4ZOGA

Vx-680/mk-0457 binds to human abl1 also in inactive dfg conformations.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
269
structure length
269
Chain Sequence
b'DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title VX-680/MK-0457 binds also to human ABL1 with inactive DFG conformations.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zogA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zogA01
4WNKA 5CI6A 4YTIA 5CF8A 1YXVA 4IX6A 4GU9A 3U55A 2QCSA 4AUAA 2VWIA 1BYGA 4JOAA 3MI9A 4JS8A 4FK6A 4MNEA 4O21A 1GIHA 4QMTA 4CFUA 3UNJA 3AC1A 5HBEA 2WTVA 4EC8A 1K3AA 3TUDA 3S0OA 4FTQA 4GEOA 4IDTA 3RNIA 3V5TA 5AA8A 2EXEA 2EWAA 5I4NA 3C4FA 1YXTA 3FKOA 5CQWA 2XNEA 5LMKC 3PRFA 5EW9A 4C62A 2GNHA 3HKOA 3QKKA 5AM6A 5FG8A 5HBHA 3C4XA 4CV9A 2X1NA 2C1AA 2XIXA 3VS6A 1LR4A 2BALA 3I6WA 4DHFA 2GFSA 3PE1A 4FV3A 2XP2A 3MPAA 2O63A 4MF1A 2W1HA 4XV9A 4BBFA 4FC0A 4QOXA 2XK3A 3DTCA 4BY9E 2QVSE 3DAJA 1PRYA 3MJ1A 3CQUA 2GHMA 2XEYA 4QYGA 4ERKA 2V7OA 3POOA 3QL8A 2CCIA 5C03A 3NUXA 1BX6A 3PP0A 4I41A 5GHVA 1IEPA 3WE4A 4C7TA 2WNTA 3NCZA 4FTJA 3CPBA 3G2FA 2B7AA 2GQGA 3A61A 2YFXA 3FMHA 4G31A 5HLWA 4HGEA 5JK3A 3H9OA 5HNIX 4JDJA 2GNIA 4KBAA 2Z7LA 5J9ZA 4UYNA 3JY0A 3L8PA 3EYGA 2ITQA 1REJA 2UW8A 1YQJA 2CSNA 4L45A 5EH0A 3SOAA 2BKKA 1WCCA 3QKMA 4LL0A 3UYSA 5EDRA 5FBNC 4C8BA 4CFVA 4E8AA 2X2LA 4GJ3A 4O2ZA 1KE5A 5LMKA 5FXRA 3EJ1A 5A6NA 4NWMA 2C3LA 3BGZA 2B4SB 5AMNA 5IQFA 5L2SA 5F95A 4M12A 1PKGA 3PXQA 1LUFA 4KB8A 3TZ8A 2C5YA 2X2MA 3HL7A 3JYAA 3T8OA 5ITAA 4RQKA 3MESA 4F09A 2PVMA 3ZO3A 4R5YA 4FI1A 2C3JA 3DJ5A 2H96A 3UODA 2X9FA 1XBCA 3D5VA 3IK3A 4O91A 4YJUA 3FMEA 4BVUA 3PIZA 4FEQA 1PKDA 3SD0A 5L3AA 2XIYA 5CU2A 1QPCA 3DFCB 3SAYA 4FX3A 2CGUA 4RRVA 3GC8A 4J98A 4EUTA 2OWBA 4BL1A 3WZJA 2HXLA 4L7SA 1JKSA 4I4EA 2I0YA 4FKJA 4S32A 3PY0A 4JR7A 4RZWA 5HGIA 1OUKA 4NL0A 1YHWA 3PIYA 4IDVA 5AAGA 4L3LA 3O23A 3SXRA 4QYYA 3VJNA 3TNIA 3C7QA 4BYJA 3LFAA 3F88A 4D2RA 2V62A 5TO8A 3C0HA 3DJ7A 5JQ8A 2WD1A 1GY3A 4LL5A 2R3JA 3HA6A 5ACKA 4EUUA 1UA2A 2OFVA 5HNGA 1EH4A 2R0IA 5CEPA 3GCUA 3OUKA 4Y5HA 3QQJA 3RHXA 3VBVA 3O71A 5EYMA 3R8VA 1NA7A 4J97A 5HO8A 4JQEA 2IVTA 5CEMA 5J1VA 5AUZA 4E6DA 3PJ3A 4GIHA 4YLKA 3FUPA 5AP7A 4BCGA 4KS8A 1IAJA 4WNMA 4Y73A 2LAVA 4XG9A 4XX9A 4C0TA 2YISA 4IACA 3RAHA 4DEIA 5M4CA 3OCTA 4HNFA 3R7OA 4BGGA 3ZUTA 5EDQA 4BCQA 5L2IA 1FMKA 3R8MA 4AXAA 3NYXA 3RWQA 3W2RA 3QUPA 4FSRA 5DFPA 3PVWA 3O50A 1JSVA 4D9UA 3C9WA 3CD8A 3Q9XA 5DR2A 5KMKA 2OJFE 5L8KA 3B2TA 5A4EA 4YC3A 3NSZA 4HVGA 4L3JA 2GDOA 5BVDA 3EB0A 3AOXA 5HCYA 4BKYA 2RF9A 4HVSA 4TWPA 2XK9A 4FV1A 4D5KA 4QPAA 3RBWA 3VS4A 5KUPA 1M17A 4CMUA 5EQEA 4Y46A 4ZY4A 4F65A 3RALA 4BTKA 4DLIA 1OBDA 2J51A 2XRUA 3VRZA 2NPQA 5I3OA 3QALE 4F0IA 1STCE 2X7OA 3R7YA 2BHHA 3F82A 4ANSA 3LQ3A 5J7BA 3FMDA 5EG3A 3CE3A 2F2CB 3E92A 1ZZLA 3DS6A 2ITYA 3VUIA 2A27A 2JKKA 2YIQA 3CY2A 4AZVA 5A4QA 2WHBA 4L42A 4I6FA 2FA2A 2Y4PA 2VV9A 3FSKA 4DH5A 1QL6A 2BPMA 5IZFA 3GBZA 4AT5A 5DOSA 2HOGA 3COIA 2WTCA 2XK6A 1U46A 2V55A 3UPXA 4DFYA 2RG6A 2XKEA 4FG9A 4O27B 4ALVA 2B9JA 4RIYB 4BDAA 1VJYA 4JI9A 4ZSJA 3U4UA 2EB3A 3IDCA 2YM5A 3ZLSA 2YLEA 5AIRA 3QZHA 4LMUA 3V01A 3Q6UA 3GB2A 3GU5A 4DT8A 1OUYA 1T45A 1DAYA 3R63A 3MVJA 3ROCA 1O9UA 2QO7A 3FYKX 3BBWA 3KVWA 4WG4A 4YZDA 5GNKA 4CG8A 3A7HA 2CN8A 3QC4A 2HIWA 3EFLA 4RIWB 4RVTA 3P1AA 1J3HA 2HENA 1SVGA 4NJ3A 3V6RA 2PZYA 4X2GA 3ZFMA 3EQIA 4RX9A 4CCUA 4JIAA 3E63A 3FL4A 4YUQA 2E9NA 3PVUA 4G5PA 3MIYA 5CEOA 3QGWA 3QQKA 3Q52A 4DH7A 3UMWA 1UU9A 3L8XA 3PXRA 4FT5A 4BIEA 4I5CA 5CSHA 4E20A 2ZV2A 2VWXA 4JT3A 4EK4A 1JSUA 2GNLA 4O0UA 2ITOA 4FIIA 4QP7A 2ZB0A 2QR7A 2JDOA 4GT5A 4ZJJA 5KHWA 4E3CA 3UJGA 1KE9A 4TYGA 5CTPA 1OL5A 1U4DA 3MA6A 4AWIA 4RJ5A 2HZNA 1OI9A 3QGYA 4W4YA 3UDBA 5FD2A 4GG5A 3PVGA 5HE0A 3TKIA 1R0PA 3I0OA 1PYXA 4QP1A 3H0ZA 4L01A 2JDTA 4IWDA 2X6DA 3LFFA 4IAKA 2JKOA 4J8NA 4UY9A 5IUHA 2BRMA 4ZSAA 5CANA 5J9LA 4GT3A 5DE2A 5C27A 4A4OA 4AW0A 3QA0A 2CMWA 4RIYA 3IO7A 3NNVA 4XS2A 5DR6A 4AG8A 3H3CA 4O0RA 3KY2A 4FZDB 4EZ5A 4FTLA 5GIPE 3C0GA 3CTQA 4D55A 4BIBA 5JMSA 4O82A 4L67A 2ESMA 4X3FA 3HUBA 3MY5A 5JN2A 4XBUA 3ZOSA 3ORXA 4BHNA 5IQCA 1PHKA 4E5BA 2NRUA 4IE9A 1YRPA 4IM3A 3ZLXA 3U9CA 4FKOA 5EM8A 1FBNA 5CSPA 3DB8A 2VO3A 2JKQA 4K8AA 5IUGA 1OPJA 2J50A 5AV0A 4G3FA 3DXQA 2OJGA 5J5SA 2PVJA 4DH3A 3AQVA 2JITA 3JS2A 2X8IA 4IANA 4D4SA 5AEPA 4XEYA 1AQ1A 4S34A 3VWAA 4ANLA 2VGOA 1TQIA 3FPMA 3HGKA 2QOFA 3HECA 1O6LA 2HELA 2YLFA 3R7UA 3LFCA 3E64A 2ITVA 5FXSA 4M0ZA 3DXNA 4KD1A 4FNWA 5DIAA 2ZV9A 1HOWA 2HAKA 3ZSGA 1M52A 2QURA 5AX3A 3V8SA 2Y7JA 4G5JA 4O1PA 2Q0NA 2GPHA 4YPSA 2J2IB 4JVGA 4NT4A 4AGDA 4G17A 3FI3A 1M2PA 2O64A 4EJNA 4IQ6A 3ZO1A 4R7BA 3POZA 1CTPE 2XF0A 4G6OA 4MK0A 2J0LA 2WQOA 4YLLA 1MRVA 5G1XA 4A4LA 1XH7A 2BHEA 2C68A 3B2WA 4MXXA 4NIFB 4AU8A 4BCFA 4EQMA 4H3PA 1Q61A 2GTNA 2VRXA 3OD6X 4D58A 5J95A 4APPA 3LAUA 1H28A 2VWBA 2WOTA 1PXLA 3P79A 3ZXTA 4BZNA 4R77A 2C6TA 3ZUVA 5E8XA 3HMOA 1XBAA 5EI2A 1GZKA 4B4LA 4DCEA 5JGBA 1WAKA 3COKA 3HAVA 2O5KA 1BL6A 3MTLA 4DFNA 2R3IA 4IWQA 3QAME 4LI5A 2WU7A 3ZZWA 4BCIA 4J95A 4F7LA 3LVPA 5B2KA 2XBAA 2QHNA 4ZS0A 1VR2A 2C6MA 