4ZOGA

Vx-680/mk-0457 binds to human abl1 also in inactive dfg conformations.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
269
structure length
269
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title VX-680/MK-0457 binds also to human ABL1 with inactive DFG conformations.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
total genus 86
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zogA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zogA01
3IG7A 4D2TA 4QYYA 4BFMA 4DC2A 5JGBA 1M14A 3KL8A 3P0MA 2OICA 4GV1A 4KBCA 3SOCA 3EN9A 4BDAA 2YCRA 5DE2A 1W8CA 3GI3A 2QD9A 5HU9A 5JGAA 1WZYA 5KHXA 4B0GA 1BI7A 2YEXA 4YZCA 4Y8DA 3SVVA 4J7BA 3ZU7A 3HAMA 1GZKA 3F88A 4BYIA 5HVYA 1IA8A 1YI6A 5ANIA 1V0BA 3NLBA 4L42A 4RJ3A 3ORKA 5E8UA 5CTPA 3PA3A 5DHJA 5FDPA 3CKXA 3TM0A 2YZLA 4BDGA 3NYXA 4RWKA 2PSQA 4ZTRA 2VTMA 1YWNA 3Q4TA 3PXRA 2R3KA 3SRVB 1F0QA 2UW8A 2VTJA 4ZSAA 5J79A 1JBPE 3G9NA 3QKMA 3RWPA 4RIXA 2UV2A 4HGTA 5HIDA 1ZYLA 2X7OA 3WIGA 5HE0A 3CTJA 3RPRA 3LFQA 4IC8A 4U7ZA 4C3RA 1SNXA 1BUHA 3QFVA 4UALA 4YNEA 4EOJA 3LHJA 1KE5A 2W96B 3K3JA 2REIA 3ENHA 3H0YA 3KCKA 4I23A 5ACKA 5BX0A 4BCQA 4RJ8A 2BZIB 4GU6A 2JEDA 4JRVA 4MBLA 4EK5A 4LFIA 4FL2A 4UZDA 4G6LA 4WBBB 2XUUA 1AGWA 4D2WA 3ZO1A 4GT3A 4PMMA 5CQWA 2BUJA 2X6EA 5EYMA 2HZ4A 3OT3A 4CKRA 4MNEA 5T6KA 4Y83A 4YU2A 4YUQA 5GINE 3S0OA 3BHYA 4DH7A 2FO0A 3AMAA 3IS5A 3QQFA 3AC1A 4DF3A 1M52A 3UMWA 3I60A 4Y85A 2C3LA 2YM4A 2B1PA 4KS7A 1YW2A 2OFVA 2CKQA 5KMMA 4R1YA 2Z7QA 4U0IA 2WZJA 2WMQA 3TJDA 3Q9XA 2WFYA 4YR8A 3CLYA 5EYKA 5G1XA 4C2WA 3ZM9A 3DOGA 3BYUA 5AP1A 3DKOA 5CENA 3QXOA 1MRVA 4FT3A 4ID7A 2XJ0A 5EDRA 4BKJA 5LVMA 4RX7A 1Z57A 4USEA 3QRUA 2Y4PA 4IE9A 5HO8A 3BLHA 2J4ZA 3LVPA 4FKLA 4ZEGA 3GU8A 2RFSA 4MYGA 4ZSLA 4C7TA 1YDRE 1LPUA 5DG5A 2J0LA 3L8PA 3VUDA 3WOWA 5LQFA 1H4LA 4GMYA 1UU3A 2W06A 4R7BA 1YDSE 4MXYA 2R3OA 4JR3A 3DZQA 4DGGA 2UW5A 3KU2A 4GT4A 4HVIA 4I0TA 4WNMA 4BCKA 3VUGA 3GCQA 1GOLA 1FVTA 1M17A 4FKVA 5EH0A 2H34A 2WKMA 4FG9A 4A9TA 5I5ZA 4FC0A 3NUAA 1IR3A 4BTKA 4UMTA 2VTHA 2XK7A 3ZLYA 3VC4A 4QP4A 1BMKA 3BQCA 5L2QA 2ZMDA 4DGOA 3MFTA 4BWPA 2PPQA 4W9XA 4Q5HA 2J0KA 5AFVA 2WEVA 4PRJA 5ETFA 4CV9A 3VW6A 3H9OA 2XIZA 3Q4ZA 4IAIA 4FUYA 2E9NA 4G6NA 4I22A 1R0PA 4XV2A 2YWVA 4CFMA 4K0YA 3IOPA 2IZTA 3A7IA 3MVHA 2Y4IB 4OTFA 5E8TA 2VX1A 5AR4A 3K5UA 4F63A 3DXNA 1OMWA 1WBPA 5IDNA 3EZRA 3KK8A 3TN8A 4NKSA 4LM5A 2BHHA 2WELA 4EBWA 3ORTA 3IW5A 3TUDA 3NPCA 3OMVA 4NJDA 3L9NA 4I21A 2XMYA 2XRUA 3WF8A 2OIDA 3RPYA 1WBNA 3NUXA 1OECA 2YZAA 3DK7A 2IO6A 3ET7A 4DINA 2R2PA 2I40A 2WOUA 2UW0A 3CQUA 5A46A 2A27A 3CY2A 4IACA 3D7TA 1YOMA 2B52A 2ZV2A 1SMHA 3MFUA 3U6HA 1XQZA 3LFDA 3IO7A 1ZWSA 4U42A 3SG8A 3OUKA 2PULA 2OU7A 4EHVA 2YDKA 2CNQA 2ONLC 4JBVA 4PY1A 1SYKA 4GEOA 2BAQA 4MXZA 2QC6A 3PWDA 2XEYA 2C5OA 3ULIA 2XKCA 4R3RA 4IANA 1NY3A 5CEKA 3FXZA 1H1PA 2XBAA 3RALA 2JFLA 4O91A 4AZWA 2QOKA 2OLCA 2F2UA 5KMKA 5IQEA 3IGGA 3T8OA 3KMUA 4EJNA 4FSMA 4XRLA 1R78A 4YSMA 2BALA 4F70A 4F9CA 3B2TA 3BHVA 4JQ7A 4CKJA 1H25A 4TL0A 4QYEA 3AT3A 4FKIA 3W2RA 2Y9QA 5HOAA 4MBIA 5JT2A 3Q5ZA 5C8KA 3PZEA 3O0GA 2C5XA 3G2FA 5HE1A 2ZYBA 2CKOA 3KA0A 1MP8A 4J98A 3QGWA 2FVDA 4ANQA 2YN8A 2JGZA 4TYJA 3PYYA 4IDTA 3DFCB 5HHWA 2WNTA 3ENMA 4ZY4A 5I0BA 2X8DA 2XCKA 1KOAA 5H2UA 4M97A 4QNYA 3RWQA 3VJOA 4BBFA 4RQVA 5BVNA 5HX8A 3FZOA 1U5QA 5CU2A 2RGPA 4AW5A 2ITYA 3KXMA 2HENA 4H39A 5L6OA 4DCAA 4WG4A 5G6VA 4E4LA 3UO5A 2JAMA 3CP9A 3TJCA 3LM0A 4BGQA 3PXQA 1TQMA 2QCSA 4L9IA 3MPTA 2QU6A 3N4UA 3DNEA 5AUYA 4EOMA 4U8ZA 5CAPA 3UNKA 4C02A 5K0XA 4LGDA 5D7AA 3HUCA 5A4LA 2YLFA 4QMWA 4FOCA 4DT9A 4P2KA 3WF7A 2F57A 2QKWB 3OY1A 3SG9A 3D5WA 2F7XE 2QONA 4JIAA 1YQJA 4KIKA 4O7ZA 5GIPE 5KMNA 2O2UA 3M2WA 1OBDA 2OKRA 5LMKA 1UNLA 5JZJA 3EQPA 3ROYA 2LAVA 2YHVA 3R0TA 4OTGA 3O96A 4IW0A 1P4OA 3G0FA 3NAYA 4FKRA 1R3CA 2ZDUA 3P08A 1YOLA 2BILB 4HOKA 4PDOA 3EQHA 4M68A 5KZ0A 3R1NA 5CWZA 5IZFA 4Z7GA 5HBJA 5I9YA 4IX3A 5E9EA 5HBEA 2WIPA 5B2KA 3V6SA 3VUKA 5B0XA 4ZZOA 3SGCA 3UQGA 4U40A 3ZS5A 2C30A 4KBAA 3JVRA 4FSZA 2VTNA 2ZV9A 4EH5A 2PMNX 3K2LA 4QOXA 3PXZA 4DFZE 2EUFB 2ACXA 1XH5A 4KUJA 1OKYA 2H96A 2W1FA 1PMNA 1Q8UA 3E7VA 3MYGA 4BHNA 2WQMA 4JIKA 4RWIA 1KE7A 3NNXA 2JIVA 1JQHA 4UWYA 2IW6A 3FKLA 4CNHA 1XWSA 4O86A 4QMNA 4R3PA 5BVWA 3C5UA 1O9UA 2O63A 4PV0A 5CS6A 4O1OA 5CZIA 5CXZA 5FWKK 4TY1A 1QMZA 1H08A 4GK2A 3HDMA 4JQ8A 4AE6A 2HELA 3ODZX 4IX4A 2C5NA 4EI4A 4C8BA 4DYMA 2R3HA 3LFBA 2W9ZB 5BYYA 3DJ5A 2BAKA 3UOLA 4NW5A 3LLAA 1LP4A 1FVRA 3O50A 4JDJA 3OXZA 3LFFA 5KBQA 2YM6A 4DFUA 1HCLA 2Z60A 3CBLA 4J97A 4YJQA 2O8YA 3WBLA 2XKEA 3CCNA 5D7VA 3PA4A 3ODYX 2XYNA 4RMZA 3FPQA 4FKJA 2C0IA 2RF9A 3LJ2A 1J1BA 3QTXA 4UB7A 3ZOSA 3DZOA 2EXCX 2FSMX 5DOSA 3CC6A 4D1SA 4RIYA 1VJYA 4EOKA 3HL7A 4BDKA 2QOQA 3PTGA 4EHGA 3OROA 4NM7A 3NR9A 3Q6UA 4ITHA 4J52A 4PP7A 5L2WA 2QOLA 2WTWA 3AQVA 4AT3A 2XJ1A 3IQ7A 3NYOA 4I92A 3UNJA 5KMOA 4E4NA 1GAGA 4YJVA 4FSTA 4KAOA 4R7IA 3WILA 1KE6A 2Z2WA 3LJ1A 3A62A 4UXLA 5E1EA 4AQCA 5I9UA 5K5NA 2X2LA 4B8LA 3UJGA 4EL9A 1Q5KA 1WMKA 3M42A 3F5GA 3R1YA 4U81A 4WSYA 3VUMA 2WTCA 3D0EA 2W1GA 2VTTA 4WG3A 2WMSA 5AV1A 2B55A 3ACKA 