4ZOGA

Vx-680/mk-0457 binds to human abl1 also in inactive dfg conformations.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
269
structure length
269
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
publication title VX-680/MK-0457 binds also to human ABL1 with inactive DFG conformations.
rcsb
source organism Homo sapiens
total genus 86
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zogA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zogA01
3PXQA 1BI8A 2I6LA 3LJ0A 3PJ2A 4M13A 2X7FA 3KB7A 3P79A 4BKYA 3UO4A 4BCFA 4MTAA 4F1MA 2GNJA 5GIPE 2XK3A 3VUGA 3FLQA 3FZSA 3MFRA 4UY9A 4WO5A 2R0IA 1R39A 4QTCA 3AXWA 4Y72A 3RAHA 4FI1A 1UWJA 4BN1A 5HO7A 5AJQA 5IA2A 4YJOA 3W2PA 2QURA 2PZ5A 3DKCA 3I6UA 3TNPC 4AN2A 3OCSA 3TNIA 4Z16A 5I9ZA 2WAJA 5K5XA 4YSMA 2J2IB 5CF4A 5FBOA 4AT5A 3BX5A 5LCKA 4P7EA 3LCSA 4U79A 4DEDA 3HLLA 4KKEA 5AP4A 1PXNA 5IUHA 4FTUA 3UYSA 3UBDA 3A2CA 3TCPA 3BLRA 4BIBA 4CT2A 3N4UA 4WNMA 3KK9A 1PW2A 3C0HA 3COHA 4UBAA 4XCUA 3MWUA 1FOTA 1VYWA 2VV9A 3O0GA 3ZZWA 2OG8A 4BI2A 4IM2A 5CAVA 3HVCA 1FQ1B 2X39A 5HVYA 3MFTA 4OLIA 2YCFA 5CEQA 4YJNA 4H36A 2VWZA 4J53A 1FGKA 1RQQA 3F7WA 4I94A 5IQFA 4E7WA 5BQ0A 5JEBA 1UKHA 3KRRA 2XMYA 3I7BA 2HZ4A 2CLQA 3ORZA 3SHEA 1KUTA 3BYUA 5TOZA 4HVSA 5LWNA 1YXUA 3NSZA 4UN0C 1KOBA 2FSLX 5CS6A 4QMXA 3MJ2A 5FBNC 4GVJA 4EWQA 5GINE 3MW1A 4J97A 2P2HA 3BQCA 2OZAA 3FHIA 4MYGA 4PTGA 2LAVA 5J7BA 3OZ6A 2IW6A 5CT7A 1H25A 1R3CA 2ITUA 1OL6A 3CKWA 3LXLA 4FV3A 4ZIMA 5ACKA 2ZDUA 2PVHA 4F9BA 4QP7A 3OOGA 5LMAA 5T6KA 2QHMA 3REPA 1M7QA 5JFWA 4Q5EA 4QMOA 3V3VA 1GIJA 4ALUA 2NNWB 4F08A 3F2RA 3P7CA 2EXEA 3DTWA 2R3GA 2ZB0A 2UW8A 2G01A 4ANOA 1YWVA 2O65A 4LGDA 3MVLA 3SVVA 2J5FA 5J79A 4B0GA 3UQFA 4XHKB 4FV8A 5EHYA 3NR9A 4EOMA 2YIYA 3F5UA 3CSVA 3N4TA 3FLWA 3FL4A 1DI9A 2ETRA 2O0UA 3MH1A 4G3GA 5EH0A 4EOIA 4LL5A 1WBWA 5AA9A 5CU0A 4A9TA 4BI1A 1CM8A 3TV4A 4EQCA 1PYXA 4F4PA 3PPZA 4FKSA 2ZJWA 4ANBA 5M4FA 3NAYA 5AAEA 4FGRA 3L8XA 4XRJA 4IAZA 5AUTA 5I9WA 3LXPA 3U87A 1Y8GA 5ETAA 4FSRA 4J96A 4KSPA 5KMLA 4AZWA 2BAKA 4LOQA 2Q83A 3CS9A 4FNXA 4M12A 1PMUA 3UVPA 2VAGA 4ZSJA 1W98A 4L3PA 5M51A 3KCFA 4GG7A 4D28A 1Q99A 2VTLA 4GK4A 4ZLOA 3IO7A 3W33A 4IAKA 1UU3A 5E91A 4G16A 5GJDA 3W8LA 3BRBA 4O0XA 4AE9A 3FQEA 3LQ3A 4EH8A 2CSNA 4FSZA 3GCSA 4J52A 2Y7JA 3VW6A 2AYPA 4YU2A 2X6DA 3UG1A 1P4FA 4BDAA 4UMUA 4X2GA 5A4QA 5D7AA 3BIZA 3EQGA 3QHWA 5H8EA 2JBOA 4ACGA 5BX0A 4GRBA 4YURA 2W4KA 5HTIA 1OUKA 4H39A 1NXKA 4MXAA 3BHUA 3D83A 4AOJA 5DPVA 4XBRA 4YHFA 5ANJA 4AN3A 4Q2AA 4TW9A 5CTPA 5JFSA 2QU6A 3FZTA 4TRLA 5KNJA 4RPVA 2CKPA 4V04A 3GU6A 3ZEWA 2YFXA 2IVSA 4QP1A 1NVRA 4JQEA 5BVDA 4BDKA 2WGJA 1PXIA 4QNAA 4UZHA 5AV4A 3QU0A 4GKIA 3GCQA 4JG8A 4YZMA 4GJ3A 4UMPA 5I0BA 5JK3A 3Q04A 3O51A 3KXGA 3NX8A 3OBGA 5IF1A 3TI1A 2GTMA 3GOKA 2E2BA 2FH9A 4PMMA 2ZV7A 5ETIA 3PSCA 5BVKA 2WQOA 4E6AA 3S4QA 3UYTA 2R3MA 3U4WA 3KMMA 2EVAA 2FVDA 2JIVA 3FMHA 5DEYA 1ND4A 3L8SA 4QMQA 4M66A 4EJ7A 4EH2A 3M1SA 2LGCA 2XS0A 3PVUA 1VJYA 1VZOA 2QO2A 4RZWA 2GSFA 2WQEA 3BGZA 3R21A 3SW7A 4MD8E 5AUVA 1Q8YA 2G2FA 4QPSA 4WSYA 2PU8A 4L3JA 2BHEA 3WE8A 4R7HA 3D5UA 4FZFB 3L9PA 3WZKA 5J9LA 3T9IA 3FBVA 4G5JA 2DUVA 4QQTA 3DBEA 3OWLA 2PE1A 4I0RA 4IDVA 4XG6A 3NDMA 3LLAA 5EM8A 3FC2A 1CSNA 2CDZA 3HMOA 5GIOE 3NW6A 3LCKA 3KREA 3C4CA 4GIHA 1QPEA 4GW8A 1RJBA 2DS1A 4HVHA 5HG9A 4RIWB 3B2TA 3F3WA 4KKHA 2OBJA 5I5ZA 5E8YA 4IB0A 2GHLA 2IZSA 4JBOA 5EI8A 4RX8A 4FVPA 3PY3A 4IAIA 4FKIA 5AEPA 5DRDA 4I4EA 2R3LA 4E5WA 4XV2A 3SV0A 3ZMMA 1B38A 3NEWA 4QMUA 3DDPA 5HIEA 4AWIA 4KB8A 3UTOA 3OTVA 4G3FA 4G6LA 4IZ7A 4YSJA 5C03A 5L6WL 3EFKA 2XA4A 2YM6A 4W8DA 3AOXA 1YDSE 3E64A 2B9FA 4BI0A 2KULA 3UOLA 5B2MA 3I6WA 3P86A 4IFGA 5C1QB 2UZLA 2XBJA 3FKOA 2W5AA 3R2BA 4QTAA 1ZZ2A 4RRVA 1E9HA 2ZB1A 4HGLA 1ZZLA 3WZDA 5J7HA 4OTIA 2CN5A 1OBGA 3VQHA 4BTKA 4HCTA 2PMOX 4AU8A 1YHSA 1XH6A 4JX7A 5C8MA 4FTLA 2EXMA 4QMTA 3OBJA 2X8IA 1Q3DA 4F0GA 5IA5A 2XBAA 3G2FA 5AWMA 1MRUA 3AD5A 3COMA 4L52A 2PTKA 3CJGA 5B2KA 4IVAA 2C4GA 4RC2A 5BNJA 2C3JA 5HBJA 4U80A 2YDKA 2ZM1A 3A7HA 3E5AA 2WMVA 3DBCA 4RJ4A 2WU7A 4O21A 4ACHA 4B6LA 4F6WA 5KMIA 3NS9A 1YKRA 4G31A 4EOQA 5BVNA 4Y46A 1VEBA 3ANRA 3MDYA 3W2SA 2WNTA 4C38A 4PMPA 4HVIA 3SLSA 3E8DA 3EQHA 2P4IA 1K2PA 4HYUA 1GZ8A 2GMXA 3BGQA 5HIBA 5C27A 2PSQA 3ZLWA 4JAIA 5EHLA 4D55A 2C6EA 2UZEA 3CTJA 4BTFA 4ZY6A 3PG3A 3AGMA 4U6RA 4AGDA 2E9VA 2OU7A 4AT4A 4RFYA 2CJMA 4W8EA 3AT2A 3VRYA 4WNKA 1OECA 4FEWA 2BAJA 3IW7A 4X6QC 4M69A 4V01A 5EOLA 5ANGA 4KNBA 4BCOA 4BDGA 4FKPA 3BYOA 1GAGA 4RZVA 2QONA 4JDIA 4GKHA 5E9EA 5AP2A 2V0DA 2OZOA 3GP0A 3NUYA 3NWWA 4FTRA 3LLTA 2I1MA 5DH3A 3K54A 4EOSA 5G1XA 5IMXA 2R3FA 3HUCA 3BU3A 1Z9XA 4I0SA 4O7NA 2Y0AA 1LEWA 1GZOA 4LRJA 2BR1A 4F99A 2W0JA 3DJ7A 2DYLA 3GNIB 3MVHA 4QYEA 2BROA 5A6NA 4R77A 4CG8A 5AUXA 2FSMX 1QPJA 4LM5A 1CTPE 4YJUA 4E4LA 3UNZA 3HNGA 4EOLA 4UX9A 3KN5A 4LYNA 2X2MA 4QQ5A 2F7EE 2XNBA 3FMKA 4QP6A 5IQCA 2FYSA 2YIXA 3NW5A 4XG8A 4CZYB 4GVAA 3A60A 2WKMA 4UEUA 4ERKA 4F7NA 3R83A 2C0TA 2UW4A 3FE3A 5HESA 3ACJA 3QWJA 4F1OA 2BKKA 1OGUA 3TXOA 3BU6A 2R3PA 4FV7A 4P90A 3G33A 3UZTA 3SC1A 4O82A 1WVXA 5CEKA 2XNNA 3BYVA 