5I9UA 4O0YA 4O7RA 3MFRA 3EFWA 4CQGA 4FT9A 4AZEA 2R9SA 2YDKA 3DOGA 4P90A 4PV0A 5KZIA 4BRXA 1ZYJA 5HD4A 1A06A 4J8MA 5EOLA 4AGUA 2FB8A 2OJJA 5L2WA 2YCFA 4FV5A 4JDKA 2WTKB 2IN6A 1ZRZA 3E87A 4WSQA 4O0SA 4CFMA 5L2QA 5EI8A 4BKJA 5AIKA 3SOCA 4U42A 5FBOA 4HCTA 2O3PA 2YAAA 4DTKA 5M08A 4GKIA 3V5WA 1Q97A 2RGPA 2HCKA 4EBWA 5DMZA 1URCA 5C9CA 1FOTA 3NS9A 1AD5A 5JZNA 3C1XA 5AADA 3QQLA 4DCAA 5FM2A 3FL5A 2FH9A 5C26A 3S4QA 2VTTA 2YIXA 5LMBA 5CS6A 3SG8A 4JG6A 4ANMA 3MH3A 4RT7A 5FLFA 4ZLYA 5AFVA 3CR0A 4FK3A 2WTKC 4F7JA 4BDJA 3MVMA 4I1ZA 3A7JA 5J1WA 5JQ5A 3LMIA 5H3QA 2ETKA 2WGJA 1PMUA 2UZBA 3D2IA 3H4JA 1PXOA 3BHHA 3L8VA 4FYNA 4QMPA 4XV1A 5HG9A 5CVFA 4QRCA 1Y6BA 4OT5A 5KCVA 2IZTA 2W1EA 4M68A 3U8WA 3NW7A 5CALA 3WF9A 3V5QA 1ZXEA 2OO8X 1HCLA 3QD4A 3R1YA 3OEFX 3RVGA 4AACA 2C5OA 2R3QA 2VX3A 4ZJIA 5JFXA 3IS5A 4MD8E 3DAKA 5KMMA 3GXLA 3ZEPA 3W55A 5HVYA 2CGXA 1YI6A 3F5XA 3KMMA 2YIYA 2P2HA 3R9DA 4BGHA 2R3PA 4YC6A 5M4FA 4K18A 3BLRA 1L3RE 4EOSA 3R28A 3BEAA 3CXWA 4E26A 2I7QA 1YOJA 4HGSA 4CT2A 4AW1A 2PMOX 4A06A 2P3GX 4AP7A 3BHTA 2V5QA 2XK4A 3P23A 3R01A 3UVQA 4FV2A 5KX8A 1ZARA 4AT3A 2NRYA 4NKSA 4CNHA 3DT1A 5TE0A 2BCJA 2PK9A 5ETAA 2C5VA 2QHMA 3PA4A 4U40A 4BBMA 4F0GA 1YKRA 3HV7A 3HA8A 2BKZA 4RWJA 4YR8A 2BILB 2W4OA 1NY3A 4RFMA 3PP1A 4F08A 2J7TA 3I5NA 1FPUA 3MV5A 5GZ9A 4HZRA 4AFJA 3QXPA 4ZZMA 4CLJA 5A4LA 5HX8A 5AV2A 3N51A 2JIVA 4IZYA 4BCNA 2UZUE 2YAKA 3MSSA 4IZ5A 4RJ4A 2PMIA 1YVJA 3O17A 5LOHA 2X39A 3CP9A 4FOCA 3HEGA 4ENXA 2VX0A 3H10A 2C5NA 3BLHA 3CBLA 3FI8A 1UKHA 3VW6A 4KKGA 4GYGA 3EQHA 3QF9A 4FKSA 4W9XA 5LARA 5B2LA 3LZBA 2F7XE 4FKPA 2VWWA 4MQ1A 3OT3A 1H00A 2O65A 3VF8A 2W0JA 2XS0A 3CD3A 1OB3A 5AUYA 1LEZA 4IH8A 1A48A 4AQCA 3NNXA 3GFWA 5CI7A 5G6VA 1Q3DA 3EN9A 3LFQA 3PJ2A 4GVJA 2RKUA 4RG0A 5EW3A 3BX5A 4ZJVA 4FEWA 4C57A 3OF0A 1YXSA 1IRKA 1U59A 4QQCA 5D1JA 5L6WL 5CU3A 3W1FA 1DI8A 4ZSLA 2YHVA 1FVRA 3R1NA 2GFCA 3EQPA 5AX9A 3GEQA 2VNWA 3BI6A 3EN4A 3TNPC 3COMA 4MAOA 1XO2B 3GFEA 3QUEA 5E8ZA 2YIRA 4TNBA 1XH8A 4A7CA 1UWJA 5HQ0A 4K0YA 2FUMA 3I7CA 2I1MA 3HRFA 2QLUA 2J0IA 3MPTA 3UYTA 5HCZA 4GV1A 2VN9A 1KOBA 4G6LA 4DGNA 3NVMB 1YW2A 2YACA 2JLDA 3LM0A 2B1PA 4ZY5A 3G6GA 1PMEA 2CN5A 3LM5A 3WZKA 3OOMA 1ZYDA 5HE1A 3ENMA 3TXOA 3DBDA 1IA8A 2NO3A 4ACDA 1OL1A 4KA3A 4V01A 3R1SA 3TDWA 3VVHA 2ZDUA 2W1FA 4XG2A 5AR7A 3RPYA 4WNOA 5I9YA 1QPDA 4FBXA 3U87A 3LIJA 2PYWA 4YJOA 3R30A 3HUCA 3QHWA 2IVVA 5DEWA 3PPJA 2PVRA 3BHVA 3E8EA 4BDDA 5HHWA 2FSOX 4YTCA 5BYLA 5KHXA 4FTKA 3PZHA 3QC9A 3AC2A 5HX6A 2PU8A 2JAMA 4GL9A 1FGKA 5LXMA 4BB4A 2XVDA 2OGVA 4UZHA 4CFWA 4CTBA 5JRQA 3II5A 2PUIA 1WVWA 2RL5A 3UG1A 3WF8A 3NNUA 2PTKA 3U6IA 4CD0A 5EM5A 2RG5A 4I0RA 2WMTA 4FIJA 1OIUA 4TRLA 4A9YA 2C6OA 3NX8A 1S9IA 2HY0A 4DEDA 3VN9A 3KRRA 1ZY5A 5E1EA 1H27A 1O6KA 5AP1A 5LVLA 1Z5MA 4MBIA 4XG8A 3A4PA 3CPCA 2Y8OA 4UMPA 1MQ4A 3DBEA 3L8SA 4QMNA 5ETCA 3H9RA 3NIZA 2VTSA 3HMIA 3BYVA 3RKBA 5JEBA 2W17A 1SM2A 2YITA 4ACHA 2PVYA 3AT2A 4ZLOA 2V7AA 4D4RA 4ITHA 3I79A 3QWKA 4C58A 4RMZA 2XKCA 3FI4A 3A8WA 3BRBA 3QWJA 2QNJA 1ZZ2A 4FTUA 4JX7A 5HU9A 2OI4X 5LVNA 2RFSA 3JVRA 3ODYX 2CKEA 5DPVA 3CTJA 4QQTA 3ZLWA 3OWJA 4BZOA 5ANGA 1H07A 4YPDA 2F49A 3DKCA 4B7TA 5KBQA 4DGGA 4EKKA 2R7IA 3FSFA 2QC6A 3PG1A 3QCSA 1OIRA 3VRYA 4ARKA 3LKMA 2GNJA 4AN3A 1DI9A 2Z7RA 2E9UA 4M67A 3A2CA 3HZTA 4TYHB 3QHRA 2I0VA 4IVCA 3W8QA 4E4MA 5CAOA 4XLVA 5DRDA 1ND4A 2OIQA 2E9PA 3VUGA 5FTGA 3ZO4A 1OBGA 3NLBA 4DITA 4LMNA 2UZLA 3AT3A 3FHRA 5CU0A 2A19B 4OTPA 2WQNA 4X2JA 5FGKA 3LQ8A 3R00A 3MB7A 2UW6A 3DBFA 4FT7A 4IVBA 4KIKB 4DH8A 4Q5EA 1VZOA 1ZOEA 4LQMA 5HO7A 1YDRE 4RWKA 4YMJA 4FSMA 2VTOA 3PTGA 2OXXA 3PXKA 3UQGA 3K2LA 3OW4A 5C4LA 1XQZA 2VTJA 4RC3A 2B52A 3KK8A 3ORZA 4XH6A 4Y72A 4C36A 4FKRA 4F9BA 3RINA 3SVVA 4W4VA 4CGAA 3PPZA 2OZOA 2JEDA 4QMUA 3TNHA 1RW8A 3NEWA 1W84A 4S2ZA 5CZIA 4KABA 4KNBA 3F2AA 4FYOA 2XM9A 4WD5A 3D83A 4ZTNA 2IZUA 1OKVA 4EH6A 2QOQA 4NUSA 5CAPA 4FIFA 4HVIA 5J5TA 4HYIA 3A60A 4TW9A 4H1JA 1KWPA 2EB2A 4ZOGA 2XJ0A 3MGYA 3UC3A 3FV8A 2WZJA 4DFZE 4TY1A 3FXWA 2ZV7A 4AOTA 5K5NA 3G51A 1H1SA 5HNBA 3EQBA 2OG8A 4M69B 3VBWA 3W8LA 4DH1A 5HVKA 4D4VA 4ASXA 5A14A 3AC8A 2QONA 4HGLA 4RA5A 2CLXA 3PDTA 4KIOA 4A9RA 3R73A 2FO0A 2GMXA 2XIZA 4IADA 4W4XA 2Z60A 3TUBA 3Q3BA 5EM7A 3QRJA 3O51A 3LXLA 4TYHA 3R21A 1T46A 3UZPA 1E9HA 4EOQA 3KXMA 2R3GA 4IFGA 3G5DA 3HMMA 3CKXA 4JAJA 3GC0A 3THBA 4QMXA 4L43A 3QRIA 3R6XA 3FJQE 3TV4A 3CC6A 5HZNA 4XMOA 1WMKA 3A99A 3Q4TA 1GIJA 2EXMA 3LCKA 2CLQA 5K5XA 2XNMA 3FE3A 1P4FA 4G9RA 4MKCA 4U0IA 1ZMUA 3W2OA 4GVAA 4YURA 5DT4A 4CTCA 5AP4A 4DEAA 3BBTB 4QT1A 5IG1A 1LPUA 3IW8A 4QTCA 4AZSA 2E2BA 3TKUA 4EH5A 4B99A 4FZ7A 4O0TA 4WNPA 4XG3A 2ITNA 3SG9A 4MXYA 3LXPA 2GSFA 3SV0A 3OZ6A 4RC4A 3F5UA 3DCVA 3L9LA 4WG5A 1W82A 1ZMVA 2VU3A 2E9OA 1NVRA 4PDPA 4CSVA 4DGLC 2R3KA 4UX9A 3ZUUA 3ZXZA 4Z7HA 2BZKB 4FL2A 3U54A 3VBXA 1Y8YA 3CKWA 1MUOA 4QNAA 3VBYA 3GCVA 3IPHA 4FTMA 2YDIA 4O0WA 4OBOA 3ZONA 5BPYA 1Y8GA 3OUNB 5K4IA 5FUTA 2REIA 2UZEA 5AAEA 3C4EA 4IXPA 4M69A 4JR3A 3QCXA 2P33A 3IECA 4DFLA 3OXZA 3CY3A 1GZNA 4E1ZA 1TKIA 3E3PA 4R1YA 4MBLA 4QTBA 1YXXA 3F3WA 3I5ZA 4N70A 5M56A 3L9NA 4HNIA 3TZMA 