4ZOGA

Vx-680/mk-0457 binds to human abl1 also in inactive dfg conformations.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
269
structure length
269
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title VX-680/MK-0457 binds also to human ABL1 with inactive DFG conformations.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zogA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zogA01
5AR2A 5M53A 2B0QA 3HUCA 1ZOEA 2XK8A 4TZRA 2UZEA 4TNDA 2I0YA 5DGZA 3VN9A 2CPKE 4DFLA 4F65A 3GCVA 2W05A 1Q41A 1H01A 4AAAA 5J87A 4JDIA 2Z7QA 2BRBA 4GK4A 3V5TA 3ZO1A 4O7TA 3E5AA 2QOLA 3VBQA 4CFFA 4ENXA 4GCJA 1WBVA 3KK9A 4EYMA 4EJ7A 1Z57A 4RWIA 5CNNA 1H1SA 4BDIA 2GNIA 3HA8A 1BUHA 1JSUA 2QOQA 1YI6A 3DTCA 3PIYA 4XJ0A 4Y85A 4YTHA 5FEDA 4BKZA 5HTBA 2C6IA 2HY81 3QYZA 4R3RA 1ZZLA 4WSQA 4EH7A 5IQDA 2YCQA 2CNUA 2BDWA 2WHBA 1OIRA 5M4FA 4ZLOA 4FG9A 2PVKA 4ERKA 4RFYA 1ZWSA 4CFVA 2UVXA 5AV0A 3HECA 1ZAOA 3R8PA 2OO8X 1JKTA 5FBOA 5K4IA 5CENA 3NMUF 4M0ZA 2BHEA 3ELJA 4ZZMA 3QQLA 4GW8A 1BKXA 3AGLA 4O0UA 5TOZA 4A7CA 4DH7A 5F94A 3VRYA 2CKPA 5HLPA 4YJTA 4QP6A 1OUYA 2J90A 2F2UA 4IWQA 4NCTC 1UWHA 5CYIA 2AC5A 3S00A 3SRVA 2WTIA 4FL3A 1BI7A 4HYHA 5M07A 4EZ7A 4H1JA 3QRJA 3KRRA 4IVBA 5FP6A 3S0OA 3QFVA 2CKQA 3BYOA 3HA6A 2RKUA 4M69B 4MBJA 3FLWA 4OBOA 4QP8A 3F2RA 2F49A 5BVDA 3EN6A 4KWPA 3G90X 1XKKA 4O0XA 4MD7E 4U5JA 4YZDA 3KKVA 5LVNA 3ENMA 1DI9A 3G6GA 3O8UA 2CJMA 3FZPA 5L2IA 3DU8A 4APPA 5K5XA 4TYHB 3BCEA 3D7TA 3QTWA 4KIPA 2PZPA 3KXGA 3IGGA 1ZARA 1WBNA 1WCCA 2O65A 4I4EA 4V0GA 1PMUA 4IBMA 3V5QA 3QKLA 3FE3A 3GCUA 3QQGA 4IXPA 2XJ2A 2YAKA 3UDBA 3ZSIA 2ETMA 5HG7A 4Z16A 4XG8A 1PXOA 3VF8A 3UMXA 2JD5A 3LXLA 4XP0A 5FEQA 3BQRA 3S95A 2WAJA 2ZB0A 2JDVA 3II5A 4WKQA 2OIQA 3F3VA 1BI8A 1X8BA 3HDNA 5GZ9A 4APCA 1OPKA 