4GVAA 4IBMA 3WI6A 5AA9A 2C68A 5EW8A 3DXPA 4F1OA 4C4EA 3P7CA 3CGOA 3T9IA 4KS8A 4FIHA 5JFWA 4S32A 4MEDA 1PMEA 4LMUA 5J5SA 2VO0A 2GNFA 5M44A 4D0XA 1ATPE 3BKBA 4I6QA 3W2OA 2CCIA 4DEDA 4WO5A 2FSTX 2HZ0A 4X2JA 4DEBA 3JVSA 4NK9A 5HE2A 5HICA 2F49A 3N51A 1ZOGA 3W32A 1RW8A 1OBGA 3AMYA 4S2ZA 5ANOA 4YLJA 5FTGA 1WBWA 3OXTA 4Q5EA 5B7VA 5KHWA 5JFSA 3HV4A 2XEZA 4JAJA 4DG3E 4A4LA 3KN5A 4FA2A 2VAGA 2CLQA 2WTIA 3GP0A 4GCJA 3LW0A 3WF6A 3SRVA 3U55A 3KULA 3KXNA 4UMRA 2PMOX 3V5TA 4C35A 2X7FA 3OWPA 1NVSA 3UZPA 5AMNA 4GYIA 2YERA 1DM2A 3ZMMA 2WTVA 3F5UA 2F7ZE 4PMSA 5C03A 4AW1A 2PHKA 2W1DA 4ZOGA 3EZVA 1WVXA 4QO9A 4NM0A 2BAJA 4YBJA 4ACDA 1U54A 3P1AA 3KULB 5AR5A 4BCOA 5F95A 1Q24A 4FT9A 4PQNA 3SHEA 4FE2A 2UZBA 2OJFE 3O8PA 4RC2A 4TYHA 5BVKA 4BCIA 1QPJA 3AT2A 3FHIA 1PXMA 4JLCA 4BB4A 2XP2A 4MQ2A 4NTTA 2X2KA 3C4WA 2GQGA 3AT4A 5J7BA 2R3GA 3IONA 3P23A 3LKMA 3FWQA 5TOZA 1KOBA 3ZFXA 2ZM4A 3R02A 5L8KA 4H1MA 4X2NA 4WG5A 4XP2A 2UUEA 4O0SA 3RPOA 4GYGA 4PPAA 4TKSA 1Q8WA 1XBCA 1U4DA 3GT8A 5C8MA 2WQOA 3A7GA 4GW8A 2X39A 3W10A 2VWUA 5CI6A 5GJDA 3ZYAA 5LCJA 2XA4A 2OXYA 2J90A 4A9RA 3OCTA 1O6KA 3NIEA 3UVQA 4FSUA 4FZAB 4C61A 3I7BA 5IQHA 4D2PA 3BLQA 3UGCA 4K9YA 4W4YA 3Q9YA 3RK7A 4CFXA 5AP7A 3RM6A 5AP3A 2GS6A 3FEGA 4L8MA 5JFXA 3MPAA 3AC2A 4ZLZA 4X0MA 2W7XA 4ZK5A 4EH2A 1CMKE 4HYUA 1FINA 4DGMA 2JC6A 4II5A 4IHPA 3FMJA 4CTBA 3BU3A 4O7RA 5FD2A 3V3VA 4DT8A 3EQIA 3OD6X 3BHHA 2WU6A 1CKPA 2FYSA 2HIWA 4E5WA 2YAKA 4RIWA 2RL5A 4BWXA 5CI7A 4CFFA 4YSJA 4HVGA 2VN9A 5LVOA 4UMUA 2PZ5A 3GEQA 2QOOA 3QA8A 2WIHA 4EUTA 4JVGA 5I3OA 4IJPA 1HCKA 3QBNA 4QNAA 3NX8A 4FSRA 4RVKA 5C01A 4LGHA 4AWIA 1Q99A 5DR6A 3UTOA 4CLIA 4YPDA 1CKJA 2XZSA 4ZJJA 3ZDUA 4EK8A 4QYHA 4PTEA 4EH6A 3ITZA 3JXWA 1YWRA 3R8ZA 4F7SA 4AOTA 4JXFA 4MD7E 3DKGA 4L3LA 3KMWA 4RIOA 3VQHA 5AR3A 3VW8A 3V8TA 2EB3A 4AN2A 1G8AA 1UNHA 3OOMA 3QQUA 5EI6A 3WZEA 2EXEA 3OP5A 1JVPP 1XH6A 1ZZLA 3R1QA 2JBOA 4J53A 3OT8A 1YDTE 2Z8CA 2OJGA 2W9FB 2WTJA 4E8AA 3PP1A 2C3IB 4D58A 3QUEA 2J5FA 1B38A 5CALA 5DMZA 1W98A 3GBZA 1OIUA 1PKDA 2GNLA 1WCCA 2ZOQA 3FBVA 4FSNA 4ZIMA 3EN5A 3KMMA 3POZA 4L7FA 5J1VA 4FL1A 4CRSA 3AOXA 4YJUA 4DEIA 2PUPA 5AUUA 4HZSA 4FV8A 4FTUA 3WF5A 4GSBA 2JKKA 3LMGA 3MIAA 3FLSA 4XV9A 2A2AA 4EHEA 4BGGA 2XNEA 3OEZA 3D5VA 1DAYA 4UWBA 4ANLA 3FZTA 3DLZA 4GL9A 2WMXA 5EI2A 4BBMA 4CSVA 4FV7A 2R3QA 4XHKB 4EQCA 4TZRA 5BQ0A 4EONA 3DKFA 4G6OA 3NYVA 3UC4A 3QKLA 5EKNA 3LIJA 1NVRA 3R7OA 4CT2A 3LQ5A 4JBQA 5DBXA 2UZWE 5M57A 3F2RA 5H8BA 3V5WA 3PXKA 1Y91A 1SVEA 3Q04A 2XNGA 4D2VA 4F9BA 4LI5A 1Q3WA 3FLNC 2R3LA 1JKKA 5ETAA 3ZLWA 4TYIA 4F1MA 3QRTA 3G5DA 4IADA 1AD5A 1P5EA 2J9MA 4FYOA 5A4EA 4TWNA 3VS7A 3QCXA 5M4FA 3R7EA 2W4KA 3HMPA 3IGOA 3PSDA 4RQKA 2Q0BA 2UVZA 2XIYA 3LXLA 4K18A 5FRIA 4BL1A 1K9AA 4GVJA 5EI8A 4TXCA 1ZMWA 3ZH8A 4JL9A 3UOJA 1CTPE 2E9UA 4NFNA 3VUHA 2PVKA 3PA5A 5EDPA 2HOGA 2YM8A 2FSLX 3CTQA 3LFEA 4FTMA 2RG5A 2H6DA 5AM7A 5BUIA 5HTIA 5E8XA 1JAMA 2F7EE 3UQCA 3VN9A 3D5UA 4TYGA 4BDHA 5AA8A 4HPTE 3MY5A 3C13A 3ULZA 3U87A 3H30A 4ZTQA 3MJ1A 3QQLA 4AGCA 5IEXA 5D1JA 3Q4UA 3TL8A 3GU5A 3VF8A 3QF9A 4EOPA 3LAUA 4ZSEA 4P90A 3UIUA 1YRPA 2RFDA 2IW8A 4UY9A 4QMYA 1XJDA 3WE8A 2QOFA 4I0SA 1NVQA 3FMEA 4C36A 5CEOA 4I1ZA 5L3AA 1XO2B 2KULA 2C6KA 4FI1A 5L8JA 2A0CX 4FNYA 1OZ1A 4CFUA 3FZRA 4F4PA 3G15A 3A7FA 4IH8A 4AOJA 4HGEA 1WBSA 1J1CA 3QC4A 4D4SA 2JFMA 3R2YA 4ARKA 4U44A 5JFVA 3UMXA 4P5QA 2XNOA 3V01A 3KRJA 3OS3A 3UPZA 5EM7A 4RA4A 2C0OA 2BVAA 2PZPA 5EM5A 4MWIA 2ERZE 4KRCA 3MBLA 4W9WA 4U41A 1W7HA 4JNWA 2G2FA 3RBWA 2PUIA 3EQGA 4C33A 5KCVA 1H1WA 4FEWA 3QLGA 3ZRLA 1H00A 2W1ZA 4IZ7A 3M1SA 2H8HA 4BTMA 3F69A 5BYLA 3EKKA 3HECA 5M08A 3NNVA 2HWOA 3W18A 3DCVA 5DVRA 3T9TA 4EYMA 3QD2B 4FV0A 4C58A 1Z9XA 2VWBA 4DBNA 3W16A 4AX8A 3OEFX 4DEHA 2X0GA 3R9NA 4AA0A 3U51A 3FZSA 2ITPA 3FLQA 5LVPA 1UKIA 2OIQA 3G0EA 2VWWA 2QOHA 5DRDA 5ICPA 1IEPA 5DLSA 5CX9A 4F08A 4GT5A 4DG0E 1H27A 3BHUA 1FGKA 4FNXA 4D1XA 5AR2A 4H3QA 2PUUA 1OVEA 4GU9A 2YM5A 3VHEA 3P7BA 1PXKA 4R5SA 1DI8A 4YP8A 3VS4A 3F2NA 4ZLOA 4XUFA 3KVWA 2XNNA 3MI9A 3VBXA 4J8NA 2J51A 1E1XA 4MK0A 2BDJA 2C47A 5FQDC 3BGPA 3MVMA 1YXSA 2E9OA 2QVSE 4QMOA 5AAGA 4LRKA 3LCKA 1WAKA 4IAKA 4Y5HA 3UODA 4UZHA 4XOYA 3HDNA 2PVHA 1GNGA 1OIQA 1SM2A 4L68A 2IPXA 3UOKA 3MW1A 2V22A 5EW3A 5T68A 4OAVB 3R71A 3CQEA 4QTAA 3D14A 4EC8A 1WBVA 5IKWA 4RVTA 4C4IA 3NVKI 4DLJA 1PHKA 5K3YA 3ZZEA 5H3QA 4F7LA 4XYFA 2ZB1A 4RJ7A 3T3VA 4BF2A 2OH0E 3F3VA 4YZDA 5CF8A 3MVLA 3NUSA 3OWKA 3QQHA 1OKVA 4BYJA 3Q9WA 4WSQA 2YCSA 2B9HA 5AEPA 4BR3A 4U97A 4RVMA 4X3FA 1QPCA 5E92A 3DK3A 2QR8A 1OL6A 2ZV8A 3UVPA 3W2SA 3TUBA 3EL8A 4NCTA 4UBAA 3OZ6A 2YWPA 2VU3A 3V5JA 4EBVA 5I3RA 5KNJA 3BPRA 4FTTA 1TVOA 3R8PA 2O64A 4CCBA 1YXVA 1ZRZA 3HLLA 5DH3A 3REPA 5KKRB 4ALVA 4YJPA 3OTVA 3QHRA 4IDVA 4O96A 3W8LA 5M06A 2ZAZA 5HZNA 3SAYA 2BFXA 4G3DA 4HYSA 2Y6OA 4IMYA 5AJQA 2C3JA 2YJSA 3CPCA 3BQRA 2WMBA 1PY5A 5ANKA 5HVJA 1BLXA 4C3FA 3U54A 4Z9LA 5CNOA 3S4QA 3C4EA 4B7TA 4ZMEA 5CEQA 3TIZA 4CMUA 5CXHA 5CU0A 1QPEA 2YA9A 4PDYA 2QO9A 4M13A 4XG7A 5T3QA 3C50A 4IM2A 3U8WA 4AT4A 5EFQA 2C4GA 3QD0A 2EB2A 2JKQA 2PE0A 4FIEA 3TTJA 4S30A 3BBTB 5E8SA 1OPJA 