4NCTA 2J0LA 4C36A 4EHEA 3EQCA 1IAHA 4E1ZA 5DRDA 3R9HA 4UYNA 3VW6A 5EQPA 4GFMA 1ZXEA 5IH5A 4OTDA 2Z60A 3DQXA 3O17A 4IB3A 1KUTA 5JGAA 2OU7A 2PWLA 1P14A 1YXVA 3BGZA 1F5QA 3V01A 5IQIA 4XP2A 2IZUA 4AZVA 5EW3A 3A8XA 1YDRE 4E6CA 3TM0A 3QRTA 2BHEA 2C5OA 4CFUA 3Q3BA 5GZ8A 4WUNA 4GT5A 3UNJA 2J5EA 2FUMA 4D1ZA 2ONLC 5FWKK 2UVXA 2VNYA 3VS0A 4F9CA 4CEGA 1G5SA 4QYHA 3DNDA 2C6DA 3F5XA 4KBKA 2PYWA 2IO6A 4DEGA 4K33A 3QTZA 3L9MA 4X6RA 4QTAA 3TNHA 2ITOA 3R9DA 1JPAA 4WNPA 4EQUA 2WQEA 4QMQA 3W2CA 3EQDA 3FMDA 3WIGA 3AT2A 4FF8A 5K0XA 4AW1A 5BUJA 2QHMA 3POZA 2OO8X 4RBLA 5IUIA 3S2PA 3WF5A 1KE9A 3ZYAA 2X7GA 2XRWA 4Z3VA 3JYAA 3V6RA 2QLUA 3G6GA 1Y8GA 3HRCA 2QODA 4H58A 5HNBA 4KIPA 4QQCA 2JC6A 2PZPA 1GZ8A 3A7GA 3VAPA 4EUTA 4D5KA 5A14A 2R3MA 2PMOX 2UW4A 4TKSA 1T45A 4KS7A 3G15A 2ITVA 3OZ6A 4IX6A 5FG8A 5AFVA 4XOYA 3UOKA 5IMXA 4I4FA 2P2HA 5CXHA 4ZMFA 2DQ7X 3O96A 4YJUA 4QMWA 3UOLA 2WNTA 3GI3A 2UW7A 4IIRA 2DYLA 2PVNA 3DZQA 3K5VA 3OFMA 4FSYA 3ZLXA 5BX0A 2EUFB 3AQVA 4ZS0A 2NPQA 4IVAA 5EK7A 3R7OA 4FNWA 3KXNA 3R30A 3GGFA 5M55A 4BKZA 2ONLA 4IM2A 3NX8A 4GJ3A 3QQHA 4UMQA 4A7CA 4YLJA 3W2PA 4ZSAA 3QCQA 2OKRA 4HGEA 2X1NA 3R1SA 4I0RA 5HKMA 3H4JA 4RSSA 4EH2A 4EJNA 4BRXA 4O84A 3EH9A 2R7IA 1S9JA 3F82A 1URWA 4D0WA 1CSNA 3G0FA 4GYIA 2I40A 3PZEA 3H9RA 2X6DA 2IVVA 3GB2A 4DG0E 4U79A 2WQNA 1OPLA 4B8LA 2WQMA 4O2PA 2YIRA 3WF7A 4E4MA 3CE3A 5KUPA 3I79A 4FL3A 3IDCA 5BVDA 4PNKA 3F7WA 3TL8A 2CKQA 2UW6A 1XH4A 3ORXA 2R9SA 4FTTA 1FMKA 1Q3WA 3NSZA 4CT2A 3MFSA 4C37A 1OPKA 3H9OA 4OTHA 5JMSA 4N57A 1OL1A 3F61A 2C5XA 1VR2A 3K2LA 4HOKA 5IG1A 5EYMA 3WF6A 3FMJA 2XKEA 1U4DA 1OBDA 3ZUVA 3EN7A 3C5UA 3LJ1A 3N4UA 3MH3A 4YR8A 3FUPA 4K9YA 2W1CA 3K5UA 5CTPA 3MSSA 2PU8A 4WT6A 4ZTRA 2ZOQA 3FV8A 5JSMA 4BI2A 3CJGA 1LR4A 1VYWA 3BHVA 5CWZA 3S0OA 3CLYA 3VS1A 2OZAB 4YSJA 4JAIA 5EH0A 3VN9A 5C4KA 2XJ0A 2X0GA 4PPAA 3GENA 3G2FA 5BVWA 4AWIA 3Q6UA 4CXAA 4CKRA 4J95A 1PXNA 4D4RA 5HORA 4G16A 5D11A 2GFSA 3BWFA 4PRJA 1ZLTA 4H3QA 2YA9A 4XCUA 4FG7A 4IHPA 3Q96A 4C8BA 4Z9LA 4F64A 3WE8A 4KABA 3P08A 4RIYB 2ZV9A 2P33A 3UP2A 4RFYA 3FY0A 3CKXA 4WBOA 3W16A 4ASDA 5EM5A 2YM8A 2IW6A 3VS3A 2WMQA 3OBGA 4I6BA 1F3MC 3HMNA 4LYNA 3ODYX 4CZUA 2JAMA 3KMMA 4FYOA 3DDPA 3DDQA 5CSVA 3SXFA 1ND4A 2ITXA 2CHLA 3ZXTA 4EOQA 3SD0A 3ZSHA 5F1ZA 1ZAOA 4DEEA 5CEPA 5KMLA 5HE0A 3UMXA 4QO9A 4G3EA 2BFXA 1V0OA 3LQ8A 3NNWA 4B6LA 4FV9A 2C3LA 5B7VA 5M56A 4D9TA 2CN5A 3QU0A 4FSZA 5CAQA 3NIEA 3P4KA 5DN3A 5G6VA 3ORIA 3DBCA 3W8LA 3UGCA 4YPDA 5HVJA 5HTBA 5IQDA 4YHTA 4RWKA 4I20A 4BCIA 5IEVA 2HXQA 3IOPA 5EHYA 5A6NA 3QZFA 2VTPA 5IH4A 4NTTA 2JITA 3LFEA 2XNPA 4EOLA 4KIQA 5M57A 4GK2A 4TWNA 2GPHA 2JBPA 2JKMA 3DTCA 4J8MA 5ANJA 5D9HA 4JVGA 3R8PA 3V5PA 4YUQA 2R3LA 5EDQA 1RDQE 2AC5A 4F9AA 2XNNA 4M68A 3KN5A 2QU5A 3KF4A 4OTQA 2E9PA 1OZ1A 3F3UA 4FODA 4WBBB 4EJ7A 5JRSA 1OM1A 2QG7A 1UA2A 4IEBA 4DGMA 1BL6A 3KXHA 3UJGA 3FBVA 3QA8A 4F6WA 2OZOA 2R3NA 4GKIA 2GHLA 3HMIA 4A9YA 2YERA 2UW5A 3B2TA 5D7VA 5FEEA 5GNKA 3A61A 2ZYBA 4D0XA 3PIYA 5M06A 3LIJA 3DB6A 5J1WA 3A7HA 3UC4A 3FAAA 5AM7A 5BVEA 5CLPA 5EI8A 5J7BA 1JVPP 3P7BA 3RP9A 4MXCA 5HEZA 3VS4A 4FL1A 4CCUA 2YJRA 3O2MA 3P23A 4FG8A 3NLBA 3MB6A 4FKWA 4GT4A 2BHHA 1U5RA 3ERKA 4O96A 4CFVA 2ZV8A 4JQ7A 5L3AA 1A9UA 3EQIA 1T46A 5ETAA 4WUAA 4CGAA 2QU6A 5HIDA 1K9AA 2GS2A 2GU8A 2HWPA 3H0ZA 4FTJA 3SXRA 3L8XA 3LXPA 1B6CB 2J90A 1CMKE 2JFLA 2W1DA 3DPKA 3E7OA 4O0YA 4BBFA 2W05A 3EKNA 3PRFA 5ITAA 5DEWA 2C5VA 3LQ5A 3E88A 3E3BX 3COHA 3CPBA 4TYJA 3V3VA 2JIUA 2QG5A 2ZAZA 3VW8A 3ETAA 4KSQA 2WMVA 3HDNA 2P55A 4NM7A 4AZFA 4AA0A 4RIXA 4RRVA 3RMFA 2H96A 4UWYA 4IX3A 5F94A 1Y57A 2WOTA 3L9PA 4Q2AA 2HK5A 4K6ZA 4XG4A 4RWJA 1Z5MA 3CJFA 3W2RA 4CCBA 3QKKA 4KA3A 4NT4A 3CIKA 3LCTA 3FMMA 3OY1A 3PXZA 3F3ZA 4I6FA 4HZSA 4ANLA 2C47A 4QTCA 4DCEA 2ZMDA 4RX9A 4I24A 2JFMA 4JX7A 3WZEA 1FMOE 4QP6A 4UWCA 4EWHA 3DAKA 2VGOA 3OHTA 2UZTA 3QXPA 4D2PA 1CKPA 4YC6A 1VYZA 1ATPE 3BE2A 3E8EA 2BTRA 1PW2A 4YTCA 2W1FA 3ENHA 2ZMCA 1UNGA 4L01A 3DXNA 2ZDUA 3G0EA 4QOXA 5E8TA 3QTQA 2O64A 1MQBA 3CTJA 3GFEA 5ANIA 3TJCA 3W8QA 3GC7A 4FT5A 4IZAA 1NVRA 1Q8TA 3PA3A 3PUPA 5E8SA 2R5TA 4QT1A 3BIZA 5HE2A 5B2MA 4RJ7A 1UU7A 2P4IA 5HESA 1YVJA 2C6EA 3TNIA 4FTNA 2YCFA 1QL6A 4JR7A 4FT3A 4XG6A 2VWIA 3ZS5A 1WBVA 2PY3A 3TUCA 4YJVA 4RVMA 5HE3A 1H1WA 4EOJA 4BDGA 4FK6A 2YJSA 1XBAA 4IJPA 3ZM4A 3R1QA 2WEVA 3KU2A 5BPYA 2UW0A 5CU3A 5AIKA 2BIYA 1PXJA 5KHXA 1KV1A 2Y8OA 3LCKA 2PZYA 4MXYA 5TO8A 3VIDA 3NAYA 4KD1A 4BZOA 5HBJA 4JS8A 4KRCA 2ZB1A 3JVSA 3LFSA 3HECA 4A4OA 5CNOA 4C4JA 4GV1A 2GTNA 2PVMA 4FVPA 4XV9A 