4D2RA 4ZY4A 3RAHA 3KL8A 4G6OA 2QURA 4GIHA 2X8DA 2VX0A 1FVRA 3BGPA 4MNFA 1ND4A 3VUIA 1OECA 5FXQA 2CGUA 2BRNA 4O27B 5G1XA 5D41A 4G9RA 5CU3A 1MUOA 1YHVA 3SX9A 3ID6C 4CNHA 4MXYA 4O7NA 4QQ5A 2XK3A 5IA1A 3P5KA 4MBLA 2QG7A 2CGWA 4YLJA 4CCBA 3RJCA 3IDBA 3G2FA 3LMGA 1OIYA 3PA3A 3D0EA 3BU3A 3LAUA 2R3FA 1M17A 2OXXA 4RX9A 4FEVA 4UWYA 3A4PA 3IW5A 3OCTA 5E8WA 4ZP5A 4I0TA 1KUTA 3A7JA 3HV5A 3TNPC 3VS2A 3PZHA 4CFWA 5KMOA 5GIOE 3SG9A 3THBA 5BYYA 4Y5QA 3B8QA 3PY3A 4FMQA 2CKOA 5BYLA 1YVJA 2W1DA 5AFVA 3KULA 3FZRA 3MYGA 3P9JA 3RVGA 3NVKI 2GU8A 2WZJA 3PIXA 3RAIA 3F5PA 2GS7A 5AIRA 3UVQA 1VYZA 5LMAA 3D2KA 5IQEA 4BRXA 3SAYA 1XBAA 1WFCA 4MD8E 4YNOA 5E90A 4DGMA 4OAVB 3W8LA 4DCEA 4DF3A 5B2MA 3L9PA 4FEXA 4HW7A 4FG8A 2J5FA 2UVZA 3PY0A 4X3FB 3I7CA 3O7LB 1SYKA 4A9YA 2ITPA 3GU5A 4ZJJA 5KBRA 4ZOGA 3BELA 5LOHA 2YM5A 4RFZA 4O21A 1M7QA 2F57A 4QMOA 4EBVA 3VC4A 1O9UA 4MF1A 3LLTA 5JN2A 4I6BA 2R7IA 2PL0A 3KGAA 2HW7A 3OROA 3Q9ZA 4I24A 1CKPA 1JOWB 1P2AA 5HTCA 2X7OA 4JAIA 5EQPA 3FI3A 3FWQA 5CQUA 5JGAA 2Q0NA 3NX8A 3OHTA 4RJ5A 4KABA 3F9NA 4QPMA 3P79A 2W0JA 4D9UA 3WARA 4XV9A 3U6JA 3ORKA 4WG5A 4BGQA 3ZLWA 1KV2A 4YJPA 4HCUA 2J9MA 4G6LA 3V5WA 4FZAB 3SA0A 2FO0A 3RPYA 2LGCA 2X8IA 3QUDA 4E5WA 4FA2A 5IA5A 4L8MA 4E7WA 4MXOA 5HKMA 1KE7A 5IEYA 1W0XC 2HZ0A 5BVFA 5EDQA 5M51A 5E8TA 4GMYA 2XEZA 1RJBA 4ZSLA 2WU6A 4EQCA 4IADA 3PJ8A 3PUPA 4FSQA 3PY1A 5E4HA 4KNBA 4PWNA 4QMZA 4OW8A 3R00A 4WHZA 3PPKA 4GV1A 2PPQA 2XS0A 2YFXA 4Y72A 4BKYA 3RMFA 3BHUA 3DK6A 2PY3A 5LVMA 5J9LA 1JNKA 2IW8A 4FF8A 4QPSA 2PVHA 3U4WA 2XUUA 1BLXA 3BEGA 5AIKA 4D4YA 3LE6A 3V5PA 3IW8A 3DB6A 4AGWA 1ATPE 3AT4A 3KK8A 3R9HA 1GAGA 4NYEA 1OL5A 1OPJA 2OJGA 4BDCA 4OTPA 4AGDA 1JSVA 3FHRA 3MVHA 3FQEA 4I20A 4LRMA 3MA3A 2UZUE 5DI1A 4F7NA 5BUEA 3KXNA 5AP2A 3QXOA 4AZVA 4B99A 