3E8DA 3GC7A 4IEBA 4Q2AA 2OF4A 2X7GA 3PWYA 4JDHA 4QMZA 3DK6A 4QRCA 4CCUA 3F61A 2I0YA 3PG3A 5FG8A 3R8UA 4OBPA 2OH4A 5GIOE 3ORIA 5EQEA 4RIXB 3E63A 4QMLA 3KQ7A 5EM8A 5DT0A 4R77A 1W0XC 4R1VA 3ZXTA 3BZ3A 3R9DA 4M8TA 2HXLA 2VO6A 3RTPA 3VJNA 3IW6A 4FGRA 5HD4A 1IRKA 3OUNB 3FUPA 4K11A 1JNKA 4Y46A 5HORA 1GIJA 4AW0A 2X4ZA 2HY81 3IDBA 3UOHA 3VS5A 5IEVA 2RSVA 1X8BA 4JI9A 3VBWA 3PP0A 4EC9A 1PJKA 3KY2A 1ERKA 3A4PA 4RFMA 4OGRA 3ZO3A 3DKCA 2VGOA 2ZMCA 3EYGA 3QGYA 1J91A 3EQDA 4QYGA 4YNOA 4MXCA 1WBTA 1BX6A 2YDJA 5IQDA 3FC2A 3IK3A 4FKUA 3THBA 1OM1A 3MV5A 1DAWA 1A9UA 2I0EA 2JBPA 5DN3A 3SW7A 5TR6A 5HESA 1M7NA 4YHTA 3R63A 5CY3A 2ITOA 4IAFA 4NIFA 5CAOA 3TZ9A 3GUBA 1XHAA 4EYJA 4NH1A 4ZP5A 1GZOA 2WMTA 3QX2A 1VYZA 4M12A 4EZ5A 3OF0A 4IAAA 3V51A 5AWMA 3F82A 4PDSA 1TKIA 2YITA 4RX9A 4HVHA 4ZTSA 3O7LD 4MNEB 4TWOA 4OW8A 4JX7A 3PJ8A 3SX9A 1WVYA 4O27B 2XK3A 1FPUA 4U43A 3LZBA 4ZLYA 3QUDA 5KZIA 4FVQA 4MD8E 5JK3A 1PF8A 3GB2A 3ZRKA 5CU3A 1Q8TA 5D11A 2P55A 2JDTA 1ZY4A 4K33A 5JEBA 3WE4A 3JYAA 1PXNA 3RPSA 2FB8A 5CQUA 3SW4A 5FBOA 5GHVA 1MUOA 3I79A 4RVLA 3IDPA 4FV1A 4TWPA 2BTSA 4N6ZA 1JPAA 3QWJA 1XKKA 2VTRA 2J50A 3D9VA 3KXHA 4BDEA 3LE6A 3LQ3A 4HPUE 4QP7A 2DYLA 3MB6A 2W4OA 2R3IA 1LEZA 4TYEA 4O2PA 1PRYA 1UNGA 4I20A 3LCDA 4BC6A 3ZO2A 4AG8A 3MVJA 3QA0A 2UW7A 5IA1A 3A2CA 3LCSA 4FTQA 4RC3A 1Y6BA 3ATTA 5CVGA 4G3FA 1YXXA 2R3MA 4G16A 4I5PA 4EZ7A 5EOBA 1HOWA 3E88A 3Q60A 3TV6A 2VTSA 5A4QA 3DBQA 3FSKA 2GU8A 4HNFA 2BZHB 3HYHA 4WBOA 3TV7A 1OL7A 3Q2MA 2B4SB 5A6NA 5IISA 5LWNA 2PWLA 3PIYA 1JKSA 4DH3A 2WMWA 2WGJA 4O22A 5H9BA 4G9RA 4IXPA 5JSMA 4QTBA 4TYHB 4ZZMA 1G5SA 2QNJA 5EDQA 3ZM4A 4YTCA 4BI0A 4F9YA 3DB8A 2UZLA 4IM3A 4NTSA 3A7HA 4G3GA 5EW9A 3RAHA 2UW9A 3AG9A 3FLWA 4M14A 4UXQA 3I0OA 3W2QA 3MS9A 4JG8A 3HNGA 4LQMA 4YJOA 1XH8A 4OT6A 3V8WA 4EOSA 4ASZA 2PVFA 2PVJA 4ITIA 1STCE 4MF0A 4YGAA 3W2CA 4UN0C 4O7LA 4RJ5A 2GTNA 3SD0A 2H9VA 3Q96A 5HG5A 2O3PA 1OKZA 4TPTA 3D2KA 4GH2A 5AP5A 4I5HA 2EU9A 4L52A 5JQ5A 1G8SA 1Q8ZA 4C3PA 4IM0A 4NL0A 3KF4A 2P33A 4O7SA 2W17A 4F0GA 2NNWB 4FYNA 5ANEA 4ZJVA 2IVTA 4Q9SA 1VYWA 4E20A 4FKOA 4B4LA 2XK9A 4EOQA 3R7GA 4IAZA 3KGAA 5CZHA 3A61A 1H1QA 5H8EA 3BEGA 1FVVA 2XKFA 2GNGA 4GRBA 4S34A 3WZJA 4QMVA 4ANMA 5CLPA 4AU8A 5CSHA 4FV9A 4UYNA 5GJGA 1OL1A 3GOKA 2GNJA 5D41A 3HKOA 3MFSA 2FUMA 3RNYA 4WOVA 2JDRA 3EHAA 4R78A 5AP6A 4V04A 2QLQA 2P0CA 3UIMA 1YKRA 4C0TA 1Y6AA 2XK4A 4NUSA 4EORA 2VV9A 4J95A 3ETAA 5EHLA 5TKDA 2P4IA 4CT1A 2O0UA 3HA6A 4L3PA 2IWIA 4NZWB 3HRCA 3R7VA 3OWJA 1Y8YA 3HEGA 3FJQE 3PZHA 5AR8A 5AV0A 4N70A 5ACBC 3CY3A 3ATSA 3CE3A 3P4KA 4ONAA 5D10A 3DAJA 2XH5A 2XNBA 3V04A 4X7QA 3HMOA 4OTPA 5CEIA 4F6UA 1AQ1A 4ZTMA 3MB7A 3KF7A 1XBAA 2PVNA 5JKGA 2EVAA 3CKWA 1K3AA 4ZZNA 3LFCA 3VRYA 3MTFA 3QALE 4FR4A 3ZSIA 2QKRA 2GNIA 3F6XA 3EFLA 4DE4A 4UX9A 3LM5A 5M55A 4O38A 4WRSA 3NUUA 4DEEA 4IAYA 1GIIA 4G5JA 2CLXA 5L8LA 4IVBA 4XLVA 2GMXA 4DH5A 3KCFA 3D7TB 3TV4A 1E9HA 2BDWA 1PXJA 2HCKA 3OCBA 1JWHA 1PYXA 3DLSA 4OTIA 3IW4A 1V0PA 3QLFA 4Z7HA 2QR7A 2JIIA 4CG8A 5M09A 4ZY5A 3RZBA 4O0RA 2ETKA 2JDVA 4EH4A 4GFMA 2XNMA 1P14A 4GUEA 3PIXA 4FZDB 5AADA 4TWCA 3EQRA 4FVPA 4IVAA 5DGZA 4CZTA 5K4JA 4DH1A 4MAOA 2UZTA 3ZO4A 2OF2A 5HCZA 3L8XA 4QQTA 4XG9A 5JMSA 3NNWA 5TF9A 1A48A 2G01A 3R1SA 4UMPA 4D2SA 3QL8A 4ENXA 4LGGA 3RVGA 4JR7A 3PRFA 4LUEA 3ZLXA 1H0VA 3QD4A 3O8TA 4AZVA 4ERWA 2AC3A 3ZFYA 3DGKA 3NW6A 4WT6A 4YO6A 3O23A 5HBHA 4MXOA 3DBCA 1ZMUA 3NAXA 4JAIA 1Q62A 5HLNA 4ZTNA 1M2RA 1BI8A 3F3UA 5CYIA 2HW6A 2XB7A 2VWZA 4BTJA 3AMBA 3I4BA 4MF1A 5JQ8A 5AAFA 1E1VA 3VWAA 3ORXA 5E4HA 3VQUA 4DN5A 3KKVA 4M3QA 4MX9A 4J8MA 1OPKA 5EKOA 1U54B 3R21A 4V01A 4CFNA 5J95A 1LR4A 4A4XA 4YLLA 1GIHA 4U3ZA 5HLPA 4XG2A 4FF8A 3ZDIA 1ND4A 2QG5A 3PLAE 2GHMA 5M56A 4R7HA 1URCA 2PY3A 4MNFA 2VRXA 2XIKA 3EN6A 2ZB0A 3EYHA 4QQCA 4FGBA 2B53A 5HD7A 3CD8A 4QP3A 4QTCA 5D12A 5KX8A 2ITXA 1XR1A 3MWUA 4QMXA 3GU4A 4AFJA 2BROA 2BRMA 1JSTA 2QHNA 3LFSA 3EN7A 4JBOA 4PX6A 4QP6A 1IA9A 3QZIA 3JR1A 4CD0A 3DU8A 3CEKA 1VEBA 3PJ3A 2Q83A 3TDWA 4X2GA 4IB5A 3UC3A 4F6SA 3R83A 2PZRA 3WZKA 3ZFMA 4I4EA 4G1WA 2CN8A 3QQJA 3QZHA 5GZAA 1SVGA 2R3RA 1XBBA 1JLUE 1YWVA 4BCFA 1GY3A 5AIKA 5BNJA 4WNKA 3PSBA 2C5YA 5AP0A 2XM8A 4FZ6A 2IW9A 5GNKA 3ZBFA 2BRHA 4K8AA 3LLTA 3Q32A 4FV5A 1CDKA 5HEZA 4OBOA 2UW6A 2JIUA 3G33A 3FXWA 5HNBA 3DBEA 5J7HA 5FP5A 3DAEA 2B9IA 2QODA 2WHBA 2J5EA 3EKNA 3GQLA 1OUYA 4RGJA 2R0UA 5IUIA 5AV4A 5J9ZA 4EKKA 3NMUF 2FA2A 3KRXA 3JY0A 4FNZA 4RX8A 3VF9A 4C2VA 3C0IA 2R3FA 4YURA 5F9EA 5HVKA 3K3IA 3O17A 2XF0A 3R00A 2A1AB 4LOQA 3NUYA 1Q61A 3KB7A 2QOIA 3CR0A 4RLKA 4TNDA 4XP3A 3ZEPA 4E4XA 5ITAA 3Q53A 2Z7SA 3HMIA 4O0XA 3NDMA 4R5YA 3VIDA 2V7AA 4IZYA 4XG3A 2VTPA 3MH3A 3PPKA 3RHXA 4PTGA 5AUWA 5JRQA 4YJRA 4FMQA 3ZZWA 1ZARA 3QRIA 3KXZA 3KC3A 2YCFA 3FKOA 2UZNA 1J7UA 4G5PA 4XG6A 4E93A 1MRYA 3RNIA 4PL4A 3UPXA 3P78A 2J7TA 2ITUA 1TQPA 3R04A 3DQXA 2YAAA 3MDYA 2BZJA 4PTCA 2BHEA 4S31A 3D94A 3F5XA 3V5PA 4CQGA 4ANSA 3ORLA 4QQJA 3ZRMA 1UWJA 3QTRA 5F4NA 3DB6A 4YC3A 3RM7A 3ZSGA 2C1BA 4D28A 3TKIA 3NW7A 4JG7A 3DDQA 3PXFA 4M66A 3PVGA 4ITJA 2WMVA 3NNUA 3C7QA 2OK1A 2VX0A 2F2CB 3TKHA 2RKUA 5FM3A 4FUXA 4RC4A 