4BDDA 3EQDA 3KF4A 3KRXA 4KBKA 2WZJA 2XZSA 5GZ8A 3I4BA 3KRJA 3NYNA 2CGWA 3DOGA 4XP0A 4EC8A 4DLIA 4C4EA 4FKLA 4D5HA 4HPUE 3VC4A 3DQXA 4FTMA 2XIRA 3KMWA 2DWBA 3NNWA 1SZMA 3CIKA 2PMNX 2YACA 4JR7A 4E6CA 2R4BA 5HU9A 3PSDA 3D0EA 3E62A 4BHNA 2RFSA 2PUPA 4E3CA 5JGBA 1ZOGA 3EIDA 1DAYA 4J1RA 3PY0A 4YR8A 2W9FB 3NUAA 3BV3A 1AGWA 2QNJA 3BE2A 4P5QA 4CEGA 4E4MA 4F0FA 5IA4A 3K5VA 4NSTA 5HO6A 1TQIA 3MH0A 3WILA 3CLYA 4CFVA 4RIXB 3FKNA 4EQMA 2EXCX 4F9AA 4UB7A 1DM2A 4EK5A 3Q9YA 4W9WA 3LFQA 3TUBA 3O7LB 3TDVA 2C30A 3QQUA 4C35A 3POZA 2GQGA 5FDXA 5C9CA 3UMXA 4UXLA 1O6YA 4I21A 4AZTA 2VWWA 2OICA 3WZEA 4A9RA 3COIA 2I0VA 4FSWA 5CXHA 3V8WA 3SG9A 1BL6A 3E7VA 4J98A 3R9NA 4DH1A 5IEVA 2CNUA 3R8ZA 4OBOA 3FSKA 4U45A 4UALA 1YQJA 2UZWE 1P2AA 4FTQA 3ODZX 4XUFA 3FYKX 3QRKA 3PJ3A 4EK6A 5EKNA 5GHVA 3UO5A 2B4SB 4IFCA 4FA2A 4RIXA 5ITAA 3R8UA 2PWLA 2ZM3A 3ZUUA 4CCUA 1OIUA 4H1JA 4KIOA 3TJCA 3I79A 2J6MA 4ASEA 2GU8A 2Z7SA 2VTPA 3SX9A 3OEFX 2YM8A 3QGYA 4C4IA 2JDSA 2GNHA 3CP9A 4M14A 4TTHB 5HX8A 3A61A 4JBPA 4OTWA 4CFMA 2RG5A 4EZ5A 3V5WA 4ACCA 4ONAA 3PDTA 4O7TA 3NZ0A 2UW7A 3HDMA 4RC4A 5HE1A 5HX6A 3QTQA 4TYIA 4AE6A 2QOBA 3VS7A 5EW9A 3FAAA 3AC1A 4IX5A 5K3YA 3F5GA 4FSTA 4WG4A 3QA0A 4G3DA 3P0MA 2J50A 1PXJA 3UP2A 1JPAA 2YM3A 3ZYAA 3CTQA 3NMUF 4IX6A 3FMJA 3KF7A 4BBMA 4HW7A 1UWHA 3HMNA 4O38A 3UZRA 2HXQA 4WHZA 4XMOA 4FODA 2RIOA 4IVCA 5G6VA 1IAHA 3UC4A 2A19B 2C5OA 5HLPA 1VR2A 3IW5A 2FSOX 3RHKA 3PA3A 3HGKA 4J95A 4PPAA 3VS1A 5AFVA 3GFEA 3Q4ZA 5E90A 1PXOA 2GCDA 5C4LA 3DBDA 3W2QA 5CI6A 1SVGA 3MV5A 4A06A 3H4JA 4UMRA 2YDIA 5FEEA 5D1JA 5M56A 3E87A 3MTFA 4FC0A 3RALA 1G3NA 5IDPA 1PXPA 3F2NA 5H2UA 3V5PA 2J9MA 2E9NA 5IQGA 2J7TA 4RFMA 3FMEA 4RJ3A 3VHEA 3N9XA 4AW5A 3P4KA 3WBLA 3NNVA 1PHKA 1YXTA 1K3AA 4IB5A 1KWPA 2O3PA 3HDNA 4FSQA 5BYLA 4A9UA 4S31A 3TM0A 5IMEA 4ZJIA 2W05A 2XRUA 5AM6A 3UOJA 4EH7A 3QWKA 4L53A 3GCVA 1FPUA 4DFBA 2ZYBA 2R3IA 4DCAA 3L9MA 5A4TA 5C4KA 2RFEA 3C0GA 4MKCA 3ORIA 1QL6A 3DQWA 4C59A 4EOPA 4HGSA 5M4CA 4DT8A 2JEDA 1PRYA 4KRDA 1ZWSA 2C68A 3VBWA 2IG7A 3U6IA 2QD9A 4LMNA 5BYZA 4X3FA 2XK9A 1FGIA 5I3RA 5L2WA 2HENA 3BHHA 1PF8A 3F88A 1Q61A 3I1AA 1W7HA 4QP2A 5E8SA 3FPQA 5EK7A 4O96A 3JVRA 5HNIX 5LOHA 2AC3A 3JY9A 3F3TA 1T45A 3T3VA 2ERKA 4QQCA 2GS2A 4OTPA 5CU6A 4YC3A 1ERKA 3TV7A 1R0EA 4IAAA 4OR5A 3C51A 5JSMA 5BVOA 1KV1A 5AIKA 4XG4A 5D11A 1Q62A 5JT2A 3OOMA 4TY1A 4L46A 4ZMFA 5FDPA 4RMZA 1M7NA 2BCJA 3LAUA 3QCYA 5IUIA 3ZTXA 4A4XA 2H9VA 5AA8A 2PZYA 4EQUA 3H9OA 3FUPA 2WEVA 3UGCA 3ODYX 4AN9A 2XK6A 3TIZA 2YDJA 2YIQA 4EBWA 2JC6A 5CVHA 4JR3A 3QZIA 4CQGA 3PPKA 5JN2A 4ZZNA 4DBXA 5M09A 1W0XC 3MESA 2HZNA 4E73A 3RI1A 3U8WA 1UV5A 4N6ZA 2XNMA 4FKJA 1M2QA 2CNQA 3EZRA 2GNFA 3FXXA 2WMBA 1Y6AA 3R73A 5GNKA 4PQNA 4YMJA 3FY0A 1Z57A 4TWCA 4DHFA 4PNKA 3A7IA 1OVEA 4C4GA 4IE9A 3ZS5A 2XJ1A 4NKSA 3D2KA 4AA4A 3KXZA 2ZVAA 3DJ5A 5K5NA 5DGZA 4F09A 1ZXEA 2G9XA 4RA5A 4AZEA 2AC5A 5DI1A 5HCZA 4DEIA 5CAPA 2OWBA 4ACMA 5IQIA 1PJKA 3VUTA 5CF5A 4W4VA 3Q5IA 2W4OA 4GT4A 3RHXA 5KMKA 4BRXA 4O7WA 3GOPA 2WB8A 3OXZA 5KCVA 3TTIA 3K3JA 5EDPA 1UKIA 4ANQA 2PVYA 3DLSA 1E1VA 1STCE 3DNEA 1KE6A 4AGWA 3MJ1A 1OPLA 4FZ7A 5AADA 2NO3A 2BKZA 3THBA 5C8KA 4R3CA 4ARKA 3P9JA 4ZSEA 1J1CA 5EM5A 3TZ8A 3PP0A 3MIYA 3DB6A 2C6TA 2OGVA 4GU6A 4L42A 4MBJA 2VTTA 4C37A 4HJOA 2UZTA 1HCKA 2HK5A 4NT4A 4P5ZA 3P5KA 2PVLA 4GFMA 4XOZA 3H10A 3U6JA 4FZ6A 4EUTA 4QMWA 1CMKE 3RGFA 4CTBA 4QYFA 2EWAA 1JKLA 4J8MA 3FYJX 4WT6A 2WMTA 2IW8A 2WTJA 5DR9A 4ZTHA 4E5BA 3FSFA 1Y91A 3CQUA 2WPAA 2YERA 4BWXA 2RGPA 5HG7A 4K33A 2VTJA 3TZ7A 2VO3A 4KD1A 1OIRA 3BYMA 4WRGA 4XOYA 5ANOA 5DIAA 2XUUA 2B0QA 2G2HA 2JLDA 3ZO2A 4AG8A 3KGAA 4O0UA 3HZTA 4FTAA 4L68A 4O1OA 3RBWA 3HMIA 4PMTA 3RCDA 4X6RA 3RPYA 3EN9A 1OKYA 4DINA 5LVPA 5IH5A 5EDRA 5AX9A 2RF9A 2ITPA 4FKRA 5IPJA 2JDTA 4H3PA 4QYHA 3RAIA 1WBNA 3Q5ZA 4IWPA 3KXXA 3GQLA 3FY2A 4FV4A 5LVOA 2JAVA 3IECA 4DLJA 4U0IA 2BRMA 3IGGA 2CKOA 5ANIA 3I5NA 1YWNA 3KK8A 4GU9A 2XYNA 4ALWA 3GC8A 2QHNA 3UIXA 4ZTRA 5L8JA 4O2ZA 2ITZA 3R9OA 4WD5A 4FL3A 4UMQA 3LFNA 4OBPA 3TKUA 2PVJA 1MQBA 4ITIA 5L2QA 4A7CA 5AP1A 4FG7A 3LE6A 2QR8A 3ZSGA 5CXZA 4YC6A 3QUPA 3S3IA 2FGIA 3TUCA 2EB3A 5CAQA 2B53A 3RM6A 3BELA 1YOLA 3HV4A 4QYGA 1SVHA 4XNEA 4C3PA 4PNIA 4IX4A 4BCNA 1Q8WA 2VTSA 3OT8A 4IZAA 4EORA 5A54A 4NUSA 4B4LA 1JQHA 3VS0A 5J1WA 4FE2A 3IKAA 4P2KA 2X9EA 3QXOA 3SAYA 3WZJA 2QOQA 5IH4A 5AR7A 4CLIA 3RJCA 3MYGA 3EQFA 4JBVA 3UIBA 4AX8A 2IN6A 4CYJA 5JFXA 1GIIA 4LFIA 2XNOA 4IDTA 3R28A 4ZS0A 3IDBA 3LM5A 5J5SA 2F2UA 3FEGA 2XKEA 3AC8A 5J8IA 5J9ZA 3TNHA 2YIWA 4Y73A 3FZOA 2JIUA 4CKJA 3TDWA 4DG3E 3QRTA 4CZTA 2OJFE 3GU8A 4OAUC 4O0TA 4RA4A 3WF8A 4F9CA 2QODA 4PRJA 4YJVA 4R6VA 2YIRA 2J90A 3SDJA 4XLIA 3ZEPA 3UP7A 4OUCA 4Y83A 3QD3A 2ITNA 4CNHA 2GS6A 2W7XA 5K4JA 1A48A 2X7OA 5IQBA 2ONLA 3A7GA 3OT3A 3GVUA 3P08A 2GNGA 3W18A 5F4NA 1FBNA 4RC3A 4O6EA 2X2KA 4DFNA 3HRBA 4GT5A 4IWQA 2HWPA 1OM1A 4Q5HA 4AOTA 2FUMA 1OPJA 2GQRA 4C34A 4CFWA 4G6NA 5JZJA 4MWHA 4D2WA 3DZQA 3C50A 3SQQA 1Q97A 4FZAB 5CSWA 2HELA 5DE2A 5FEDA 1O9UA 3BHTA 4E1ZA 3C5IA 3QQKA 3DK6A 3TV6A 2OIQA 4ZTNA 1OZ1A 1ZYLA 3NIZA 4K8AA 4EZ3A 1YWRA 1UNHA 4KIKB 3HV5A 