2PUIA 2C6MA 4XH6A 2OJ9A 2Z7RA 4FNZA 3Q4CA 1OBGA 3TUCA 1SZMA 2ITYA 3ACJA 4S33A 4P90A 4CFXA 2E9VA 4XV1A 5L8KA 4A4LA 2WMUA 4CFUA 4MCVA 3OW4A 4J95A 2YWVA 5I9UA 2WTDA 3D7ZA 4YJSA 2FYSA 5D10A 2QD9A 4FICA 3I0OA 4IC7A 4RIYB 2OZAB 4UYAA 1H07A 5CS6A 3PJCA 3FYJX 1XR1A 1Y6AA 3QTIA 2C47A 4LMNA 4M84A 1ZYJA 4O38A 3VNTA 4EOQA 2RSVA 2C6OA 4MBIA 3ZFMA 5EQEA 3PXZA 3DZOA 1ZY4A 5AWMA 5HX6A 2OF4A 2YIQA 3O71A 3Q4UA 4ORKA 2VUWA 4FTTA 5CU0A 4RWKA 1KWPA 2WMWA 3AC5A 3E3BX 4AT3A 1SVEA 3SC1A 4QP7A 4AA5A 4NUSA 1OMWA 4A4OA 3ZM9A 4AF3A 3QCQA 4EOPA 5IUHA 4JI9A 4Q5HA 2WMVA 4CLJA 2V0DA 1M52A 2ZMDA 4R7HA 4RVTA 5BMSA 5HG9A 3CGFA 2P2HA 2CMWA 5B2LA 4OAUC 4Q5EA 3LJ1A 4OTDA 2VWWA 2XKDA 3QUPA 4RQVA 3U6IA 4QNYA 3G15A 3DDPA 5E8XA 3BHTA 3ZUTA 3FI4A 5B7VA 4TL0A 4ACHA 3FMKA 4AGCA 3COMA 4WA9A 4FKSA 2A4LA 5DMZA 4C7TA 5LJJA 3UQGA 3VS3A 4PDPA 4G3DA 5J8IA 3ZSHA 5I9ZA 5AA9A 1URCA 4TWNA 5L6WL 3RINA 1W84A 3CQUA 5G6VA 1YXSA 3TJDA 3Q6UA 3FZOA 3PSCA 4RVMA 4ANSA 4L3PA 1GZNA 3JPVA 3MSSA 1ZXEA 4FTUA 2X7FA 4NSTA 3QTUA 4G3CA 5HBJA 5CEIA 1YWVA 5E1SA 1TQIA 4C57A 4QMNA 5TKDA 3BEAA 1RQQA 2KTYA 1H1QA 3MTLA 4M12A 4D9TA 2BUJA 2HOGA 4FSWA 3VUHA 4ANBA 2GNLA 2RF9A 3WZUA 4KD1A 2WTCA 4BCIA 3DLSA 4JOAA 4DEHA 4F9WA 3DCVA 3H9FA 3Q3BA 4KUJA 2V7OA 3C0GA 2YZLA 1Y8YA 5HORA 3NUSA 3VO3A 3VQHA 5HQ0A 2BTRA 3QHRA 1TQMA 3CBLA 1QPEA 3OWPA 4JDHA 4ALUA 2OH0E 3DV3A 4RJ4A 4DGGA 3A7HA 2R5TA 4YJUA 2PSQA 3QTRA 4KIOA 1SNUA 4X2GA 3QRUA 2WQBA 4FZ6A 3H3CA 3TG1A 4MF0A 4RX7A 3EQFA 3LXKA 4TN6A 4UXQA 3RKBA 2BRHA 2UW9A 3JY0A 4KBAA 3NCZA 5HD7A 3WIGA 4G34A 4XUFA 5AR7A 4BCMA 3DBEA 4AZEA 4J1RA 2VTPA 2AYPA 3R7YA 4LFIA 2G2HA 3LLAA 2IJMA 3UO6A 3FC1X 3QLFA 4L01A 4RSSA 5HE3A 3S2PA 2W5HA 1STCE 2XKCA 3C4WA 3HV3A 4WOVA 5AV1A 5HEZA 5DWRA 4AZFA 4R1YA 2H96A 4RLKA 2P4IA 5AP1A 