3ZUUA 2EB3A 5EQYA 1J7UA 5CVHA 1OIYA 3SW7A 5ANDA 1OUKA 4XLVA 4YC8A 3BBWA 4IAKA 1K3AA 2YITA 2B7AA 2VTAA 4R6VA 4DFZE 4JL9A 5CVGA 4L67A 1PYXA 2WMTA 4OT6A 4JG8A 1FGKA 4KKHA 2GQSA 2I7QA 3FY2A 3PA4A 4YTHA 3OCSA 5CU2A 2RG6A 3CTQA 4CMUA 4ZJJA 5CAOA 4RLKA 3C4XA 3DTWA 1OIUA 4KINA 3G9LX 1WBSA 4DTAA 3D4QA 4LGGA 1JWHA 3MPMA 1BMKA 3VHEA 2C4GA 5C26A 3CQEA 1W84A 4IJ9A 5LMKA 4AZEA 4RZVA 5FDXA 4AGWA 1F0QA 4CRSA 2Q83A 3KRLA 5E9EA 5J9ZA 4FKQA 4QYEA 5JK3A 5K4JA 3I5NA 5C4LA 5L6WL 3BLQA 4D9UA 4WOVA 4UMRA 3IW4A 4J52A 3R83A 4FR4A 1LEWA 3P5KA 3PTGA 3SRVA 4LGHA 2Z7RA 4B9DA 3MB7A 2WQBA 4DFBA 4I6QA 1OIRA 3R73A 5D12A 4CKJA 3KF7A 4AE9A 4HVGA 3Q4ZA 2GHGA 3AGMA 4YHJA 1H8FA 3QALE 4A9SA 4CFNA 3FLSA 3N51A 5JZJA 1KE6A 4O7VA 5A6OA 3LMHA 4BDBA 4AZSA 3OF0A 3UO6A 2PZIA 3TV7A 3RKBA 2QLQA 1MRYA 3GP0A 3F3WA 3FLYA 4X6QC 2IZSA 2VTMA 4BICA 3EFLA 3U54A 4QQTA 4J98A 2XIYA 4IAAA 2CN8A 4R3CA 3A4PA 5HBHA 3EFJA 2ZDTA 3MGYA 3OT8A 3O7LD 3ZO2A 1H24A 4EH3A 2OJ9A 1Y6AA 3FMLA 4MD7E 5FTOA 3VF9A 2C6KA 5AM6A 3R04A 5KZIA 4C3PA 4MNEA 2QR8A 4GK4A 4O0TA 2OBJA 5FGKA 4FV5A 3MY0A 4G3DA 4KKEA 4KBCA 4LRMA 5LMAA 3U87A 3BGPA 3QTSA 4EOMA 4FTLA 5CS6A 1XH5A 1RJBA 4PF4A 3Q5IA 3FJQE 2XUUA 3MPTA 4NYEA 4EBWA 3GCSA 1Q4LA 4ITIA 4O22A 2HZ4A 1PMUA 5CSXA 1FVRA 2WIHA 3ZDIA 2OF2A 5IA1A 3R02A 3QCYA 4L00A 4MHAA 4O7RA 2WMRA 2W7XA 3FL4A 3MIYA 2GNIA 5L2TA 2V7OA 3L8SA 3QTIA 4W4VA 4FEVA 3IW8A 4LV8A 1XHAA 2OF4A 5IEYA 4LRJA 4GMYA 3W2SA 5KBQA 1UU8A 1M7NA 4O7WA 3KMWA 3T3UA 2WTCA 3PJ2A 2QR7A 2W1IA 1JKKA 2VWYA 4FVRA 4ZS4A 4FL2A 3DK7A 2ZM4A 3ZRMA 2WGJA 3E8CA 5K0KA 3ZRKA 4EEVA 3PPZA 1UKIA 2JKOA 3TUDA 3RK7A 3UIMA 4W4XA 3ATTA 5AADA 3KRXA 3MY5A 5EYKA 4GFOA 3AGLA 4HCVA 4WIHA 3TTJA 3G33A 1J3HA 3ZC6A 3PVUA 2VWVA 4FTKA 4CFMA 3OCTA 3T9TA 2HXLA 2WFYA 3R8LA 2CLXA 3IKAA 4PMSA 3LXKA 5HG7A 5HG5A 4EH4A 5B2LA 5IQFA 3AD6A 3FDNA 2VX3A 1AD5A 3Q32A 3RM6A 4IMYA 1XQZA 4UYAA 3POOA 2X7FA 2C3JA 2EXCX 2OH0E 4M7IA 5ANKA 3SVVA 4ZZMA 3A99A 3LZBA 4NM0A 3OXZA 4RQVA 2OK1A 2OW3A 3DBFA 1ZYLA 2VUWA 2WMAA 4YP8A 3EIDA 3MTLA 1YRPA 3MA6A 3QTUA 4MBLA 4CKIA 1WMKA 2IW9A 2G9XA 2PE1A 3NYXA 4M0YA 1HOWA 3RVGA 4D1SA 1JLUE 2Z2WA 4TWOA 3BQRA 3ZRLA 2E2BA 2XP2A 4ITHA 2GQRA 2I1MA 4CG8A 2P3GX 4NM5A 2FSTX 2VGPA 4XJ0A 2C69A 3AD5A 4GJ2A 4X3JA 3SA0A 4PMMA 4U81A 4FIJA 5DMZA 3F9NA 1PXIA 3A2CA 4ANBA 4U45A 1PY5A 1H25A 5IPJA 3KN6A 5CEQA 3C9WA 5IQGA 3PXKA 5LCKA 2XK7A 3BBTB 1ZYDA 1XKKA 1TVOA 3FLZA 3H0YA 3MVHA 4ZXTA 3DLZA 4DH5A 2VN9A 3BEAA 4IZYA 3S3IA 4RVTA 2CNUA 4BIEA 4QP4A 3II5A 3REPA 4FX3A 3AOXA 2CCIA 2V55A 3BEGA 4LL0A 4D2SA 4Y5QA 2FSMX 3KFAA 5DR2A 3OEZA 3V5WA 5BVKA 4B4LA 4O7YA 4WKQA 1STCE 3BRBA 3A60A 2XKFA 2CGVA 3EQPA 3QAME 2QOOA 4G3CA 3DY7A 3FL5A 4NJ3A 5F95A 1GIIA 3D0EA 3G5DA 1PKGA 1Q8YA 3FI4A 3DBQA 3R2YA 5H3QA 4YZNA 2H6DA 4MX9A 4EH6A 4TL0A 3F5UA 3NNXA 4BBMA 2BRGA 2GNJA 1Q5KA 3QQKA 3U9NA 5JFSA 1H27A 3ZUTA 4IC8A 5EQEA 2QOIA 1H1QA 1R0PA 1XBBA 4C2WA 5C1QB 2XBAA 3U6IA 3MS9A 3U9CA 4FV2A 5J1VA 4V0GA 4ZSJA 4WG4A 3W1FA 2W4OA 1JNKA 3CTHA 3UG1A 3U4UA 4DH3A 3Q53A 4CT1A 1ZY4A 3AT3A 2XS0A 4R3PA 4OLIA 4J7BA 4JDKA 5DG5A 1KOAA 1OL5A 2W9ZB 5DI1A 5LOHA 2BZKB 2ZM3A 3ORTA 4DITA 2QOKA 4NKSA 3ORNA 1M2QA 2IVSA 2ETMA 2QOFA 3UVRA 4FSWA 4UZHA 3VJOA 3R8MA 3QYZA 4BGQA 1MRVA 3P9JA 3OWJA 2W1GA 4PL3A 4BYJA 4HYUA 5HICA 3ACJA 5A3XA 4FEWA 4RWIA 1SNUA 1OECA 4O7ZA 4XRLA 5GHVA 4X2JA 5L8KA 4USFA 5EYDA 2UVYA 2OJJA 2C3IB 4IAFA 4TYEA 5IZFA 4EK8A 4IZ7A 3MV5A 4AE6A 1CTPE 2R64A 3M11A 4FGBA 5DR6A 3VBTA 4BDFA 4YMJA 3PXYA 5H8EA 3CBLA 2PUIA 3TWJA 3U55A 5LQFA 4PTGA 5I9VA 3LHJA 4YJTA 3VS2A 4AXAA 5C9CA 5M4FA 1A06A 2HAKA 3R7VA 4HW7A 4EONA 3NW6A 3C50A 3TKUA 4EQCA 4YNEA 3D15A 3ID6C 4RIXB 2GTMA 4DH8A 3DFCB 4I93A 3GC9A 3GT8A 3RM7A 5D41A 5KNJA 1BUHA 4HPTE 4O83A 2ITNA 3O8TA 4FICA 3TI1A 5HE1A 4J97A 5HOAA 1ZYSA 4Q9ZA 2XNBA 5A54A 1O6LA 2JBOA 4TT7A 2A0CX 5JFWA 2YLFA 2QD9A 1UU3A 1MQ4A 2R4BA 3NRMA 1ZOGA 3IS5A 2YIWA 5EDRA 1OKVA 3TKIA 1BX6A 3VRYA 3W18A 4HVIA 5CSPA 5JH6A 4O7LA 3ODZX 4U41A 2VO7A 3ALNA 4IB1A 5CVFA 5I3OA 3VRZA 4L44A 3PFQA 4IVDA 4NH1A 5HLWA 5IF1A 4MD9E 5AAGA 4WNOA 5M4IA 2GS7A 5IUGA 5EKOA 5JT2A 4QMOA 3UODA 1QPCA 3SW4A 3LJ2A 3I6WA 3ZTXA 2B53A 4JBQA 4GS6A 5IQBA 3SOCA 2YACA 4Y8DA 1PXKA 2WMXA 4UBAA 3BV2A 1GOLA 4BCNA 2H34A 2EB2A 3LFNA 1GZKA 2V22A 3LCSA 4G2FA 3AC2A 4AOJA 4BN1A 5A4EA 5E8ZA 2YABA 2ITTA 2XCKA 4FSRA 4IC7A 3D5XA 4XS2A 2C6TA 4KSPA 3ANQA 5TT7A 1PYEA 3CY3A 4BCFA 3ZFXA 3FSKA 3DXQA 2OSCA 3PP1A 2VO6A 4DLJA 2W9FB 4IH8A 3VBWA 2HZNA 1CKJA 1APME 1OI9A 3SKCA 3HDMA 3RI1A 4GKHA 4DGGA 5HVKA 4QPSA 3RNIA 