2XEYA 3QKKA 4TNDA 3ZLSA 1OITA 2W9ZB 2YWPA 2WQMA 3ZU7A 4B9DA 5M4UA 3VJNA 1SYKA 4MX9A 3EN5A 2Z2WA 3AMBA 1PYEA 4EYMA 3LIJA 5A3XA 3DBFA 2C6MA 1IASA 5IQEA 5EQEA 2I0YA 4U5JA 4O7VA 2IVVA 1KE7A 2QR7A 4BWKA 4X7QA 5DG5A 2C6DA 3QQLA 3QUDA 4N70A 4C4HA 5A46A 2YWVA 3OUKA 4IANA 4DH5A 2RL5A 3RPOA 2Y9QA 3A4OX 3PJCA 5HU3A 1M14A 4FK3A 4OTGA 3VS6A 1M2PA 2CHLA 3FC1X 3R7IA 4IMYA 5EYMA 5CF6A 1MP8A 3RZFA 4D4VA 5E8TA 4WNOA 3JR1A 3CBLA 1JVPP 4FL2A 4KIKA 2YCSA 3GXLA 4M97A 5JQ5A 2VX0A 5KMJA 1ZMUA 4HYSA 1KOAA 3PRIA 2BIYA 5TT7A 1FMKA 1L3RE 2ITOA 4LMUA 4U9AA 4XV1A 4XG2A 4APCA 5HOAA 3QQHA 3VBXA 1CKJA 1P4OA 2VX3A 3D5XA 3MIAA 4FNYA 2BZHB 5F1ZA 4ID7A 3B2WA 4PDOA 4GFGA 2FSTX 2PVFA 4ZSAA 4KKGA 2GQSA 4TXCA 2X8EA 4YO6A 4YZ9A 3IOKA 1H07A 4L7SA 5BVFA 4RQVA 5CI7A 2J0LA 5AMNA 3VS2A 5D9HA 2OIBA 3QTUA 4AFJA 3HECA 4HYHA 3D5WA 1H8FA 4IACA 3D7TB 4EWHA 1UA2A 5D41A 4TT7A 5JZNA 3RKBA 2X81A 3RPSA 3VUKA 1JAMA 4IJ9A 5DVRA 4MEDA 1DAWA 3ORXA 4E93A 3LFEA 5E8VA 2J0JA 4BCJA 2C0OA 3NYXA 4NKAA 2UW9A 4D58A 1OIQA 3CEKA 3E8EA 4DH3A 3IQ7A 4YJRA 5M55A 3CTHA 3FI2A 1R78A 4DC2A 2PK9A 3Q9XA 2WOTA 3R71A 3PPJA 5CT0A 4N4SA 4AZFA 3WYXA 4ZZMA 4EI4A 5KO1A 2QOHA 2VGPA 3LZBA 2XNEA 5EQPA 4FK6A 3CXWA 4D2RA 4ZTMA 4B8MA 2PVKA 3NLBA 2OXDA 3P7BA 3C4XA 2IO6A 4JQ7A 4R1YA 5T68A 2PVMA 2WMAA 3NAXA 4FVRA 2WTVA 4QO9A 4CMTA 3G15A 4H3BA 3MTLA 1OI9A 4APPA 2QOIA 5L2SA 4C02A 1W82A 3C4EA 3LFAA 4GS6A 4PDSA 4Q9SA 3HV3A 4AGUA 5HBEA 4PTCA 5HD7A 4CG9A 4KS8A 2QVSE 3A8WA 4YZNA 4EBVA 2VTHA 3LMGA 5CX9A 3PTGA 4U81A 4AF3A 4CTCA 2UVXA 2W4JA 3MB7A 3JPVA 2BRBA 1XKKA 4QTBA 2P0CA 4FTJA 2OXYA 1W8CA 1KE5A 2CCHA 3IDPA 4BCMA 3W55A 2ONLC 3Q4TA 5K0KA 3VAPA 3KVWA 4ORKA 2BUJA 3U4UA 4DFLA 5L6OA 3PLAE 3VS3A 3MA6A 2R7BA 1LPUA 4LG4A 3BWFA 4I22A 5H8GA 5L6PA 3A7FA 4OTQA 3QAME 5A6OA 4O7ZA 4GCJA 3HEGA 4UXQA 4ZJJA 2QCSA 3VW8A 2WU6A 3NUNA 3RNYA 4ZP5A 3MY0A 3KXHA 5I3OA 4FTTA 3Q60A 4XP2A 1Y6BA 3WARA 2YM5A 2B52A 2GTNA 2O64A 4ZEGA 4NU1A 4NW6A 5AV3A 3SD0A 4I4FA 3IW8A 1FMOE 3AQVA 4G34A 4D0XA 1YI3A 3NNUA 3EN7A 3KXNA 1H1SA 5IA3A 4BWPA 2PPQA 3DGKA 2NP8A 4MXCA 4Y5QA 5AUZA 2PVRA 2VN9A 1SM2A 4AAAA 5DLSA 3VS4A 4B7TA 4DEGA 3IW4A 3VS5A 1Q4LA 3O8UA 3QCQA 4ZLYA 4JVGA 4XP3A 2F57A 5IEXA 2F9GA 1B6CB 2W1CA 2W5HA 4EC9A 4O7LA 1YHWA 3BKBA 4RIWA 4KA3A 3IGOA 1YOJA 4BDEA 5AP7A 4YNOA 2WTDA 3TKHA 3PA5A 3GC9A 4O0SA 3QF9A 3EL8A 1SMHA 2V7OA 4GG5A 3QX2A 5M44A 4JQ8A 5HE2A 2A27A 2RFDA 3RPRA 2CGUA 4BCKA 1S9JA 4PL3A 1QCFA 1G8AA 3R01A 4TYHB 3VF8A 2IVUA 1I09A 3OCTA 4CT1A 4QMNA 3FLSA 4WSQA 4CKIA 3JVSA 4C36A 4DEAA 3D2IA 3MN3A 2R5TA 5HKMA 2BPMA 4F1TA 1YW2A 5DNRA 3ALOA 3N51A 1GZNA 3HAVA 4BTJA 1MRVA 4FV5A 5J1VA 2GHMA 4DYMA 1WAKA 3P23A 5HHWA 4FV2A 4DG0E 4KIPA 3COKA 2IJMA 4L01A 5HQ0A 4IZ5A 4AW1A 2OLCA 4F65A 1OL7A 1IRKA 2WTIA 1XR1A 2YLFA 4MXZA 4ZOGA 3S0OA 4YJPA 4FV9A 1OKWA 3V51A 4GV1A 1YOMA 3R0TA 1WBPA 3EYGA 3R63A 1V1KA 4QP4A 4TYHA 4BL1A 4EYJA 4CGAA 2C1BA 4NFNA 3QUEA 3SKCA 1OBDA 2HAKA 3JUHA 4OW8A 4KINA 4IW0A 4FSNA 3O50A 2HIWA 2QOFA 3E8CA 3QYWA 2YABA 5DR2A 3ZC6A 3QCSA 2XKDA 4CV8A 4FV1A 3I0QA 3MSSA 3IS5A 1ZMWA 1UU9A 1XHAA 1JSVA 2P3GX 3AT3A 3QRIA 4NM7A 3PVWA 1E1XA 4CMOA 3MY1A 4L00A 4QPAA 3F5PA 2JAMA 1YXVA 3IPHA 3LQ8A 4DG2E 3R1NA 4M7IA 5FG8A 3UIMA 1PY5A 2ZV2A 3V8TA 4EZ7A 4L6QA 3AC4A 3NNXA 3QZFA 5DR6A 5FTQA 4ANNA 1NT2A 4V05A 2BRGA 3R7GA 4YHTA 4PUZA 2OJ9A 4D5KA 4QMLA 4C58A 3ORLA 3E8NA 4FZDB 5E1SA 4BGHA 5BMMA 5TKDA 2OKRA 1YDTE 4AA5A 3QKLA 4C2VA 3FV8A 3KY2A 3F3ZA 3F3VA 3NUSA 3DFCB 2JDVA 5CU4A 1J7UA 2XK8A 2FA2A 4ZTSA 4C4JA 3HAMA 3EKKA 4NEUA 4ZK5A 2VTQA 2CPKE 1PMNA 2A1AB 2P55A 3VIDA 5HNBA 2ZM4A 4AXAA 2ZMCA 4D0WA 4D2VA 4NJDA 1GIHA 4NCTC 1IA8A 3R9RA 1H1PA 2WMSA 4GIIA 4ZXTA 5DT0A 5J87A 4QP8A 4DFXE 2BRHA 2H8HA 3KULB 1QMZA 4R5SA 4WG3A 5JRSA 3CKXA 4HYIA 4TPTA 4BKZA 2QOCA 2JFLA 4YBKA 2I0HA 3UO6A 1ZYSA 1LUFA 3CD3A 1JKTA 2OF4A 3LFCA 3Q52A 1JOWB 5KKRB 1WFCA 2ACXA 5JRQA 1MUOA 3LHJA 4BGGA 4IWDA 3PLSA 4BCHA 4U3YA 4H05A 1P5EA 4O7RA 5CZIA 3PWYA 2OJIA 4BKJA 2QLUA 3QTWA 3OY3A 4C33A 3W10A 4B99A 5JQ8A 4NFMA 4C57A 4XH6A 2JGZA 3H0ZA 4G3CA 4DEHA 4YTCA 5BUJA 4JG7A 4BGQA 3E63A 4CD0A 3R7VA 2ITQA 2XNPA 3I60A 5EYKA 4EHEA 4BF2A 3LQ5A 1LR4A 3UPXA 4BY9E 2XJ0A 3R00A 4RQKA 4D2SA 4TWNA 4EOKA 3FL5A 1BYGA 4BZOA 3OP5A 4WRSA 1XH7A 4FIIA 5CU2A 4IHPA 4ENXA 3M42A 4OTRA 4RX9A 5CLPA 5HVKA 1M52A 3G6GA 4G9CA 5I9UA 1APME 4UWBA 4DGMA 4DEBA 5CNNA 4E5AX 3UE4A 4L45A 4IVDA 5EG3A 2E9UA 1ZARA 3F82A 5FP5A 2OJJA 3RMFA 2ETKA 4PPBA 5BUEA 4BDIA 2CNVA 5CALA 4DE4A 4LI5A 3WIGA 4EH4A 2HW6A 5T3QA 1RE8A 4FTNA 3NUPA 5DT4A 1Q8UA 3MBLA 5EI6A 4BC6A 1W83A 4MF0A 3W2OA 1IAJA 2G1TA 5AV0A 4I24A 1NA7A 3FXWA 4DF3A 1JBPE 2VTRA 1XH5A 3PIXA 3Q6WA 3FXZA 4CFNA 4L7FA 5EW8A 3G9LX 4LV5A 4DBNA 3D5VA 4Z7HA 1H27A 5EM7A 4O84A 3WF5A 5JFVA 5CEIA 3EZVA 3ZBXA 2RG6A 2Q0BA 3S2PA 3VHKA 3MFUA 3GCUA 4BIDA 4FEVA 5DBXA 5C01A 2GDOA 4I3ZA 5HGIA 3VBVA 2PMLX 4MXXA 1GNGA 3EH9A 4RWLA 1J3HA 2WMQA 3L1SA 4L9IA 2B9IA 4NH1A 4YC8A 3V5QA 1Q3WA 2XKFA 1WCCA 4QMVA 4BVUA 4RJ7A 1GOLA 2OXXA 3KMUA 4Y95A 4NYEA 3FLYA 4ASZA 4M0YA 3QBNA 3LFSA 4ITJA 2A0CX 5CSHA 4IXPA 4UYAA 4BBEA 5LMBA 4UZDA 2WTKB 1RW8A 4FICA 4D1XA 3OHTA 