5K5XA 4KSQA 5J5TA 4MD9E 3VAPA 4KIQA 1JOWB 1BYGA 1GZ8A 3DDPA 4FG8A 3FI3A 3LCOA 3S2PA 4OR5A 4CYIA 5IQCA 3PIZA 3AC8A 2ITVA 4KIOA 3I1AA 4DLIA 5I9ZA 3D15A 2CGXA 2EXMA 2QHMA 2RIOA 4IWQA 5CAUA 2AUHA 3PRIA 5CAVA 3HV6A 2OZAB 5A4TA 3R9RA 3PE1A 4FSQA 3FPMA 3N4TA 1CM8A 1R1WA 3LOKA 3LFAA 4HVDA 4APPA 3G9LX 2IVVA 4MKCA 2HZIA 5AX3A 3E62A 1P4FA 2Y6MA 4FNWA 4GFOA 4HCVA 5F1ZA 3TACA 5EK7A 3MY0A 2I6LA 5FDXA 5EQYA 4JS8A 3EJ1A 3H10A 3ZSHA 4QTDA 1QCFA 3NW5A 4M0YA 1YI4A 3LXNA 4P5ZA 1PXLA 1U46A 2WAJA 3GCSA 3HVCA 4PPBA 2C69A 5FEDA 2GSFA 4DFNA 2BRNA 2IJMA 2XIRA 3H0ZA 3PPJA 4KKEA 5HO6A 4E1ZA 4ZAUA 2JLDA 3DBFA 3NS9A 2C6LA 4QT1A 1YHSA 3EIDA 2YISA 5L4QA 4LMNA 4GIHA 5CANA 2PYWA 5I4NA 3ZLSA 2JKMA 3CJFA 3FMHA 1ZXEA 3IDCA 3Q6WA 4CLJA 5IMEA 5AV2A 3M11A 5HCYA 4EH8A 4X3FB 4BCNA 3S1HA 1JKTA 4M7IA 4NIFB 4KKGA 2GS2A 4AA4A 5FXRA 3VHKA 4N4SA 2OXXA 5AUXA 5DA3A 2W1CA 4I5MA 4NFMA 2UZUE 4J99A 3KXXA 3QUPA 3FV8A 3L9MA 4H3PA 4K2RA 3V5LA 3D2IA 4PMTA 4MXXA 4DFXE 4O1PA 5A54A 1NW1A 2XCHA 4N0SA 5HO7A 3ALOA 4OTHA 2GTMA 4EQUA 4YHFA 3KRLA 1W83A 4H3BA 3NRMA 4KKHA 3MH0A 5CEMA 1ZY5A 4IC7A 2B0QA 5CT0A 4DFBA 4EQMA 1CKIA 3AD4A 2I1MA 3EQCA 3RKBA 4QMTA 5IPJA 4PDPA 3RCDA 4EOLA 1ZLTA 2I7QA 5ANJA 3TDVA 2IVSA 2PVMA 4W4VA 3QU0A 4YJSA 1EH4A 3L8SA 4LV8A 1W82A 4DTBA 4CGAA 4NW6A 3ZC6A 3HV7A 2BKKA 4BCMA 4JDIA 3OWLA 3E5AA 5TO8A 4AOIA 4Y73A 5M4IA 3PJCA 3VUTA 4NU1A 2Y8OA 3OFMA 5A4CA 3UP2A 3HMMA 4Y72A 1YXUA 2Y4IC 2OJ9A 3D83A 3ZUVA 3C51A 4V0GA 3FI8A 5CVFA 3H9FA 2WMAA 3GQIA 3MY1A 3TZ7A 2P2HA 4L45A 3RPVA 1O6YA 4J71A 3CSVA 3UP7A 4RX5A 4X6QC 1IAJA 1RDQE 1A06A 2BRGA 2CGUA 4QTEA 2PVYA 2ZV7A 5LMKC 4GIIA 4KABA 2JITA 3HP2A 5L2IA 2HK5A 4M67A 2J2IB 4FV4A 4AGWA 3R28A 2CMWA 1CSNA 1WVWA 4CG9A 4U80A 2PMLX 3I0QA 4L44A 3T3UA 3ZUTA 1URWA 4IIRA 4X3JA 2R3NA 4O82A 5KE0A 5BVEA 5CSVA 3TNWA 3FZPA 3POOA 5IQGA 3EN4A 4YJNA 4F9WA 2WXVA 3ERKA 4YMJA 4RJ6A 4I4FA 2FGIA 5AP2A 4OTRA 4KWPA 4AT5A 4IVDA 4B8MA 4Z55A 3JS2A 1G3NA 3L8VA 3EOCA 3Q9ZA 3D5XA 3VVHA 4E3CA 4U9AA 1U5RA 3UE4A 2VTIA 1ZYDA 5DR9A 1YVJA 5IDPA 5KMIA 4FICA 3TNIA 1ZMVA 2VWIA 1RE8A 4BBEA 3FC1X 3FQEA 1F3MC 3I5NA 4E5BA 2YM3A 4OBQA 3QZGA 4O6LA 5D9HA 4CV8A 2GQSA 4AS0A 4UWCA 3DTWA 3PE2A 2BRBA 5FXQA 2CJMA 3SQQA 2O5KA 4FIGA 3ID6C 2ETRA 5IA4A 1M2PA 2C6TA 3WYXA 4FKQA 5IMXA 5B2LA 4EJ7A 4ORKA 4E6QA 1KSWA 2NO3A 4QMQA 4QD6A 3HUBA 2VWXA 4WRGA 3BYVA 3VBYA 5B2MA 3FSFA 3FQSA 4I41A 3BU6A 4D5KA 5C9CA 2CCHA 2WB8A 3O8UA 1GJOA 1OPLA 2UZOA 1FOTA 3CS9A 4FTIA 2UVXA 2WO6A 3RINA 5IA2A 1U59A 2W1EA 1NXKA 1SZMA 4GFGA 4A06A 2C0TA 3BE9A 4GJ3A 4L67A 3WARA 5HG8A 3WZDA 3G6GA 3TZMA 1UU7A 2VTQA 2XVDA 4EZ3A 5IU2A 2CKEA 4G34A 3BIZA 3SV0A 2RFEA 4BI2A 1K2PA 1RQQA 3TI1A 4BY9E 3BE2A 1ZOEA 2RFNA 2WOTA 3ANQA 5DWRA 4F09A 3BGQA 5HG7A 5C26A 3I7CA 4CEGA 3VBVA 5LVNA 4I3ZA 4DBXA 4FKTA 1MQ4A 1FGIA 4AE9A 3FZ1A 4PNIA 4IQ6A 4OAUC 1UWHA 3B2WA 5C4KA 3L9PA 5ANDA 4FZ7A 4KIPA 4M84A 4JOAA 2FSOX 3ALNA 1JKLA 3DA6A 3H9RA 4HYHA 4XJ0A 3SOAA 4GUBA 4GKIA 2A4LA 3RAKA 3UG2A 5FM2A 2HW7A 3B8QA 3ROCA 4BIDA 4BCPA 3QAME 2G2IA 3LPBA 4NWMA 4ANNA 2OSCA 2KTYA 4JRNA 4JJRA 3ZTXA 4AGDA 1Y8GA 3AXWA 2W05A 3E64A 2YIQA 1IASA 2YIRA 2B9JA 1MRUA 4AAAA 4EKLA 2X2MA 3A8XA 5HCXA 3FMLA 2YIWA 3MPMA 2UVYA 5FXSA 4M15A 4EOOA 4BVUA 3F7WA 3KREA 4FVRA 4AP7A 4ZJIA 3TG1A 3R7UA 2OW3A 3COHA 2UZEA 3DBDA 5L6WL 2BZKB 5FLFA 5HLWA 2AYPA 4IB1A 5I9VA 4C4FA 5IH4A 4U5JA 3KFAA 4BHZA 3ZC5A 1FQ1B 4E5AX 1KUTA 4FTKA 3EFKA 2ITTA 4BZNA 4F99A 4ZMFA 4BICA 2PZIA 3MJ2A 3ZHPC 4BGHA 3F7ZA 3TXOA 4PNKA 5LMBA 1PKGA 4F9AA 3WZUA 1P2AA 4IWDA 5IH5A 2YABA 4DG2E 1KE8A 4RBLA 2J0MB 2QG7A 2PMIA 3KN6A 4LV5A 4ACCA 3GC9A 2C6MA 2XNPA 3A60A 2YIXA 4Q9ZA 3SXFA 3NVMB 3HP5A 4R3CA 4XMOA 3QTSA 3QCYA 4XG4A 5DFPA 4L53A 4TNBA 3AC4A 2PVRA 5BUEA 2X6DA 4ZTHA 3HAVA 4O0VA 3RK5A 4DTAA 5AIRA 4D0WA 4EH9A 1H26A 3TWJA 1S9JA 3HV3A 4HCUA 4CFVA 5IUHA 2UZDA 4AXAA 3GXLA 4ACMA 4RRVA 2ITQA 4YTHA 3QRJA 3UBDA 2HWPA 3RI1A 5A14A 3WYYA 4WNOA 3PXYA 4ASDA 3C4FA 3UYTA 2GNHA 2OIBA 4EK3A 1Q97A 4FBXA 4WNPA 4KBKA 2NP8A 1ZYJA 2PTKA 3GOPA 4X21A 5FTQA 4PWNA 3KRWA 4BDBA 4G9CA 3U4UA 4C4GA 4QMMA 4EH3A 4AZEA 4G31A 3OTUA 5LVLA 3VS2A 4B6LA 1NT2A 4Z16A 3FKNA 5HQ0A 1OI9A 5C27A 1J7IA 4WIHA 4L6QA 3OXIA 4FK3A 4F7JA 5TE0A 5L6PA 3C0GA 2E9VA 4TT7A 3FMNA 2QO2A 2X9FA 1WFCA 3HV5A 4EEVA 5GZ8A 3BX5A 5M4CA 4FKWA 2NRUA 3BWJA 1REJA 3OCGA 5AUVA 4QP2A 1KWPA 2OZOA 4UYAA 4EK4A 5CASA 2UW4A 3SDJA 1JSUA 5DEYA 4O6EA 1B39A 2XIXA 5CEPA 1YHVA 2Y0AA 2CGWA 4C4HA 2XM9A 3Q2JA 2I0VA 4MVFA 3F3TA 3OW3A 2GS7A 4L00A 2C6DA 4JDKA 3OBJA 3HX4A 1LUFA 5BVDA 3EFWA 3FL5A 3HRBA 5KMLA 2V62A 1H07A 5IUGA 2AC5A 5LXMA 5DIAA 4HGSA 5I9WA 3FAAA 4FKPA 4O7NA 4XOZA 3PLSA 4O7VA 3RP9A 4DHFA 3CQWA 3PSCA 3ZXZA 1DS5A 3D4QA 3FMMA 2X8IA 3P7AA 1MQBA 4TN6A 3MA3A 2PZYA 2WQEA 3CXWA 4IB3A 3F5PA 3KVXA 4E4MA 4ENYA 1M2QA 4OTWA 3LMHA 5FEQA 1YXTA 3RAIA 5IA5A 4IFCA 2JKOA 3DJ7A 3DS6A 4JT3A 3FDNA 3GFWA 4O0YA 3TEIA 4CZUA 3W1FA 2W5BA 3GVUA 4I6HA 5IG1A 4IWPA 3BV2A 4OT5A 4QMUA 3VBTA 4D4VA 2YDIA 1PXIA 4E6AA 1PMUA 2ITNA 3I5ZA 4FODA 4R6VA 5F94A 5HKMA 2C1AA 4O84A 5CNNA 1H28A 5KMJA 3P5KA 3TZ8A 4ZSGA 3LFNA 3QKKA 4UMQA 4BDDA 2EWAA 2VTAA 1L3RE 