3D83A 3NUUA 4TYGA 2UZUE 3AC4A 3ZO3A 1U5QA 2OFUA 4D1XA 4AACA 3CSVA 3UOJA 4NKAA 3E7VA 4TTHB 1U54A 4LMUA 3LJ0A 4GEOA 3KVXA 2B9IA 3W2OA 2E9UA 3MY1A 5AJQA 4FSUA 1XH8A 4JR3A 4C59A 4UMUA 4H36A 4L43A 2F2UA 4PDSA 5CQUA 2V0DA 3PY0A 4IVCA 4KIOA 4EC9A 2EXEA 5AMNA 4C3RA 2X9FA 2NNWB 2XM9A 1O9UA 4F6SA 5AA8A 3BX5A 4G6NA 2Q0BA 1H0VA 4WHZA 3BKBA 3F69A 1B38A 3KEXA 4CQGA 5BVFA 4HCUA 3NUAA 5EHOA 3QTXA 4F08A 2XNOA 2XB7A 1Z9XA 2V62A 4FUYA 4NUSA 4XG8A 1FQ1B 3UNKA 2WAJA 1FINA 2XJ1A 3ZZEA 3EZVA 3SC1A 4QMNA 4O0VA 5J95A 4EZ3A 5T6KA 5C8KA 3NMUF 4TNDA 1I44A 5EM7A 4AOTA 2PVFA 4IXPA 4KNBA 1QCFA 2R3IA 2R7BA 3QYWA 5K3YA 3TN8A 5I3RA 1LEZA 3OS3A 4O91A 3RZBA 3FI3A 1YHVA 2C68A 4I5PA 4HCTA 4CLIA 3PPJA 3W10A 3SRVB 3VO3A 3CY2A 4QPAA 5KMNA 3DU8A 3QKLA 4YZDA 4BTFA 5IH6A 4I0TA 4AF3A 2A2AA 3PY3A 4I41A 1XWSA 2J2IB 3BWJA 2JKQA 4ITJA 4PP7A 2NRUA 4E73A 4USEA 5KCVA 3Q2JA 4DGOA 3TV6A 4LI5A 3PWYA 3V8WA 2WU7A 4KAOA 5DLSA 3HRBA 4A06A 1Q8ZA 4ENYA 4GVAA 3VBXA 4G6LA 4DTBA 4J71A 2OJFE 5HCYA 2B1PA 2WIPA 4Y83A 4ARKA 5CSWA 4YU2A 1SZMA 3DZOA 3KB7A 2YIXA 3IQ7A 3NUXA 4QP1A 4EL9A 3WBLA 4U44A 2DUVA 1PMVA 3Q4TA 2FA2A 4TRLA 3RCDA 5IA2A 3ROYA 4UN0C 1Q8WA 3NYNA 3PE1A 4FV3A 2C0TA 4DA5A 2JKKA 2VWUA 4GCJA 5AUYA 1JKSA 4MNEB 3DB8A 1IR3A 4XG7A 4FKRA 5DNRA 4OAVB 3SHEA 5L8JA 5DWRA 2R0IA 4YZMA 2QOLA 1JSVA 3R9NA 2CNVA 1OITA 4BDEA 3W2QA 4P5ZA 4FV4A 3C7QA 2G2HA 3PVBA 4JG7A 1Y91A 4BDHA 4BBEA 2UW8A 2WMSA 2Z7SA 4Y95A 4XEYA 3FXZA 4MYGA 1NA7A 1R0EA 3CGFA 4E6QA 5KMKA 3MH1A 4AFEA 2X2MA 3BE9A 3DXPA 3GC8A 3HUBA 3QRIA 3ORPA 3L9NA 2G01A 4YLKA 3EFKA 5AV4A 1PKDA 2IVUA 4EK5A 1E1VA 4XG3A 2RFDA 1P4OA 1CDKA 2IZRA 4HYIA 4E3CA 2W1EA 4ONAA 4ENXA 2F7XE 3R63A 3E5AA 2QO7A 3TIZA 4D58A 4QYYA 2BAKA 4Y5HA 2PVYA 2QKRA 3OW4A 4QP2A 4MBJA 4MWHA 5I9WA 5B0XA 2YM4A 4RA4A 4ACDA 1XBCA 3O71A 2YLEA 5KO1A 5LVPA 4BL1A 3ALOA 5DRBA 4FT0A 1BYGA 5CI7A 4YZBA 4CFFA 3V5QA 4ASXA 3V8SA 3E8NA 5C8MA 3OT3A 4ZSLA 4ALVA 4YJPA 3I81A 4ZAUA 3OROA 5HTCA 3H9FA 3QBNA 4GU9A 4II5A 2B9HA 2F7EE 4YURA 3HYHA 3DLSA 5A4CA 1FBNA 4FUXA 3VJNA 2C1BA 3COKA 3VUDA 2W4JA 2FGIA 3JVRA 4GT3A 5AEPA 5IISA 4PL4A 4XLIA 2VU3A 2XMYA 2J50A 5M4CA 1G8SA 1QMZA 3QX4A 4L3PA 1JQHA 2XH5A 3I60A 4IAZA 4IB5A 4MXZA 4Q5EA 4AS0A 3KGAA 4D4YA 4HVSA 3JR1A 4FKOA 1DAWA 3NYVA 4P90A 4TYHB 3DT1A 4RT7A 5C01A 4E5BA 3UP7A 3NUPA 4O1PA 4PL5A 1OBGA 4MBIA 3KC3A 3NUNA 3O8PA 4FA2A 5K5NA 1MUOA 3SX9A 2QC6A 3ZMMA 4O38A 4X3FC 3FZ1A 4D2WA 3LLAA 5D1JA 4DBXA 3MIAA 4QMLA 2CGXA 1YOLA 2WO6A 4FTQA 5AP4A 4G6OA 3P7CA 3DJ6A 3EB0A 2FB8A 4QMZA 3E93A 2W5BA 3QHRA 4FKGA 5K9IA 2E9NA 1S9IA 1ZWSA 4HNIA 3R28A 5HBEA 3ZOSA 3UVPA 4S34A 2FSLX 4YTIA 3PY1A 4DCAA 3F5PA 2J0KA 1WAKA 2JDSA 4QP9A 4Z7HA 3B8RA 3FYJX 4D5HA 2XK3A 2VTIA 2XCHA 4I92A 5L4QA 5EKNA 4F0FA 3AMYA 5BUEA 1OPJA 4TN6A 3ZO4A 4L3JA 2YAKA 4DFXE 4F63A 3S00A 3UVQA 5AA9A 5L2WA 4I94A 5E7RA 1WVWA 2ZV2A 2BRHA 3LXLA 3PPKA 2GCDA 2VX0A 2XNMA 5E1EA 4FZFB 3BYOA 2VRXA 3R01A 4DEHA 3EQRA 4M0ZA 5M53A 5IUHA 2ERZE 5IQAA 2VTJA 1H01A 2Z8CA 3UZPA 4C61A 4X0MA 3UDBA 3VWAA 3GQLA 4IANA 4PV0A 3MJ2A 5H2UA 3QHWA 5C03A 3WE4A 4O7NA 2RFEA 4ZSGA 5BUIA 2X2LA 5HVYA 2A1AB 3NCZA 4FK3A 4V0GB 2A19B 3QXOA 4F65A 1NT2A 3FKLA 3N9XA 4DLIA 3R7YA 1PHKA 2GQGA 3U51A 4RVLA 3VUMA 4BCOA 4AN3A 5DVRA 3MBLA 5LMBA 4FIGA 4GFGA 4FSNA 3MPAA 3FC1X 2HELA 4GU6A 3R6XA 4X2NA 5CY3A 4EC8A 4EH7A 4X3FA 3HAMA 4CG9A 3V8TA 5JKGA 2W4KA 3S1HA 3SV0A 1J1BA 4K18A 1IRKA 3E62A 4QPMA 4BCPA 4CTBA 3AXWA 4ZY6A 1E1XA 2QKWB 4JBPA 3O7LB 4AGUA 4RJ4A 3ZM9A 4QP8A 2IZTA 2C6LA 4ZTSA 3QUPA 1FVTA 3I5ZA 2UUEA 4FTOA 2EU9A 3FQSA 3MI9A 3MYGA 2XEZA 4HYSA 3UPXA 3Q9YA 2ITPA 4O7TA 2WTKC 2J0JA 4E5AX 3P86A 1TKIA 3CR0A 3P78A 3KXXA 3VHKA 3OD6X 2BRNA 1ZOEA 4G5PA 1DAYA 4LGDA 3QD2B 2VWXA 1SMHA 4JDIA 3LOKA 4BKJA 4XV2A 3NEWA 2QOBA 2BDWA 4I4EA 4ID7A 4YBJA 4YJQA 1KE5A 4CYIA 2RG5A 3CD8A 1RQQA 4NFNA 3H3CA 3R7UA 3BHUA 3DK6A 3HX4A 5EW9A 3FQEA 4L68A 5FP6A 3HV4A 5HX8A 3BHYA 4O0XA 5JGDA 2BZJA 3PG1A 5HGIA 2YDJA 3PJCA 4FNXA 4JG6A 2JIIA 3NAXA 1W0XC 4MWIA 4ZTLA 3D9VA 2F7ZE 3VQHA 3FZTA 5J5TA 4DH7A 3HV3A 3OUNB 2FVDA 1TQPA 3BELA 4EK6A 4L9IA 4EKLA 4M13A 4KB8A 4DAWA 2BDFA 5AP2A 2J6MA 5ACBC 3TUBA 2PVRA 1YI6A 3HV5A 2W1HA 1ZY5A 4FYNA 4P5QA 1QPJA 2WKMA 4N6ZA 3EFWA 4YO6A 4ZLOA 2IG7A 4BKYA 1J91A 2W5AA 4M69A 3B8QA 3LFAA 2UVZA 4M97A 3S4QA 4E6DA 3KCFA 3ELJA 2WEIA 3Q2MA 2JDTA 4UV0A 2X8DA 2R3FA 2ZVAA 3OTUA 4IWPA 1NXKA 2ZJWA 2HW6A 4E8AA 3Q4UA 1OL6A 5KHWA 4RLLA 3F7ZA 3EKKA 4NFMA 3GOPA 3IDBA 1E9HA 1OB3A 2QNJA 4IAYA 3F2NA 2Z7LA 2WTWA 3KKVA 3GVUA 1YXSA 1JKTA 3CQWA 3NW5A 5IQCA 3GU4A 