3ZDUA 4MHAA 3R9DA 2P33A 4RIOA 1VYZA 2IW9A 3RWPA 4IAYA 3VNTA 3GCPA 4I5CA 4K77A 2RSVA 4BFMA 5TR6A 3JXWA 2WELA 3BCEA 3LMHA 3V5TA 4FGBA 4G1WA 4CFUA 3DKOA 3DAKA 4FOCA 1PMEA 4IADA 5EQYA 4C61A 1BLXA 3U55A 3GFWA 4AA0A 5K4IA 3QD4A 4UMTA 4RVKA 5ETCA 4K6ZA 4IJPA 4A9SA 5E4HA 4JLCA 3F7ZA 3L8VA 5M57A 2NRYA 3RNIA 5CENA 5IG1A 3FPMA 3QZHA 1M17A 1OL1A 2C5YA 2VX1A 3MI9A 3ZBFA 3Q4CA 4QPMA 3ZM4A 3BBWA 5IQDA 4MBLA 4FKTA 3T8OA 4MCVA 3UOKA 4YNEA 3BWJA 3TG1A 5J9YA 4AACA 4XS2A 3EWHA 4L43A 4I5PA 4FKWA 4GEOA 4J99A 3O8TA 4BHZA 3EOCA 4U7ZA 4EOOA 2P2IA 4Z55A 3OG7A 4WBOA 5B7VA 2VRXA 4FUXA 3OD6X 4RIYB 1OKVA 2GFSA 3BI6A 4A4OA 3QTIA 2ITYA 3ZCLA 4GH2A 4X2FA 4ITHA 4JAJA 2C1AA 5FXSA 4KIQA 3VUMA 2UVYA 2EUFB 2J5EA 2V5QA 3C13A 3GU4A 3PYYA 4PDPA 5D12A 3OTUA 3WZUA 2CGXA 2VWUA 4JG6A 5AAGA 3ZUVA 5B2LA 3D7ZA 3R1QA 2VNYA 3F5XA 3W8QA 5CASA 3S00A 4BZDA 5A4LA 4YJTA 5D10A 3S95A 4JDKA 3UJGA 3CR0A 4GYGA 3QQJA 4RX7A 3GENA 4ASDA 4RX5A 2PE2A 2CMWA 4MF1A 2F2CB 2WEIA 1SVEA 1Y8YA 2RKUA 4BCPA 4G6OA 1NW1A 5IA1A 1WVYA 3OXIA 4YUQA 1YXXA 2X8DA 5CZHA 3R8LA 1F5QA 3ZFYA 5LVLA 5CYIA 3BPRA 4X0MA 3NVMB 1H08A 4RIYA 4N0SA 3SXFA 5I9VA 4WA9A 4NW5A 1G8SA 3H9RA 3H3CA 4ALVA 4BTMA 4HGEA 3CPBA 2C6OA 4F70A 4LOPA 3ZO4A 4FV0A 3L9NA 3VVHA 1BUHA 3GU7A 3F3UA 3HRFA 5I9XA 5KKRC 4FSMA 3WYYA 4R7BA 5CAOA 2WFYA 3R8MA 3BLHA 3QL8A 4BDFA 4DFZE 1QPCA 2FO0A 3E93A 4OAVB 2IZUA 4E8AA 3NYOA 2B7AA 5M53A 4XG3A 3KA0A 3OY1A 3UODA 3TL8A 1KSWA 4JDJA 4JS8A 4FYNA 3QC4A 3VN9A 4YO4A 2JDOA 4FV6A 4NL0A 3AC2A 4X2KA 3CJFA 5ANDA 4MH7A 3EN4A 3EHAA 2GPHA 5LXMA 4AOIA 5IUGA 4UV0A 3PXYA 4Q9ZA 1SNUA 3FHRA 5E7RA 5IA0A 2UZDA 3I5ZA 3DU8A 5F94A 2F7XE 1R1WA 1URWA 4I5HA 4F6UA 2WIPA 4XV9A 4GUEA 4PF4A 1SNXA 3BGPA 2QO9A 2PZPA 3RZBA 2ZOQA 3ITZA 4GJ2A 4I6HA 3R8VA 4RVLA 1Z5MA 5E8UA 3WF6A 3ZOSA 4E26A 2CKEA 4MXOA 4IM0A 4GFOA 2VWBA 4CFXA 3E7OA 3LXKA 4M68A 3FMMA 3TZ9A 4RWIA 3P1AA 2R0UA 5EI2A 5LJJA 2YCRA 3R6XA 4D4YA 1TQPA 1RDQE 1XO2B 3BHVA 4TKSA 4O7YA 3MH2A 4FKOA 3SXSA 1IR3A 3HUBA 4MBIA 2BFYA 3PFQA 5BVWA 2VGOA 3OVVA 4JJRA 3ULIA 3A8XA 3QALE 4PDYA 4GK2A 1DS5A 1H24A 2YM7A 2QI8A 4BDJA 5AIRA 4L67A 5CAUA 4PL5A 4Y5HA 1OIYA 4YLKA 3P7AA 3QGWA 3DFAA 4TWPA 3PUPA 2YEXA 5HCYA 3SRVB 4DT9A 5IZFA 3EQIA 3TKIA 3PIYA 5JKGA 2OI4X 4MK0A 2NPQA 2YAKA 4JI9A 5IH6A 3D15A 1PXMA 3AC5A 4KWPA 3SA0A 3HL7A 4I6QA 5DFPA 2X4ZA 2OFVA 4HCUA 4DITA 3NYVA 3BV2A 5KX8A 2YAAA 2O5KA 2WTKC 4KRCA 3TN8A 3RTPA 2BAQA 2W96B 4IQ6A 4MXYA 4H1MA 1UNLA 1FVRA 3DAEA 3V5LA 3N4VA 5L2IA 4PV0A 4Y8DA 1H4LA 2XM9A 2W99B 4EHVA 2B9HA 2XK7A 4W9XA 5FLFA 4QMSA 4BIEA 5F9EA 5DYJA 4DTAA 3DXQA 3W2CA 4FMQA 3A99A 4U97A 3SOCA 3ENHA 5AP3A 3CY2A 4USDA 4PX6A 4O0VA 1OMWA 3A62A 3D14A 3LJ2A 4YZBA 4FEUA 3FZPA 4KAOA 4AQCA 5KUPA 4EEVA 2WHBA 3HV6A 3R7UA 2XIKA 5HG5A 2PULA 2PL0A 1O6KA 4QMMA 2O8YA 4LUDA 2Y8OA 3ZRMA 1TVOA 2YHVA 5H9BA 3G9NA 3NRMA 2ITVA 3OW3A 2B55A 4MNFA 2HWOA 3ACKA 3OXTA 3R7EA 4CQEA 4EUUA 1XH8A 3DS6A 4DA5A 3ZLYA 3Q2JA 4PTEA 3GC7A 4NM0A 3I81A 3EN6A 3HMMA 5AX3A 5HLWA 1OB3A 1XJDA 3EMGA 3OWKA 5AV2A 2J0KA 3NW7A 5HD4A 3QD0A 4WNPA 4LQMA 4O6LA 3BEAA 4XBUA 5HLNA 3SOAA 4ZS4A 4I41A 2VUWA 3QQGA 4I6BA 5HTCA 1ZAOA 1XH4A 3IG7A 2Y4PA 5EKOA 4O81A 5BYYA 4WKQA 4CKRA 4QOXA 4R78A 4C2WA 1KV2A 1X8BA 4O2PA 5HICA 4OBQA 5LMKA 2BRNA 4O0YA 4KSQA 4XV3A 3JYAA 4DGNA 2OSCA 3DB8A 4GYIA 2A4LA 3CGFA 3LCOA 3PZHA 4IBMA 1A06A 5CANA 3CCNA 2VTMA 2OZAB 5L2TA 3V01A 5EOBA 4HZRA 2R3NA 3MPAA 4YBJA 3O2MA 4X2NA 2XIZA 2CGVA 3KRLA 3TWJA 4CSVA 2R3OA 4L44A 2ZV8A 3LJ1A 3ZSHA 5EYCA 2ZV9A 2XJ2A 2GFCA 2E9OA 4LOOA 4RLLA 4XX9A 5HO8A 3ZC5A 3I7CA 5EM6A 4CRSA 3S1HA 3FMNA 1UU7A 2HXLA 4UYNA 1REKA 2Z8CA 2WTWA 2PMIA 3KKVA 4FTKA 2X9FA 2WXVA 2WD1A 3ZRLA 2UZOA 4QD6A 2PZIA 4IEBA 1JSTA 2BZIB 2UW6A 4JIAA 3AT4A 4QRCA 2QKWB 2BMCA 4DFUA 3B8QA 2VZ6A 4FIEA 4HNFA 4YZDA 3ATSA 3Q6UA 4DH8A 4PWNA 2PYWA 2JKQA 3ZUTA 3PA4A 4O0RA 5KBRA 3V8SA 4EHZA 3CD8A 4TN6A 3GUBA 4IZYA 4TYEA 4R8QA 4YTIA 3WF7A 2G15A 1P14A 4U42A 4M3QA 4FBXA 3TJDA 3QQFA 3R22A 4LRMA 1F3MC 4C3RA 1PMVA 4KS7A 3C1XA 3Q4UA 4FKVA 4O1PA 4PPCA 3VUIA 4RJ8A 5E92A 5M08A 3G5DA 3PZEA 2YN8A 1B39A 3PSBA 3UVRA 3K5UA 4AW0A 1BMKA 4CCBA 1XBCA 2IWIA 2VNWA 4G5PA 4J71A 1IG1A 3KU2A 3DXNA 4MWIA 1L8TA 4U41A 3CC6A 2O63A 4WOVA 5M06A 2XNGA 2PE0A 5EW3A 4FEXA 3UOHA 2OIDA 3IDCA 2R9SA 3QFVA 4S33A 4M0ZA 4RVTA 2IZRA 5AR8A 3OEZA 5KMMA 3POOA 5DMZA 4EKKA 5JGAA 1PKGA 3U54A 3UNJA 4ZSLA 2EU9A 2UZVA 3UQGA 3E3BX 3Q32A 4QTEA 4L3LA 5CEOA 2JDRA 3B8RA 5LVMA 4JL9A 5IISA 5J95A 2C5VA 4ZLZA 3Q9WA 2F4JA 2C3KA 3QCXA 1ZYCA 4R7IA 1NVQA 5FTGA 3QC9A 1TQMA 4FG8A 2PUNA 1T46A 3QD2B 1IA9A 2JD5A 5C26A 4WBBB 1XBBA 4HGTA 3PJ8A 3Q3BA 4CRLA 3M2WA 3FZRA 4AFEA 3MGYA 5TF9A 3C0IA 1G5SA 1UVRA 2CLXA 1XH9A 3LW0A 3MFSA 4QP3A 4QMZA 3ORNA 5EDQA 4TZRA 5I4NA 5CF8A 1H28A 3NUXA 3FI3A 3PG1A 3RCJA 4E4NA 2BHHA 3MH3A 5KMOA 3BZ3A 1YVJA 1WZYA 1H01A 2VTAA 2R3HA 2Z7RA 4LV8A 2ZAZA 4MD9E 4NK9A 5F95A 1NY3A 4EH6A 3ID6C 3LPBA 2OH0E 4U43A 2W1ZA 3GGFA 4BCGA 5BUIA 2C6LA 2VWYA 5HG8A 5ACBC 4I93A 4QT1A 3C4FA 3D7TA 5BVEA 1J1BA 2C0IA 4F6SA 5A9UA 1IEPA 2XP2A 4I23A 3AMAA 2BTSA 4D9UA 4ZAUA 4C3FA 4TL0A 4FT5A 5ANEA 5GZAA 2YJRA 2R3JA 5IQAA 3JS2A 