2QOOA 3DFAA 4BKJA 4CZUA 4FKVA 3IPHA 3LVPA 3K5VA 4C33A 2GS2A 1KOAA 4BBEA 1H25A 5BVNA 3S4QA 3P86A 1H24A 3E93A 5DR9A 5DT0A 3CPBA 5LVLA 4Y5HA 3RM7A 2O2UA 3DKFA 4FVQA 4BTJA 4DFZE 3F5GA 3PYYA 2V22A 4KBKA 3ATTA 4EK8A 3L1SA 2XNGA 4ZMFA 3BGQA 2W96B 2OFUA 4TRLA 1BMKA 4BCFA 4O7WA 2C0TA 3R8LA 1ZYDA 2BKZA 2VWVA 3PJ3A 4W8DA 2R2PA 3FLSA 5H3QA 4BI2A 4EK3A 3COKA 4GH2A 3ORPA 1ZYSA 4GT5A 5FP5A 4ZY5A 4IWPA 4U9AA 4ERWA 2QC6A 3R7EA 4HYUA 4L67A 2PMNX 1OKWA 4FVRA 1J7IA 2HK5A 3NIZA 1BL6A 5HZNA 3R8MA 4C3RA 4PDSA 4PP7A 4Q9SA 1CMKE 3NS9A 3ORNA 3PE1A 4EK6A 2XF0A 3QYWA 3KC3A 5I5ZA 3BYSA 4J52A 3I6UA 3W2RA 2PE1A 4ANMA 4CRLA 2VX3A 4R77A 4ID7A 4C62A 2IVSA 4O2ZA 5ICPA 3OXIA 1GZ8A 4MH7A 4ANQA 4UN0C 3QBNA 3L8SA 5GJGA 4S2ZA 5KMLA 3MWUA 4PQNA 2CKEA 3UMWA 5CU4A 3D83A 2J0IA 4TWPA 1O6LA 5KX8A 3GU6A 2IVVA 1WMKA 4UWCA 1GY3A 5DEYA 4U3ZA 5I9VA 4EUTA 2ITUA 3O17A 3TV7A 3ENHA 4HJOA 3SVVA 1XHAA 3PG3A 3C4FA 5AUXA 3VS5A 3HMMA 5K9IA 4CEGA 4ANOA 2ITVA 2XYUA 3S3IA 5IH6A 5KUPA 3BWJA 4R3PA 4YJOA 5LQFA 2HXLA 2CNQA 3R1NA 5AR5A 3TM0A 4A4XA 2C3IB 3CXWA 2YJRA 2WMBA 1JLUE 3EJ1A 2IPXA 4XP3A 2YIYA 2JDRA 2VWBA 2GFSA 4XOZA 3UNJA 3DBQA 1E1VA 3KVXA 2PE2A 1W7HA 4D2SA 2BPMA 5JK3A 5CF6A 1OKYA 1U4DA 1UNHA 2W4JA 2Y9QA 2ZJWA 1CTPE 1ZMVA 4HOKA 4X6QC 4BIEA 2UW7A 3VBYA 1JKLA 3HMNA 2GNHA 4EOSA 4YUQA 2I0HA 4J71A 3W32A 4JG6A 4FV9A 4BGHA 2WEVA 2UZBA 4C34A 1LPUA 3UOLA 3TZMA 1WBOA 2H6DA 4AE9A 1H1RA 4DBNA 3ORTA 4QTAA 4F09A 4FL2A 4P2KA 5CEPA 1H8FA 3FV8A 1YDRE 5M57A 4ZTMA 4B4LA 3EHAA 4F1MA 1E9HA 3NRMA 2V5QA 3PPZA 4CGAA 2OICA 3QGYA 4EC9A 4YSMA 4F7JA 3GGFA 5EYCA 2EB2A 3TKHA 1YWRA 1OIUA 3SOAA 4MNEB 4BDAA 4FSMA 2I0EA 3H30A 4KIQA 3KA0A 2C5XA 2YLFA 2FSLX 2YM3A 4EBWA 3HMOA 2G2IA 3GC8A 4DA5A 2GNGA 2UW4A 3Q5ZA 5L2TA 1LEWA 4I5HA 3SD0A 4IE9A 5AAFA 1EH4A 4EKLA 