1Q8WA 4NFMA 3A8XA 3UIXA 2B54A 4BKZA 3PA3A 4FTCA 3MFTA 4CKJA 3LJ1A 3ODZX 4MWIA 3RP9A 1VEBA 4PL4A 3RPSA 3D5UA 4JQ8A 2ZYBA 3OEZA 4MXOA 3W32A 3DBQA 4HW7A 3Q9ZA 5E91A 2NNWB 1VYWA 1OM1A 1J7IA 4QTAA 3QFVA 1GZ8A 3ZCLA 1Q24A 4QMMA 4RC2A 4O2PA 2R4BA 2QOCA 3MN3A 3ANRA 3MVLA 4FOBA 3DQXA 1UNHA 3NYVA 3QU0A 1H0WA 4FV7A 4M14A 4Q2AA 4LG4A 4U9AA 2FGIA 3UNZA 2IZSA 5KMOA 3EN7A 3KB7A 4FTRA 4TYEA 4DAWA 4JJRA 4KBKA 4AW5A 4YHTA 3FLSA 5I0BA 5C8MA 2SRCA 3CJFA 1GZOA 2BZJA 3IW5A 5GIOE 2JDSA 4JIKA 3FZSA 3M2WA 4LYNA 1FMOE 3PA5A 4FTIA 1P5EA 1VYZA 2WTWA 3R7VA 4C59A 1AGWA 3RZBA 5K3YA 4PTEA 2ERKA 3ZBXA 3ZM4A 4YNOA 4FNZA 5IA3A 1E1XA 5T68A 3PLAE 1ZOGA 1JVPP 2F9GA 3C50A 2WIHA 1DAWA 3UP2A 3EFKA 3AD6A 4U81A 4DEHA 4C38A 2PVFA 3TKHA 2W06A 5IKWA 4DA5A 2PVLA 4I0SA 4RVMA 4YJTA 4I20A 4YJRA 1U54B 2C5XA 5D41A 2XK8A 4FL1A 1JPAA 3WZUA 3D5XA 3A4OX 4JAIA 1QMZA 4L8MA 3DKFA 5KO1A 4RLLA 3ANQA 4M15A 4YZ9A 2WPAA 4A9TA 1SMHA 2G2IA 2GU8A 4FKVA 4U44A 1PJKA 4ANBA 4ZZOA 1OPKA 3ZO2A 4FKQA 4QNYA 1WBTA 4Y8DA 4CMOA 4IB0A 4U8ZA 1Q5KA 3TIYA 1E1VA 1BKXA 3HV3A 1NXKA 5E8TA 3OFMA 4RJ6A 3VULA 5CZHA 3NIEA 2W96B 2YM6A 4R7HA 5AR2A 3TJDA 4IM0A 5AM7A 3OVVA 5E8SA 4ASZA 3F2NA 4FV4A 4F6WA 5IA4A 2ETRA 4XG7A 2XNGA 4EH8A 2BIYA 1TVOA 3EL7A 3D9VA 4R7IA 4U97A 1XJDA 3ZH8A 3P7AA 5E92A 5M09A 4LOQA 4AOIA 1REKA 5D10A 4OTIA 3P9JA 4EYJA 3SX9A 5A9UA 4E6QA 3Q6WA 3UZTA 5AR8A 2YWPA 4RIXA 2HWPA 4FGBA 4FIHA 3K3IA 4WO5A 4CKRA 5AV1A 3BV2A 3NVKI 3LLTA 3VUMA 2X4ZA 3VS7A 2A0CX 4FV9A 2VTMA 2XK7A 3BCEA 5HLPA 1LP4A 3D14A 4PDOA 3HMPA 4D1XA 1OKWA 1U54A 1V0BA 5IF1A 3R22A 3UTOA 1UV5A 5EOBA 5D12A 4BN1A 2YJSA 4EONA 3UQFA 4C35A 2OSCA 5ANJA 4UWYA 2Z02A 4CQEA 3HMNA 4PNIA 5HG7A 3D15A 4ZTHA 3SGCA 1XKKA 1OIYA 4J99A 3NR9A 5LWNA 4U7ZA 4X3FB 4ZTMA 3IONA 5HESA 4DTAA 3IGGA 2GQRA 5DR9A 4W8DA 4FE2A 5J9YA 3UVRA 3R8UA 2WELA 4GK3A 2YDJA 4EJ7A 5HG8A 4H1MA 2Q83A 4ZAUA 1PXJA 5BYYA 4UMQA 3FZRA 3EQDA 3QD2B 5ANKA 3CTHA 5CXZA 4A4XA 2HXQA 1UNLA 3KXGA 4EK6A 5CEKA 4QYEA 4ZTRA 4M8TA 4M84A 3C13A 5T3QA 4X3FC 5CEQA 4B8LA 5DLSA 4OTRA 5B0XA 3JY9A 3UZRA 4PX6A 2CKQA 3JVSA 5BVOA 3FMJA 1TQPA 4I23A 4I3ZA 5JT2A 4R8QA 4WBBB 1B38A 4H3QA 4P2KA 2G01A 3FLQA 5DGZA 4TL0A 2I6LA 3K5VA 4GS6A 3BYUA 4APCA 3GOKA 3C5IA 2AUHA 3QRKA 4I22A 2Z7QA 3V5JA 4IX3A 4P4CA 4XRLA 5GJFA 1SVHA 3BHUA 3UO6A 5HE3A 3K3JA 4DTBA 4QMVA 4O7LA 3LFBA 5EDPA 5E90A 2Y0AA 4JX3A 4XP3A 4FUXA 4N0SA 4P5QA 3LHJA 4E73A 5HEZA 2WMXA 3ET7A 4FKUA 3ZRMA 1MP8A 3PXYA 4ONAA 3W33A 4DYMA 3KU2A 5AUXA 4L9IA 3FLWA 1GNGA 2G9XA 3GOPA 3BWFA 4AZFA 3D94A 2BDFA 4ZMFA 4BCKA 4O7TA 4CG9A 3FMNA 5FEEA 1KOAA 3G0FA 2C6IA 4AZTA 3DA6A 3F5GA 4MD9E 4U45A 3HRBA 4PMSA 3GU6A 4IWOA 3DKGA 3EFJA 3F5PA 3FKNA 3W2PA 5LCJA 4Z16A 2G2HA 1YWRA 2ITTA 3DPKA 5B2MA 1Y91A 5LMAA 4GCJA 5HU3A 5HKMA 3ORNA 4E6CA 2IVUA 3PJ8A 2O2UA 3PXZA 2VNYA 4WBOA 3MWUA 4CYJA 4IZ7A 4C3FA 2YA9A 3O7LD 5EYKA 4FVQA 4ZY6A 4X6QC 5FRIA 5C8KA 3PSCA 5A4CA 5EHLA 4D2VA 3LCSA 4NM5A 5DI1A 3RAIA 1OKZA 2XRWA 1M2QA 2PZRA 4PTGA 4CFNA 3MW1A 3QXOA 5A54A 4XOYA 2UZWE 5CAVA 4EOPA 4WUAA 5IDNA 1JKTA 2W1IA 2ZAZA 5CENA 4NTTA 4K11A 1JOWB 3CJGA 4NTSA 4IX4A 3TIZA 4ZSEA 4H39A 2X9EA 4MXAA 5AV3A 4IEBA 5H9BA 3KRXA 2F7EE 2OF4A 3SLSA 1OMWA 2AC3A 3KXXA 2W5AA 4D28A 4X2KA 5EK7A 5I3RA 4RVLA 4F6UA 3O8UA 3RMFA 2I0EA 5ANIA 4Z3VA 1QPJA 2OK1A 1JLUE 2G2FA 4NM0A 3OS3A 4AOJA 1OECA 4K6ZA 3PWDA 2YABA 4FZFB 4BI2A 1Q4LA 4NFNA 4BWXA 3LXKA 1JKLA 2X0GA 4MWHA 4BDIA 1KUTA 2EVAA 3DXPA 3SKCA 2P0CA 1WBWA 1Z57A 2XB7A 3ZTXA 2W1DA 2QI8A 2ZM4A 4XV2A 3Q4UA 5C01A 1UNGA 3KRJA 3ATTA 4BTFA 5KMLA 4NEUA 5FTQA 3QCYA 3IGOA 1M14A 3O0GA 2C6EA 2WU6A 1Q8YA 4FTAA 1PXPA 5IA2A 1RDQE 4J53A 1NVQA 3G0EA 3EN6A 4D2PA 3AG9A 5EHOA 3VBQA 3MVHA 3R8ZA 5CEIA 3TG1A 3V51A 5BQ0A 3RPVA 3CSVA 4ASDA 3IW6A 3UO5A 4UEUA 3TNWA 3V04A 3SDJA 3OCGA 4B0GA 1RJBA 2Y9QA 4F9WA 5DN3A 2PMNX 1BUHA 4OGRA 1OZ1A 3FWQA 3DNDA 3PY3A 4BDBA 2HZ4A 2R3HA 2R3FA 3Q2MA 3ZSHA 4EH7A 2WQMA 4USDA 5E8VA 4AGWA 3R1QA 3UP7A 5M07A 4A9SA 4IJ9A 3PXFA 3OXTA 5E1SA 3UVPA 4PNKA 3DLZA 2PWLA 3KMWA 3R2YA 3FQSA 2PE0A 1H01A 1MRYA 4I94A 3JUHA 4O7SA 2XIRA 2PMLX 3I6UA 4W4WA 1YI4A 4OAUC 1UKIA 2YCQA 3CIKA 5HI2A 1NW1A 3R8PA 3O7LB 3ZU7A 2QKRA 4KRCA 4QP4A 1KE8A 2W05A 1JKKA 4LGHA 2O0UA 5GJGA 4MXCA 4AZWA 4NW5A 3QQFA 3ZYAA 3T3VA 3ORKA 4OTWA 5CNOA 4NM3A 4F64A 3WYXA 4AN2A 4O7NA 2QOOA 4U43A 2C6LA 4J52A 4AS0A 4F9CA 5IQAA 1H8FA 1Q99A 4NW6A 3F66A 4FVRA 3K54A 2RFDA 4C4IA 4FNXA 4RX7A 3QRUA 3GP0A 1P14A 2UZVA 3TV7A 4HZSA 2ZVAA 2G15A 2VUWA 4LFIA 4EBVA 3SW7A 3OMVA 3ZDIA 3BHYA 1R78A 2Z8CA 5D7AA 3QX4A 2VTPA 3FZOA 4DGMA 3ZDUA 4DINA 3UBDA 4YO4A 2XMYA 3GU4A 5C1QB 3CGOA 2BAJA 4LRKA 3ITZA 2GNFA 4TXCA 3C51A 4L46A 4BBEA 2HZIA 3UPZA 1J7LA 3TDVA 3P4KA 4B9DA 4ZIMA 2VTNA 3FLYA 4G3GA 3QA8A 4LGDA 3GUBA 4LV5A 3PPKA 3HVCA 4G2FA 2FYSA 3R7GA 4FKTA 5D9HA 5I9WA 3PFQA 4IB5A 1XH9A 5CASA 5DG5A 4FL3A 4RJ8A 1H4LA 4IAFA 5HBJA 4FR4A 4CFFA 3E88A 5IA0A 2XUUA 4M3QA 4EH3A 5AJQA 3QZFA 1CSNA 1J1CA 4FTNA 1JNKA 4QP9A 5EHYA 4WT6A 3RK5A 2OW3A 3A7GA 4MBJA 4PPCA 3S3IA 4BICA 2QU6A 3F3ZA 3QLFA 4RFYA 5E4HA 2BR1A 3FMLA 3R02A 4WSYA 3SC1A 4BDCA 3EQGA 2OXDA 3MH1A 4O84A 1APME 3KFAA 3NUPA 