4XEYA 4Z9LA 4YJSA 3U6HA 1JSUA 2I40A 1U54B 2F7ZE 3O7LD 4HOKA 3U51A 4DGGA 4DEEA 3WIKA 5IDNA 2KTYA 5ICPA 3R7OA 2W1DA 1XWSA 5KZIA 4NM5A 4JX3A 5LMKC 2OK1A 3PE1A 2CN8A 3OWPA 3ORKA 4DCEA 1BL7A 4DTBA 3UMWA 2GNIA 1XBAA 4J8NA 1J7LA 3DKGA 1H1QA 4NCTA 2BTRA 1YHVA 5CSXA 3V6SA 2CKQA 3EKNA 4C7TA 5CSPA 2X6EA 3FMDA 3IONA 3ORMA 4MNEB 3VWAA 3T3UA 2Q0NA 3C4ZA 2VU3A 4DGLC 3GEQA 1OPKA 3DY7A 4BBFA 5C8NA 4GT3A 5KHWA 4NTSA 3ZRKA 4BR3A 1PKDA 1UNGA 4AT3A 1U54A 2R7IA 3DK7A 1AD5A 4OT6A 4RGJA 5DWRA 5JH6A 4QYYA 3QA8A 2UW3A 4I5MA 1V0OA 3ELJA 4ZY4A 5CEPA 3FI8A 5J5TA 3HV7A 3MB6A 4FSYA 5EYDA 4HVGA 2HZIA 2R2PA 3UVQA 3DXPA 4Y85A 2YJSA 1GJOA 3K3IA 2PHKA 5KMNA 2UUEA 2B9JA 2NRUA 3BEGA 3ZFMA 4XJ0A 3ZO1A 2JKMA 4HNIA 2HW7A 3KRWA 5KHXA 3DKFA 5HEZA 2QC6A 2UZUE 3O8PA 4MNEA 3MVMA 4UWCA 4YGAA 3LKMA 5TE0A 1FVTA 3OROA 4JRNA 4FT0A 4S30A 1ZOHA 4CMUA 2Z7LA 5K0XA 5DHJA 3W1FA 1W84A 3DBQA 2QG5A 4I92A 4L8MA 3NGAA 3GQIA 2OW3A 4YJQA 3WOWA 1JLUE 1WVWA 4LGHA 3PJ1A 2YCQA 4DGOA 4S32A 3OF0A 3QRJA 4RT7A 4RG0A 4I6FA 3G0EA 5M07A 4F63A 2DQ7X 2XYUA 4RWJA 5LWMA 4EOJA 2JBPA 2W5BA 1J7IA 4A07A 3O23A 2BDJA 1ZYJA 4IB3A 4O7SA 2QU5A 2V62A 3HP5A 4DH7A 4NJ3A 3UNKA 3OCBA 2FB8A 2PVNA 4FKGA 4ERWA 4YZCA 4NZWB 4PP9A 4NWMA 4XG9A 4DTKA 2H6DA 3F2AA 3NCGA 2W1FA 1GZKA 2BZKB 3EYHA 3IOPA 3VBTA 4BB4A 4CXAA 1ATPE 3KC3A 4IWOA 2PUUA 2GNLA 4MD7E 4GMYA 3WF9A 3NIEA 3OCGA 4EK3A 4WG5A 4KBAA 5A4CA 1Q8TA 4FR4A 3EFLA 4M69B 1U4DA 2ITWA 5JMSA 5H8BA 3O96A 4YHJA 5LARA 3VO3A 4M8TA 3QLGA 3D9VA 4DAWA 4E6DA 1MRYA 2W06A 3F66A 3PIZA 4OTDA 5L8LA 5AR5A 4AGCA 1KE9A 1XQZA 2WMRA 2ZDTA 3HA8A 2ESMA 2IVTA 3EB0A 2OH4A 3P78A 2CCIA 2C69A 3H0YA 3ORPA 4UWYA 5BMSA 1H00A 2XRWA 3ZO3A 4E4XA 2IPXA 3CGOA 3VRZA 3TIYA 4EH9A 3DNDA 4BYJA 3LFBA 4TWOA 4D1ZA 4FTOA 3OUNB 4F0IA 2YA9A 3FLZA 2HCKA 4F9WA 3II5A 3EQCA 4I0TA 2YZLA 1O6LA 5CU3A 1WMKA 4RLKA 2BDFA 2I0EA 3G90X 1Q41A 3BHYA 3RINA 4USFA 5H3QA 5IKWA 4USEA 4LL0A 3G6HA 4M15A 3QTSA 2B54A 5AP6A 5AR2A 4YP8A 3NVKI 3C7QA 3SXRA 4Z7GA 3E92A 4I20A 4FIFA 2ITXA 3FKLA 4I1ZA 3VBYA 3PXFA 3ZZEA 2BZJA 2XIXA 1BX6A 5L3AA 3KXMA 2X0GA 5L8KA 3OFMA 2G2IA 4FOBA 5HNGA 4D1SA 4H58A 5FGKA 1WBSA 3GT8A 4IM3A 4EK4A 3QHRA 4FX3A 3MA3A 1CKIA 3H9FA 4FVQA 3CE3A 4V0GB 4ASXA 4WUNA 4P4CA 2QOOA 4LUEA 3UIUA 2Z60A 3RP9A 5CQUA 4BDBA 3RWQA 4C62A 5GJGA 3OWJA 2XCKA 3NCZA 3VBQA 2VTIA 2Z7QA 4RWKA 1YI4A 4J7BA 4Z3VA 4ZSGA 4PMSA 2HY0A 3FJQE 4II5A 4QQJA 3MPTA 5BPYA 2BIKB 3LM0A 3G0FA 1F0QA 3QZGA 4C0TA 3VQUA 2PUIA 3RAKA 3T9TA 3ZM9A 2XK4A 4U8ZA 4GUBA 2Z02A 2PZRA 2VD5A 5CY3A 3R02A 3PVBA 4V0GA 3CPCA 4W4WA 4PL4A 3VF9A 3EQPA 4N6YA 2QLQA 2Y4IB 4G3EA 4K18A 2YLEA 3MS9A 3R7YA 3RK9A 4QTDA 2F49A 5HBHA 3A4PA 2HY81 3TEIA 3U9CA 4JOAA 3KULA 5EFQA 1LP4A 3W16A 4CVAA 3A7JA 4D2TA 2W17A 4MVFA 2R3QA 5JGDA 3AD6A 5LQFA 3HRCA 3I0OA 4ZTQA 2UZBA 4MAOA 1JKKA 3CQEA 4U44A 4CYIA 5K9IA 3CY3A 3BBTB 2W1HA 2J51A 1WBTA 2JIIA 3PRFA 4ZTLA 3GI3A 1OL2A 3KFAA 5E8ZA 5HE0A 4IVBA 4ANLA 2XF0A 3DJ6A 3E3PA 3PXZA 3R1SA 4YPDA 1ZY5A 5AR4A 2W1IA 3FMLA 3BQRA 3GB2A 3GC0A 3Q53A 3R8PA 5F20A 3ZFXA 2J4ZA 2C6KA 4AZSA 2R3KA 3R1YA 1PXKA 3QKMA 4K9YA 4EONA 3D94A 3ZH8A 1WBVA 4ACDA 4XRLA 4ZMEA 2YITA 1HOWA 3ALNA 3V5JA 3ERKA 4IC7A 3UDBA 3ORTA 2OFUA 5DOSA 1ZOEA 1J91A 2VTOA 3ROYA 3EJ1A 4RFZA 4K11A 3ZDIA 1BKXA 3DT1A 4CV9A 4EH3A 3PXRA 2X2LA 3K2LA 4FUYA 4EHGA 5FWKK 3D4QA 4XLVA 4HPTE 5IQHA 3AC3A 3V04A 2UV2A 4IX3A 5E8XA 4OT5A 5I9YA 5ETFA 4D4RA 4X2JA 5HI2A 3EQBA 1I44A 1H0VA 2BILB 3PE2A 4O0WA 5AM7A 5FRIA 4BICA 4CZUA 2VO0A 4FF8A 5DT3A 2JKOA 2WIHA 4F7LA 5IU2A 2UW0A 2WQBA 3R30A 5ANKA 3LOKA 3LMIA 3TNWA 4B8LA 3OC1A 4NTTA 2XM8A 3ATTA 1GY3A 2JITA 5HTBA 5TO8A 2QG7A 4RVMA 3TACA 3WE4A 4XYFA 4C8BA 1PXLA 4BCQA 1OL5A 2XCHA 4C4FA 4AP7A 4D9TA 3KEXA 4O86A 3V6RA 4AUAA 3KCKA 1FVVA 3MVJA 3TT0A 2QO7A 5HZNA 4FTIA 2Y6MA 4F7JA 5GJFA 4FTCA 3C5UA 4WUAA 4R1VA 2XIYA 4X3JA 4JBQA 3KL8A 5AV1A 4TYGA 5AP5A 3RAWA 1ZLTA 3BYSA 3O17A 4YLJA 2WMWA 2XVDA 3FLNC 5CEMA 3QRUA 4TNBA 5DEWA 2JFMA 4ZY5A 3QTXA 4CFFA 4OTHA 2V22A 3FQSA 1S9IA 2SRCA 4O22A 3UPZA 3L9LA 2VWVA 3AD4A 4BZNA 3HMPA 5HIDA 4O91A 4QMYA 4X3FB 5LCJA 1U5QA 2X7GA 3DV3A 5IEYA 2QQ7A 3F61A 4M67A 1ZRZA 2C3IB 3ETAA 4JIKA 3DK3A 4F64A 2H34A 4YPSA 5AUUA 5HORA 5CVGA 2XH5A 3DDQA 3FDNA 2R3RA 3VJOA 3MY5A 1ZMVA 5FXQA 5FM3A 2V7AA 2VTNA 4S2ZA 3WI6A 4AZVA 4JRVA 2ITTA 4R5YA 4XG7A 4RJ5A 1CKPA 2C5XA 3E88A 4PP7A 4ANSA 1R0PA 2QOLA 1LEZA 4G17A 5CWZA 2HZ0A 4E20A 2QOKA 4PY1A 2W1EA 1NVSA 4U40A 4X21A 5E8WA 2Y6OA 3Q96A 2O2UA 3QTZA 1WBOA 4W4XA 4DFYA 1A9UA 2BALA 2VO6A 2ERZE 3KQ7A 3O71A 3PVGA 3C9WA 4KUJA 3F69A 4M84A 3UZPA 4CLJA 4TYJA 3DLZA 4AW2A 4JT3A 4EL9A 2YISA 3HP2A 4ZZOA 2WMUA 3HKOA 3QX4A 1EH4A 4IC8A 4AS0A 4EH5A 4GL9A 2PY3A 3EL7A 1HCLA 2J0IA 1REJA 3LFDA 4FKUA 4YTFA 5FXRA 1OUYA 4R3RA 1YI6A 4BCIA 3PXKA 4EKLA 4F7SA 3RPVA 3QXPA 3ENMA 2WO6A 1H1WA 3LXNA 2X1NA 4FEQA 1JNKA 4FIJA 1JKSA 4K2RA 5FUTA 4YLLA 4BDHA 4O83A 5KBQA 1MQ4A 4IAFA 3U9NA 3BU5A 3ZLXA 2C6IA 4FIGA 4RJ6A 1H26A 2B1PA 3OMVA 4IIRA 2X4FA 4G9RA 3RK5A 3ROCA 2HYYA 3ZHPC 4FL1A 3TUDA 4YTHA 5EHOA 3ZXTA 5AUYA 4HCVA 4D4SA 3MPMA 2ETMA 1YRPA 3DTCA 5FTOA 4E6QA 3FWQA 3JY0A 5CSVA 4A4LA 4GSBA 4HZSA 