4FIIA 4MCVA 4PL3A 1OL5A 4XLIA 3W8QA 5A9UA 3DTCA 5KBRA 4ZS4A 4QPAA 4D9UA 2X1NA 4RA5A 3E8CA 5LJJA 4MH7A 4C4JA 3E3PA 3BLRA 4E6CA 5I9XA 3PG1A 4KSPA 2UW3A 3K54A 4Y95A 2VO7A 4QQ5A 4RWLA 2VX3A 1S9IA 5DT3A 4FEQA 1OB3A 3Q52A 2GFCA 4DITA 3F66A 2BCJA 4BKZA 4YC8A 1RJBA 5CF4A 4NSTA 5DEWA 3UIXA 3UVRA 3WIKA 2UZVA 3QYWA 3EL7A 3MH2A 3O7LB 4IX5A 4C38A 4FSWA 4NCTC 2Y7JA 5EHOA 3MTLA 3PVWA 4L46A 2YJRA 4FTNA 4RZWA 2PVLA 2VTLA 1ZYCA 5CVHA 3C5IA 2OXDA 2NPQA 4I94A 5M51A 3UNZA 3NCZA 4DEAA 1DI9A 3BI6A 5L2SA 2ESMA 3DNDA 3OG7A 1FBNA 2IVUA 4USFA 2BR1A 4YHJA 3NSZA 4FV6A 3O71A 1H24A 3R8VA 2GPHA 3I81A 2IN6A 2QURA 3OBGA 3BEAA 2VO3A 4BTFA 2WPAA 5EG3A 3ANRA 4YJTA 4ALWA 4GG5A 4S33A 3U4WA 4GG7A 5J9YA 4N6YA 2OGVA 3N9XA 3TNQB 5AAEA 5DPVA 4ERKA 2IG7A 4W8DA 3DQWA 3O2MA 2W99B 3PFQA 4IZAA 3RAWA 3SXSA 4A7CA 3ZBXA 4Z3VA 3DT1A 2PU8A 4FTLA 4ZS0A 3RHKA 5IA3A 4U3YA 5CU4A 3NWWA 4LRJA 5DRBA 4IZ5A 5AUZA 3QHWA 3U9CA 4LOOA 4WHZA 1UVRA 5M07A 4FTOA 3UYSA 2CKPA 1UU9A 1OIYA 4W4XA 3AC3A 5CAQA 4AACA 3LXPA 3E8NA 4B99A 4NKAA 3S95A 3UO6A 4CYJA 5E1SA 2ITWA 3VBQA 4B9DA 4FV2A 4USDA 5L2TA 3UZRA 2BMCA 2C6OA 2R64A 2XRWA 4UV0A 3S3IA 2HAKA 3R6XA 3JPVA 2YACA 3AGMA 4O83A 4YC6A 1PXPA 2WTKB 5AV3A 5BPYA 1YOJA 4JG6A 3EFJA 1PXOA 2HZNA 3VS3A 4A9UA 5HTBA 1UA2A 2W5AA 4FTJA 2V7OA 1H0WA 3F3WA 4HYIA 3FI4A 4BWKA 4EWQA 3WF9A 4F0FA 2OO8X 3W2PA 2CSNA 2VWYA 5E8WA 5HX6A 4P4CA 5IQBA 3MIYA 2BIYA 2ERKA 4FEXA 1ZOHA 5CSPA 4YLKA 2B7AA 2GCDA 5FGKA 5K0KA 3GC0A 3BELA 3OOGA 5LOHA 4O2ZA 3OW4A 4AUAA 3FE3A 3GFEA 3Q5IA 4TTHB 3BYMA 3IW8A 2ETMA 2VZ6A 4FIFA 4MTAA 2WQBA 2W1HA 2G15A 4YO4A 4YZBA 4J1RA 1PMVA 2GHGA 2ZJWA 3BBWA 1XH7A 3GGFA 2CNVA 4IFGA 4HW7A 5CSXA 4FT0A 2BFYA 2Z02A 3V8SA 3A99A 3OHTA 3BHTA 5C1QB 2GQRA 3HZTA 4R8QA 4O7YA 4LYNA 5FEEA 5GZ9A 1FMOE 1Z5MA 3G51A 3BCEA 4D55A 4ACHA 4G3EA 2W4JA 3BU5A 3HGKA 3K5VA 2LGCA 3E92A 3OCSA 4RFZA 1IG1A 2OZAA 4BN1A 4O7WA 4PPCA 3QTQA 2W5HA 4FOBA 1V1KA 5HG9A 1I09A 2F9GA 2VWVA 3C4XA 4HJOA 3RK9A 2R7IA 4WD5A 4MWHA 3DFAA 3FHRA 4A4OA 4L43A 1FMKA 2OI4X 2PE2A 1OIRA 3EH9A 4WUAA 2F4JA 5EYCA 4FTAA 3F9NA 4WA9A 3LJ0A 1V0OA 2C6IA 3R7YA 5AR7A 3AD5A 4KIKB 2QO7A 3VULA 2W1IA 3CPBA 3R2BA 4X2FA 2CDZA 4G17A 3ORPA 5AUTA 4CVAA 5C4LA 2R5TA 3R22A 3QTWA 4ZTLA 5FUTA 2J0IA 1BL6A 3RMFA 4CMOA 4WKQA 3ZUUA 3MFRA 3QD3A 4I6FA 4AZSA 4XV3A 2PUNA 4CQEA 1I44A 3UIBA 4IX6A 4V0GB 4E26A 4HNIA 4L7SA 3S00A 4ALUA 5DT4A 4O7TA 4NEUA 4RIYB 2BPMA 5E90A 4FK6A 5DR2A 4ZSJA 3MH1A 3SXRA 2G2HA 3KK9A 1H1RA 4O0TA 4H36A 4BZOA 2P3GX 3OC1A 3VRZA 4F6WA 1KE9A 4FTRA 3VNTA 3AGLA 2BTRA 4FTCA 5EM6A 4CMTA 3GU7A 4D1ZA 5DI1A 3A7JA 2G1TA 3BV3A 1ZZ2A 3FY2A 3H3CA 4UEUA 3P9JA 3UZTA 4TW9A 5HNIX 3RZFA 4FSYA 4HCTA 4DTKA 2WU7A 3QC9A 3ZONA 1NA7A 4O81A 5KKRC 4CKIA 4G2FA 2SRCA 5EOLA 3C0HA 2BIKB 3I6WA 5J1WA 4KA3A 5CF6A 4C34A 3UG1A 3R7IA 4D4RA 4AGUA 2WMUA 4I5CA 2R9SA 5J8IA 4AN9A 3COKA 2C5VA 4D5HA 2E9PA 5BMSA 3UO4A 4AFEA 3H4JA 4E7WA 3ELJA 3FMKA 3F2AA 4FZFB 2XBJA 4HGLA 4X3FC 5TT7A 3A8WA 2OBJA 3FLZA 3TNPC 4DAWA 4QMPA 4YZ9A 5IA0A 1JSVA 4FT5A 4I0RA 4IVCA 3QCSA 5K9IA 4LL5A 4O0UA 4RPVA 4V05A 5JN2A 3TUCA 4L3JA 4BCJA 1YI3A 2W0JA 4KNBA 3QWKA 4RLLA 5BVOA 2CPKE 1Y57A 2VTOA 2ONLA 4FEVA 3GC8A 4APCA 4FL3A 3NUPA 5IF1A 4DA5A 5HIEA 3F3ZA 4GS6A 4F65A 1J3HA 3G6HA 2DS1A 4BDCA 4CRLA 4ANBA 3PY1A 3O51A 1REKA 1Q8YA 5CF5A 4AW2A 3SA0A 5F20A 3FYKX 3UQFA 3PPZA 3TCPA 2CNUA 4M69A 5LARA 1ZAOA 2VD5A 4BIBA 4BKYA 3DXQA 3C9WA 3SLSA 4D2RA 2DUVA 2VNYA 3P86A 3L1SA 4PF4A 4QMSA 1UU8A 4H58A 1R39A 4KRDA 5ETIA 5J87A 3CJGA 2QOBA 1XH4A 5KO1A 2IZRA 3ACJA 4MQ1A 4BCGA 4I6BA 5H8GA 2OWBA 4DGLC 2OJJA 2VNWA 2CGVA 4KB8A 3KEXA 4QP8A 2JDOA 5IEYA 2CHLA 4QYFA 4J96A 2X8EA 1SVHA 3NEWA 3EQBA 3IKAA 3JY9A 1IAHA 1O6LA 5BMMA 3R9OA 1OKWA 5E8ZA 4KD1A 4RT7A 5LCKA 2HXQA 4RZVA 3U9NA 2CN5A 4JQEA 4EH7A 4XX9A 1PYEA 4XBUA 5CSWA 2OG8A 4EWHA 1L8TA 3QCQA 3KXGA 4QPSA 5KUPA 3OVVA 4CFWA 5A3XA 4AN3A 5HU3A 1ZYSA 4NT4A 3RCJA 3W55A 4QP9A 2OFUA 3COIA 3FMDA 4YBKA 4LL0A 4BI1A 4TRLA 3DAKA 4XH6A 4FX3A 3E3BX 1KV1A 3GCUA 5AP4A 2HY0A 3KRRA 4FKSA 3E8EA 3FYJX 5JRSA 5FTOA 4BDJA 5EQPA 3ZEWA 2BDFA 3GCVA 4XG8A 5CT7A 4YZMA 3R30A 4FV3A 3QTIA 3IPHA 4NM3A 4QPMA 4AZTA 3DY7A 4OUCA 3C1XA 2XYUA 3NUNA 3HA8A 5GJFA 3DPKA 1APME 1T45A 4C37A 2A19B 4PMPA 2J0JA 4ANOA 3V6RA 3NGAA 3N4VA 3Q4CA 4F1TA 3ORMA 3SC1A 3QQGA 3VO3A 4K1BA 2OJIA 2JAVA 1QL6A 3C4ZA 2XS0A 2Z7LA 2V55A 2YFXA 2QI8A 5ANGA 3QX4A 3D7ZA 2Z7RA 4FIJA 1R0EA 2XK6A 3TT0A 4EOIA 4IWOA 3E7OA 4XBRA 4OLIA 3NZ0A 4PUZA 4RSSA 4GK4A 4MHAA 2E2BA 4E6DA 1OUKA 2YLEA 3B8RA 1VR2A 2PL0A 3COMA 3PVBA 3PVUA 4K6ZA 3TNHA 3VS1A 4N57A 3GENA 4AZFA 3RGFA 4ZY6A 3R9HA 5K4IA 4I24A 3VUIA 4FG7A 4LOPA 4CTCA 5CU6A 3QTZA 3I6UA 4MBJA 3CTHA 2G9XA 3PJ1A 3FI2A 4RG0A 4FEUA 2J6MA 3IOKA 3EMGA 4IJ9A 4C62A 4BZDA 2QOCA 3BYSA 1QPDA 2WQNA 4BDIA 1W84A 4XNEA 2RG6A 2DWBA 2NRYA 4XEYA 4AA5A 4DH8A 1BL7A 2WMRA 2VGPA 3NIZA 2FH9A 2VUWA 4EUUA 3CGFA 3R8MA 2JDSA 2PK9A 4MXAA 5JH6A 2YM7A 4PP9A 3U6JA 4XP0A 1Q3DA 4DEGA 4CXAA 3Q3BA 1TQIA 1F5QA 4HZRA 3MA6A 3TTIA 4W4WA 3UDBA 4XCUA 5IQFA 5JZNA 4A07A 1LEWA 2GDOA 2XJ2A 3ORZA 3R73A 5IH6A 5FP6A 4H1JA 5AX9A 3LQ8A 4QP1A 5HNGA 4RWJA 3A4OX 3NYNA 