4PMMA 1PXIA 1V1KA 3NUNA 5CYIA 1G5SA 3MA3A 4EL9A 2CNVA 5BYZA 1PXNA 3KK9A 5IQDA 5IQEA 1PF8A 2J90A 1GIIA 4JBVA 2B9FA 4FODA 3MIAA 3U51A 4PTCA 2W4JA 5M44A 4S31A 4GK2A 2HWOA 3MB6A 3NW6A 4LGGA 5A46A 4AF3A 1XH5A 4O6LA 5CSWA 2QG7A 3VW8A 3ELJA 2UUEA 3RAWA 4DFXE 4PP9A 3L9MA 4FSYA 4I93A 5TT7A 2BIKB 2AC5A 2UZDA 4EH4A 1OL6A 1UU8A 1WBPA 2BMCA 2QOLA 4IC7A 5L6OA 3LMGA 4KWPA 4G34A 1ZWSA 4IB1A 5EQYA 1OL2A 2IVSA 5IQIA 2EUFB 1JBPE 3PUPA 2ITUA 2B0QA 4BWKA 4USFA 3NNWA 5A3XA 2R5TA 5CVHA 2BFYA 3SRVA 1B6CB 4EQUA 3F6XA 3D0EA 4DE4A 2IZRA 2XKDA 1YXUA 2JBPA 3PE2A 4I21A 1OITA 5KNJA 3VUDA 2GCDA 3LW0A 4OR5A 4B6LA 4FKGA 3A7FA 2VTHA 3EL8A 4KIQA 4L68A 4X2FA 5F94A 3DGKA 3SXSA 5IISA 4EHEA 3UGCA 3Q04A 3QTUA 3TTJA 5BVFA 1BI7A 1YOMA 2VWZA 4D2SA 1FQ1B 5IEYA 3NAYA 5CNNA 5HE2A 3KC3A 5M4UA 4FSUA 2EXCX 2VZ6A 4FKLA 3ORPA 5E8YA 4DF3A 3KCKA 4AA5A 3LFEA 4DFBA 4DC2A 3F7WA 4G9CA 4OTGA 4Y83A 3REPA 4C4EA 1WBNA 3VO3A 4MTAA 4ALWA 3W2QA 1U5QA 4FIGA 4DFUA 5EFQA 2IJMA 1YHVA 4E6AA 4EOLA 2R3LA 2WQEA 2NP8A 3EYHA 2P2IA 3HDMA 4J1RA 2I0HA 1W0XC 4Y5QA 1OPLA 3D4QA 3GNIB 4FV8A 4MH7A 4F9AA 3DZQA 3BQCA 4DBXA 2Y6OA 2YERA 5JFVA 3VS2A 3AD4A 4WRSA 3I1AA 3WBLA 5M06A 3LCDA 3KL8A 4X6RA 4ZEGA 3UOHA 5CT7A 4IVAA 2H34A 4G16A 4C4FA 3F69A 1KE6A 3BLQA 3QQHA 4NU1A 5CX9A 4E5WA 5KBRA 2W7XA 4CVAA 3AMAA 3CLYA 4GG7A 3LJ0A 3H0YA 3W2CA 3OG7A 3RGFA 4EWQA 4BDEA 3RK9A 5BUJA 4UV0A 5LVPA 5HO6A 1WBOA 3Q9YA 2OICA 4M7IA 5HVJA 5JH6A 1SNUA 2GS6A 3L9PA 4EHVA 3ACKA 4M66A 3I60A 2W1GA 4FMQA 3P7CA 2JDRA 3UIMA 4G3CA 4HVDA 2X8DA 3DBCA 3TCPA 4JRNA 5HIDA 1SNXA 4MYGA 3R7EA 4F7SA 2YZLA 4UB7A 2VWVA 1Z9XA 5DBXA 2ETMA 2OKRA 3EKKA 3QTXA 4DN5A 2C30A 3Q5IA 4EOOA 3O8TA 4OLIA 2WFYA 1XHAA 3U6JA 3LLAA 1ZOHA 3BYOA 2WMSA 3VC4A 3LFDA 2ZV8A 5F9EA 3QYWA 3LFNA 4AFEA 3ZEWA 4IFCA 1CM8A 3WZEA 4HYSA 4X3JA 4U6RA 4NCTA 4KAOA 4CCBA 4UWCA 4IB3A 1UWHA 1ZY4A 3L1SA 4EH2A 5K0XA 3TM0A 5LVOA 4PPAA 2WEVA 2CDZA 1S9JA 4V05A 5FEQA 4BR3A 3N4VA 5JFSA 4R5SA 3E5AA 3QTRA 4MF0A 4YO6A 4PMPA 5EQPA 2BRNA 2BAQA 4AAAA 4II5A 5AWMA 3TI1A 5DYJA 1YOLA 3HX4A 3D2KA 3T9TA 4EK8A 1Q3WA 2OIDA 4GKHA 3QTZA 1SYKA 4ACMA 4YBJA 2EU9A 2R3RA 2CKOA 4ITIA 5FP6A 5KMNA 4QMOA 2CJMA 3GU8A 2Q0BA 3MY1A 1OL7A 2UVYA 4RWIA 1OKYA 3NW5A 4J71A 1LEWA 3GI3A 3MS9A 4I24A 4K33A 4QTEA 5M53A 4UBAA 4L53A 2JD5A 5DWRA 1YI3A 2JIUA 4YJPA 1KE7A 4Q5HA 4EOIA 4O7VA 4JRVA 4D2WA 5LJJA 4BYIA 4EC9A 2WMUA 4WKQA 3UO4A 3ATSA 4C4GA 3WILA 5HG5A 4KIPA 4XP0A 3LOKA 1TQMA 5IPJA 4NYEA 3MH2A 3QKLA 4QP3A 3LMHA 4MD7E 3ETAA 3PG3A 3ZM9A 3S1HA 4R78A 1I09A 3NUAA 4BIDA 3RAKA 3QZIA 4G6NA 3RNYA 4FGRA 5GINE 4A9UA 3ROYA 4CKIA 4KUJA 3ALNA 5AUTA 5BVNA 4TKSA 3IDBA 3JXWA 3HNGA 4OTHA 4IAZA 5DA3A 3EKNA 1GJOA 4FEVA 3OTUA 3DK3A 4RX8A 3R9NA 4BCJA 3DQWA 2C3KA 5CT0A 4PP7A 1PW2A 3TNQB 1J91A 5JGAA 1K9AA 1NVSA 2PPQA 1IG1A 4WIHA 2X7FA 3KCFA 4FNYA 3WYYA 2UW4A 3V5LA 3Q2JA 3FC1X 1IA9A 5K0KA 4QPMA 5F20A 5IH4A 3E62A 3KULA 4YZBA 3PIXA 5KZ0A 3LQ5A 3DU8A 5HTIA 2IPXA 4YZMA 5FEDA 3KXZA 3SXFA 3KMUA 4FKWA 4LUDA 5CY3A 2X4FA 3E8CA 3GC9A 5H8EA 5HIBA 3VBTA 3K5UA 2KTYA 3MYGA 4JXFA 5AAFA 5HD7A 4OTDA 3T9IA 2C0TA 3SA0A 4XRJA 2JBOA 1ZLTA 3LFSA 3ZS5A 2UZNA 4XP2A 1QCFA 2FSLX 3S00A 2A4LA 5J87A 3M11A 3E7VA 3ACJA 5ETFA 3QTWA 4HOKA 2G1TA 3U9NA 1H26A 4JBOA 2QR8A 4H58A 4PPBA 5M4IA 3G33A 3FI2A 2HW7A 3Q4CA 4HCVA 4TPTA 4BWPA 5IMEA 3GU7A 4DGOA 3FDNA 2VGPA 3OWKA 1UU7A 2B55A 2BAKA 2OZAB 2VD5A 3TZ9A 4GU6A 5AP3A 5CLPA 3R9RA 2IO6A 2J0JA 5CF5A 4LOPA 2BZHB 2QD9A 4RJ7A 4M13A 4F0FA 2HYYA 1M2RA 3A7IA 3QD3A 4IMYA 5JRSA 5AUUA 1G8AA 5EKNA 3BGPA 3RHKA 3WI6A 3LPBA 2C6KA 3IOKA 4FEXA 1KV2A 2YEXA 2VWYA 4I5MA 4FT0A 4EEVA 5IUIA 2JDVA 4FZ6A 4HCUA 2OH0E 4IVDA 5M55A 3VQHA 4F99A 3H9FA 2C6DA 3ORIA 4IWPA 2GNGA 1JQHA 2ZM1A 2CCHA 2KULA 2PVNA 1JSTA 1URWA 4FSZA 4V04A 5A6OA 5C4KA 2WTIA 2WXVA 4FT3A 3UIBA 4C61A 3AMBA 1M7NA 3IKAA 4RIXB 4TWNA 3OY3A 3TTIA 2UZOA 3VUHA 2ZM3A 2ERZE 2IW9A 5F1ZA 2H6DA 3F7ZA 3W2SA 3KXHA 2OBJA 3FZTA 4XOZA 3W16A 2J6MA 2QKWB 2GS7A 5TOZA 4FSWA 4J7BA 4GIIA 4EQCA 5CSXA 2Z2WA 3PVBA 4F1TA 4GYIA 4BTMA 3R04A 4S30A 2JC6A 3AC5A 3IQ7A 5IU2A 1P2AA 3R9HA 3KN5A 5KE0A 3NUUA 2BRHA 4EOMA 3BQRA 2R2PA 3P08A 1H08A 2HZ0A 5L8LA 5K9IA 1YDTE 4IAIA 4WA9A 4LUEA 3UE4A 2GHGA 4ERWA 2XCKA 3SQQA 2OZAA 2XIKA 3OWPA 3WZDA 1G8SA 3TZ7A 4WHZA 2PUUA 3RPOA 4ZZNA 3BPRA 3R8LA 4FG8A 2XYUA 4GK4A 5BUEA 2ZOQA 1J7UA 3UOKA 2UVXA 5IH6A 3QX2A 4KRDA 4CYIA 5HTCA 3FY2A 4M97A 4D0WA 4TT7A 4OAVB 4N57A 4U3ZA 2WIPA 4ZTQA 3FKLA 4IJPA 1OVEA 4GUEA 4IIRA 4KSPA 4CRSA 4OBQA 3N4TA 2V0DA 4FICA 5BMSA 1F5QA 2ITXA 3NGAA 5H8BA 3MBLA 4R3RA 4AX8A 4S33A 4K2RA 1U5RA 3DFAA 3Q60A 1X8BA 3BE2A 4YSMA 3V3VA 3P7BA 4BDFA 2PE2A 4MVFA 3DAEA 4F7NA 4D0XA 4X0MA 4FSTA 3FMKA 5AR4A 5J8IA 4QP2A 3VS0A 2I40A 1PXMA 4O0XA 4DEGA 4O81A 4OTFA 5IH5A 4ENYA 2VWUA 5HORA 3BZ3A 2X81A 1H1QA 1HCKA 1WVYA 3LXNA 4CZYB 5BUIA 2BTSA 1F0QA 4F63A 1GOLA 3EZRA 4N6ZA 3DLSA 4ZTLA 1MQBA 2JGZA 4TYJA 4F4PA 4D1SA 3Q32A 2X2KA 4D1ZA 3UMXA 4PY1A 4BHZA 1CMKE 4LM5A 2XH5A 4RVKA 3VS3A 4JBQA 4MNFA 1V0OA 1ZYLA 3OBJA 2QO2A 2XJ2A 3ULZA 4O22A 4JDHA 4D5HA 2UW3A 5FQDC 4NK9A 1BMKA 4RA4A 5J79A 5L2TA 3FXZA 3GGFA 5KMJA 1OIQA 4GFOA 