2Y4IC 3ET7A 3HYHA 3Q2MA 1CDKA 2W1GA 4K1BA 2JKKA 3DCVA 5A4EA 3ANQA 1M2RA 3ZXZA 3UG2A 4FT7A 4KBCA 1ZYDA 4DN5A 2H96A 2AUHA 4FIHA 4QP9A 3R04A 2J0MB 4BDCA 4QMPA 4MQ2A 3EQRA 4U3ZA 3HX4A 5DRBA 1Q24A 2C5NA 1FINA 2GHGA 1V0PA 3IW6A 4GK3A 3ZSIA 3FQHA 3UQCA 3IK3A 3L8PA 3GBZA 3SG8A 2EB2A 2UW5A 1YDRE 1V0BA 1U59A 2UZNA 5A14A 3SGCA 1K9AA 2XB7A 1U5RA 4NIFB 4K0YA 2E9PA 3TNQB 4IB1A 1Y57A 1YXSA 3AMYA 3M11A 4FYOA 4JNWA 1UU8A 3LFFA 5FD2A 2XKCA 5FQDC 2C3LA 5CNOA 2OJGA 1H1RA 2YZAA 3C4WA 4FNWA 5DN3A 4RSSA 3VUDA 1ZY4A 3ULZA 4ANMA 4S34A 1H0WA 3H30A 4JDHA 2WOUA 3Q9ZA 4EK8A 4A9YA 3W32A 3EFWA 3BE9A 2WQNA 2WTCA 3CQWA 1DI8A 4FT3A 3ZONA 5AUWA 5LVNA 1BI7A 2UVZA 4FG9A 3KN6A 4KABA 5L4QA 1AQ1A 3KVXA 2VO7A 2OF2A 4G2FA 4IH8A 5AR3A 1QPDA 2GS7A 4NIFA 4QNYA 3RVGA 1URCA 3UC3A 1OKZA 1Q8ZA 4LRKA 3OW4A 5GZ9A 5M4IA 3FZ1A 4O27B 3PWDA 5CVFA 5AAFA 4W4YA 5CQWA 4R3PA 4ENYA 3NUUA 3TTJA 2HOGA 3G51A 5B0XA 2REIA 3FI4A 3HA6A 1KE8A 2IZTA 3DZOA 5D7VA 2YM4A 5E1EA 5AP0A 3DPKA 5HCXA 3PY1A 5KE0A 2VWIA 3AGLA 4JXFA 3QTRA 3NPCA 3R2YA 3LCTA 4H3QA 2A2AA 3LVPA 4RBLA 3BLQA 5FM2A 2BFXA 3VULA 3VUHA 3W2RA 4FT9A 4BYIA 5DA3A 4FKQA 4WIHA 5FP6A 5HE3A 3EFJA 4OGRA 2XEZA 1U46A 3RM7A 2C47A 4D2PA 3DAJA 2VWXA 4EJNA 1Q5KA 3SRVA 3RK7A 3SW4A 4NM3A 2V55A 1TKIA 4FNZA 3TZMA 4ZJVA 2R64A 2ZMDA 3LCDA 3AG9A 3QYZA 5HVJA 4FSUA 2OO8X 3PP1A 3F6XA 3GU5A 3QLFA 4LGGA 5FEQA 3DA6A 2I7QA 2QKRA 4OTFA 2RFNA 1JWHA 3OS3A 3R9HA 2BDWA 4HVDA 2BVAA 4N57A 3F9NA 4F9YA 2WMXA 4X3FC 4MQ1A 5KZ0A
chains in the Genus database with same CATH superfamily
3PXQA 1BI8A 2I6LA 3LJ0A 3PJ2A 4M13A 2X7FA 3KB7A 3P79A 4BKYA 3UO4A 4BCFA 4MTAA 4F1MA 2GNJA 5GIPE 2XK3A 3VUGA 3FLQA 3FZSA 3MFRA 4UY9A 4WO5A 2R0IA 1R39A 4QTCA 3AXWA 4Y72A 3RAHA 4FI1A 1UWJA 4BN1A 5HO7A 5AJQA 5IA2A 4YJOA 3W2PA 2QURA 2PZ5A 3DKCA 3I6UA 3TNPC 4AN2A 3OCSA 3TNIA 4Z16A 5I9ZA 2WAJA 5K5XA 4YSMA 2J2IB 5CF4A 5FBOA 4AT5A 3BX5A 5LCKA 4P7EA 3LCSA 4U79A 3UDSA 4DEDA 3HLLA 4KKEA 5AP4A 1PXNA 5IUHA 4FTUA 3UYSA 3UBDA 3A2CA 3TCPA 3BLRA 4BIBA 4CT2A 3N4UA 4WNMA 3KK9A 1PW2A 3C0HA 3COHA 4UBAA 4XCUA 3MWUA 1FOTA 1VYWA 2VV9A 3O0GA 3ZZWA 2OG8A 4BI2A 4IM2A 5CAVA 3HVCA 1FQ1B 3AKJA 2X39A 5HVYA 3MFTA 4OLIA 2YCFA 5CEQA 4YJNA 4H36A 2VWZA 4J53A 1FGKA 1RQQA 3F7WA 4I94A 5IQFA 4E7WA 5BQ0A 5JEBA 1UKHA 3KRRA 2XMYA 3I7BA 2HZ4A 2CLQA 3ORZA 3SHEA 1KUTA 3BYUA 5TOZA 4HVSA 5LWNA 1YXUA 3NSZA 4UN0C 1KOBA 2FSLX 5CS6A 4FJVA 4QMXA 3MJ2A 5FBNC 4GVJA 4EWQA 5GINE 3MW1A 4J97A 2P2HA 3BQCA 2OZAA 3FHIA 4MYGA 4PTGA 2LAVA 5J7BA 3OZ6A 2IW6A 5CT7A 1H25A 1R3CA 2ITUA 1OL6A 3CKWA 3LXLA 4FV3A 4ZIMA 5ACKA 2ZDUA 2PVHA 4F9BA 4QP7A 3OOGA 5LMAA 5T6KA 2QHMA 3REPA 1M7QA 5JFWA 4Q5EA 4QMOA 3V3VA 1GIJA 4ALUA 2NNWB 4F08A 3F2RA 3P7CA 2EXEA 3DTWA 2R3GA 2ZB0A 2UW8A 2G01A 4ANOA 1YWVA 2O65A 4LGDA 3MVLA 3SVVA 2J5FA 5J79A 4B0GA 3UQFA 4XHKB 4FV8A 5EHYA 3NR9A 4EOMA 2YIYA 3F5UA 3CSVA 3N4TA 3FLWA 3FL4A 1DI9A 2ETRA 2O0UA 3MH1A 4G3GA 5EH0A 4EOIA 4LL5A 1WBWA 5AA9A 5CU0A 4A9TA 4BI1A 1CM8A 3TV4A 4EQCA 1PYXA 4F4PA 3PPZA 4FKSA 2ZJWA 4ANBA 5M4FA 3NAYA 5AAEA 4FGRA 3L8XA 4XRJA 4IAZA 5AUTA 5I9WA 3LXPA 3U87A 1Y8GA 5ETAA 4FSRA 4J96A 4KSPA 5KMLA 4BKZA 4AZWA 2BAKA 4LOQA 2Q83A 3CS9A 4FNXA 4M12A 1PMUA 3UVPA 2VAGA 4ZSJA 1W98A 4L3PA 5M51A 3KCFA 4GG7A 4D28A 1Q99A 2VTLA 1W2FA 4GK4A 4ZLOA 3IO7A 3W33A 4IAKA 1UU3A 5E91A 4G16A 5GJDA 3W8LA 3BRBA 4O0XA 4AE9A 3FQEA 3LQ3A 4EH8A 2CSNA 4FSZA 3GCSA 4J52A 2Y7JA 3VW6A 2AYPA 4YU2A 2X6DA 3UG1A 1P4FA 4BDAA 4UMUA 4X2GA 5A4QA 5D7AA 3BIZA 4QDEA 3EQGA 3QHWA 5H8EA 2JBOA 4ACGA 5BX0A 4GRBA 4YURA 2W4KA 5HTIA 1OUKA 4H39A 1NXKA 3TMOA 4MXAA 3BHUA 3D83A 2ZFYA 4AOJA 5DPVA 4XBRA 4YHFA 5ANJA 4AN3A 4Q2AA 4TW9A 5CTPA 5JFSA 2QU6A 3FZTA 4TRLA 5KNJA 4RPVA 2CKPA 4V04A 3GU6A 3ZEWA 2YFXA 2IVSA 4QP1A 1NVRA 4JQEA 5BVDA 4BDKA 2WGJA 1PXIA 4QNAA 4UZHA 5AV4A 3QU0A 4GKIA 3GCQA 4JG8A 4YZMA 4GJ3A 4UMPA 5I0BA 5JK3A 3Q04A 3O51A 3W0SA 3KXGA 3NX8A 3OBGA 5IF1A 3TI1A 2GTMA 3GOKA 2E2BA 2FH9A 4PMMA 2ZV7A 5ETIA 3PSCA 5BVKA 2WQOA 4E6AA 3S4QA 3UYTA 2R3MA 3U4WA 3KMMA 2EVAA 2FVDA 2JIVA 3FMHA 5DEYA 1ND4A 3L8SA 4QMQA 4M66A 4EJ7A 4EH2A 3M1SA 2LGCA 2XS0A 3PVUA 1VJYA 1VZOA 2QO2A 4RZWA 2GSFA 2WQEA 3BGZA 3R21A 3SW7A 4MD8E 5AUVA 1Q8YA 2G2FA 4QPSA 4WSYA 2PU8A 4L3JA 2BHEA 3WE8A 4R7HA 3D5UA 4FZFB 3L9PA 3WZKA 5J9LA 3T9IA 3FBVA 4G5JA 2DUVA 4QQTA 3DBEA 3OWLA 2PE1A 4I0RA 4IDVA 4XG6A 3NDMA 3LLAA 5EM8A 3FC2A 1CSNA 2CDZA 3HMOA 5GIOE 3NW6A 1VLRA 3LCKA 3KREA 3C4CA 4GIHA 1QPEA 4GW8A 4AXCA 1RJBA 2DS1A 4HVHA 5HG9A 4RIWB 3PUFC 3B2TA 3F3WA 4KKHA 2OBJA 5I5ZA 5E8YA 4IB0A 2GHLA 2IZSA 4JBOA 5EI8A 4RX8A 4FVPA 3PY3A 4IAIA 4FKIA 5AEPA 5DRDA 4I4EA 2R3LA 4E5WA 4XV2A 3SV0A 3ZMMA 1B38A 3NEWA 4QMUA 3DDPA 5HIEA 4AWIA 4KB8A 3UTOA 3OTVA 4G3FA 4G6LA 4IZ7A 4YSJA 5C03A 5L6WL 3EFKA 2XA4A 2YM6A 4W8DA 3AOXA 1YDSE 3E64A 2B9FA 4BI0A 2KULA 3UOLA 5B2MA 3I6WA 3P86A 4IFGA 5C1QB 2UZLA 2XBJA 3FKOA 2W5AA 3R2BA 4QTAA 1ZZ2A 4RRVA 1E9HA 2ZB1A 4HGLA 1ZZLA 3WZDA 5J7HA 4OTIA 2CN5A 1OBGA 3VQHA 4BTKA 4HCTA 2PMOX 4AU8A 1YHSA 1XH6A 4JX7A 5C8MA 4FTLA 2EXMA 4QMTA 3OBJA 2X8IA 1Q3DA 4F0GA 5IA5A 2XBAA 3G2FA 5AWMA 1MRUA 3AD5A 3COMA 4L52A 2PTKA 3CJGA 5B2KA 4IVAA 