4HVSA 3QZFA 4ZXTA 5DYJA 2V0DA 3NCGA 2Q0NA 4CZYB 3FXXA 4XS2A 2XK8A 4E73A 1H8FA 1T46A 2ZDTA 5HE3A 2V5QA 2X4FA 3R8LA 5HTCA 1PW2A 3MSSA 2GFSA 4DCEA 3QYZA 3FLYA 4XRJA 4ASEA 5IQAA 4A9YA 4RFYA 4U6RA 5E91A 3PY3A 5DNRA 1GZNA 4ACGA 2YCQA 4K77A 4RIWB 3PJ2A 3AD6A 3DV3A 3DJ6A 3OY3A 1M7QA 2DQ7X 3LCTA 2C3KA 3P79A 4WUNA 3ZCLA 1J7LA 4D4YA 4F7NA 2HYYA 4YTIA 4BDFA 5IQIA 3ORNA 5BYZA 3MGYA 3C4CA 1YHWA 5ETCA 1UV5A 3W33A 3E87A 4AF3A 2P2IA 2WEIA 3AC5A 4LG4A 4PL5A 4H05A 2B9FA 3PY0A 5EYDA 3VS6A 5EHYA 2ZM1A 4O21A 4D9TA 1OL2A 3BYOA 3VS0A 4FKGA 3FQHA 3GU6A 3U6IA 3EB0A 2C6EA 3GCPA 2PE1A 3MN3A 4YPSA 4XV1A 4W8EA 4F64A 1BKXA 3QQKA 4RJ4A 5LWMA 3GNIB 1XH9A 1WBOA 1SNUA 3E93A 4L01A 4BIEA 3EQFA 3FY0A 1H01A 1Q4LA 2IZSA 4U45A 4JX3A 4F0IA 3L9LA 4EK6A 4DFLA 1Q41A 4YTFA 2X9EA 2ZVAA 4OTDA 4Y5QA 5HGIA 5A6OA 1H1SA 5AM6A 5BVFA 4O0WA 1OITA 4P7EA 3EWHA 2WTKC 4I93A 2QU5A 4LUDA 2IZUA 3CIKA 4LRMA 4BCHA 3QRKA 4IB0A 4G3CA 4M0ZA 1OGUA 2ITZA 3BRBA 4X2KA 4EHZA 4A9SA 5JGDA 3G90X 3QXPA 3V5QA 2GHLA 4BRXA 5M53A 1VZOA 3BGZA 4OTQA 3FL4A 4GK3A 3CD3A 3PUPA 4M69B 1KV2A 3MESA 3QTUA 2B54A 3II5A 3IW7A 4U79A 4YZNA 5J9LA 2X81A 3HMNA 5E8YA 2YIYA 3RJCA 3JUHA 4NJ3A 3BWFA 4FT7A 3TIYA 5HI2A 2XKDA 3LXKA 3LMIA 2R3PA 5FBNC 3TKUA 4ASXA 1UKHA 5M4UA 2JD5A 4NYEA 4X6RA 3SKCA 4DFYA 4JBPA 2QQ7A 4C57A 2ZM3A 5HIBA 2R0IA 4DGNA 2WD1A 2BKZA 2R4BA 4GJ2A 5LMAA 2I0HA 2R3JA 3IECA 4NM5A 2QLUA 4KINA 3HRFA 5E7RA 2WTDA 4GKHA 5C8NA 3PDTA 2O65A 5E8VA 5BUJA 3R01A 2R7BA 4C59A 1B6CB
chains in the Genus database with same CATH superfamily
3IG7A 4D2TA 4QYYA 4BFMA 4DC2A 5JGBA 1M14A 3KL8A 3P0MA 2OICA 4GV1A 4KBCA 3SOCA 3EN9A 4BDAA 2YCRA 5DE2A 1W8CA 3GI3A 2QD9A 5HU9A 5JGAA 2AEGA 1WZYA 5KHXA 4B0GA 1BI7A 2YEXA 4YZCA 4Y8DA 3SVVA 4J7BA 3ZU7A 3HAMA 1GZKA 3F88A 4BYIA 5HVYA 1IA8A 1YI6A 5ANIA 4BJJA 1V0BA 3NLBA 4L42A 4RJ3A 3ORKA 5E8UA 5CTPA 3PA3A 5DHJA 5FDPA 3CKXA 3TM0A 2YZLA 4BDGA 3NYXA 4RWKA 2PSQA 4ZTRA 2VTMA 1YWNA 3Q4TA 3PXRA 2R3KA 3SRVB 1F0QA 2UW8A 2VTJA 4ZSAA 5J79A 1JBPE 3G9NA 3QKMA 3RWPA 4RIXA 2UV2A 4HGTA 5HIDA 1ZYLA 2X7OA 3WIGA 5HE0A 3CTJA 3RPRA 3LFQA 4IC8A 4U7ZA 4C3RA 1SNXA 1BUHA 3QFVA 4UALA 4YNEA 4EOJA 3LHJA 1KE5A 2W96B 3K3JA 2REIA 3ENHA 3H0YA 3KCKA 4I23A 5ACKA 5BX0A 4BCQA 4RJ8A 2BZIB 4GU6A 2JEDA 4JRVA 4MBLA 4EK5A 4LFIA 4FL2A 4UZDA 4G6LA 4WBBB 2XUUA 1AGWA 4D2WA 3ZO1A 4GT3A 4PMMA 5CQWA 2BUJA 2X6EA 5EYMA 2HZ4A 3OT3A 4CKRA 4MNEA 5T6KA 4Y83A 4YU2A 4YUQA 5GINE 3S0OA 3BHYA 4DH7A 2FO0A 3AMAA 3IS5A 3QQFA 3AC1A 4DF3A 1G8JA 1M52A 3UMWA 3I60A 4Y85A 2C3LA 2YM4A 2B1PA 4KS7A 1YW2A 2OFVA 2CKQA 5KMMA 4R1YA 2Z7QA 4U0IA 2WZJA 2WMQA 3TJDA 3Q9XA 2WFYA 4YR8A 3CLYA 5EYKA 5G1XA 4C2WA 3ZM9A 3DOGA 3BYUA 5AP1A 3DKOA 5CENA 3QXOA 1MRVA 4FT3A 4ID7A 2XJ0A 5EDRA 4BKJA 5LVMA 4RX7A 1Z57A 4USEA 3QRUA 2Y4PA 4IE9A 5HO8A 3BLHA 2J4ZA 3LVPA 4FKLA 4ZEGA 3GU8A 2RFSA 4MYGA 4ZSLA 4C7TA 1YDRE 1LPUA 5DG5A 2J0LA 3L8PA 3VUDA 3WOWA 5LQFA 1H4LA 4GMYA 1UU3A 2W06A 4R7BA 1YDSE 4MXYA 2R3OA 4JR3A 3DZQA 4DGGA 4F78A 2UW5A 3KU2A 4GT4A 4HVIA 4I0TA 4WNMA 4BCKA 3VUGA 3GCQA 1GOLA 1FVTA 1M17A 4FKVA 5EH0A 2H34A 2WKMA 4FG9A 4A9TA 5I5ZA 4FC0A 3NUAA 1IR3A 4BTKA 4UMTA 2VTHA 2XK7A 3ZLYA 3VC4A 4QP4A 1BMKA 3BQCA 5L2QA 2ZMDA 4DGOA 3MFTA 4BWPA 2PPQA 4W9XA 4Q5HA 2J0KA 5AFVA 2WEVA 4PRJA 5ETFA 4CV9A 3VW6A 3H9OA 2XIZA 3Q4ZA 4IAIA 4FUYA 2E9NA 4G6NA 4I22A 1R0PA 4XV2A 2YWVA 4CFMA 4K0YA 3IOPA 2IZTA 3A7IA 3MVHA 2Y4IB 4OTFA 5E8TA 2VX1A 5AR4A 3K5UA 4F63A 3DXNA 1OMWA 1WBPA 5IDNA 3EZRA 3KK8A 3TN8A 4NKSA 4LM5A 2BHHA 2WELA 4EBWA 3ORTA 3IW5A 3TUDA 3NPCA 3OMVA 4NJDA 3L9NA 4I21A 2XMYA 2XRUA 3WF8A 2OIDA 3RPYA 1WBNA 3NUXA 1OECA 2YZAA 3DK7A 2IO6A 3ET7A 4DINA 2R2PA 2I40A 2WOUA 2UW0A 3CQUA 5A46A 2A27A 3CY2A 4IACA 3D7TA 1YOMA 2B52A 2ZV2A 1SMHA 3MFUA 3U6HA 1XQZA 3LFDA 3IO7A 1ZWSA 4U42A 3SG8A 3OUKA 2PULA 2OU7A 4EHVA 2YDKA 2CNQA 2ONLC 4JBVA 4PY1A 1SYKA 4GEOA 2BAQA 4MXZA 2QC6A 3PWDA 2XEYA 2C5OA 3ULIA 2XKCA 4R3RA 4IANA 1NY3A 3W0PA 5CEKA 3FXZA 1H1PA 2XBAA 3RALA 2JFLA 4O91A 4AZWA 2QOKA 2OLCA 2F2UA 5KMKA 5IQEA 3IGGA 3T8OA 3KMUA 4EJNA 4FSMA 4XRLA 1R78A 4YSMA 2BALA 4F70A 4F9CA 3B2TA 3BHVA 4JQ7A 4CKJA 1H25A 4TL0A 4QYEA 3AT3A 4FKIA 3W2RA 2Y9QA 5HOAA 4MBIA 5JT2A 3Q5ZA 5C8KA 3PZEA 3O0GA 2C5XA 3G2FA 5HE1A 2ZYBA 2CKOA 3KA0A 1MP8A 4J98A 3QGWA 2FVDA 4ANQA 2YN8A 2JGZA 4TYJA 3PYYA 4IDTA 3DFCB 5HHWA 2WNTA 3ENMA 4ZY4A 5I0BA 2X8DA 2XCKA 1KOAA 5H2UA 4M97A 4QNYA 3RWQA 3VJOA 4BBFA 4RQVA 5BVNA 5HX8A 3FZOA 1U5QA 5CU2A 2RGPA 4AW5A 2ITYA 3KXMA 2HENA 4H39A 5L6OA 4DCAA 4WG4A 5G6VA 4E4LA 3UO5A 2JAMA 3CP9A 3TJCA 3LM0A 4BGQA 3PXQA 1TQMA 2QCSA 4L9IA 3MPTA 2QU6A 3N4UA 3DNEA 5AUYA 4EOMA 4U8ZA 5CAPA 3UNKA 4C02A 5K0XA 4LGDA 5D7AA 3HUCA 5A4LA 2YLFA 4QMWA 4FOCA 4DT9A 4P2KA 3WF7A 2F57A 2QKWB 3OY1A 3SG9A 3D5WA 2F7XE 2QONA 4JIAA 1YQJA 4KIKA 4O7ZA 5GIPE 5KMNA 2O2UA 3M2WA 1OBDA 2OKRA 5LMKA 3W0NA 1UNLA 5JZJA 3EQPA 3ROYA 2LAVA 2YHVA 3R0TA 4OTGA 3O96A 4IW0A 1P4OA 3G0FA 3NAYA 4FKRA 1R3CA 2ZDUA 3P08A 1YOLA 2BILB 4HOKA 4PDOA 3EQHA 4M68A 5KZ0A 3R1NA 5CWZA 5IZFA 4Z7GA 5HBJA 5I9YA 4IX3A 5E9EA 5HBEA 2WIPA 5B2KA 3V6SA 3VUKA 5B0XA 4ZZOA 3SGCA 3UQGA 4U40A 3ZS5A 2C30A 4KBAA 3JVRA 