4W8EA 3E7OA 4QTDA 1WVXA 3V6SA 4BCPA 1PY5A 3C4ZA 2BROA 1BLXA 3V8TA 4YNEA 5TR6A 4CFXA 1W98A 5CU6A 2X6EA 3QTIA 5FWKK 4F1MA 2R3NA 4PDSA 5E8WA 3MFSA 3RM6A 5C8NA 1Q8UA 5D11A 4FUYA 4TNDA 4ZLZA 4YJQA 4C4HA 3RCDA 4E4XA 4BCOA 2JAVA 3EIDA 3KRLA 3D5WA 4HYUA 1O6YA 3R71A 1L8TA 2QODA 2LGCA 3NYOA 4O96A 4A07A 4CT1A 4E7WA 4Q9SA 3ZLYA 1NT2A 2PZPA 2UW5A 4FZAB 4K77A 4I6QA 3I0QA 3HV5A 4NH1A 5DRBA 5EM6A 4USEA 2QU5A 4FEUA 5D7VA 4KKHA 4G1WA 5CU4A 3G6HA 4ZSGA 4U80A 5L8JA 4X2NA 1G3NA 3RM7A 3P0MA 4BZDA 3DTWA 3IW7A 2OU7A 4FF8A 4YHJA 4EHGA 3FPQA 1KV1A 2XJ1A 4JG7A 2DQ7X 4OTQA 4WG3A 4Y85A 4D9TA 3FMMA 5EYDA 2CGVA 4YTFA 2IW8A 4BF2A 3HP2A 4BC6A 2VO0A 3NDMA 4HVHA 3CEKA 3TT0A 4EHZA 4GH2A 5DT3A 4QD6A 3PJ1A 5H8GA 2OLCA 5IA1A 3BIZA 3P78A 1K2PA 1XR1A 4E93A 4TZRA 3BU3A 1ZYCA 2BRBA 3TEIA 2PULA 4GFGA 4R1VA 2JFLA 2XNBA 3QTQA 3D7TB 4ACCA 5ACBC 5AV4A 2J5EA 5DVRA 5FDXA 3TWJA 4RQVA 2JKMA 3QLGA 4XJ0A 5CQUA 5AP2A 3C4WA 4YP8A 3FC2A 1PXKA 3G90X 3MY0A 2WMRA 3R2BA 4O0VA 4RJ3A 3GT8A 3CGFA 2O8YA 5M51A 2AYPA 4CLIA 5CAQA 2HW6A 4GRBA 2C1BA 3ORLA 4OUCA 2WEIA 3E8NA 3I7BA 4PWNA 4UWBA 5DEYA 3NMUF 4EORA 4QMQA 4FA2A 3QCQA 4XG4A 5IQGA 2WMBA 2XKFA 4C37A 3ERKA 3GVUA 4YLJA 1Y6AA 1R3CA 4JDIA 4C2VA 4EOKA 2OF2A 4Q9ZA 2DWBA 2UV2A 4PDYA 4ZTSA 4NSTA 4C33A 3NYNA 2QG5A 2WMWA 5GJDA 5I9XA 2FVDA 3VHKA 2XNOA 4RIWA 3RK7A 5KMIA 5AP6A 1R39A 3GC7A 4JNWA 4XNEA 4DBNA 4PRJA 3TJCA 5BX0A 4K1BA 3S2PA 4GMYA 4H36A 3RZFA 3V8WA 2R0UA 5LWMA 4G3EA 1RE8A 1WBVA 3OW3A 4L44A 3WIKA 4R6VA 3OT8A 4ZP5A 3QQUA 3IDPA 3OROA 5JZJA 4C02A 3DJ6A 2XEZA 4FTTA 3ZSIA 4ANNA 2HK5A 3OC1A 3D7TA 4FSQA 2BUJA 2VTAA 2QOBA 2VTIA 2X7GA 4FTOA 4AA0A 3MH0A 4C3PA 3RPRA 3BWJA 3ZZEA 1XH6A 4O86A 4YU2A 1PMNA 2P4IA 4L7FA 4UMTA 5AR5A 4DG2E 5CF6A 2ITWA 2QOHA 2CGWA 2PSQA 3QZGA 4LRJA 5EI6A 3DV3A 3SW4A 3VQUA 5F4NA 2BZIB 3QQGA 4NZWB 1DS5A 4DEBA 5FXQA 5EYCA 4B8MA 4H3BA 3BELA 2YCRA 2OJ9A 3IOPA 3E8DA 3HYHA 3BV3A 3VF9A 4EH9A 4Z55A 4J96A 5LCKA 3KF7A 5BNJA 4O7WA 3JPVA 4EK3A 4Z7GA 4QMYA 4O83A 5CF4A 2WTDA 4MX9A 4BI0A 3UG2A 2QO9A 3G9LX 3OCBA 4FVPA 1BL7A 1MRUA 4IC8A 4ITJA 3VUTA 3NCGA 3BGQA 4IM2A 2C3IB 4N4SA 2ZMDA 3DK7A 4WRGA 3VNTA 4F9YA 5J7HA 3F61A 3EMGA 2XZSA 5JSMA 1I44A 3GCPA 3NZ0A 2BFXA 2GHLA 4YTHA 4F1OA 5IQBA 5JGDA 3QYZA 4BDHA 4EWHA 4PL5A 1M7QA 2CKPA 3RCJA 4Y95A 3AGLA 4R3PA 5IA5A 2JIIA 2PUNA 2YM8A 4O1OA 4XUFA 4AGCA 3P5KA 4UALA 4I4FA 3MPMA 5AUWA 2J5FA 3C0IA 4YJVA 2QOKA 3N9XA 4TTHB 1Q62A 2PHKA 4BGQA 3VAPA 1CKPA 2VO6A 2W9ZB 3OP5A 4AE9A 4MQ2A 1FGIA 4XG6A 1YDSE 3NPCA 3BU6A 2H9VA 5L6PA 4QMSA 2VO7A 2ZJWA 3BYMA 3FAAA 2OH4A 3Q53A 3B8RA 3ENHA 3IG7A 4GW8A 4IZAA 4NIFA 2ITZA 2XNNA 4CZUA 4LV8A 4U3YA 1FVTA 4ANQA 4PL3A 5LVMA 2UVZA 4GUBA 4ALUA 2VTQA 4X21A 2C4GA 4H05A 3NRMA 2J0KA 3RTPA 3VS5A 1ZMWA 2R7BA 3EHAA 2R3OA 4AT4A 1JWHA 3I81A 2BDWA 2Y4IB 3I4BA 4RBLA 3S95A 4BCMA 3GCQA 4YHFA 3ZC5A 4DLJA 2YWVA 3DDPA 5HIEA 3C5UA 2PUPA 4ZK5A 3AGMA 4YJSA 3TN8A 3JR1A 2ZDTA 3NAXA 2FSMX 3N4UA 4TWCA 2YJRA 3VS1A 2B9HA 1H1WA 3KGAA 4DG0E 2C0IA 5ICPA 3VJOA 2E9VA 1UVRA 4C2WA 4RFZA 1ZYSA 3KKVA 3WF6A 4DT9A 3MTFA 1ERKA 4IAAA 2DYLA 1Y57A 5FTOA 3ZRLA 3EN5A 3SRVB 1H24A 4RX5A 4IBMA 1YWNA 4QO9A 2Y4IC 3O96A 2ZB1A 3PSBA 1W7HA 4RZVA 3UOLA 4CXAA 4HJOA 4NJDA 2VTLA 4TN6A 4U5JA 3OY1A 3IW4A 4EZ7A 4KS7A 3DZOA 2WQBA 5DHJA 4BTJA 1IR3A 2W5HA 4JBPA 5T6KA 3KVXA 4U79A 2XBJA 4L3PA 3OBGA 4O38A 4FG7A 5I5ZA 3WF7A 2JFMA 4O6EA 4QMZA 3T3UA 3EWHA 4UMRA 4L52A 5IDPA 4L6QA 4F70A 3BEGA 1YWVA 2QLQA 4XCUA 4PUZA 2WTJA 3AC3A 2Y6MA 4EYMA 3TUCA 2RSVA 3G9NA 3DKOA 3EQCA 4PMTA 2ACXA 3FZPA 4QQ5A 3EQFA 4V0GA 4DG3E 2F2UA 2V22A 3Q4ZA 3NUYA 4GFMA 3HV4A 2F7ZE 3FYJX 3MDYA 3ORTA 4LOOA 4UZDA 5M57A 3UQCA 4GSBA 5AP0A 1H1RA 4BFMA 4N6YA 4MCVA 2XYNA 5TKDA 1BI8A 2QOIA 2WOUA 3D7ZA 3DK6A 3UIUA 1CDKA 3UNKA 2UW7A 3BKBA 4UXQA 4GT4A 2UZTA 3FEGA 5H2UA 4EK5A 3TL8A 1Q41A 2PZIA 4AA4A 1XH4A 4R3CA 2XM8A 3B8QA 3U6HA 3RJCA 2B9IA 3OXIA 4TYIA 4IW0A 3OTVA 5CSVA 2W1CA 3ZFYA 4XYFA 5IMXA 4RSSA 3CQEA 1PYEA 2BRGA 4AW2A 1WZYA 3H30A 5ANDA 2CHLA 2WMQA 3F2RA 2YIWA 4WUNA 5ETIA 4E4LA 1F3MC 3DY7A 3KXNA 4MEDA 1SVEA 2ZMCA 2WAJA 3F9NA 5ANOA 5DT0A 5E7RA 4C4JA 3M1SA 3HLLA 4ANOA 1WBSA 1GAGA 4YSJA 4YC8A 3FLNC 5I9ZA 4OW8A 2IG7A 3MFUA 2PL0A 4GJ2A 4NM7A 5BVKA 4XBRA 3LJ2A 3ZHPC 4AE6A 1Q8ZA 3FQHA 2X8EA 5AR3A 3ZBFA 3LE6A 3AC4A 4LRMA 4QMLA 3VIDA 3BYSA 4L00A 4W9WA 4ACGA 5GZAA 3PYYA 3PY1A 3ALOA 3FBVA 3SHEA 4E4NA 2RIOA 4I5HA 5AA9A 5IQHA 5GZ8A 4K9YA 1UU3A 3Q5ZA 1PMVA 2YZAA 1H0VA 3F3UA 5DH3A 3M42A 2ITPA 3ZRKA 4OBPA 5E9EA 4YJNA 3ZC6A 3PRIA 5K4JA 1CKJA 5CWZA 4JG8A 2W1ZA 1IASA 3C4CA 4IX5A 5BVEA 1DM2A 3WF5A 4YZNA 5HOAA 4P7EA 3ULIA 5B7VA 4UYAA 1P4OA 3FLZA 3R83A 3FZ1A 4I6BA 3MJ2A 3TV6A 5CAUA 2Z7SA 2BDJA 2IWIA 1QPEA 2PVHA 2B53A 4FIEA 2C0OA 4BDKA 2CPKE 4CV8A 3ZFXA 3ORMA 4ID7A 2GTMA 2DUVA 3EOCA 2J9MA 3CQWA 2J0MB 2CNUA 4FKIA 1V0PA 2BVAA 4QQJA 5JFWA 4KINA 1J1BA 2PZ5A 3KN6A 3PSDA 4JQ7A 2OXYA 3KF4A 4KSQA 3QD0A 4V0GB 3AD5A 4G3DA 2YCSA 4OT6A 5JKGA 5AP5A 2UW0A 5IEXA 2R3MA 4IAYA 4FV6A 1H1PA 3DNEA 4JLCA 5KKRB 2FSTX 5E8UA 3RI1A 2WMAA 2P55A 4HPTE 3PWYA 4NCTC 5HTBA 4D4YA 2YM3A 1Q8TA 2GS2A 2PVKA 5FM3A 4EI4A 4C34A 1RQQA 4E5AX 