4FZ7A 4H05A 4A4XA 4D2TA 1YWNA 3OVVA 4JX3A 3KXZA 3UOHA 4DEIA 4E4XA 4EH9A 3R7IA 3R9OA 5CASA 4MD8E 4DFNA 4ZMEA 3LFCA 3I1AA 4AQCA 3SXSA 4O82A 5DA3A 3FI2A 3MFRA 4UB7A 4W4YA 4WO5A 4E5WA 4R7IA 3ZONA 3ZXZA 5ANEA 3FZRA 2BUJA 4EQMA 1U54B 3PIXA 3WARA 4AW5A 2F57A 4MXOA 2B52A 4TZRA 2BAJA 4W8DA 5FD2A 5JRQA 2CGUA 1Z57A 2R0UA 4ZSEA 4DG2E 5KBRA 4E93A 2VTOA 3IO7A 3IG7A 3PLAE 3PP0A 3PXFA 5LVOA 4FZ6A 4EWQA 5CYIA 4OTFA 4ZLZA 3GNIB 4QMPA 3R22A 1Q99A 2BDJA 2ITQA 4U97A 3RHKA 3QD3A 4PQNA 2YM6A 1KV2A 5H9BA 1Q41A 4CRLA 2OGVA 2NRYA 3QGWA 4NWMA 5KMIA 5E4HA 3SG9A 4EHGA 3DKGA 1W8CA 4JXFA 3E87A 4IACA 4M12A 4U6RA 5K5XA 2YISA 2HZIA 1P4FA 3C1XA 3EQBA 4JI9A 4L53A 4BDDA 5CEMA 4FKTA 3RHXA 4QTEA 1KE7A 3PJ3A 4EZ5A 3SQQA 3N4VA 2BALA 3D7ZA 4FV1A 2FO0A 5J79A 4DGLC 5CNNA 5IQEA 3D5UA 4GRBA 1OL2A 1V1KA 3DGKA 4MXXA 5CSHA 3WZJA 2JIVA 3EQFA 4NK9A 3NR9A 2UZLA 3EWHA 3L9LA 3ORMA 3QQJA 4FKPA 4A9TA 5CF5A 2VO3A 4IVBA 4ASEA 1YHSA 1RE8A 4EBVA 5A4TA 2J7TA 4BF2A 4EH8A 1HCKA 1QPDA 3HKOA 1WFCA 3OG7A 5HX6A 1WCCA 4OBOA 1LPUA 1OIQA 2XK8A 4H3BA 1BI7A 4RJ3A 1AQ1A 4C38A 5L2IA 4QP7A 4LL5A 1PRYA 5GZ9A 5E92A 1I09A 5TF9A 1DI8A 3OXTA 4YSMA 2ZV7A 5JFXA 2JDOA 5M07A 3LPBA 1JAMA 4GW8A 4ACHA 1ZRZA 2XK6A 3MDYA 3FI8A 4TYIA 4XP0A 4OBQA 4ANNA 4C4HA 4JRVA 4ANSA 5EFQA 5CAPA 3ZBFA 4L42A 1H1SA 3WYYA 3SLSA 1LP4A 3QD4A 4JBOA 5CEIA 5LVLA 3HLLA 3TT0A 2VWZA 2BRBA 2C5YA 3O50A 1H1PA 3R1YA 4C02A 4R78A 3JY0A 3K3JA 4QMTA 4QNAA 4YJOA 3WF9A 2PUUA 2G2IA 2B54A 3TJDA 4E4NA 3I7BA 4IWDA 4YGAA 3RALA 4FTUA 1XR1A 4DG3E 2XRUA 4WNMA 4XP3A 3FLNC 1JSUA 4U5JA 1YXUA 4XRJA 5I9UA 1YQJA 5KE0A 3TZ7A 4WD5A 4S2ZA 5EOLA 4IDTA 3D7TA 4U0IA 4BCGA 2Y6OA 5AV3A 3RWQA 3QUEA 5AP3A 4LUDA 5CZHA 4FEQA 2Z02A 4CMOA 3Q6WA 4HNFA 4A4LA 2RGPA 4QMVA 3EN5A 1VZOA 2QHNA 2G2FA 2RKUA 2FH9A 3L8VA 2IWIA 3D14A 4NEUA 3EYHA 3QCXA 4O2ZA 3ZDUA 1UVRA 3PWDA 3C13A 4KBAA 2YCQA 4O86A 4JLCA 3TCPA 4AT3A 2PTKA 5E1SA 3C0IA 5ICPA 1PMNA 2GMXA 4K8AA 4OR5A 4RG0A 5GJDA 2H8HA 3Q5ZA 4DFYA 3M1SA 5HTIA 4F4PA 5GZAA 1M2PA 3S95A 5JQ5A 2WMWA 3MESA 4G17A 1CKIA 2IN6A 3VUHA 5E8VA 3DJ5A 1YKRA 4LOOA 3NUSA 3E92A 2O8YA 3WZDA 5BVNA 5EM8A 3HNGA 2A4LA 3IGGA 3U4WA 4EOKA 2RSVA 3MTFA 3G6HA 4TYHA 4ZEGA 2YCSA 3JY9A 3OWLA 3MN3A 3DK3A 4DT8A 4EHVA 2C6MA 4RQKA 5DR9A 4EZ7A 3DBDA 5IDPA 2OLCA 4ALUA 3TNWA 2OIQA 4Y85A 4C4IA 1H1RA 4GSBA 3PYYA 5T68A 4O0SA 1BI8A 4F7LA 4R7HA 2O0UA 4HVHA 1IA9A 1K2PA 1H00A 4L6QA 3HA6A 5DYJA 2GHMA 2PUNA 3Q04A 1REKA 3DV3A 2YZLA 5AUTA 3FYKX 4IM3A 3WZKA 4IDVA 5IA4A 3OBJA 1FVVA 3UQGA 2REIA 3LFFA 4JAJA 2PE2A 2IVTA 4E7WA 5F9EA 3CCNA 3QC9A 4B7TA 3DCVA 4U8ZA 4NIFB 1IAJA 3BGQA 2PPQA 2ETRA 4X2FA 2O65A 4LM5A 3FQHA 3G9NA 2WXVA 3IOKA 4BR3A 5AAFA 2FYSA 1TQIA 3GCVA 3NW7A 5AR3A 3BPRA 2OICA 4TW9A 5ACKA 3QZIA 5AR2A 5M09A 2DWBA 3TEIA 1W98A 5HNGA 3FZOA 4YJRA 2Q0NA 4BDCA 1ZYJA 3ZH8A 5A4LA 1ZARA 3LFBA 4NW6A 4TNBA 5AUVA 3OOMA 4F1MA 5M08A 4WSYA 3O23A 4JDJA 4YHFA 2XKDA 3THBA 5BMSA 3CP9A 5FBNC 1Q97A 4WRSA 5A9UA 3A8WA 3T3VA 3C5IA 4BTMA 5FP5A 2XNGA 4DEBA 5HO7A 3N4TA 4RMZA 4HVDA 5HG8A 4QTBA 4RGJA 4I5MA 2VZ6A 4DHFA 1M14A 3P79A 4FI1A 4MAOA 3CS9A 3GCQA 4MKCA 2F2CB 4QMXA 4M15A 5JFVA 1L8TA 4YLLA 3DAEA 3VF8A 4BDAA 3CEKA 3MH0A 4BCQA 1YDTE 4W4WA 5TE0A 1KWPA 3VQUA 4FMQA 1REJA 2YEXA 1ZMWA 3TDWA 3C0HA 4JBVA 4O0UA 3M2WA 2OIBA 4GIIA 2XIRA 4C58A 3RZFA 2VTHA 3A7IA 1DI9A 4FKLA 4FKUA 4IFGA 2WTIA 3HMOA 4PWNA 3OCGA 5BYZA 3BI6A 2CSNA 1TQMA 1XO2B 3ZLYA 5CALA 3ENMA 1R3CA 2C0IA 3IW7A 4EK3A 4C35A 4DT9A 3GU8A 4X3FB 5DT0A 1W82A 3BU5A 5FDPA 4I23A 4JT3A 4AU8A 4LUEA 4FZAB 4NM3A 4CV9A 3D5VA 5L2SA 2DS1A 3V5LA 3Q4CA 3DKFA 3UQFA 4M3QA 3R21A 2NO3A 5EI6A 2HZ0A 3QWKA 4PDOA 4G5JA 5JQ8A 1WZYA 2BCJA 2I0YA 4G34A 3HEGA 4M8TA 4E26A 4UMTA 1G3NA 3GEQA 3ZFMA 3DNEA 3K54A 3SGCA 5JEBA 2UZBA 2R3OA 3G51A 5H8BA 5HQ0A 2WHBA 2BILB 4W8EA 3O8UA 5AUUA 4R3RA 3IPHA 5FXSA 2YM7A 4HZRA 2Z7QA 5CQWA 1R39A 5AUWA 3RWPA 4BI0A 1B39A 4Y72A 3GOKA 3HZTA 1FGIA 3R2BA 3ZZWA 3IONA 3COMA 4MNFA 3NDMA 4RX8A 4YNOA 1H07A 5DHJA 2O2UA 4C62A 1JKLA 2QONA 5HI2A 4DBNA 1U59A 4XBRA 4XNEA 1YXXA 2J0IA 2EWAA 4U3YA 5AWMA 2WELA 4M84A 5FQDC 4U40A 2PUPA 2WPAA 3NCGA 4LG4A 3EL8A 2J4ZA 1W83A 2CLQA 2R3KA 4HGLA 3RK5A 3TV4A 4EOIA 1PMEA 3ET7A 3QZGA 4CFXA 2WD1A 3OCBA 2YWVA 4BYIA 4ZTHA 3TIYA 4M69B 4MVFA 3M42A 4O1OA 4F7NA 3U6HA 4EYJA 5HD7A 3W32A 3FLQA 4YPSA 4EORA 2W5HA 4C33A 4LFIA 4IAIA 2HENA 2O63A 3FLWA 2OIDA 3V04A 5IDNA 2PMNX 3VVHA 2F49A 2XJ2A 4TWPA 3HL7A 1RW8A 3HA8A 3NYOA 5AX3A 4EOPA 5M4UA 4PNIA 3E8DA 2WTKB 3QQGA 3OY3A 4BZNA 5A4QA 3MH2A 5LXMA 4JIKA 4QD6A 2UZDA 4GIHA 4V05A 