4FSZA 2VTNA 2ZV9A 4EH5A 2PMNX 3K2LA 4QOXA 3PXZA 4DFZE 2EUFB 2ACXA 1XH5A 4KUJA 1OKYA 2H96A 2W1FA 1PMNA 1Q8UA 3E7VA 3MYGA 4BHNA 2WQMA 4JIKA 4RWIA 1KE7A 3NNXA 2JIVA 1JQHA 4UWYA 2IW6A 3FKLA 4CNHA 1XWSA 4O86A 4QMNA 4R3PA 5BVWA 3C5UA 1O9UA 2O63A 4PV0A 5CS6A 4O1OA 5CZIA 5CXZA 5FWKK 4TY1A 1QMZA 1H08A 4GK2A 3HDMA 4JQ8A 4AE6A 2HELA 3ODZX 4IX4A 2C5NA 4EI4A 4C8BA 4DYMA 2R3HA 3LFBA 2W9ZB 5BYYA 3TMOA 3DJ5A 2BAKA 3UOLA 4NW5A 3LLAA 1LP4A 1FVRA 3O50A 4JDJA 3OXZA 3LFFA 5KBQA 1W2CA 2YM6A 4DFUA 1HCLA 2Z60A 3CBLA 4J97A 4YJQA 2O8YA 3WBLA 2XKEA 3CCNA 5D7VA 3PA4A 3ODYX 2XYNA 4RMZA 3FPQA 4FKJA 2C0IA 2RF9A 3LJ2A 1J1BA 3QTXA 4UB7A 3ZOSA 3DZOA 2EXCX 2FSMX 5DOSA 3CC6A 4D1SA 4RIYA 1VJYA 4EOKA 3HL7A 4BDKA 2QOQA 3PTGA 4EHGA 3OROA 4NM7A 3NR9A 3Q6UA 4ITHA 4J52A 4PP7A 5L2WA 2QOLA 2WTWA 3AQVA 4AT3A 2XJ1A 3IQ7A 3NYOA 4I92A 3UNJA 5KMOA 4E4NA 1GAGA 4YJVA 4FSTA 4KAOA 4R7IA 3WILA 1KE6A 2Z2WA 3LJ1A 3A62A 4UXLA 5E1EA 4AQCA 5I9UA 5K5NA 2X2LA 4B8LA 3UJGA 4EL9A 1Q5KA 1WMKA 3M42A 3F5GA 3R1YA 4U81A 4WSYA 3VUMA 2WTCA 3D0EA 2W1GA 2VTTA 4WG3A 2WMSA 5AV1A 2B55A 3ACKA 4GVAA 4IBMA 3WI6A 5AA9A 2C68A 5EW8A 3DXPA 4F1OA 4C4EA 3P7CA 3CGOA 3T9IA 4KS8A 4FIHA 5JFWA 4S32A 4MEDA 1PMEA 4LMUA 5J5SA 2VO0A 2GNFA 5M44A 4D0XA 1ATPE 3BKBA 4I6QA 3W2OA 2CCIA 4DEDA 4WO5A 2FSTX 4LV7A 2HZ0A 4X2JA 4DEBA 3JVSA 4NK9A 5HE2A 5HICA 2F49A 3N51A 1ZOGA 3W32A 1RW8A 1OBGA 3AMYA 4S2ZA 5ANOA 4YLJA 5FTGA 1WBWA 3OXTA 4Q5EA 5B7VA 5KHWA 5JFSA 3HV4A 2XEZA 4JAJA 4DG3E 4A4LA 3KN5A 4FA2A 2VAGA 2CLQA 2WTIA 3GP0A 4GCJA 3LW0A 3WF6A 3SRVA 3U55A 3KULA 3KXNA 4UMRA 2PMOX 3V5TA 4C35A 2X7FA 3OWPA 1NVSA 3UZPA 5AMNA 4GYIA 2YERA 1DM2A 3ZMMA 2WTVA 3F5UA 2F7ZE 4PMSA 5C03A 4AW1A 2PHKA 2W1DA 4ZOGA 3EZVA 1WVXA 4QO9A 4NM0A 2BAJA 4YBJA 4ACDA 1U54A 3P1AA 3KULB 5AR5A 4BCOA 5F95A 1Q24A 4FT9A 4PQNA 3SHEA 4FE2A 2UZBA 2OJFE 3O8PA 4RC2A 4TYHA 5BVKA 4BCIA 1QPJA 3AT2A 3FHIA 1PXMA 4JLCA 4BB4A 2XP2A 4MQ2A 4NTTA 2X2KA 3C4WA 2GQGA 3AT4A 5J7BA 2R3GA 3IONA 3P23A 3LKMA 3FWQA 5TOZA 1KOBA 3ZFXA 2ZM4A 3R02A 5L8KA 4H1MA 4X2NA 4WG5A 4XP2A 2UUEA 4O0SA 3RPOA 4GYGA 4PPAA 4TKSA 1Q8WA 1XBCA 1U4DA 3GT8A 5C8MA 1OGYA 2WQOA 3A7GA 4GW8A 2X39A 3W10A 2VWUA 5CI6A 5GJDA 3ZYAA 5LCJA 2XA4A 2OXYA 2J90A 4A9RA 3OCTA 1O6KA 3NIEA 3UVQA 4FSUA 4FZAB 4C61A 3I7BA 5IQHA 4D2PA 3BLQA 3UGCA 4K9YA 4W4YA 3Q9YA 3RK7A 4CFXA 5AP7A 3RM6A 5AP3A 2GS6A 3FEGA 4L8MA 5JFXA 3MPAA 3AC2A 4ZLZA 4X0MA 2W7XA 4ZK5A 4EH2A 1CMKE 4HYUA 3UDSA 1FINA 4DGMA 2JC6A 4II5A 4IHPA 3FMJA 4CTBA 3BU3A 4O7RA 5FD2A 3V3VA 4DT8A 3EQIA 3OD6X 3BHHA 2WU6A 1CKPA 2FYSA 2HIWA 4E5WA 2YAKA 4RIWA 2RL5A 4BWXA 5CI7A 4CFFA 4YSJA 4HVGA 2VN9A 5LVOA 4UMUA 2PZ5A 3GEQA 2QOOA 3QA8A 2WIHA 4EUTA 4JVGA 5I3OA 4IJPA 1HCKA 3QBNA 4QNAA 3NX8A 4QEBA 4FSRA 4RVKA 5C01A 4LGHA 4AWIA 1Q99A 5DR6A 3UTOA 4CLIA 4YPDA 1CKJA 2XZSA 4ZJJA 3ZDUA 4EK8A 4QYHA 4PTEA 4EH6A 3ITZA 3JXWA 1YWRA 3R8ZA 4F7SA 4AOTA 4JXFA 4MD7E 3DKGA 4L3LA 3KMWA 4RIOA 3VQHA 5AR3A 3VW8A 3V8TA 2EB3A 4AN2A 1G8AA 1UNHA 3OOMA 3QQUA 5EI6A 3WZEA 2EXEA 3OP5A 4AXEA 1JVPP 1XH6A 1ZZLA 3R1QA 2JBOA 4J53A 3OT8A 1YDTE 2Z8CA 2OJGA 2W9FB 2WTJA 4E8AA 3PP1A 2C3IB 4D58A 3QUEA 2J5FA 1B38A 5CALA 5DMZA 1W98A 3GBZA 1OIUA 1PKDA 2GNLA 1WCCA 2ZOQA 3FBVA 4FSNA 4ZIMA 3EN5A 4QDEA 3KMMA 3POZA 4L7FA 5J1VA 4FL1A 4CRSA 3AOXA 4YJUA 4DEIA 2PUPA 5AUUA 4HZSA 4FV8A 4FTUA 3WF5A 4GSBA 2JKKA 3LMGA 3MIAA 3FLSA 4XV9A 2A2AA 4EHEA 4BGGA 2XNEA 3OEZA 3D5VA 1DAYA 4UWBA 4ANLA 3FZTA 4DHZA 3DLZA 4GL9A 2WMXA 5EI2A 4BBMA 4CSVA 1XMLA 4FV7A 2R3QA 4XHKB 4EQCA 4TZRA 5BQ0A 4EONA 3DKFA 4G6OA 3NYVA 3UC4A 3QKLA 5EKNA 2IEWA 3LIJA 1NVRA 3R7OA 4CT2A 3LQ5A 4JBQA 5DBXA 2UZWE 5M57A 3F2RA 5H8BA 3V5WA 3PXKA 1Y91A 1SVEA 3Q04A 2XNGA 4D2VA 4F9BA 4LI5A 1Q3WA 3FLNC 2R3LA 1JKKA 5ETAA 3ZLWA 4TYIA 4F1MA 3QRTA 3G5DA 4IADA 1AD5A 1P5EA 2J9MA 4FYOA 5A4EA 4TWNA 3VS7A 3QCXA 5M4FA 3R7EA 2W4KA 3HMPA 3IGOA 3PSDA 4RQKA 2Q0BA 4DDGA 2UVZA 2XIYA 3LXLA 4K18A 5FRIA 4BL1A 1K9AA 4GVJA 5EI8A 4TXCA 1ZMWA 3ZH8A 4JL9A 3UOJA 1CTPE 2E9UA 4NFNA 3VUHA 2PVKA 3PA5A 5EDPA 2HOGA 2YM8A 2FSLX 3CTQA 3LFEA 4FTMA 2RG5A 2H6DA 5AM7A 5BUIA 5HTIA 5E8XA 1JAMA 2F7EE 3UQCA 3VN9A 3D5UA 4TYGA 4BDHA 5AA8A 4HPTE 3MY5A 3C13A 3ULZA 3U87A 3H30A 4ZTQA 3MJ1A 3QQLA 4AGCA 5IEXA 5D1JA 3Q4UA 3TL8A 3GU5A 3VF8A 3QF9A 4EOPA 3LAUA 4ZSEA 4P90A 3UIUA 1YRPA 2RFDA 2IW8A 4UY9A 4QMYA 1XJDA 3WE8A 2QOFA 4I0SA 1NVQA 3FMEA 4C36A 5CEOA 4I1ZA 5L3AA 1XO2B 2KULA 2C6KA 1ST4A 4FI1A 5L8JA 2A0CX 4FNYA 3W0QA 1OZ1A 4CFUA 3FZRA 4F4PA 3G15A 3A7FA 4IH8A 4AOJA 4HGEA 1WBSA 1J1CA 3QC4A 4D4SA 2JFMA 3R2YA 4ARKA 4U44A 5JFVA 5BV3A 3UMXA 4P5QA 2XNOA 3V01A 3KRJA 3OS3A 3UPZA 5EM7A 4RA4A 2C0OA 2BVAA 2PZPA 5EM5A 4MWIA 2ERZE 4KRCA 3MBLA 4W9WA 4U41A 1W7HA 4JNWA 2G2FA 3RBWA 2PUIA 3EQGA 4C33A 5KCVA 1H1WA 4FEWA 3QLGA 3ZRLA 1H00A 2W1ZA 4IZ7A 3M1SA 2H8HA 4BTMA 3F69A 5BYLA 3EKKA 3HECA 5M08A 3NNVA 3O5AA 2HWOA 3W18A 3DCVA 5DVRA 3T9TA 4EYMA 3QD2B 4FV0A 4C58A 1Z9XA 2VWBA 4DBNA 3W16A 4AX8A 3OEFX 4DEHA 2X0GA 3R9NA 4AA0A 3U51A 3FZSA 2ITPA 3FLQA 5LVPA 1UKIA 2OIQA 3G0EA 2VWWA 2QOHA 5DRDA 5ICPA 1IEPA 5DLSA 5CX9A 4F08A 4GT5A 4DG0E 1H27A 3BHUA 1FGKA 4FNXA 4D1XA 5AR2A 4H3QA 