4QMWA 4QYFA 3HRCA 3WIGA 5EKOA 3PJCA 4EKLA 2XCHA 4M0YA 3KEXA 3QUDA 5FDPA 4ORKA 4QP8A 5AUVA 4RIOA 4ZS4A 5BMMA 4UN0C 5L4QA 5CVGA 3HAMA 1W83A 3A62A 3W18A 2OJIA 5LQFA 1XBBA 3LCOA 5I9VA 3NUSA 5KKRC 3ZMMA 4BDGA 3VHEA 4QPSA 2A2AA 3UOJA 3R9OA 3FHIA 3E93A 1R0EA 4EOJA 4UXLA 4RLKA 4ASEA 4RGJA 3FXXA 3OOGA 3R0TA 4IHPA 2R64A 3AXWA 4TWOA 4HPUE 3OWLA 3AT4A 4KKEA 5HLNA 4CZTA 3WE8A 2H8HA 3F3VA 4JL9A 4I0TA 4ZMEA 4EZ3A 1OGUA 2F4JA 4QP6A 3CS9A 3F3TA 1YHSA 4PF4A 1KSWA 4NKAA 4QYHA 4X7QA 3ID6C 1W8CA 2ONLC 4XHKB 5TF9A 3AMYA 4AN9A 2C69A 4WOVA 2WKMA 1B39A 3QTSA 3OCSA 4I5PA 3COHA 2W99B 1IAHA 3G15A 2YM7A 2XNPA 2C47A 3FQEA 4MNEB 3LCTA 3HV6A 2W4KA 1ZAOA 3GCSA 3GENA 5HICA 2CNQA 3KULB 2PY3A 4CEGA 1FINA 3EZVA 4FSNA 4YZCA 2PE1A 3QBNA 3VUKA 3WARA 5EW8A 3PLSA 5CXHA 3NWWA 1CKIA 3EH9A 3FY0A 3PZEA 5DNRA 2A1AB 2W5BA 3KRWA 5ANEA 5HCXA 3WOWA 4XLIA 4I92A 4O7YA 4XV3A 3E3BX 2BTRA 4CMTA 4MXZA 3BU5A 5IEVA 3Q96A 4P5ZA 3EQRA 2UW9A 2VX1A 4PQNA 5BVWA 2GQSA 2YN8A 3KQ7A 4U41A 4Z9LA 3GQLA 4FV0A 3P86A 4RPVA 2QQ7A 4ZXTA 3R7IA 3RWPA 1ATPE 2OIBA 4RWLA 3HP5A 4BCHA 3U4WA 4O7ZA 3V5PA 3O2MA 4DEEA 2ONLA 4CRLA 4I6HA 4KBCA 4YGAA 4UMUA 5A4TA 2VAGA 4HGTA 3BE9A 1H25A 4C3RA 2OFUA 2WO6A 3KA0A 2DS1A 3HDNA 2HY81 3OHTA 2VTRA 2WMVA 3TACA 4YBKA 4MHAA 2J4ZA 4HYHA 1R1WA 1JAMA 2RFEA 1SZMA 1FVVA 2WB8A 3DB6A 1XWSA 3GQIA 4BI1A 1WFCA 3CCNA 4D2TA 3DDQA 1A9UA 2IW6A 2RFNA 2XA4A 3Q9WA 4KIKA 3QRTA 2F57A 3UC4A 4F6SA 5FP5A 3O8PA 3KREA 3W10A 2W9FB 2YM4A
chains in the Genus database with same CATH superfamily
4WNKA 5CI6A 4YTIA 5CF8A 1YXVA 4IX6A 4GU9A 3U55A 2QCSA 4AUAA 2VWIA 1BYGA 4JOAA 3MI9A 4JS8A 4FK6A 4MNEA 4O21A 1GIHA 4QMTA 4CFUA 3UNJA 3AC1A 5HBEA 2WTVA 4EC8A 1K3AA 3TUDA 3S0OA 4FTQA 4GEOA 4IDTA 3RNIA 3V5TA 5AA8A 2EXEA 2EWAA 5I4NA 3C4FA 1YXTA 3FKOA 5CQWA 2XNEA 5LMKC 3PRFA 5EW9A 4C62A 2GNHA 3HKOA 3QKKA 5AM6A 5FG8A 5HBHA 3C4XA 4CV9A 2X1NA 2C1AA 2XIXA 3VS6A 1LR4A 2BALA 4DDIA 3I6WA 4DHFA 2GFSA 3PE1A 4FV3A 2XP2A 3MPAA 2O63A 4MF1A 2W1HA 4XV9A 4BBFA 2XALA 4FC0A 4QOXA 2XK3A 3DTCA 4BY9E 2QVSE 3DAJA 1PRYA 3MJ1A 3CQUA 2GHMA 2XEYA 4QYGA 4ERKA 2V7OA 3POOA 3QL8A 2CCIA 5C03A 3NUXA 1BX6A 3PP0A 4I41A 5GHVA 1IEPA 3WE4A 4C7TA 2WNTA 3NCZA 4FTJA 3CPBA 3G2FA 2B7AA 2GQGA 3A61A 2YFXA 3FMHA 4G31A 5HLWA 4HGEA 5JK3A 3H9OA 5HNIX 4JDJA 2GNIA 1W2CA 4KBAA 2Z7LA 5J9ZA 4UYNA 3JY0A 3L8PA 3EYGA 2ITQA 1REJA 2UW8A 1YQJA 2CSNA 4L45A 5EH0A 3SOAA 2BKKA 1WCCA 3QKMA 4LL0A 3UYSA 5EDRA 5FBNC 4C8BA 4CFVA 4E8AA 1G8JA 2X2LA 4GJ3A 4O2ZA 1KE5A 5LMKA 5FXRA 3EJ1A 5A6NA 4NWMA 2C3LA 3BGZA 2B4SB 5AMNA 5IQFA 5L2SA 5F95A 4M12A 1PKGA 3PXQA 1LUFA 4KB8A 3TZ8A 2C5YA 2X2MA 3HL7A 3JYAA 3T8OA 5ITAA 4RQKA 3MESA 4F09A 2PVMA 3ZO3A 4R5YA 4FI1A 2C3JA 3DJ5A 2H96A 3UODA 2X9FA 1XBCA 3D5VA 3IK3A 4O91A 4YJUA 3FMEA 4BVUA 3PIZA 4FEQA 1PKDA 3SD0A 5L3AA 2XIYA 5CU2A 1QPCA 3DFCB 3SAYA 4FX3A 2CGUA 4RRVA 3GC8A 4J98A 2IF8A 4EUTA 2OWBA 4BL1A 3WZJA 2HXLA 4L7SA 1JKSA 4I4EA 2I0YA 4FKJA 4S32A 3PY0A 4JR7A 4RZWA 5HGIA 1OUKA 4NL0A 1YHWA 3PIYA 4IDVA 5AAGA 4L3LA 3O23A 3SXRA 4QYYA 3VJNA 3TNIA 3C7QA 4BYJA 3LFAA 3F88A 4D2RA 2V62A 5TO8A 3C0HA 3DJ7A 5JQ8A 2WD1A 1GY3A 4LL5A 2R3JA 3HA6A 5ACKA 4EUUA 1UA2A 2OFVA 5HNGA 1EH4A 2R0IA 5CEPA 4LDTA 3GCUA 3OUKA 4Y5HA 3QQJA 3RHXA 3VBVA 3O71A 5EYMA 3R8VA 1NA7A 4J97A 5HO8A 4JQEA 2IVTA 5CEMA 5J1VA 5AUZA 4E6DA 3PJ3A 4GIHA 4YLKA 3FUPA 5AP7A 4BCGA 4KS8A 1IAJA 4WNMA 4Y73A 2LAVA 4XG9A 4XX9A 4C0TA 2YISA 4IACA 3RAHA 4DEIA 5M4CA 3OCTA 4HNFA 3R7OA 4BGGA 3ZUTA 5EDQA 4BCQA 5L2IA 1FMKA 3R8MA 4AXAA 3NYXA 3RWQA 3W2RA 3QUPA 4FSRA 5DFPA 3PVWA 3O50A 1JSVA 4D9UA 3C9WA 3CD8A 3Q9XA 5DR2A 5KMKA 2OJFE 5L8KA 3B2TA 5A4EA 4YC3A 3NSZA 4HVGA 4L3JA 3AKJA 2GDOA 5BVDA 3EB0A 3AOXA 5HCYA 4BKYA 2RF9A 4HVSA 4TWPA 2XK9A 4FV1A 4D5KA 4QPAA 3RBWA 3VS4A 5KUPA 1M17A 4CMUA 5EQEA 4Y46A 4ZY4A 4F65A 3RALA 4BTKA 4DLIA 1OBDA 2J51A 2XRUA 3VRZA 2NPQA 5I3OA 3QALE 4F0IA 1STCE 2X7OA 3R7YA 2BHHA 3F82A 4ANSA 3LQ3A 5J7BA 3FMDA 5EG3A 3CE3A 2F2CB 3E92A 1ZZLA 3DS6A 2ITYA 3VUIA 2A27A 2JKKA 2YIQA 3CY2A 4AZVA 5A4QA 2WHBA 4L42A 4I6FA 2FA2A 2Y4PA 2VV9A 3FSKA 4DH5A 1QL6A 2BPMA 5IZFA 3GBZA 4AT5A 5DOSA 2HOGA 3COIA 2WTCA 2XK6A 1U46A 4O4DA 2V55A 3UPXA 4DFYA 2RG6A 2XKEA 4FG9A 4O27B 4ALVA 2B9JA 4RIYB 4BDAA 1VJYA 4JI9A 4ZSJA 3U4UA 2EB3A 3IDCA 2YM5A 3ZLSA 2YLEA 5AIRA 3QZHA 4LMUA 3V01A 3Q6UA 3GB2A 3GU5A 4DT8A 1OUYA 1T45A 1DAYA 3R63A 3MVJA 3ROCA 1O9UA 2QO7A 3FYKX 3BBWA 3KVWA 4WG4A 4YZDA 5GNKA 4CG8A 3A7HA 2CN8A 3QC4A 2HIWA 3EFLA 4RIWB 4RVTA 3P1AA 1J3HA 2HENA 1SVGA 4NJ3A 3V6RA 2PZYA 4X2GA 3ZFMA 3EQIA 4RX9A 4CCUA 4JIAA 3E63A 3FL4A 4YUQA 2E9NA 3PVUA 4G5PA 3MIYA 5CEOA 3QGWA 3QQKA 3Q52A 4DH7A 3UMWA 1UU9A 3L8XA 3PXRA 4FT5A 4BIEA 4I5CA 5CSHA 4E20A 2ZV2A 2VWXA 4JT3A 4EK4A 1JSUA 2GNLA 4O0UA 2ITOA 4FIIA 4QP7A 2ZB0A 2QR7A 2JDOA 4GT5A 4ZJJA 5KHWA 4E3CA 3UJGA 1KE9A 4TYGA 5CTPA 1OL5A 1U4DA 3MA6A 4AWIA 4RJ5A 2HZNA 1OI9A 3QGYA 4W4YA 3UDBA 5FD2A 4GG5A 3PVGA 5HE0A 3TKIA 1R0PA 3I0OA 1PYXA 4QP1A 3H0ZA 4L01A 2JDTA 4IWDA 2X6DA 3LFFA 4IAKA 2JKOA 4J8NA 4UY9A 5IUHA 2BRMA 4ZSAA 5CANA 5J9LA 4GT3A 5DE2A 5C27A 4A4OA 4AW0A 3QA0A 2CMWA 4RIYA 3IO7A 3NNVA 4XS2A 5DR6A 