1YOMA 5DH3A 1L3RE 4FTIA 3NS9A 3BCEA 4FIIA 4S33A 5ANOA 5FRIA 3Q52A 3ZEWA 2BMCA 3EQGA 3IK3A 3HRFA 3MVJA 4M14A 4S30A 1YW2A 5E8YA 3ULZA 5CT7A 4ZY4A 4C57A 1G8AA 4FZDB 2BRMA 2Y4PA 3P7AA 3RGFA 1YWVA 1ERKA 3C4WA 3BYMA 3PSBA 4CTCA 3SDJA 4D4SA 4UMPA 4DYMA 4HYHA 2OJIA 1IASA 5AP7A 4DTKA 5LARA 5M44A 2RFSA 1ZYCA 3MVMA 5HO8A 3ZFYA 5I9ZA 4UXLA 4O21A 5T3QA 5I5ZA 3WOWA 2LAVA 2SRCA 3TG1A 5BVOA 4ERKA 2CCHA 4MQ2A 4ERWA 4AFJA 3DJ7A 4FKVA 2CKOA 5FBOA 1VJYA 2PZ5A 1PXOA 4MEDA 4XG9A 4AG8A 2JLDA 2RFNA 4CLJA 4O27B 2GDOA 2HYYA 1GIJA 3IW5A 4D2RA 1GAGA 2LGCA 3OWKA 4DN5A 3KCKA 5FM3A 2JGZA 5CU6A 4YJNA 5C27A 4GYGA 4PTEA 4BHZA 3KA0A 1IEPA 4ZY5A 5DGZA 2UW9A 3HVCA 5E8UA 4E20A 5CU4A 2BROA 5BMMA 2X4FA 5CANA 3KY2A 3W33A 2CNQA 3EOCA 4Q5HA 4ZIMA 3FEGA 4J96A 1NY3A 4CQEA 1LUFA 3VS6A 3BQCA 4BWPA 1GZOA 3IGOA 4Q9SA 2CMWA 3BU6A 4UALA 3UQCA 5AP0A 2V7AA 3GQIA 4AZTA 3KRJA 4CZYB 2GNLA 5HO6A 3O0GA 4NJDA 4F1TA 4ORKA 2VV9A 2PULA 3JS2A 3NNVA 3UYTA 4OAUC 3PSDA 1O6YA 1DS5A 1PJKA 2BR1A 2E9VA 2YM3A 4CFWA 1IA8A 4RC4A 4ALWA 4F6UA 5CF8A 1BL7A 1Q3DA 4D4VA 4AGCA 3VC4A 5L6PA 4RIOA 3KQ7A 3HGKA 4BDKA 4BWXA 4C0TA 2HY81 5HZNA 3JXWA 4J99A 2GSFA 2PVHA 4RJ5A 3GCPA 2ACXA 3LM5A 5HIEA 5KMJA 3UTOA 3LFQA 4S31A 1GIHA 4FIHA 5DBXA 3I7CA 4I6HA 3ACKA 3OC1A 4L7SA 4WSQA 3B2WA 2X7OA 5DPVA 3ZO1A 5KKRC 3ZSIA 5AV0A 5FTGA 4O6LA 2QQ7A 1M7QA 4E4LA 3OOGA 5EOBA 2WOUA 3BLHA 2Y0AA 4FOBA 4BI1A 2C6IA 3PXQA 1M17A 3JUHA 3QX2A 3I4BA 1ZMVA 4G31A 4GVJA 4OTPA 5LWMA 1PXPA 3LM0A 3QRUA 4RPVA 3KXGA 5DOSA 3QF9A 1JOWB 4QTDA 3WIKA 4L7FA 2BAQA 4JNWA 3D7TB 1W7HA 5FXRA 3RNYA 5KMMA 2XBJA 3FPMA 2XK9A 3MFTA 3R9RA 4NZWB 2OXDA 4BCMA 2BPMA 3I0QA 4GG7A 4FKJA 4F0GA 3ZC5A 2YIYA 4YBKA 3IECA 3AC5A 4MQ1A 3PA5A 5HCZA 5I9YA 5J9YA 4OT5A 5J5SA 4G3FA 1UV5A 5AR7A 5IEXA 3HMMA 3Q9ZA 2XIZA 4J8NA 3G90X 4YTFA 4V04A 4NSTA 3TZ8A 5J87A 3VUGA 4B8MA 4EOOA 1M2RA 5EDPA 3H10A 5CI6A 4PP9A 2UZVA 4KKGA 1SVHA 1MRUA 2G1TA 4AP7A 1WBWA 2OFVA 3OMVA 4OTWA 4UXQA 5JGBA 3QL8A 2QURA 3TNQB 4AGDA 4FV7A 3KULB 4RJ6A 5LWNA 2PMIA 3LCOA 4C7TA 3BYUA 4ACGA 4RC2A 4S32A 4EYMA 4F9WA 4BHNA 4BZDA 5GIOE 3R7EA 2YWPA 3FMEA 3U6JA 3GC0A 1URCA 2VTNA 3DA6A 3HUCA 4NIFA 1EH4A 3CQUA 3C51A 1NVQA 4DH1A 2IPXA 3D5WA 4DE4A 2C1AA 4D2VA 2YN8A 3FE3A 4IM0A 1U46A 5IA3A 2UZEA 4F1OA 4X2GA 4Y73A 2OH4A 3R00A 4YO4A 4FT9A 4K2RA 3QRKA 4AA5A 4ZTQA 3HP2A 3T8OA 4N4SA 1SVGA 3LQ3A 3BZ3A 3E3PA 1Q8UA 2C0OA 4GL9A 2RIOA 2B4SB 1PXMA 3L1SA 5CF6A 3TNPC 2VAGA 4IX5A 4FV8A 3ANRA 3PRIA 5HLNA 2P0CA 4ZTNA 3LXNA 1PF8A 2ITUA 2VWBA 2XA4A 5L8LA 2W06A 2R2PA 4XOZA 5DE2A 3V5JA 4O6EA 3RCJA 2GS6A 3NVKI 5ETIA 3LAUA 4LRKA 3KVWA 4F9BA 3V5TA 4ZTMA 2EVAA 2G15A 2ITZA 2NP8A 3SOAA 3FC2A 4BY9E 5GINE 1YWRA 4O0RA 2GNGA 5DT4A 4AT4A 4BCJA 3TACA 3CGOA 3F6XA 5AP5A 4L46A 3RK9A 4IX4A 1SNXA 3QTRA 4AN2A 2W96B 1UKHA 2QVSE 3PJ1A 5I4NA 3O51A 5FEDA 2C6OA 1OUYA 4FG9A 5EYCA 4AOIA 4IBMA 3EQHA 3FSFA 4OW8A 4HPUE 4W9WA 3FHIA 4C4FA 4FIFA 4BB4A 5FXQA 1H28A 2PK9A 4M67A 2QO9A 3A62A 3ORLA 3MA3A 4BCKA 2OXYA 2C30A 4FOCA 2VWWA 5HLPA 1O6KA 3TZ9A 3WILA 2CKEA 4GUBA 5DEYA 1KSWA 4FNZA 1XH9A 3D94A 4IQ6A 4XHKB 4WA9A 2AUHA 2PL0A 5E90A 2B55A 3ATSA 4N6YA 3UO4A 5CZIA 5KZ0A 1OKWA 2CJMA 3Q9WA 4BC6A 3RPOA 1WBNA 4RFZA 2Y4IC 4BGGA 2R3RA 5D10A 4BWKA 3FPQA 4RA5A 2HCKA 4XUFA 5H8GA 3DQWA 3VNTA 3HMPA 5J8IA 3PXRA 4GG5A 4ANMA 4QMYA 3R8ZA 3FZPA 3IW6A 3EN4A 4F70A 4P2KA 5HIBA 3RPYA 2R3PA 3HP5A 5AV2A 4AN9A 1WBPA 4XH6A 3KMUA 3DS6A 2JEDA 3OUKA 3PIZA 3QKMA 4GK3A 4QP3A 2RL5A 4WNKA 3UG2A 4C4GA 4CVAA 3EYGA 2CKPA 4FEXA 1OKZA 3QLFA 5CU0A 2PVKA 1KE8A 4V01A 3PSCA 1P2AA 4GH2A 4AW2A 5EHLA 5F20A 4ZZNA 5HU3A 3R1NA 4F7JA 4O0WA 5DFPA 5E8XA 1H26A 2UV2A 2X6EA 3QQLA 3EHAA 3UYSA 2IW8A 1GY3A 4FTCA 4TPTA 4DEAA 2BIKB 1Q24A 4RX7A 1WVYA 3NVMB 5AR5A 4C3FA 4ACMA 4PPCA 3VS5A 3KXMA 1V0PA 1OMWA 3GUBA 4TXCA 4H1MA 3QWJA 2AC3A 4I0SA 5AR4A 2VTSA 4QYGA 1J7LA 4F9YA 1R78A 2W0JA 4RZWA 4FSMA 3UNZA 4QMUA 5IA5A 4U42A 4XMOA 2VX1A 4FEUA 3RAWA 4FE2A 2VTRA 4Z55A 1WBTA 3GU7A 4K11A 3RJCA 3KK8A 5HU9A 4MXAA 3UMWA 5LMKC 5IQHA 4CSVA 4FV6A 2VTTA 4OBPA 1OGUA 1IG1A 4FC0A 3EN6A 4RIWB 3NNUA 2XYNA 4X21A 1WBOA 2ETKA 4I21A 4P4CA 5HD4A 1V0BA 3UE4A 4QQ5A 4A9RA 4QMMA 4PDYA 2OWBA 3AC3A 3VUTA 2XYUA 1OKYA 2YCRA 4NU1A 5TOZA 3VBQA 4C4EA 5IMEA 1YDSE 3BLRA 2OJGA 2CGWA 3LLTA 4KWPA 3UIXA 3KRRA 3D2KA 4IFCA 1FPUA
chains in the Genus database with same CATH superfamily