3DGKA 3ZO4A 2C6DA 3FPMA 4TKSA 1G8AA 3R9RA 4NU1A 2WD1A 4EUUA 2CN8A 2XM8A 3EWHA 3COIA 4AACA 1Q8ZA 4R5SA 4RMZA 4EOOA 4M66A 5HBEA 4UMUA 3F3ZA 1G8SA 3MTFA 4EQMA 5J9YA 3K3IA 4BTKA 3AGMA 3TCPA 3UZRA 3CS9A 4FTCA 3L8XA 5ANJA 4NH1A 4FKRA 2CLXA 4YO6A 4IAZA 5IUGA 1BYGA 4KSQA 4FV6A 4LOQA 4QYHA 2W4OA 3FLQA 3C51A 3K2LA 2IW6A 3BKBA 3F61A 5BYZA 3TDVA 3GENA 3IW4A 4ZJVA 1CM8A 2V62A 3NLBA 5KHWA 2VZ6A 4IB5A 4JBVA 1H27A 4PNIA 5AP5A 4QMUA 5DYJA 3TV4A 3BHVA 3UQFA 2UZWE 3PPJA 4Z3VA 4O91A 5DT4A 4FTNA 5F20A 4XS2A 3MFUA 3VBVA 5FXSA 4N4SA 1XH6A 3MS9A 3K5UA 3LCTA 3EQIA 1OZ1A 1QMZA 4P5ZA 3SHEA 4YTFA 5GZAA 5IQBA 3UPZA 1R3CA 5EM7A 4A9RA 2JKQA 3R9DA 2OIBA 4FL1A 3SRVB 4AA4A 3QZGA 3OOMA 3LCKA 4ZK5A 2WOUA 1UKHA 4HVHA 1XBCA 3GCPA 3IW7A 3OY3A 4FSYA 4WNPA 3ZC6A 4F99A 5IF1A 3MH2A 2PU8A 2B52A 5A4CA 2YCRA 2OKRA 3FMEA 2YWPA 4AU8A 2WO6A 2V7AA 4QP2A 2YA9A 2IO6A 4ONAA 3F88A 3NIEA 4ZTSA 3T3UA 3QHWA 2QONA 2X4FA 2WQMA 3CR0A 2R3HA 3FKLA 4D28A 3C5UA 1YDSE 5M06A 3W10A 3DK7A 5B2KA 2PZYA 2Y8OA 3DKGA 5HGIA 4MQ2A 2OXYA 4BCQA 1YI4A 3DPKA 4TWOA 2R7BA 2UZTA 4DGNA 3D7TB 3DQWA 2ZMCA 4FTKA 4BIBA 1G5SA 4XLIA 1A9UA 1Q61A 2VGPA 3KRLA 3ZC5A 4HYSA 3TV6A 4HNFA 4E4XA 3F3WA 2O3PA 3C4ZA 4BDKA 4V0GB 5EDPA 4P7EA 4BHZA 2B1PA 4OR5A 2UW0A 2BCJA 3C9WA 2J4ZA 5CALA 3SGCA 4U97A 5FUTA 3FXXA 3MPAA 4I1ZA 5DA3A 3BQCA 1U54A 4U0IA 5HLWA 4FV2A 4GK3A 5EDRA 3VHKA 3F69A 3LM5A 3HP5A 3R63A 4RJ3A 3WI6A 5CAOA 4OTQA 3EB0A 3ANRA 1J7LA 3R04A 3RWQA 3VAPA 3G9LX 4U40A 5KMKA 2QHMA 3ORMA 3O23A 4DINA 2QO7A 3EL7A 4KB8A 3SXRA 5D7AA 1HOWA 5H8BA 5A3XA 1H4LA 2VU3A 4FUYA 2JKOA 2P2IA 4KRCA 5GJDA 2QI8A 3QQHA 2QVSE 2IVUA 4B9DA 2RL5A 5GZ8A 3VUTA 5TT7A 4DH5A 3OCBA 4NT4A 2VTTA 3CY3A 2C69A 3F82A 4OLIA 4WO5A 4YO4A 3FPQA 3L8VA 4JRNA 4U43A 2QO9A 2Y0AA 2A27A 4PMMA 3OT3A 4WRSA 