4AG8A 3H3CA 4O0RA 3KY2A 4FZDB 4EZ5A 4FTLA 5GIPE 3C0GA 3CTQA 4D55A 4BIBA 5JMSA 4O82A 4L67A 2ESMA 4X3FA 3HUBA 3MY5A 5JN2A 4XBUA 3ZOSA 3ORXA 4BHNA 5IQCA 1PHKA 4E5BA 2NRUA 4IE9A 3AKLA 1YRPA 4IM3A 3ZLXA 3U9CA 4FKOA 5EM8A 1FBNA 5CSPA 3DB8A 2VO3A 2JKQA 4K8AA 5IUGA 1OPJA 2J50A 5AV0A 4G3FA 3DXQA 2OJGA 5J5SA 2PVJA 4DH3A 3AQVA 2JITA 3JS2A 2X8IA 4IANA 4D4SA 5AEPA 4XEYA 1AQ1A 4S34A 3VWAA 4ANLA 2VGOA 1TQIA 3FPMA 3HGKA 2QOFA 3HECA 1O6LA 2HELA 2YLFA 3R7UA 3LFCA 3E64A 2ITVA 5FXSA 4M0ZA 3DXNA 4KD1A 4FNWA 5DIAA 2ZV9A 1HOWA 2HAKA 3ZSGA 1M52A 2QURA 5AX3A 3V8SA 2Y7JA 4G5JA 4O1PA 2Q0NA 2GPHA 4YPSA 2J2IB 4JVGA 4NT4A 4AGDA 4G17A 3FI3A 1M2PA 2O64A 4EJNA 4IQ6A 3ZO1A 4R7BA 3POZA 1CTPE 2XF0A 4G6OA 4MK0A 2J0LA 2WQOA 4YLLA 1MRVA 5G1XA 4A4LA 1XH7A 2BHEA 2C68A 3B2WA 4MXXA 4NIFB 4AU8A 4BCFA 4EQMA 4H3PA 1Q61A 2GTNA 2VRXA 3OD6X 4D58A 5J95A 4APPA 3LAUA 1H28A 2VWBA 2WOTA 1PXLA 3P79A 3ZXTA 4BZNA 4R77A 2C6TA 3ZUVA 5E8XA 3HMOA 1XBAA 5EI2A 1GZKA 4B4LA 4DCEA 5JGBA 1WAKA 3COKA 3HAVA 2O5KA 1BL6A 3MTLA 4DFNA 2R3IA 4IWQA 3QAME 4LI5A 2WU7A 3ZZWA 4BCIA 4J95A 4F7LA 3LVPA 5B2KA 2XBAA 2QHNA 4ZS0A 1VR2A 2C6MA 5I9UA 4O0YA 4O7RA 3MFRA 3EFWA 4CQGA 4FT9A 4AZEA 2R9SA 2YDKA 3DOGA 4P90A 4PV0A 5KZIA 4BRXA 1ZYJA 5HD4A 1A06A 4J8MA 5EOLA 4AGUA 2FB8A 2OJJA 2AQXA 5L2WA 2YCFA 4FV5A 4JDKA 2WTKB 2IN6A 1ZRZA 3E87A 4WSQA 4O0SA 4CFMA 5L2QA 5EI8A 4BKJA 5AIKA 3SOCA 4U42A 5FBOA 4HCTA 2O3PA 2YAAA 4DTKA 5M08A 4GKIA 3V5WA 1Q97A 2RGPA 2HCKA 4EBWA 5DMZA 1URCA 5C9CA 1FOTA 3NS9A 1AD5A 5JZNA 3C1XA 5AADA 3QQLA 4DCAA 5FM2A 3FL5A 2FH9A 5C26A 3S4QA 2VTTA 2YIXA 5LMBA 5CS6A 3SG8A 4JG6A 4ANMA 3MH3A 4RT7A 5FLFA 4ZLYA 5AFVA 3CR0A 4FK3A 2WTKC 4F7JA 4BDJA 3MVMA 4I1ZA 3A7JA 5J1WA 5JQ5A 3LMIA 5H3QA 2ETKA 2WGJA 1PMUA 2UZBA 3D2IA 3H4JA 1PXOA 3BHHA 3L8VA 4FYNA 4QMPA 4XV1A 5HG9A 5CVFA 4QRCA 1Y6BA 4OT5A 5KCVA 2IZTA 2W1EA 4M68A 3U8WA 3NW7A 5CALA 3WF9A 3V5QA 1ZXEA 2OO8X 1HCLA 3QD4A 3R1YA 3OEFX 3RVGA 4AACA 2C5OA 2R3QA 2VX3A 4ZJIA 5JFXA 3IS5A 4MD8E 3DAKA 5KMMA 3GXLA 3ZEPA 3W55A 5HVYA 2CGXA 1YI6A 3F5XA 3KMMA 2YIYA 2P2HA 3R9DA 4BGHA 2R3PA 4YC6A 5M4FA 4K18A 3BLRA 1L3RE 4EOSA 3R28A 3BEAA 3CXWA 4E26A 2I7QA 1YOJA 4HGSA 4CT2A 4AW1A 2PMOX 4A06A 2P3GX 4AP7A 3BHTA 2V5QA 2XK4A 3P23A 3R01A 3UVQA 4FV2A 5KX8A 1ZARA 4AT3A 2NRYA 4NKSA 3VONA 4CNHA 3DT1A 5TE0A 2BCJA 2PK9A 5ETAA 2C5VA 2QHMA 3PA4A 4U40A 4BBMA 4F0GA 1YKRA 3HV7A 3HA8A 2BKZA 4RWJA 4YR8A 2BILB 2W4OA 1NY3A 3W0SA 4RFMA 3PP1A 4F08A 2J7TA 3I5NA 1FPUA 3MV5A 5GZ9A 4HZRA 4AFJA 3QXPA 4ZZMA 4CLJA 5A4LA 5HX8A 5AV2A 3N51A 2JIVA 4IZYA 4BCNA 2UZUE 2YAKA 3MSSA 4IZ5A 4RJ4A 2PMIA 1YVJA 3O17A 5LOHA 2X39A 3CP9A 4FOCA 3HEGA 4ENXA 2VX0A 3H10A 2C5NA 3BLHA 3CBLA 3FI8A 1UKHA 2A98A 3VW6A 4KKGA 4GYGA 3EQHA 3QF9A 4FKSA 4W9XA 5LARA 5B2LA 3LZBA 2F7XE 4FKPA 2VWWA 4MQ1A 3OT3A 3PFYA 1H00A 2O65A 3VF8A 2W0JA 2XS0A 3CD3A 1OB3A 5AUYA 1LEZA 4IH8A 1A48A 4AQCA 2XAOA 3NNXA 3GFWA 5CI7A 5G6VA 1Q3DA 3EN9A 3LFQA 3PJ2A 4GVJA 2RKUA 4RG0A 5EW3A 3BX5A 4ZJVA 4FEWA 4C57A 3OF0A 1YXSA 1IRKA 1U59A 4QQCA 5D1JA 5L6WL 5CU3A 3W1FA 1DI8A 4ZSLA 2YHVA 1FVRA 3R1NA 2GFCA 3EQPA 5AX9A 3GEQA 2VNWA 3BI6A 3EN4A 3TNPC 3COMA 4MAOA 1XO2B 3GFEA 3QUEA 5E8ZA 2YIRA 4TNBA 1XH8A 4A7CA 1UWJA 5HQ0A 4K0YA 2FUMA 3I7CA 2I1MA 3HRFA 2QLUA 2J0IA 3MPTA 3UYTA 5HCZA 4GV1A 2VN9A 1KOBA 4G6LA 4DGNA 3NVMB 1YW2A 2YACA 2JLDA 3LM0A 2B1PA 4ZY5A 3G6GA 1PMEA 2CN5A 3LM5A 3WZKA 3OOMA 1ZYDA 5HE1A 3ENMA 3TXOA 3DBDA 1IA8A 2NO3A 4ACDA 1OL1A 4KA3A 4V01A 3R1SA 3TDWA 3VVHA 2ZDUA 2W1FA 4XG2A 5AR7A 3RPYA 4WNOA 5I9YA 1QPDA 4FBXA 3U87A 3LIJA 2PYWA 4YJOA 3R30A 4DDGA 3HUCA 3QHWA 2IVVA 5DEWA 3PPJA 2PVRA 3BHVA 3E8EA 4BDDA 4AXFA 5HHWA 2FSOX 4YTCA 5BYLA 5KHXA 4FTKA 3PZHA 3QC9A 3AC2A 5HX6A 2PU8A 2JAMA 4GL9A 1FGKA 1VLRA 5LXMA 4BB4A 2XARA 2XVDA 2OGVA 4UZHA 4CFWA 4CTBA 5JRQA 3II5A 2PUIA 1WVWA 2RL5A 3UG1A 3WF8A 3NNUA 2PTKA 3U6IA 4CD0A 5EM5A 2RG5A 4I0RA 2WMTA 4FIJA 4MUQA 1OIUA 4TRLA 4A9YA 2C6OA 3NX8A 1S9IA 2HY0A 4DEDA 3VN9A 3KRRA 1ZY5A 5E1EA 1H27A 1O6KA 5AP1A 5LVLA 1Z5MA 4MBIA 4XG8A 3A4PA 3CPCA 2Y8OA 4UMPA 1MQ4A 3DBEA 3L8SA 4QMNA 5ETCA 3H9RA 3NIZA 2VTSA 3HMIA 3BYVA 3RKBA 5JEBA 2W17A 3O5AA 1SM2A 2YITA 4ACHA 2PVYA 3AT2A 4ZLOA 2V7AA 4D4RA 4AXEA 4ITHA 3I79A 3QWKA 4C58A 4RMZA 2XKCA 3FI4A 3A8WA 3BRBA 3QWJA 2QNJA 1ZZ2A 4FTUA 4JX7A 5HU9A 2OI4X 5LVNA 2RFSA 3JVRA 3ODYX 2CKEA 5DPVA 3CTJA 4QQTA 3ZLWA 3OWJA 4BZOA 5ANGA 1H07A 4YPDA 2F49A 3DKCA 4B7TA 5KBQA 4DGGA 4EKKA 2R7IA 3FSFA 2QC6A 3PG1A 3QCSA 1OIRA 3VRYA 4ARKA 3LKMA 2GNJA 2XANA 4AN3A 1DI9A 2Z7RA 2E9UA 4M67A 3A2CA 3HZTA 4TYHB 3QHRA 2I0VA 4IVCA 3W8QA 4E4MA 5CAOA 4XLVA 5DRDA 1ND4A 2OIQA 2E9PA 3VUGA 5FTGA 3ZO4A 1OBGA 3NLBA 4DITA 4LMNA 2UZLA 3AT3A 3FHRA 5CU0A 2A19B 4OTPA 2WQNA 4X2JA 5FGKA 3LQ8A 3R00A 3MB7A 2UW6A 3DBFA 4FT7A 4IVBA 4KIKB 4DH8A 4Q5EA 1VZOA 1ZOEA 4LQMA 5HO7A 1YDRE 4RWKA 4YMJA 4FSMA 2VTOA 3PTGA 4F78A 2OXXA 3PXKA 3UQGA 3K2LA 3OW4A 5C4LA 1XQZA 2VTJA 4RC3A 2B52A 3KK8A 3ORZA 4XH6A 4Y72A 4C36A 4FKRA 4F9BA 3RINA 3SVVA 4W4VA 4CGAA 3PPZA 2OZOA 2JEDA 4QMUA 3TNHA 1RW8A 3NEWA 1W84A 4S2ZA 5CZIA 4KABA 4KNBA 3F2AA 4FYOA 2XM9A 4WD5A 3D83A 4ZTNA 2IZUA 1OKVA 