1Y8YA 4A07A 3QD0A 2YDKA 4IADA 4CNHA 1SM2A 2QOCA 5CX9A 2A27A 1XH6A 5DT3A 4KIKB 2YHVA 3QTWA 5DIAA 3QFVA 3UBDA 3L8PA 5LJJA 4O81A 4BGHA 3WZUA 3UC3A 3E63A 3FWQA 2ERKA 2W99B 5E8WA 5ETFA 4BFMA 3QLGA 5AX9A 1NVSA 2WQOA 4KRDA 3FMKA 1UWJA 5AIRA 2R3QA 4ZP5A 5CT0A 2KULA 3GU6A 2PSQA 4FSTA 4G1WA 5EM6A 5GJFA 5D7AA 5AUZA 2WTVA 3I0OA 3R8VA 2GNHA 3CKWA 4AA4A 1YOJA 4XBUA 4IB0A 4CV8A 1VEBA 4OTGA 3AMBA 4QNYA 3VBVA 3ZSGA 3QQUA 2JD5A 3MW1A 5GJGA 5KMOA 4G9RA 5HHWA 4ZJIA 2UZNA 2C5NA 5I0BA 4FGRA 4AW0A 3K3IA 4W9XA 2X2KA 3V51A 3AD4A 3VS7A 5AUXA 4DGNA 3AT4A 4BCHA 5GIPE 4OUCA 1P5EA 4RWLA 5TKDA 4ASZA 3I6UA 4BIDA 2O5KA 1ZZLA 3P0MA 4IWOA 3R7GA 3QRJA 4P7EA 4PPBA 2ZM1A 3GCUA 3CPCA 2PVLA 3AC8A 4FKSA 3C4ZA 4IWQA 4RFMA 5LVNA 4FTRA 5CAVA 2J5FA 3WF8A 4FVQA 2EXMA 4MCVA 4LV7A 3E64A 3ZLSA 4QQJA 2X4ZA 2Y9QA 3AKJA 5A46A 4F99A 2YFXA 3UZRA 3PLSA 2XK4A 2X8IA 1BKXA 2X39A 1YHWA 3WI6A 4JRNA 1UNHA 4NTSA 2GNFA 2Y7JA 4I3ZA 4PMPA 2V5QA 3FKOA 2JDVA 3EZRA 4OTIA 5AV1A 3DKOA 4WRGA 4CD0A 4EKKA 5BQ0A 4WG3A 3LMGA 3DAJA 3RBWA 1JBPE 4H39A 4I22A 1Y6BA 2UW3A 3KIOC 4KUJA 4LOQA 2BVAA 5K4IA 3PDTA 4O4BB 5E91A 3BYVA 5HNIX 4DFUA 4PUZA 2PHKA 3PVWA 2WB8A 3BU3A 3MWUA 1XJDA 3ORKA 4XV3A 3LVPA 5ETCA 5FEQA 3SG8A 4YC3A 2HIWA 3OTVA 2OG8A 3LCDA 1TFFA 2BKZA 4YZCA 3R8UA 3FMHA 4LQMA 5AR8A 3F88A 4R77A 2QO2A 4K0YA 4LV5A 2WU6A 4U3ZA 2ITYA 1GZNA 4XX9A 5TR6A 3LKMA 3EMGA 3LE6A 3RAKA 3GU5A 2YM5A 1WVXA 2HOGA 3AG9A 4ZK5A 1KOBA 3QQFA 5JZNA 3W55A 2HY0A 4F7SA 3C0GA 5BNJA 4R1YA 2W17A 5C8NA 3DOGA 2WMUA 3NPCA 4XV1A 3F2AA 5J7HA 2UZOA 4R7BA 2ESMA 3F66A 3RAIA 2WTDA 4PMTA 2B0QA 4BDIA 3GFWA 4A9UA 4C2VA 2Y6MA 4BIBA 4FV0A 3ORZA 3QGYA 2FSOX 2ITWA 3C4FA 4AT5A 4Z7GA 2C3KA 4EK4A 2OZAA 5M51A 3LFDA 3QCSA 4JQEA 4L8MA 4MF0A 2XIKA 3F2RA 3DFAA 5J9LA 3JPVA 1UU9A 1H0WA 5L2QA 3RPRA 5G1XA 4EI4A 2BZHB 2JAVA 4BTKA 3ZHPC 3CD3A 2KTYA 3COIA 4FTMA 2R3JA 3KULA 5CEOA 5I9XA 3MJ1A 3ITZA 5AAEA 5KX8A 2R3GA 4RIYA 4U80A 4FBXA 3LW0A 2YZAA 4JDHA 4OTRA 5CEKA 4K1BA 3A7FA 5LCJA 2F9GA 1J7IA 3VULA 5ANGA 3QUDA 4ZLYA 2QI8A 3UPZA 4F0IA 2B9FA 3SAYA 1YXTA 4PTCA 2YAAA 3TTIA 2J0MB 3BHTA 5FM2A 3EN9A 1FOTA 3NIZA 3V6SA 4E6AA 3UIBA 1YI4A 2J9MA 3Q60A 4UZDA 2VNWA 2VTQA 4X7QA 5FLFA 4AZWA 2ZB0A 5CENA 2CPKE 4BTJA 4DC2A 5KKRB 4Y46A 5IKWA 3HAVA 4AUAA 3PE2A 1W2DA 1DM2A 3GXLA 2I0VA 2BTSA 2X8EA 4Z16A 4QRCA 2BZIB 4DEDA 4APCA 1SYKA 1YI3A 2I0HA 3FKNA 4EHZA 3HV7A 1BLXA 4USDA 4CYJA 3UZTA 1ZMUA 3FMNA 2WTJA 4O7SA 4RC3A 4U43A 2X81A 3OEFX 4B0GA 3NUYA 4CMTA 4ZZOA 3W0QA 5BYLA 1GJOA 3VUKA 4U9AA 3FHRA 4J1RA 3VUIA 2HWOA 2VD5A 2W1ZA 3MVLA 5EW8A 5AP6A 4MK0A 5HCXA 3QZHA 4ANQA 3OWPA 2H9VA 2E9OA 4ANOA 2XKCA 2AYPA 3TXOA 5JN2A 4RX5A 4FKIA 4YZ9A 3T9IA 3R71A 2JDRA 3WYXA 5EG3A 5AP1A 4B99A 4ZJVA 3RINA 2J51A 3KL8A 1J1CA 2XM8A 3ZEPA 4D28A 1VLRA 1M52A 3PG3A 4HGSA 3A4OX 4FIEA 4H3PA 4JOAA 3NGAA 4UEUA 4EH5A 4PDPA 4F09A 4RJ8A 4D55A 4G9CA 4FSQA 4LMNA 3PZHA 4XYFA 1SVEA 5FTQA 4FTAA 4JQ8A 5IU2A 4RVKA 5L6OA 5B2KA 4DF3A 2PVJA 3MFUA 4H1JA 3H30A 4L52A 4PX6A 5CAUA 3F3VA 4ZOGA 4FT7A 5CXZA 3F3TA 2XNEA 3FXWA 2XEYA 3QA0A 4N0SA 2OI4X 1X8BA 4ACCA 2VTLA 1Q62A 3PVGA 4EUUA 3QC4A 4NW5A 5CF4A 3ZBXA 1UWHA 1MP8A 4XG2A 3KK9A 1H08A 4R8QA 2QOQA 3HV6A 2PZRA 4U7ZA 3TZMA 1TZDA 4R5SA 1ZOHA 4UX9A 3LMIA 3RPVA 2XIXA 4N70A 1NW1A 2X9EA 4APPA 3ROCA 3OXIA 1PXLA 3FXXA 4CZTA 4KS8A 5EI2A 4YJSA 3NFFB 1A48A 3DKCA 4NCTC 4UY9A 4M66A 2O3PA 3UIUA 3TKHA 5LVMA 4I5HA 2I6LA 1H4LA 4G3GA 2VO0A 5HG9A 4J53A 1CM8A 3F5GA 3U8WA 3DBEA 4MH7A 3W0SA 4QMSA 2QCSA 2YDIA 3VONA 3BV3A 3EL7A 1OVEA 4WG5A 4TWCA 3C4EA 3AMAA 2XZSA 2OXXA 3FZSA 4IW0A 1AGWA 2HW7A 2BFYA 2UZWE 4HJOA 4I5CA 4PY1A 3VBYA 3KRWA 3UO5A 3P5JC 2XF0A 4OGRA 4BVUA 1GNGA 4AX8A 4IE9A 1Q61A 2CDZA 4AAAA 5FUTA 4MF1A 1UNLA 4JJRA 4L45A 3NWWA 3RPSA 4R5YA 5BYYA 4QYFA 4C34A 3NZ0A 4X2KA 3CXWA 3P1AA 3PJ8A 3ZCLA 1OL7A 3KREA 3GBZA 4RIWA 3RAHA 4MTAA 4I1ZA 2GFCA 4L3LA 5F4NA 2PE0A 4FNYA 3ULIA 4DFLA 3ZLWA 4EOSA 2XAMA 1JSTA 1R1WA 2B9JA 3CC6A 3OP5A 4TY1A 4R1VA 4HGTA 3R0TA 2P2IA 2WZJA 3OW3A 1XH7A 2QOHA 1HCLA 2F4JA 2PMLX 2WMBA 3IDPA 3Q9XA 1ZZ2A 2R3HA 3ZU7A 4BDJA 2XVDA 2X0PA 3AC1A 4KIKA 2RF9A 4IZ5A 3RTPA 1QPEA 2Y4IB 4UWBA 4DINA 3D2IA 4GUEA 4K77A 3A7JA 4JIAA 4LOPA 3C4CA 2I0EA 2YIQA 3BYSA 5IA0A 4NL0A 3TDVA 2IJMA 3BHHA 3EJ1A 4NCTA 2J0LA 4C36A 4EHEA 3EQCA 1IAHA 4E1ZA 5DRDA 3R9HA 4UYNA 3VW6A 5EQPA 4GFMA 1ZXEA 5IH5A 4OTDA 2Z60A 3DQXA 3O17A 4IB3A 1KUTA 5JGAA 2OU7A 2PWLA 1P14A 1YXVA 3BGZA 1F5QA 3V01A 5IQIA 4XP2A 2IZUA 4AZVA 5EW3A 3A8XA 1YDRE 4E6CA 3TM0A 3QRTA 2BHEA 2C5OA 4CFUA 3Q3BA 5GZ8A 4WUNA 4GT5A 3UNJA 2J5EA 2FUMA 4D1ZA 2ONLC 5FWKK 2UVXA 2VNYA 3VS0A 4F9CA 4CEGA 1G5SA 4QYHA 3DNDA 2C6DA 3F5XA 4KBKA 2PYWA 2IO6A 4DEGA 4K33A 3QTZA 3L9MA 4X6RA 4QTAA 3TNHA 2ITOA 3R9DA 1JPAA 4WNPA 