2C4GA 4RC2A 5BNJA 2C3JA 5HBJA 4U80A 2YDKA 2ZM1A 3A7HA 3E5AA 2WMVA 3DBCA 4RJ4A 2WU7A 4O21A 4ACHA 4B6LA 4F6WA 5KMIA 3NS9A 1YKRA 4G31A 4EOQA 5BVNA 4Y46A 1VEBA 3ANRA 3MDYA 3W2SA 2WNTA 4C38A 4PMPA 4HVIA 3SLSA 3E8DA 3EQHA 2P4IA 1K2PA 4HYUA 1GZ8A 2GMXA 3BGQA 5HIBA 3W0RA 5C27A 2PSQA 3ZLWA 4JAIA 5EHLA 4D55A 2C6EA 2UZEA 3CTJA 4BTFA 4ZY6A 3PG3A 3AGMA 4U6RA 4AGDA 2E9VA 2OU7A 4AT4A 4RFYA 2CJMA 4W8EA 3AT2A 3VRYA 4WNKA 1OECA 4FEWA 2BAJA 3IW7A 4X6QC 4M69A 4V01A 5EOLA 5ANGA 4KNBA 4BCOA 4BDGA 4FKPA 3BYOA 1GAGA 4RZVA 2QONA 4JDIA 4GKHA 5E9EA 5AP2A 2V0DA 2OZOA 3GP0A 3NUYA 3NWWA 4FTRA 3LLTA 2I1MA 5DH3A 3K54A 4EOSA 5G1XA 5IMXA 2R3FA 3HUCA 3BU3A 1Z9XA 4I0SA 4O7NA 2Y0AA 1LEWA 1GZOA 4LRJA 2BR1A 4F99A 3AKKA 2W0JA 3DJ7A 2DYLA 3GNIB 3MVHA 4QYEA 2BROA 5A6NA 4R77A 4CG8A 5AUXA 2FSMX 1QPJA 4LM5A 1CTPE 4YJUA 4E4LA 3UNZA 3HNGA 4EOLA 4UX9A 3KN5A 4LYNA 2X2MA 4QQ5A 2F7EE 2XNBA 3FMKA 4QP6A 5IQCA 2FYSA 2YIXA 3NW5A 4XG8A 4CZYB 4GVAA 1W2DA 2WKMA 3A60A 4UEUA 4ERKA 4F7NA 3R83A 2C0TA 2UW4A 3FE3A 5HESA 3ACJA 3QWJA 4F1OA 2BKKA 1OGUA 3TXOA 3BU6A 2R3PA 4FV7A 4P90A 3G33A 3UZTA 3SC1A 4O82A 1WVXA 5CEKA 2XNNA 3BYVA 4BDDA 3EQDA 3KF4A 3KRXA 4KBKA 2WZJA 2XZSA 5GZ8A 3I4BA 3KRJA 3NYNA 2CGWA 3DOGA 4XP0A 4EC8A 4DLIA 4C4EA 4FKLA 4D5HA 4HPUE 3VC4A 3DQXA 4FTMA 2XIRA 3KMWA 2DWBA 3NNWA 1SZMA 3CIKA 2PMNX 2YACA 4JR7A 4E6CA 2R4BA 5HU9A 3PSDA 3D0EA 3E62A 4BHNA 2RFSA 1XMMA 2PUPA 4E3CA 5JGBA 1ZOGA 3EIDA 1DAYA 4J1RA 3PY0A 4YR8A 2W9FB 4I6LA 3NUAA 3BV3A 1AGWA 2QNJA 3BE2A 4P5QA 4CEGA 4E4MA 4F0FA 5IA4A 3K5VA 4NSTA 5HO6A 1TQIA 3MH0A 3WILA 3CLYA 4CFVA 4RIXB 3FKNA 4EQMA 2EXCX 4F9AA 4UB7A 1DM2A 4EK5A 3Q9YA 4W9WA 3LFQA 3TUBA 3O7LB 3TDVA 2C30A 3QQUA 4C35A 3POZA 2GQGA 5FDXA 5C9CA 3UMXA 4UXLA 1O6YA 4I21A 4AZTA 2VWWA 2OICA 3WZEA 4A9RA 3COIA 2I0VA 4FSWA 5CXHA 3V8WA 3SG9A 1BL6A 3E7VA 4J98A 3R9NA 4DH1A 5IEVA 2CNUA 3R8ZA 4OBOA 3FSKA 4U45A 4UALA 1YQJA 2UZWE 1P2AA 2XAOA 4FTQA 3ODZX 4XUFA 3FYKX 3QRKA 3PJ3A 4EK6A 5EKNA 5GHVA 3UO5A 2B4SB 4IFCA 4FA2A 4RIXA 5ITAA 3R8UA 2PWLA 2ZM3A 3ZUUA 4CCUA 1OIUA 4H1JA 4KIOA 3TJCA 3I79A 2J6MA 4ASEA 2GU8A 2Z7SA 2VTPA 3SX9A 3OEFX 2YM8A 3QGYA 4C4IA 2JDSA 2GNHA 3CP9A 4M14A 4TTHB 5HX8A 3A61A 4JBPA 4OTWA 4CFMA 2RG5A 4EZ5A 3V5WA 4ACCA 4ONAA 3PDTA 4O7TA 3NZ0A 2UW7A 3HDMA 4RC4A 5HE1A 5HX6A 3QTQA 4TYIA 4AE6A 2QOBA 3VS7A 5EW9A 3FAAA 3AC1A 4IX5A 5K3YA 3F5GA 4FSTA 4WG4A 3QA0A 4G3DA 3P0MA 2J50A 1PXJA 3UP2A 1JPAA 2YM3A 3ZYAA 3CTQA 3NMUF 4IX6A 3FMJA 3KF7A 4BBMA 4HW7A 1UWHA 3HMNA 4O38A 3UZRA 2HXQA 4WHZA 4XMOA 4FODA 2RIOA 4IVCA 5G6VA 1IAHA 3UC4A 2A19B 2C5OA 5HLPA 1VR2A 3IW5A 2FSOX 3RHKA 3PA3A 3HGKA 4J95A 4PPAA 3VS1A 5AFVA 3GFEA 3Q4ZA 5E90A 1PXOA 2GCDA 5C4LA 3DBDA 3W2QA 5CI6A 1SVGA 3MV5A 4A06A 3H4JA 4UMRA 2YDIA 5FEEA 5D1JA 5M56A 3E87A 3MTFA 4FC0A 3RALA 1G3NA 5IDPA 1PXPA 3F2NA 5H2UA 3V5PA 2J9MA 2E9NA 5IQGA 2J7TA 4RFMA 3FMEA 4RJ3A 3VHEA 3N9XA 4AW5A 3P4KA 3WBLA 3NNVA 1PHKA 1YXTA 1K3AA 4IB5A 1KWPA 2O3PA 3HDNA 4FSQA 5BYLA 4A9UA 4S31A 3TM0A 5IMEA 4ZJIA 2W05A 2XRUA 5AM6A 3UOJA 4EH7A 3QWKA 4L53A 3GCVA 1FPUA 4DFBA 2ZYBA 2R3IA 4DCAA 3L9MA 5A4TA 5C4KA 2RFEA 3C0GA 4MKCA 3ORIA 1QL6A 3DQWA 4C59A 4EOPA 4HGSA 5M4CA 4DT8A 2JEDA 1PRYA 4KRDA 1ZWSA 2C68A 3VBWA 2IG7A 3U6IA 2QD9A 4LMNA 5BYZA 4X3FA 2XK9A 1FGIA 5I3RA 5L2WA 2HENA 3BHHA 1PF8A 3F88A 1Q61A 3I1AA 1W7HA 4QP2A 5E8SA 3FPQA 5EK7A 4O96A 3JVRA 5HNIX 5LOHA 2AC3A 3JY9A 3F3TA 1T45A 3T3VA 2ERKA 4QQCA 2GS2A 4OTPA 5CU6A 4YC3A 1ERKA 3TV7A 1R0EA 4IAAA 4OR5A 3C51A 5JSMA 5BVOA 1KV1A 5AIKA 4XG4A 5D11A 1Q62A 5JT2A 3OOMA 4TY1A 4L46A 4ZMFA 5FDPA 4RMZA 1M7NA 2BCJA 3LAUA 3QCYA 5IUIA 3ZTXA 4A4XA 2H9VA 5AA8A 2PZYA 4EQUA 3H9OA 3FUPA 2WEVA 3UGCA 3ODYX 4AN9A 2XK6A 3TIZA 2YDJA 2YIQA 4EBWA 2JC6A 5CVHA 4JR3A 3QZIA 4CQGA 3PPKA 5JN2A 4ZZNA 4DBXA 5M09A 1W0XC 3MESA 2HZNA 4E73A 3RI1A 3U8WA 1UV5A 4N6ZA 2XNMA 4FKJA 1M2QA 2CNQA 4O4BB 3EZRA 2GNFA 3FXXA 2WMBA 1Y6AA 3R73A 5GNKA 4PQNA 4YMJA 3FY0A 1Z57A 4TWCA 4DHFA 4PNKA 3A7IA 1OVEA 4C4GA 4IE9A 3ZS5A 2XJ1A 4NKSA 3D2KA 4AA4A 3KXZA 2ZVAA 3DJ5A 5K5NA 5DGZA 4F09A 1ZXEA 2G9XA 4RA5A 4AZEA 2AC5A 5DI1A 5HCZA 4DEIA 5CAPA 2OWBA 4ACMA 5IQIA 1PJKA 3VUTA 5CF5A 4W4VA 3Q5IA 2W4OA 4GT4A 3RHXA 5KMKA 4BRXA 4O7WA 3GOPA 2WB8A 3OXZA 5KCVA 3TTIA 3K3JA 5EDPA 1UKIA 4ANQA 2PVYA 3DLSA 1E1VA 1STCE 3DNEA 1KE6A 4AGWA 3MJ1A 1OPLA 4QDVA 4FZ7A 5AADA 2NO3A 2BKZA 3THBA 5C8KA 4R3CA 4ARKA 3P9JA 4ZSEA 1J1CA 5EM5A 3TZ8A 3PP0A 3MIYA 3DB6A 2C6TA 2OGVA 4GU6A 4L42A 4MBJA 2VTTA 4C37A 4HJOA 2UZTA 1HCKA 2HK5A 4NT4A 4P5ZA 3P5KA 2PVLA 4GFMA 4XOZA 3H10A 3U6JA 4FZ6A 4EUTA 4QMWA 1CMKE 3RGFA 4CTBA 4QYFA 2EWAA 4LV7A 2IEWA 1JKLA 4J8MA 3FYJX 4WT6A 2WMTA 2IW8A 2WTJA 5DR9A 4ZTHA 4E5BA 3FSFA 1Y91A 3CQUA 2WPAA 2YERA 4BWXA 2RGPA 5HG7A 4K33A 2VTJA 3TZ7A 2VO3A 4KD1A 1OIRA 3BYMA 4WRGA 4XOYA 5ANOA 5DIAA 2XUUA 2B0QA 2G2HA 2JLDA 3ZO2A 4AG8A 3KGAA 4O0UA 3HZTA 4FTAA 4L68A 4O1OA 4O4CA 3RBWA 3HMIA 4PMTA 3RCDA 4X6RA 3RPYA 3EN9A 1OKYA 4DINA 5LVPA 5IH5A 5EDRA 5AX9A 2RF9A 2ITPA 4FKRA 5IPJA 2JDTA 4H3PA 4QYHA 3RAIA 1WBNA 3Q5ZA 4IWPA 3KXXA 3GQLA 3FY2A 4FV4A 5LVOA 2JAVA 3IECA 4DLJA 4U0IA 2BRMA 3IGGA 2CKOA 5ANIA 3I5NA 1YWNA 