4EH6A 2QOQA 4NUSA 5CAPA 4FIFA 4HVIA 5J5TA 4HYIA 3A60A 4TW9A 4H1JA 1KWPA 2EB2A 3NFFB 4ZOGA 2XJ0A 3MGYA 3UC3A 3FV8A 2WZJA 4DFZE 4TY1A 3FXWA 2ZV7A 4AOTA 5K5NA 3G51A 1H1SA 5HNBA 3EQBA 2OG8A 4M69B 3VBWA 3W8LA 4DH1A 5HVKA 4D4VA 4ASXA 5A14A 3AC8A 4O4BB 2QONA 4HGLA 4RA5A 2CLXA 3PDTA 4KIOA 4A9RA 3R73A 2FO0A 2GMXA 2XIZA 4IADA 4W4XA 2Z60A 3TUBA 3Q3BA 5EM7A 3QRJA 3O51A 3LXLA 4TYHA 3R21A 1T46A 3UZPA 1E9HA 4EOQA 3KXMA 2R3GA 4IFGA 3G5DA 3HMMA 3CKXA 4JAJA 3GC0A 3THBA 4QMXA 4L43A 3QRIA 3R6XA 3FJQE 3TV4A 3CC6A 5HZNA 4XMOA 1WMKA 3A99A 3Q4TA 1GIJA 2EXMA 3LCKA 2CLQA 5K5XA 2XNMA 3FE3A 1P4FA 4G9RA 4MKCA 4U0IA 1ZMUA 3W2OA 4GVAA 4YURA 5DT4A 4CTCA 5AP4A 4DEAA 3BBTB 4QT1A 5IG1A 1LPUA 3IW8A 4QTCA 4AZSA 2E2BA 3TKUA 4EH5A 4B99A 4FZ7A 4O0TA 4WNPA 4XG3A 2ITNA 3SG9A 4MXYA 3LXPA 2GSFA 3SV0A 3OZ6A 4RC4A 3F5UA 3DCVA 3L9LA 4WG5A 1W82A 1ZMVA 2VU3A 2E9OA 1NVRA 4PDPA 4CSVA 4DGLC 2R3KA 4UX9A 3ZUUA 3ZXZA 4Z7HA 2BZKB 4FL2A 3U54A 3VBXA 1Y8YA 3CKWA 1MUOA 4QNAA 3VBYA 3GCVA 3IPHA 4FTMA 2YDIA 4QDVA 4O0WA 4OBOA 3ZONA 5BPYA 1Y8GA 3OUNB 5K4IA 5FUTA 2REIA 2UZEA 5AAEA 4BJJA 3C4EA 4QDEA 4IXPA 4M69A 4JR3A 3QCXA 2P33A 3IECA 4DFLA 3OXZA 3CY3A 1GZNA 4E1ZA 1TKIA 3E3PA 4R1YA 4MBLA 4QTBA 1YXXA 3F3WA 3I5ZA 4N70A 5M56A 3L9NA 4HNIA 3TZMA 1Q8WA 4NFMA 3A8XA 3UIXA 2B54A 4BKZA 3PA3A 4FTCA 3MFTA 4CKJA 3LJ1A 3ODZX 4MWIA 3RP9A 1VEBA 4PL4A 3RPSA 3D5UA 4JQ8A 2ZYBA 3OEZA 4MXOA 3W32A 3DBQA 4HW7A 3Q9ZA 5E91A 2NNWB 1VYWA 1OM1A 1J7IA 4QTAA 3QFVA 1GZ8A 3ZCLA 1Q24A 4QMMA 4RC2A 4O2PA 2R4BA 2QOCA 3MN3A 3ANRA 3MVLA 4FOBA 3DQXA 1UNHA 3NYVA 3QU0A 1H0WA 4FV7A 4M14A 4Q2AA 4LG4A 4U9AA 2FGIA 3UNZA 2IZSA 5KMOA 3EN7A 3KB7A 4FTRA 4TYEA 4DAWA 4JJRA 4KBKA 4AW5A 4YHTA 3FLSA 5I0BA 5C8MA 2SRCA 3CJFA 1GZOA 2BZJA 3IW5A 5GIOE 2JDSA 4JIKA 3FZSA 3M2WA 4LYNA 1FMOE 3PA5A 4FTIA 1P5EA 1VYZA 2WTWA 3R7VA 4C59A 1AGWA 3RZBA 5K3YA 4PTEA 2ERKA 3ZBXA 3ZM4A 4YNOA 4FNZA 5IA3A 1E1XA 5T68A 3PLAE 1ZOGA 1JVPP 2F9GA 3C50A 2WIHA 1DAWA 3UP2A 3EFKA 3AD6A 4U81A 4DEHA 4C38A 2PVFA 4O4FA 3TKHA 2W06A 5IKWA 4DA5A 2PVLA 4I0SA 4RVMA 4YJTA 4I20A 4YJRA 1U54B 2C5XA 5D41A 2XK8A 4FL1A 1JPAA 3WZUA 3D5XA 3A4OX 4JAIA 1QMZA 4L8MA 3DKFA 5KO1A 4RLLA 3ANQA 4DHJA 4M15A 4YZ9A 2WPAA 4A9TA 1SMHA 2G2IA 2GU8A 4FKVA 4U44A 1PJKA 4ANBA 4ZZOA 1OPKA 3ZO2A 4FKQA 4QNYA 1WBTA 4Y8DA 4CMOA 4IB0A 4U8ZA 1Q5KA 1OGYA 3TIYA 1E1VA 1BKXA 3HV3A 1NXKA 5E8TA 3OFMA 4RJ6A 3VULA 5CZHA 3NIEA 2W96B 2YM6A 4R7HA 5AR2A 3TJDA 4IM0A 5AM7A 3OVVA 5E8SA 4ASZA 3F2NA 4FV4A 4F6WA 5IA4A 2ETRA 4XG7A 2XNGA 4EH8A 2BIYA 1TVOA 3EL7A 3D9VA 4R7IA 4U97A 1XJDA 3ZH8A 3P7AA 5E92A 5M09A 4LOQA 4AOIA 1REKA 5D10A 4OTIA 3TMOA 4FJVA 3P9JA 4EYJA 3SX9A 5A9UA 4E6QA 3Q6WA 3UZTA 5AR8A 2YWPA 4RIXA 2HWPA 4FGBA 4FIHA 3K3IA 4WO5A 4CKRA 5AV1A 3BV2A 3NVKI 3LLTA 3VUMA 2X4ZA 3VS7A 2A0CX 4FV9A 2VTMA 2XK7A 3BCEA 5HLPA 1LP4A 3D14A 4PDOA 3HMPA 4D1XA 1OKWA 1U54A 1V0BA 5IF1A 3R22A 3UTOA 1UV5A 5EOBA 5D12A 4BN1A 2YJSA 4EONA 3UQFA 4C35A 2OSCA 5ANJA 4UWYA 2Z02A 4CQEA 3HMNA 4PNIA 4AQKA 5HG7A 3D15A 4ZTHA 3SGCA 1XKKA 1OIYA 4J99A 3NR9A 5LWNA 4U7ZA 4X3FB 4ZTMA 3IONA 5HESA 4DTAA 3IGGA 2GQRA 5DR9A 4W8DA 4FE2A 5J9YA 3UVRA 3R8UA 2WELA 4GK3A 2YDJA 4EJ7A 5HG8A 4H1MA 2Q83A 4ZAUA 1PXJA 5BYYA 4UMQA 3FZRA 3EQDA 3QD2B 5ANKA 3CTHA 5CXZA 4A4XA 2HXQA 1UNLA 3KXGA 4EK6A 5CEKA 4QYEA 4ZTRA 4M8TA 4M84A 3C13A 5T3QA 4X3FC 5CEQA 4B8LA 5DLSA 4OTRA 5B0XA 3JY9A 3UZRA 4PX6A 2CKQA 3JVSA 5BVOA 3FMJA 1TQPA 4I23A 4I3ZA 5JT2A 4R8QA 4WBBB 1B38A 4H3QA 4P2KA 2G01A 3FLQA 5DGZA 4TL0A 2I6LA 3K5VA 4GS6A 3BYUA 4APCA 3GOKA 3C5IA 2AUHA 3QRKA 4I22A 2Z7QA 3V5JA 4IX3A 4P4CA 4XRLA 5GJFA 1SVHA 3BHUA 3UO6A 5HE3A 3K3JA 4DTBA 4QMVA 4O7LA 3LFBA 5EDPA 5E90A 2Y0AA 4JX3A 4XP3A 4FUXA 4N0SA 2X0PA 4P5QA 3LHJA 4E73A 5HEZA 2WMXA 3ET7A 4FKUA 3ZRMA 1MP8A 3PXYA 4ONAA 3W33A 4DYMA 3KU2A 5AUXA 4L9IA 3FLWA 1GNGA 2G9XA 3GOPA 3BWFA 4AZFA 3D94A 2BDFA 4ZMFA 4BCKA 4O7TA 4CG9A 3FMNA 5FEEA 1KOAA 3G0FA 2C6IA 4AZTA 3DA6A 3F5GA 4MD9E 4U45A 3HRBA 4PMSA 3GU6A 4IWOA 3DKGA 3EFJA 3F5PA 3FKNA 3W2PA 5LCJA 4Z16A 2G2HA 1YWRA 2ITTA 3DPKA 5B2MA 1Y91A 5LMAA 4GCJA 5HU3A 5HKMA 3ORNA 4E6CA 2IVUA 3PJ8A 2O2UA 3PXZA 2VNYA 4WBOA 3MWUA 4CYJA 4AXDA 4IZ7A 4C3FA 2YA9A 3O7LD 5EYKA 4FVQA 4ZY6A 4X6QC 5FRIA 5C8KA 3PSCA 5A4CA 5EHLA 4D2VA 3LCSA 4NM5A 5DI1A 3RAIA 1OKZA 2XRWA 1M2QA 2PZRA 4PTGA 4CFNA 3MW1A 3QXOA 5A54A 4XOYA 2UZWE 5CAVA 4EOPA 4WUAA 5IDNA 1JKTA 2W1IA 2ZAZA 5CENA 4NTTA 4K11A 1JOWB 3CJGA 4NTSA 4IX4A 3TIZA 4ZSEA 4H39A 2X9EA 4MXAA 5AV3A 4IEBA 5H9BA 3KRXA 2F7EE 2OF4A 3SLSA 1OMWA 2AC3A 3KXXA 2W5AA 4D28A 4X2KA 5EK7A 5I3RA 4RVLA 4F6UA 3O8UA 3RMFA 2I0EA 5ANIA 4Z3VA 1QPJA 2OK1A 1JLUE 2G2FA 4NM0A 3OS3A 4AOJA 1OECA 4K6ZA 3PWDA 2YABA 4FZFB 4BI2A 1Q4LA 4NFNA 4BWXA 3LXKA 1JKLA 2X0GA 4MWHA 4BDIA 1KUTA 2EVAA 3DXPA 3SKCA 2P0CA 1WBWA 1Z57A 2XB7A 3ZTXA 2W1DA 2QI8A 2ZM4A 4XV2A 3Q4UA 5C01A 1UNGA 3KRJA 3ATTA 4BTFA 5KMLA 4NEUA 5FTQA 3QCYA 3IGOA 1M14A 3O0GA 2C6EA 2WU6A 1Q8YA 4FTAA 1PXPA 5IA2A 1RDQE 4J53A 1NVQA 3G0EA 3EN6A 4D2PA 3AG9A 5EHOA 3VBQA 3W0MA 3MVHA 3R8ZA 5CEIA 3TG1A 3V51A 5BQ0A 3RPVA 3CSVA 4ASDA 3IW6A 3UO5A 4UEUA 3TNWA 3V04A 3SDJA 3OCGA 4B0GA