4EQUA 2WQEA 4QMQA 3UDTA 3W2CA 3EQDA 3FMDA 3WIGA 3AT2A 4FF8A 5K0XA 4AW1A 5BUJA 2QHMA 3POZA 2OO8X 4RBLA 5IUIA 3S2PA 3WF5A 1KE9A 3ZYAA 2X7GA 2XRWA 4Z3VA 3JYAA 3V6RA 2QLUA 3G6GA 1Y8GA 3HRCA 2QODA 4H58A 5HNBA 4KIPA 4QQCA 2JC6A 2PZPA 1GZ8A 3A7GA 3VAPA 4EUTA 4D5KA 5A14A 2R3MA 2PMOX 2UW4A 4TKSA 1T45A 4KS7A 3G15A 2ITVA 3OZ6A 4IX6A 5FG8A 5AFVA 4XOYA 3UOKA 5IMXA 4I4FA 2P2HA 5CXHA 4ZMFA 2DQ7X 3O96A 4YJUA 4QMWA 3UOLA 2WNTA 3GI3A 2UW7A 4IIRA 2DYLA 2PVNA 3DZQA 3K5VA 3OFMA 4FSYA 3ZLXA 5BX0A 2EUFB 3AQVA 4ZS0A 2NPQA 4IVAA 5EK7A 3R7OA 4FNWA 3KXNA 3R30A 3GGFA 5M55A 4BKZA 2ONLA 4IM2A 3NX8A 4GJ3A 3QQHA 4UMQA 4A7CA 4YLJA 3W2PA 4ZSAA 3QCQA 2OKRA 4HGEA 2X1NA 3R1SA 4I0RA 5HKMA 3H4JA 4RSSA 4EH2A 4EJNA 4BRXA 4O84A 3EH9A 2R7IA 1S9JA 3F82A 1URWA 4D0WA 1CSNA 3G0FA 4GYIA 2I40A 3PZEA 3H9RA 2X6DA 2IVVA 3GB2A 4DG0E 4U79A 2WQNA 1OPLA 4B8LA 2X0QA 2WQMA 4O2PA 2YIRA 3WF7A 4E4MA 3CE3A 5KUPA 3I79A 4FL3A 4AXDA 3IDCA 5BVDA 4PNKA 3F7WA 3TL8A 2CKQA 2UW6A 1XH4A 3ORXA 2R9SA 4FTTA 1FMKA 1Q3WA 3NSZA 4CT2A 3MFSA 4C37A 1OPKA 3H9OA 4OTHA 5JMSA 4N57A 1OL1A 3F61A 2C5XA 1XMMA 1VR2A 3K2LA 4HOKA 5IG1A 5EYMA 3WF6A 3FMJA 2XKEA 1U4DA 1OBDA 3ZUVA 3EN7A 3C5UA 3LJ1A 3N4UA 3MH3A 4YR8A 3FUPA 4K9YA 2W1CA 3K5UA 5CTPA 3MSSA 2PU8A 4WT6A 4ZTRA 2ZOQA 3FV8A 5JSMA 4BI2A 3CJGA 1LR4A 1VYWA 3BHVA 5CWZA 3S0OA 3CLYA 3VS1A 2OZAB 4YSJA 4JAIA 5EH0A 3VN9A 5C4KA 2XJ0A 2X0GA 4PPAA 3GENA 3G2FA 5BVWA 4AWIA 3Q6UA 4CXAA 4CKRA 3BL9A 4J95A 1PXNA 4D4RA 5HORA 4G16A 5D11A 2GFSA 3BWFA 4PRJA 1ZLTA 4H3QA 2YA9A 4XCUA 4FG7A 1W2CA 4IHPA 3Q96A 4C8BA 4Z9LA 4F64A 3WE8A 4KABA 3P08A 4RIYB 2ZV9A 2P33A 3UP2A 4RFYA 3FY0A 3CKXA 4WBOA 3W16A 4ASDA 5EM5A 2YM8A 2IW6A 3VS3A 2WMQA 3OBGA 4I6BA 1F3MC 3HMNA 4LYNA 3ODYX 4CZUA 2JAMA 3KMMA 4FYOA 3DDPA 3DDQA 5CSVA 3SXFA 1ND4A 2ITXA 2CHLA 3ZXTA 4EOQA 2IF8A 3SD0A 3ZSHA 5F1ZA 1ZAOA 4DEEA 5CEPA 5KMLA 5HE0A 3UMXA 4QO9A 4G3EA 2BFXA 1V0OA 3LQ8A 3NNWA 4B6LA 4FV9A 2C3LA 5B7VA 5M56A 1OGYA 4D9TA 2CN5A 3QU0A 4FSZA 5CAQA 3NIEA 3P4KA 5DN3A 5G6VA 3ORIA 3DBCA 3W8LA 3UGCA 4YPDA 5HVJA 5HTBA 5IQDA 4YHTA 4RWKA 4I20A 4BCIA 5IEVA 2HXQA 3IOPA 5EHYA 5A6NA 3QZFA 2VTPA 5IH4A 4NTTA 2JITA 3LFEA 2XNPA 4EOLA 4KIQA 5M57A 4GK2A 4TWNA 2GPHA 2JBPA 2JKMA 3DTCA 4J8MA 5ANJA 5D9HA 4JVGA 3R8PA 3V5PA 4YUQA 2R3LA 5EDQA 1RDQE 2AC5A 4F9AA 2XNNA 4M68A 3KN5A 2QU5A 3KF4A 4OTQA 2E9PA 1OZ1A 3F3UA 4FODA 4WBBB 4EJ7A 5JRSA 1OM1A 2QG7A 1UA2A 4IEBA 4DGMA 1BL6A 3KXHA 3UJGA 3FBVA 3QA8A 4F6WA 4BJJB 2OZOA 2R3NA 3AKKA 4GKIA 2GHLA 3HMIA 4A9YA 2YERA 2UW5A 3B2TA 5D7VA 5FEEA 5GNKA 3A61A 2ZYBA 4D0XA 3PIYA 5M06A 3LIJA 3DB6A 5J1WA 3A7HA 3UC4A 3FAAA 5AM7A 5BVEA 5CLPA 5EI8A 5J7BA 1JVPP 3P7BA 3RP9A 4MXCA 5HEZA 3VS4A 4FL1A 4CCUA 2YJRA 3O2MA 3P23A 4FG8A 3NLBA 3MB6A 4FKWA 4GT4A 2BHHA 1U5RA 3ERKA 4O96A 4CFVA 2ZV8A 4JQ7A 5L3AA 1A9UA 3EQIA 1T46A 5ETAA 4WUAA 4CGAA 2QU6A 5HIDA 1K9AA 2GS2A 2GU8A 2HWPA 3H0ZA 4FTJA 3SXRA 3L8XA 3LXPA 1B6CB 2J90A 1CMKE 2JFLA 2W1DA 3DPKA 3E7OA 4O0YA 4BBFA 2W05A 3EKNA 3PRFA 5ITAA 5DEWA 2C5VA 3LQ5A 3E88A 3E3BX 3COHA 3CPBA 4TYJA 3V3VA 2JIUA 2QG5A 2ZAZA 3VW8A 3ETAA 4KSQA 2WMVA 3HDNA 2P55A 4NM7A 4AZFA 4AA0A 4RIXA 4RRVA 3RMFA 2H96A 4UWYA 4IX3A 5F94A 1Y57A 2WOTA 3L9PA 4Q2AA 2HK5A 4K6ZA 4XG4A 4RWJA 1Z5MA 3CJFA 3W2RA 4CCBA 3QKKA 4KA3A 4NT4A 3CIKA 3LCTA 3FMMA 3OY1A 3PXZA 3F3ZA 4I6FA 4HZSA 4ANLA 3TYKA 4DDGA 2C47A 4QTCA 4DCEA 2ZMDA 4RX9A 4I24A 2JFMA 4JX7A 3WZEA 1FMOE 4QP6A 4UWCA 4EWHA 3DAKA 2VGOA 3OHTA 2UZTA 3QXPA 4D2PA 1CKPA 4YC6A 1VYZA 1ATPE 3BE2A 3E8EA 2BTRA 1PW2A 2BKKA 4YTCA 2W1FA 3ENHA 2ZMCA 1UNGA 4L01A 3DXNA 2ZDUA 3G0EA 4QOXA 5E8TA 3QTQA 2O64A 1MQBA 3CTJA 3GFEA 5ANIA 3TJCA 3W8QA 3GC7A 4FT5A 4IZAA 1NVRA 1Q8TA 3PA3A 3PUPA 5E8SA 2R5TA 4QT1A 3BIZA 5HE2A 5B2MA 3UDZA 4RJ7A 1UU7A 2P4IA 5HESA 1YVJA 2C6EA 3TNIA 4FTNA 2YCFA 1QL6A 4JR7A 4FT3A 4XG6A 2VWIA 3ZS5A 1WBVA 2PY3A 3TUCA 4YJVA 4RVMA 5HE3A 1H1WA 4EOJA 4BDGA 4FK6A 2YJSA 1XBAA 4IJPA 3ZM4A 3R1QA 2WEVA 3KU2A 5BPYA 2UW0A 5CU3A 5AIKA 2BIYA 1PXJA 5KHXA 1KV1A 2Y8OA 3LCKA 2PZYA 4MXYA 5TO8A 3VIDA 3NAYA 4KD1A 4BZOA 5HBJA 4JS8A 4KRCA 2ZB1A 3JVSA 3LFSA 3HECA 4A4OA 5CNOA 4C4JA 4GV1A 2GTNA 2PVMA 4FVPA 4XV9A 3ZUUA 2EB3A 5EQYA 1J7UA 5CVHA 1OIYA 3SW7A 5ANDA 1OUKA 4XLVA 4YC8A 3BBWA 4IAKA 1K3AA 2YITA 2B7AA 2VTAA 4R6VA 4DFZE 4JL9A 5CVGA 4L67A 1PYXA 2WMTA 4OT6A 4JG8A 1FGKA 4KKHA 2GQSA 2I7QA 3FY2A 3PA4A 4YTHA 3OCSA 5CU2A 2RG6A 3CTQA 4CMUA 4ZJJA 5CAOA 4RLKA 3C4XA 3DTWA 1OIUA 4KINA 3G9LX 1WBSA 4DTAA 3D4QA 4LGGA 1JWHA 3MPMA 1BMKA 3VHEA 2C4GA 5C26A 3CQEA 1W84A 4IJ9A 5LMKA 4AZEA 4RZVA 