4E73A 5IMEA 5HE1A 3DDQA 4JL9A 4JDJA 3EYHA 1Y91A 3PG1A 1BX6A 2VO6A 2W1IA 4X3FC 5A46A 3FMLA 1FGKA 5CU2A 3AC8A 1A06A 1Z5MA 5TO8A 1WBSA 2V55A 4HZRA 3R73A 3TKIA 4K18A 1PXJA 3MW1A 3OEZA 4KKGA 2P55A 4FZDB 3TI1A 1FGIA 4E3CA 1JKSA 2XIYA 4FTMA 4O0WA 4RIOA 1E1XA 1GOLA 3FLNC 4QMYA 5DEWA 4IWOA 5IH4A 2YITA 3P08A 2WOTA 2XA4A 4HGLA 3PWDA 4RQKA 5I3RA 5JQ5A 2ZV8A 3QQJA 5H2UA 2GQSA 1UVRA 4KIKB 3QQUA 5IA0A 3E88A 4KKEA 5HNBA 2B7AA 2DQ7X 3POZA 3A8WA 4L44A 4OUCA 5E8UA 1IRKA 4U8ZA 2R3OA 3E3PA 2GHMA 2ZV2A 3E8DA 3EQBA 4JBOA 2HCKA 4PPCA 5DH3A 3VJOA 2NO3A 2VWZA 3GEQA 4KS7A 2J0JA 4CKRA 3CPCA 3MY1A 4EH2A 3HV4A 1YW2A 4AZWA 2HWOA 2WQEA 1OL1A 2JIIA 3LOKA 2C6LA 3GCSA 3AC3A 4FC0A 4O22A 4ZXTA 3CC6A 4UBAA 4CV9A 2BILB 2UZVA 2XJ0A 3D4QA 3PRFA 4FUXA 4ZSGA 5KZ0A 4QTDA 4PL3A 2EVAA 5AUVA 3BIZA 4I0RA 5AX9A 4OBQA 4L68A 4GU6A 4CXAA 5CAQA 5D11A 1PMVA 4BR3A 1K9AA 4FKPA 5LMBA 2ZV7A 5HESA 2EU9A 4NKAA 1NVSA 2BVAA 3VBTA 3VUGA 3HRBA 4EH5A 2VAGA 2DYLA 4EC8A 2R3NA 2AUHA 3D2IA 3OUNB 4QYGA 5FD2A 4C37A 4F64A 3OC1A 4PMTA 1R78A 2F9GA 3WYXA 3ZS5A 2REIA 3NUXA 4BYJA 3MIYA 2W9ZB 3GQIA 4IHPA 4BTMA 4YURA 4IH8A 4F9CA 3ODYX 5ANKA 5AV2A 3NUNA 2XVDA 5H8EA 3UGCA 3FEGA 3TT0A 2YIWA 3EQGA 4ZTLA 3ZRMA 4QMWA 4JAJA 4QQTA 3VF9A 4AW1A 5AP0A 2C1AA 1FPUA 2R3MA 4BCPA 1CKJA 4H3BA 5E91A 3F66A 5LMKC 1FOTA 3Q96A 4QMSA 1UKIA 4MKCA 1OUKA 1PKGA 2XRWA 4C4HA 2XRUA 5A4LA 4I41A 5GINE 3QA8A 2YZAA 4IVDA 4ZLYA 3ERKA 4JQ7A 4QQCA 3CCNA 5F4NA 3LMHA 4MTAA 3AT2A 2OWBA 3PXKA 2IWIA 3LMIA 2XJ1A 4NIFA 4DFYA 3LFQA 3MIAA 4I94A 2WKMA 1W82A 2XNBA 4YP8A 4PY1A 4AN2A 4D0WA 2YDIA 1UU8A 2G01A 2IZRA 3UZTA 1YOLA 3QGWA 4UY9A 4NM0A 2X1NA 3BZ3A 3PP0A 5CAPA 5IA4A 4PTGA 4O0YA 1KE8A 3C13A 3IECA 3RK7A 2JLDA 5EI2A 4CZTA 3BLHA 5KHXA 3DY7A 3HYHA 5EI8A 4C8BA 2JGZA 2BAJA 2CCHA 2GHGA 3QA0A 