3KK8A 4GU9A 2XYNA 4ALWA 3GC8A 2QHNA 3UIXA 4ZTRA 5L8JA 4O2ZA 2ITZA 3R9OA 4WD5A 4FL3A 4UMQA 3LFNA 4OBPA 3TKUA 2PVJA 1MQBA 4ITIA 5L2QA 4A7CA 5AP1A 4FG7A 3LE6A 2QR8A 3ZSGA 5CXZA 4YC6A 3QUPA 3S3IA 2FGIA 3TUCA 2EB3A 5CAQA 2B53A 3RM6A 3BELA 1YOLA 3HV4A 4QYGA 1SVHA 4XNEA 4C3PA 4PNIA 4IX4A 4BCNA 1Q8WA 2VTSA 3OT8A 4IZAA 4EORA 5A54A 4NUSA 4B4LA 1JQHA 3VS0A 5J1WA 4FE2A 3IKAA 4P2KA 2X9EA 2IF8A 3QXOA 3SAYA 3WZJA 2QOQA 5IH4A 5AR7A 4CLIA 3RJCA 3MYGA 3EQFA 4JBVA 3UIBA 4AX8A 2IN6A 4CYJA 5JFXA 1GIIA 4LFIA 2XNOA 4IDTA 3R28A 4ZS0A 3IDBA 3LM5A 5J5SA 2F2UA 3FEGA 2XKEA 3AC8A 5J8IA 5J9ZA 3TNHA 2YIWA 4Y73A 3FZOA 2JIUA 4CKJA 4O4DA 2NYAA 4DG3E 3TDWA 3QRTA 4CZTA 2OJFE 3GU8A 4OAUC 4O0TA 4RA4A 3WF8A 4F9CA 2QODA 4PRJA 4YJVA 4R6VA 2YIRA 2J90A 3SDJA 4XLIA 3ZEPA 3UP7A 4OUCA 4Y83A 3QD3A 2ITNA 4CNHA 2GS6A 2W7XA 5K4JA 1A48A 2X7OA 5IQBA 2ONLA 3A7GA 3OT3A 3GVUA 3P08A 2GNGA 3W18A 5F4NA 1FBNA 4RC3A 4O6EA 2X2KA 4DFNA 3HRBA 4GT5A 4IWQA 2HWPA 1OM1A 4Q5HA 4AOTA 2FUMA 1OPJA 2GQRA 4C34A 4CFWA 4G6NA 5JZJA 4MWHA 4D2WA 3DZQA 3C50A 3SQQA 1Q97A 4FZAB 5CSWA 2HELA 5DE2A 5FEDA 1O9UA 3BHTA 4E1ZA 3C5IA 3QQKA 3DK6A 3TV6A 4AAYA 2OIQA 4ZTNA 1OZ1A 1ZYLA 3NIZA 4K8AA 4EZ3A 1YWRA 1UNHA 4KIKB 3HV5A 2XEYA 3QKKA 4TNDA 3ZLSA 1OITA 2W9ZB 2YWPA 2WQMA 3ZU7A 4B9DA 5M4UA 3VJNA 1SYKA 4MX9A 3EN5A 5BV3A 2Z2WA 3AMBA 1PYEA 4EYMA 3LIJA 5A3XA 3DBFA 2C6MA 1IASA 5IQEA 5EQEA 2I0YA 4U5JA 4O7VA 4AXDA 2IVVA 1KE7A 2QR7A 4BWKA 4X7QA 5DG5A 2C6DA 3QQLA 3QUDA 4N70A 4C4HA 5A46A 2YWVA 3OUKA 4IANA 4DH5A 2RL5A 3RPOA 2Y9QA 3A4OX 3PJCA 5HU3A 1M14A 4FK3A 4OTGA 3VS6A 1M2PA 2CHLA 3FC1X 3R7IA 4IMYA 5EYMA 5CF6A 1MP8A 3RZFA 4D4VA 5E8TA 4WNOA 3JR1A 3CBLA 1JVPP 4FL2A 4KIKA 2YCSA 3GXLA 4M97A 5JQ5A 2VX0A 5KMJA 1ZMUA 1ST0A 4HYSA 1KOAA 3PRIA 2BIYA 5TT7A 1FMKA 1L3RE 2ITOA 4LMUA 4U9AA 4XV1A 4XG2A 4APCA 5HOAA 3QQHA 3VBXA 1CKJA 1P4OA 2VX3A 3D5XA 3MIAA 4FNYA 2BZHB 5F1ZA 4ID7A 3B2WA 4PDOA 4GFGA 2FSTX 2PVFA 4ZSAA 4KKGA 2GQSA 4TXCA 2X8EA 4YO6A 4YZ9A 3IOKA 1H07A 4L7SA 5BVFA 4RQVA 5CI7A 2J0LA 5AMNA 3VS2A 5D9HA 2OIBA 3QTUA 4AFJA 3HECA 4HYHA 3D5WA 1H8FA 4IACA 3D7TB 4EWHA 1UA2A 5D41A 4TT7A 5JZNA 3RKBA 2X81A 3RPSA 3VUKA 1JAMA 4IJ9A 5DVRA 4MEDA 1DAWA 3ORXA 4E93A 3LFEA 5E8VA 2J0JA 4BCJA 2C0OA 3NYXA 4NKAA 2UW9A 4D58A 1OIQA 3CEKA 3E8EA 4DH3A 3IQ7A 4YJRA 5M55A 3CTHA 3FI2A 3ML1A 1R78A 4DC2A 2PK9A 3Q9XA 2WOTA 3R71A 3PPJA 5CT0A 4N4SA 4AZFA 4F78A 3WYXA 4ZZMA 4EI4A 5KO1A 2QOHA 2VGPA 3LZBA 2XNEA 5EQPA 4FK6A 3CXWA 4D2RA 4ZTMA 4B8MA 2PVKA 3NLBA 2OXDA 3P7BA 3C4XA 2IO6A 4JQ7A 4R1YA 5T68A 2PVMA 2WMAA 3NAXA 4FVRA 2WTVA 4QO9A 4CMTA 1TFFA 3G15A 4H3BA 3MTLA 1OI9A 4APPA 2QOIA 5L2SA 4C02A 1W82A 3C4EA 3LFAA 4GS6A 4PDSA 4Q9SA 3HV3A 4AGUA 5HBEA 4PTCA 5HD7A 4CG9A 4KS8A 2QVSE 3A8WA 4YZNA 4EBVA 2VTHA 3LMGA 5CX9A 3PTGA 4U81A 4AF3A 4CTCA 2UVXA 2W4JA 3MB7A 3JPVA 2BRBA 1XKKA 4QTBA 2P0CA 4FTJA 2OXYA 1W8CA 3AKLA 1KE5A 2CCHA 3IDPA 4BCMA 3W55A 2ONLC 3Q4TA 5K0KA 3VAPA 3KVWA 4ORKA 2BUJA 3U4UA 4DFLA 5L6OA 3PLAE 3VS3A 3MA6A 2R7BA 1LPUA 4LG4A 3BWFA 4I22A 5H8GA 5L6PA 3A7FA 4OTQA 3QAME 5A6OA 4O7ZA 4GCJA 3HEGA 4UXQA 4ZJJA 2QCSA 3VW8A 2WU6A 3NUNA 3RNYA 4ZP5A 3MY0A 3KXHA 5I3OA 4FTTA 3Q60A 4XP2A 1Y6BA 3WARA 2YM5A 2B52A 2GTNA 2O64A 4ZEGA 4NU1A 4NW6A 5AV3A 3SD0A 4I4FA 3IW8A 1FMOE 3AQVA 4G34A 4LDTA 4D0XA 1YI3A 3NNUA 3EN7A 3KXNA 1H1SA 5IA3A 4BWPA 2PPQA 3DGKA 2NP8A 4MXCA 4Y5QA 5AUZA 2PVRA 2VN9A 1SM2A 4AAAA 5DLSA 3VS4A 4B7TA 4DEGA 3IW4A 3VS5A 1Q4LA 3O8UA 3QCQA 4ZLYA 4JVGA 4XP3A 2F57A 5IEXA 2F9GA 1B6CB 2W1CA 2W5HA 4EC9A 4O7LA 1YHWA 3BKBA 4RIWA 4KA3A 3IGOA 1YOJA 4BDEA 5AP7A 4YNOA 2WTDA 3TKHA 3PA5A 3GC9A 4O0SA 3QF9A 3EL8A 1SMHA 2V7OA 4GG5A 3QX2A 5M44A 4JQ8A 5HE2A 3W0OA 2A27A 2RFDA 3RPRA 2CGUA 4BCKA 1S9JA 4PL3A 1QCFA 1G8AA 3R01A 4TYHB 3VF8A 2IVUA 1I09A 3OCTA 4CT1A 4QMNA 3FLSA 4WSQA 4CKIA 3JVSA 4C36A 4DEAA 3D2IA 3MN3A 1W2CA 2R5TA 2BPMA 5HKMA 4F1TA 1YW2A 5DNRA 3ALOA 3N51A 1GZNA 3HAVA 4BTJA 1MRVA 4FV5A 5J1VA 2GHMA 4DYMA 1WAKA 3P23A 5HHWA 4FV2A 4DG0E 4KIPA 3COKA 2IJMA 4L01A 5HQ0A 4IZ5A 4AW1A 2OLCA 4F65A 1OL7A 1IRKA 2WTIA 1XR1A 2YLFA 4MXZA 4ZOGA 3S0OA 4YJPA 4FV9A 1OKWA 3V51A 4GV1A 1YOMA 3R0TA 1WBPA 3EYGA 3R63A 1V1KA 4QP4A 4TYHA 4BL1A 4EYJA 4CGAA 2C1BA 4NFNA 3QUEA 3SKCA 1OBDA 2HAKA 3JUHA 4OW8A 4KINA 4IW0A 4FSNA 3O50A 2HIWA 2QOFA 3E8CA 3QYWA 2YABA 5DR2A 3ZC6A 3QCSA 2XKDA 4CV8A 4FV1A 3I0QA 3MSSA 3IS5A 1ZMWA 1UU9A 1XHAA 1JSVA 2P3GX 3AT3A 3QRIA 4NM7A 3PVWA 1E1XA 4CMOA 3MY1A 4L00A 4QPAA 3F5PA 2JAMA 1YXVA 3IPHA 3LQ8A 4DG2E 3R1NA 4M7IA 5FG8A 3UIMA 1PY5A 2ZV2A 3V8TA 4EZ7A 4L6QA 3AC4A 3NNXA 3QZFA 5DR6A 5FTQA 4ANNA 1NT2A 4V05A 2BRGA 3R7GA 4YHTA 4PUZA 2OJ9A 4D5KA 4QMLA 4C58A 3ORLA 3E8NA 4FZDB 5E1SA 4BGHA 5BMMA 5TKDA 2OKRA 1YDTE 4AQKA 4AA5A 3QKLA 4C2VA 3O5AA 3FV8A 3KY2A 3F3ZA 3F3VA 3NUSA 3DFCB 2JDVA 5CU4A 1J7UA 2XK8A 2FA2A 4ZTSA 4C4JA 3HAMA 3EKKA 4NEUA 4ZK5A 2VTQA 2CPKE 1PMNA 2A1AB 2P55A 3VIDA 5HNBA 2ZM4A 4AXAA 2ZMCA 4D0WA 4D2VA 4NJDA 1GIHA 4NCTC 1IA8A 3R9RA 1H1PA 2WMSA 4GIIA 4ZXTA 5DT0A 5J87A 4QP8A 4DFXE 2BRHA 2H8HA 2X0OA 3KULB 1QMZA 4R5SA 4WG3A 2A98A 3CKXA 4HYIA 4TPTA 5JRSA 2QOCA 2JFLA 4YBKA 2I0HA 3UO6A 1ZYS