2PUUA 1OVEA 4GU9A 2YM5A 3VHEA 3P7BA 1PXKA 4R5SA 1DI8A 4YP8A 3VS4A 3F2NA 4ZLOA 4DHJA 4XUFA 3KVWA 2XNNA 3MI9A 3VBXA 4J8NA 2J51A 1E1XA 4MK0A 2BDJA 2C47A 5FQDC 3BGPA 3MVMA 1YXSA 2E9OA 2QVSE 4QMOA 5AAGA 4LRKA 3LCKA 1WAKA 4IAKA 4Y5HA 3UODA 2XAOA 4UZHA 4XOYA 3HDNA 2PVHA 1GNGA 1OIQA 1SM2A 4L68A 2IPXA 3UOKA 3MW1A 2V22A 5EW3A 5T68A 4OAVB 3R71A 3CQEA 4QTAA 3D14A 4EC8A 1WBVA 5IKWA 4RVTA 4C4IA 3NVKI 4DLJA 1PHKA 5K3YA 3ZZEA 5H3QA 4F7LA 4XYFA 2ZB1A 4RJ7A 3T3VA 4BF2A 2OH0E 3F3VA 4YZDA 5CF8A 3MVLA 3NUSA 3OWKA 3QQHA 1OKVA 4BYJA 3Q9WA 4WSQA 2A98A 2YCSA 3PUFC 2B9HA 5AEPA 4BR3A 4U97A 4RVMA 4X3FA 1QPCA 5E92A 3DK3A 2QR8A 1OL6A 2ZV8A 3UVPA 3W2SA 3TUBA 3EL8A 4NCTA 4UBAA 3OZ6A 2YWPA 2VU3A 3V5JA 4EBVA 5I3RA 5KNJA 3BPRA 4FTTA 1TVOA 3R8PA 2O64A 4CCBA 1YXVA 1ZRZA 3HLLA 5DH3A 3REPA 5KKRB 4ALVA 4YJPA 3OTVA 3QHRA 4IDVA 4O96A 3W8LA 5M06A 2ZAZA 5HZNA 3SAYA 2BFXA 4G3DA 4HYSA 2Y6OA 4IMYA 5AJQA 2C3JA 2YJSA 3CPCA 3BQRA 2WMBA 1PY5A 5ANKA 5HVJA 1BLXA 4C3FA 3U54A 4Z9LA 5CNOA 3S4QA 3C4EA 4B7TA 4ZMEA 5CEQA 3TIZA 4CMUA 5CXHA 5CU0A 1W2DA 1QPEA 2YA9A 4PDYA 2QO9A 4M13A 4XG7A 5T3QA 3C50A 4IM2A 3U8WA 4AT4A 5EFQA 2C4GA 3QD0A 2EB2A 2JKQA 2PE0A 4FIEA 3TTJA 4S30A 3BBTB 5E8SA 1OPJA 3E8DA 3GC7A 4IEBA 4Q2AA 2OF4A 2X7GA 4BJJB 3PWYA 4JDHA 4QMZA 3DK6A 4QRCA 4CCUA 3F61A 2I0YA 3PG3A 5FG8A 3R8UA 4OBPA 2OH4A 5GIOE 3ORIA 5EQEA 4RIXB 3E63A 4QMLA 3KQ7A 5EM8A 5DT0A 4R77A 1W0XC 4R1VA 3ZXTA 3BZ3A 3R9DA 4M8TA 2HXLA 2VO6A 3RTPA 3VJNA 3IW6A 4FGRA 5HD4A 1IRKA 3OUNB 3FUPA 4K11A 1JNKA 4Y46A 5HORA 1GIJA 4AW0A 2X4ZA 2HY81 3IDBA 3UOHA 3VS5A 5IEVA 2RSVA 1X8BA 4JI9A 3VBWA 3PP0A 4EC9A 1PJKA 3KY2A 1ERKA 3A4PA 4RFMA 4OGRA 3ZO3A 3DKCA 2VGOA 2ZMCA 3EYGA 3QGYA 1J91A 3EQDA 4QYGA 4YNOA 4MXCA 1WBTA 1BX6A 2YDJA 5IQDA 3FC2A 3IK3A 4FKUA 3THBA 1OM1A 3MV5A 1DAWA 1A9UA 2I0EA 2JBPA 5DN3A 3SW7A 5TR6A 5HESA 1M7NA 4YHTA 3R63A 5CY3A 2ITOA 4IAFA 4NIFA 5CAOA 3TZ9A 3GUBA 1XHAA 4EYJA 4NH1A 4ZP5A 1GZOA 2WMTA 3QX2A 1VYZA 4M12A 4EZ5A 3OF0A 4IAAA 3V51A 5AWMA 3F82A 4PDSA 1TKIA 2YITA 4RX9A 4HVHA 4ZTSA 3O7LD 4MNEB 4TWOA 4OW8A 4JX7A 3PJ8A 3SX9A 1WVYA 4O27B 2XK3A 1FPUA 4U43A 3LZBA 4ZLYA 3QUDA 5KZIA 3UDZA 4FVQA 4MD8E 5JK3A 1PF8A 3GB2A 3ZRKA 5CU3A 1Q8TA 5D11A 2P55A 2JDTA 1ZY4A 4K33A 5JEBA 3WE4A 3JYAA 1PXNA 2NYAA 3RPSA 2FB8A 5CQUA 3SW4A 5FBOA 5GHVA 1MUOA 3AKLA 3I79A 4RVLA 3IDPA 4FV1A 4TWPA 2BTSA 4N6ZA 1JPAA 3QWJA 1XKKA 2VTRA 2J50A 3D9VA 3KXHA 4BDEA 3LE6A 3W0MA 3LQ3A 4HPUE 4QP7A 2DYLA 3MB6A 2W4OA 2R3IA 1LEZA 4TYEA 4O2PA 1PRYA 1UNGA 4I20A 3LCDA 4BC6A 3ZO2A 4AG8A 3MVJA 3QA0A 2UW7A 5IA1A 3A2CA 3LCSA 4FTQA 4RC3A 1Y6BA 3ATTA 5CVGA 4G3FA 1YXXA 2R3MA 4G16A 4I5PA 4EZ7A 5EOBA 1HOWA 3E88A 3Q60A 3TV6A 2VTSA 5A4QA 3DBQA 3FSKA 2GU8A 3PFYA 4HNFA 2BZHB 3HYHA 4WBOA 3TV7A 4AXFA 1OL7A 3Q2MA 2B4SB 5A6NA 5IISA 5LWNA 2PWLA 3PIYA 1JKSA 4DH3A 2WMWA 2WGJA 4O22A 5H9BA 4G9RA 4IXPA 5JSMA 4QTBA 4TYHB 4ZZMA 1G5SA 2QNJA 5EDQA 3ZM4A 4YTCA 4BI0A 4F9YA 3DB8A 2UZLA 4IM3A 4NTSA 3A7HA 4G3GA 5EW9A 3RAHA 2UW9A 3AG9A 3FLWA 4M14A 4UXQA 3I0OA 3W2QA 3MS9A 4JG8A 3HNGA 4LQMA 4YJOA 1XH8A 4OT6A 3V8WA 4EOSA 4ASZA 2PVFA 2PVJA 4ITIA 1STCE 4MF0A 4YGAA 3W2CA 4UN0C 4O7LA 4RJ5A 2GTNA 3SD0A 2H9VA 3Q96A 5HG5A 2O3PA 1OKZA 4TPTA 3D2KA 4GH2A 5AP5A 4I5HA 2EU9A 4L52A 5JQ5A 1G8SA 1Q8ZA 4C3PA 4AXCA 4IM0A 4NL0A 3KF4A 2P33A 4O7SA 2W17A 4F0GA 2NNWB 4FYNA 5ANEA 4ZJVA 2IVTA 4Q9SA 1VYWA 4E20A 4FKOA 4B4LA 2XK9A 4EOQA 3R7GA 4IAZA 3KGAA 5CZHA 3A61A 1H1QA 5H8EA 3BEGA 1FVVA 2XKFA 2GNGA 4GRBA 4S34A 3WZJA 4QMVA 4ANMA 5CLPA 4AU8A 5CSHA 4FV9A 4UYNA 5GJGA 1OL1A 3GOKA 2GNJA 5D41A 3HKOA 3MFSA 2FUMA 3RNYA 4WOVA 2JDRA 3EHAA 4R78A 5AP6A 4V04A 2QLQA 2P0CA 3UIMA 1YKRA 4C0TA 1Y6AA 2XK4A 4NUSA 4EORA 2VV9A 4J95A 3ETAA 5EHLA 5TKDA 2P4IA 4CT1A 2O0UA 3HA6A 4L3PA 2IWIA 4NZWB 3HRCA 3R7VA 3OWJA 1Y8YA 3HEGA 3FJQE 3PZHA 5AR8A 5AV0A 4N70A 5ACBC 3CY3A 3ATSA 3CE3A 3P4KA 4ONAA 5D10A 3DAJA 2XH5A 2XNBA 3V04A 4X7QA 3HMOA 4OTPA 5CEIA 4F6UA 1AQ1A 4ZTMA 3MB7A 3KF7A 1XBAA 2PVNA 5JKGA 2EVAA 3CKWA 1K3AA 4ZZNA 3LFCA 3VRYA 3MTFA 3QALE 4FR4A 3ZSIA 2QKRA 2GNIA 3F6XA 3EFLA 4DE4A 4UX9A 3LM5A 5M55A 4O38A 4WRSA 3NUUA 4DEEA 4IAYA 1GIIA 4G5JA 2CLXA 5L8LA 4IVBA 4XLVA 3BLAA 2GMXA 4DH5A 3KCFA 3D7TB 3TV4A 1E9HA 2BDWA 1PXJA 2HCKA 3OCBA 1JWHA 1PYXA 3DLSA 4OTIA 3IW4A 1V0PA 3QLFA 4Z7HA 2QR7A 2JIIA 4CG8A 5M09A 4ZY5A 3RZBA 4O0RA 2ETKA 2JDVA 4EH4A 4GFMA 2XNMA 1P14A 4GUEA 3PIXA 4FZDB 5AADA 4TWCA 3EQRA 4FVPA 4IVAA 5DGZA 4CZTA 5K4JA 4DH1A 4MAOA 2UZTA 3ZO4A 1ST0A 2OF2A 5HCZA 3L8XA 4QQTA 3W0OA 4XG9A 5JMSA 3NNWA 5TF9A 1A48A 2G01A 3R1SA 4UMPA 4D2SA 3QL8A 4ENXA 4LGGA 3RVGA 4JR7A 3PRFA 4LUEA 3ZLXA 1H0VA 3QD4A 3O8TA 4AZVA 4ERWA 1XMMA 2AC3A 3ZFYA 3DGKA 3NW6A 4WT6A 4YO6A 3O23A 5HBHA 4MXOA 3DBCA 1ZMUA 3NAXA 4JAIA 1Q62A 5HLNA 4ZTNA 1M2RA 1BI8A 3F3UA 5CYIA 2HW6A 2XB7A 2VWZA 4BTJA 3AMBA 3I4BA 4MF1A 5JQ8A 5AAFA 1E1VA 3VWAA 3ORXA 5E4HA 3VQUA 4DN5A 3KKVA 4M3QA 4MX9A 4J8MA 1OPKA 5EKOA 1U54B 3R21A 4V01A 4CFNA 5J95A 1LR4A 4A4XA 4YLLA 1GIHA 4U3ZA 5HLPA 4XG2A 4FF8A 3ZDIA 1ND4A 2QG5A 3PLAE 2GHMA 5M56A 3TYKA 4R7HA 1URCA 2PY3A 4MNFA 2VRXA 2XIKA 3EN6A 2ZB0A 3EYHA 4QQCA 4FGBA 2B53A 5HD7A