4J99A 1QPJA 1YDTE 2PE0A 4RIXA 2PUPA 3A99A 1YHWA 4FV3A 5IISA 5A4TA 1JWHA 2FUMA 2IZUA 4CQEA 4EJNA 3E64A 4JJRA 4FKJA 2A19B 3TEIA 2Z60A 4R8QA 4ACDA 4BDDA 4MWIA 4JQEA 3QZFA 4BWPA 5IQFA 4O0SA 3VHEA 3EZVA 3OY1A 4CTCA 5L3AA 3IQ7A 4U42A 5DIAA 2I1MA 4S32A 3ALNA 3WZDA 3EN4A 3OP5A 3T8OA 4FKUA 3RP9A 4D4VA 4R1VA 4BYIA 3MH0A 4FOBA 1FVTA 3HX4A 2BHHA 5IQIA 5CI7A 4C4EA 4ENYA 1A48A 1XO2B 4Q2AA 4N0SA 2O8YA 3CKWA 2HAKA 4RLLA 3U8WA 2ZDUA 4EOMA 3NNWA 3AD4A 1REKA 4EORA 4FTQA 3SDJA 3R9OA 4O7RA 4O6EA 1UU9A 4YLLA 4XG6A 3TNHA 3R01A 2ITXA 2ONLA 3UE4A 2WMXA 4RWLA 4DHFA 4DGLC 4IC8A 4XLVA 3TIYA 4BI1A 4KRDA 5DRDA 5HCZA 5AUUA 4ZS0A 5AP4A 3PP1A 4AT4A 5IEXA 4D1SA 4YBJA 3IGOA 4BY9E 4I93A 2OFVA 1FVVA 1MQ4A 1T46A 3HDMA 3ZO2A 2FB8A 4BF2A 4BCKA 3QLGA 3RAKA 3HAVA 3U51A 5FQDC 5BUJA 5JZJA 1GIIA 3VIDA 3VQUA 4E93A 2P0CA 4E6CA 5J95A 1ZLTA 3ZLYA 1FINA 4FGRA 2QU5A 1XH4A 4AG8A 1VZOA 4O86A 1ERKA 3LFBA 2E9UA 3A62A 4QMTA 3COHA 5B0XA 3H9OA 4EWHA 4N6ZA 5AV4A 4I6QA 5HVYA 3HP2A 2ACXA 3OMVA 2XK7A 4BFMA 3BGZA 2Q83A 4RC3A 4UALA 4D4RA 2W1ZA 3OVVA 3R8UA 5KBQA 3AOXA 4E1ZA 1SMHA 3NW6A 3DKCA 2X8EA 3PVUA 2BR1A 3VS7A 3EH9A 2ERKA 1M2QA 2YM8A 4BGGA 2IZTA 1H26A 3A7FA 4B7TA 5FDXA 5M55A 1RE8A 4XMOA 2OIDA 4QMPA 5C4LA 3QRKA 2WQNA 4NW6A 4HPTE 3AXWA 1Q5KA 3FMHA 2F2CB 4XBRA 2OI4X 3I1AA 3I5NA 3OT8A 1PY5A 4G6NA 4QQJA 1JPAA 4IDVA 3FC2A 5FTOA 1MP8A 4R6VA 4QYFA 2VTHA 5FTQA 4RFMA 5EK7A 3JVSA 3ZTXA 4X7QA 4R5YA 3UG1A 1TKIA 4NEUA 4XV3A 3QRIA 3GU7A 5CXHA 5JFXA 2ITTA 3F7WA 2YEXA 3UIXA 4QNAA 3NEWA 4U44A 1XBBA 2LAVA 4GG7A 4E20A 3CEKA 3NYNA 2YCFA 5FGKA 3FI2A 5IH5A 4R78A 4ZMEA 4O0RA 3MN3A 3GXLA 4AW5A 4D2WA 3N4UA 2NP8A 4FSUA 3KFAA 2I7QA 3M11A 1APME 2W9FB 3Q4TA 3FJQE 1B6CB 3LXPA 1REJA 4PL4A 4IAAA 5ANEA 4AOTA 3NNUA 5FDPA 2PVNA 3HV6A 1Q4LA 1T45A 2PZIA 