5FDXA 4AGWA 1F0QA 4CRSA 2Q83A 3KRLA 5E9EA 5J9ZA 4FKQA 4QYEA 5JK3A 5K4JA 3I5NA 5C4LA 5L6WL 3BLQA 4D9UA 4WOVA 4UMRA 3IW4A 4J52A 3R83A 4I6LA 4FR4A 1LEWA 3P5KA 3PTGA 3SRVA 4LGHA 2Z7RA 4B9DA 3MB7A 2WQBA 4DFBA 4I6QA 1OIRA 3R73A 5D12A 4CKJA 3KF7A 4AE9A 4HVGA 3Q4ZA 2GHGA 3AGMA 4YHJA 1H8FA 3QALE 4A9SA 4CFNA 3FLSA 3N51A 5JZJA 1KE6A 4O7VA 5A6OA 3LMHA 4BDBA 4AZSA 3OF0A 3UO6A 2PZIA 3TV7A 3RKBA 2QLQA 1MRYA 3GP0A 3F3WA 3FLYA 4X6QC 2XANA 2IZSA 2VTMA 4BICA 3EFLA 3U54A 4QQTA 4J98A 2XIYA 4IAAA 2CN8A 4R3CA 3A4PA 5HBHA 3EFJA 2ZDTA 3MGYA 3OT8A 3O7LD 3ZO2A 1H24A 4EH3A 2OJ9A 1Y6AA 3FMLA 4MD7E 5FTOA 3VF9A 4DDIA 2C6KA 5AM6A 3R04A 2IEWA 5KZIA 4C3PA 4MNEA 2QR8A 4GK4A 4O0TA 2OBJA 5FGKA 4FV5A 3MY0A 4G3DA 4KKEA 4KBCA 4LRMA 5LMAA 3U87A 3BGPA 3QTSA 4EOMA 4FTLA 5CS6A 1XH5A 1RJBA 4PF4A 3Q5IA 3FJQE 2XUUA 3MPTA 4NYEA 4EBWA 3GCSA 1Q4LA 4ITIA 4O22A 2HZ4A 1PMUA 5CSXA 1FVRA 2WIHA 3ZDIA 2OF2A 5IA1A 3R02A 3QCYA 4L00A 4MHAA 4O7RA 2WMRA 2W7XA 3FL4A 3MIYA 2GNIA 4QDVA 4AXCA 5L2TA 2V7OA 3L8SA 3QTIA 4W4VA 4FEVA 3IW8A 4LV8A 1XHAA 2OF4A 5IEYA 4LRJA 4GMYA 3W2SA 5KBQA 1UU8A 1M7NA 4O7WA 3KMWA 3T3UA 2WTCA 3PJ2A 2QR7A 2W1IA 1JKKA 2VWYA 4FVRA 4ZS4A 4FL2A 4FRFA 3DK7A 2ZM4A 3ZRMA 2WGJA 3E8CA 5K0KA 3ZRKA 4EEVA 3PPZA 1UKIA 2JKOA 3TUDA 3RK7A 3UIMA 4W4XA 3ATTA 5AADA 3KRXA 3MY5A 5EYKA 4GFOA 3AGLA 4HCVA 4WIHA 3TTJA 3G33A 1J3HA 3ZC6A 3PVUA 2VWVA 4FTKA 4CFMA 3OCTA 3T9TA 2HXLA 2WFYA 3R8LA 2CLXA 3IKAA 4PMSA 3LXKA 5HG7A 5HG5A 4EH4A 5B2LA 5IQFA 3AD6A 3FDNA 2VX3A 1AD5A 3Q32A 3RM6A 4IMYA 1XQZA 4UYAA 3ML1A 3POOA 2X7FA 2C3JA 2EXCX 2OH0E 4M7IA 5ANKA 3SVVA 4ZZMA 3A99A 3LZBA 4NM0A 3OXZA 4RQVA 2OK1A 2OW3A 3DBFA 1ZYLA 2VUWA 2WMAA 4YP8A 3EIDA 3MTLA 1YRPA 3MA6A 3QTUA 4MBLA 4CKIA 1WMKA 2IW9A 2G9XA 2PE1A 3NYXA 4M0YA 1HOWA 3RVGA 4D1SA 1JLUE 2Z2WA 4TWOA 3BQRA 3ZRLA 2E2BA 2XP2A 4ITHA 2GQRA 2I1MA 4CG8A 2P3GX 4NM5A 2FSTX 2VGPA 4XJ0A 2C69A 3AD5A 4GJ2A 4X3JA 3SA0A 4PMMA 4U81A 4FIJA 5DMZA 3F9NA 1PXIA 3A2CA 4ANBA 4U45A 1PY5A 1H25A 5IPJA 3KN6A 5CEQA 3C9WA 5IQGA 3PXKA 5LCKA 2XK7A 3BBTB 1ZYDA 1XKKA 1TVOA 3FLZA 3H0YA 3MVHA 4ZXTA 3DLZA 4DH5A 2VN9A 3BEAA 4IZYA 3S3IA 4RVTA 2CNUA 2AQXA 4BIEA 4QP4A 3II5A 3REPA 4FX3A 3AOXA 2CCIA 2V55A 3BEGA 4LL0A 4D2SA 4Y5QA 2FSMX 3KFAA 5DR2A 3OEZA 3V5WA 5BVKA 4B4LA 4O7YA 4WKQA 1STCE 3BRBA 3A60A 2XKFA 2CGVA 3EQPA 3QAME 2QOOA 4G3CA 3DY7A 3FL5A 4NJ3A 5F95A 1GIIA 3D0EA 3G5DA 1PKGA 1Q8YA 3FI4A 3DBQA 3R2YA 5H3QA 4YZNA 2H6DA 4MX9A 4EH6A 4TL0A 3F5UA 3NNXA 4BBMA 2BRGA 2GNJA 1Q5KA 3QQKA 3U9NA 5JFSA 1H27A 3ZUTA 4IC8A 5EQEA 2QOIA 1H1QA 1R0PA 1XBBA 4C2WA 5C1QB 2XBAA 3U6IA 3MS9A 3U9CA 4FV2A 5J1VA 4V0GA 4ZSJA 4WG4A 3W1FA 2W4OA 1JNKA 3CTHA 3UG1A 3U4UA 4DH3A 3Q53A 4CT1A 1ZY4A 3AT3A 2XS0A 4R3PA 4OLIA 4J7BA 4JDKA 5DG5A 1KOAA 1OL5A 2W9ZB 5DI1A 5LOHA 2BZKB 2ZM3A 3ORTA 4DITA 2QOKA 4NKSA 3ORNA 1M2QA 2IVSA 2ETMA 2QOFA 3UVRA 4FSWA 4UZHA 4FJVA 3VJOA 3R8MA 3QYZA 4BGQA 1MRVA 3P9JA 3OWJA 2W1GA 4PL3A 4BYJA 3W0RA 4AQKA 4HYUA 5HICA 3ACJA 5A3XA 4FEWA 4RWIA 1SNUA 1OECA 4O7ZA 4XRLA 5GHVA 4X2JA 5L8KA 4USFA 5EYDA 2UVYA 2OJJA 2C3IB 4IAFA 4TYEA 5IZFA 4EK8A 4IZ7A 3MV5A 4AE6A 1CTPE 2R64A 3M11A 4FGBA 5DR6A 3VBTA 4BDFA 4YMJA 3PXYA 5H8EA 3CBLA 2PUIA 3TWJA 3U55A 5LQFA 4PTGA 5I9VA 3LHJA 4YJTA 3VS2A 4AXAA 5C9CA 5M4FA 1A06A 2HAKA 3R7VA 4HW7A 4EONA 3NW6A 3C50A 3TKUA 4EQCA 4YNEA 3D15A 3ID6C 4RIXB 2GTMA 4DH8A 3DFCB 4I93A 3GC9A 3GT8A 3RM7A 5D41A 3PFYA 5KNJA 1BUHA 4HPTE 4O83A 2ITNA 3O8TA 4FICA 3TI1A 5HE1A 4J97A 5HOAA 1ZYSA 4Q9ZA 2XNBA 5A54A 1O6LA 2JBOA 4TT7A 2A0CX 5JFWA 2YLFA 2QD9A 1UU3A 1MQ4A 2R4BA 3NRMA 1ZOGA 3IS5A 2YIWA 5EDRA 1OKVA 3TKIA 1BX6A 3VRYA 3W18A 4HVIA 5CSPA 5JH6A 4O7LA 3ODZX 4U41A 2VO7A 3ALNA 4IB1A 5CVFA 5I3OA 3VRZA 4L44A 2XARA 3PFQA 4IVDA 4NH1A 5HLWA 5IF1A 4MD9E 5AAGA 4WNOA 5M4IA 2GS7A 5IUGA 5EKOA 5JT2A 4QMOA 3UODA 1QPCA 3SW4A 3LJ2A 3I6WA 3ZTXA 2B53A 4JBQA 4GS6A 5IQBA 3SOCA 2YACA 4Y8DA 1PXKA 2WMXA 4UBAA 3BV2A 1GOLA 4BCNA 2H34A 2EB2A 3LFNA 1GZKA 2V22A 3LCSA 4G2FA 3AC2A 4AOJA 4BN1A 5A4EA 5E8ZA 2YABA 2ITTA 2XCKA 4FSRA 4IC7A 3D5XA 4XS2A 2C6TA 4KSPA 3ANQA 5TT7A 1PYEA 3CY3A 4BCFA 3ZFXA 3FSKA 3DXQA 2OSCA 3PP1A 2VO6A 4DLJA 2W9FB 4IH8A 3VBWA 2HZNA 1CKJA 1APME 1OI9A 3SKCA 3HDMA 3RI1A 4GKHA 4DGGA 5HVKA 4QPSA 3RNIA 3D83A 3NUUA 4O4DA 4TYGA 2UZUE 3AC4A 3ZO3A 1U5QA 2OFUA 4D1XA 4AACA 3CSVA 3UOJA 4NKAA 3E7VA 4TTHB 1U54A 4LMUA 3LJ0A 4GEOA 3KVXA 2B9IA 3W2OA 2E9UA 3MY1A 5AJQA 4FSUA 1XH8A 4JR3A 4C59A 4UMUA 4H36A 4L43A 2F2UA 4PDSA 5CQUA 2V0DA 3PY0A 4IVCA 4KIOA 4EC9A 2EXEA 5AMNA 4C3RA 2X9FA 2NNWB 4QEBA 2XM9A