2C6KA 4C61A 3N4TA 2PVMA 3GB2A 3OXZA 4IX4A 5F95A 4TYGA 4X2NA 3IK3A 3MVJA 4NKSA 5EH0A 4R7IA 2GMXA 1V0PA 2KULA 2X6EA 4ASXA 3MB7A 3EKNA 4FKTA 4F1TA 2NNWB 3B8RA 4AUAA 5E1EA 4C02A 5M44A 3EN5A 4E4LA 1CDKA 3ZLXA 4FI1A 5LXMA 3LJ2A 1R0PA 3W1FA 1RW8A 4DEAA 4RWJA 3MH3A 4C3PA 4YHTA 1M7NA 4BCHA 3ORXA 4RG0A 4AOIA 4TYEA 2JBPA 2JDOA 1Q97A 2R9SA 4C2WA 4WBBB 3BPRA 3TJCA 4RBLA 3SG8A 2BIKB 3NNXA 3CSVA 3BRBA 3BE9A 5AUTA 2XIZA 4NJDA 3EYGA 2QLQA 3AMBA 3QWJA 5IQHA 4CMTA 5DE2A 5TR6A 5HU3A 2F7ZE 4DFBA 3I7BA 3P1AA 2GTMA 2XMYA 4XEYA 4YGAA 1AGWA 3QKMA 4FNYA 3D15A 1YOMA 5L2QA 4GU9A 2CN5A 5I3OA 3R71A 5AP6A 3P78A 4GKHA 2QKRA 4I0SA 2PUNA 2WNTA 4ZEGA 3ZDUA 5AP3A 2WTKB 3KXXA 5CAUA 4EH3A 3NNVA 2JAMA 4B0GA 1PRYA 5IQCA 2J7TA 3NW7A 4CMOA 3Q53A 5CVGA 1YRPA 5I9YA 3WF6A 3LQ5A 3OWLA 3IOKA 3DXQA 4C4IA 4AXAA 5HOAA 4K0YA 4JBPA 1CSNA 4GYIA 4AWIA 2R3JA 4FOCA 4C38A 5IU2A 2W1HA 4IB1A 3LQ3A 3FBVA 4ACCA 2XCHA 3R9NA 5GIPE 4A9TA 4ZAUA 3VRZA 1B38A 4FSTA 1WAKA 2OJFE 4IFGA 4L7FA 4QP3A 4E6AA 3UTOA 3UC3A 3VVHA 5A54A 2FSOX 3LQ8A 3H0ZA 3GVUA 4QYEA 4F9AA 4GUBA 2IZSA 4GT4A 3V8SA 5CF5A 3NYXA 1H00A 4F6WA 3RZFA 5KMNA 1H1PA 4CTBA 3R7IA 3PIZA 4IB3A 4F08A 1LR4A 3ZOSA 2PYWA 2DWBA 4FTLA 1G3NA 1PXNA 2ZYBA 4IX6A 4J7BA 2R3KA 4JDKA 4IM3A 4GEOA 4UZDA 4AFJA 4K11A 4HCTA 5AUZA 2YN8A 3TZ8A 4JBQA 4ITIA 4O7YA 4FT5A 4I6HA 4YZ9A 5EYMA 2B9IA 3V6RA 2YDJA 4L42A 4BC6A 4I23A 1WVWA 2OGVA 3ATSA 3MPTA 4S30A 2GQGA 2JIVA 3KRJA 3OFMA 4J98A 1XH7A 4IMYA 1K3AA 4FV0A 4FX3A 3WF7A 3HL7A 1PW2A 3QD2B 4U81A 4UZHA 3MBLA 4OT6A 4BTFA 4HVSA 4MD9E 3NAXA 2B9FA 4XG4A 2C30A 5D1JA 3KN5A 4RJ8A 1ZY5A 4FT3A 2BZKB 5AUWA 3I4BA 2PVYA 1YOJA 4D0XA 3BV2A 5AM7A 2YM7A 1J3HA 3V04A 4D2VA 2BKKA 4EH8A 2Y4PA 3FMMA 3ZBXA 3GU4A 1L8TA 3WF9A 1PF8A 4GVAA 3FL5A 1JAMA 3MH1A 3RK5A 3Q2JA 3GI3A 3SXFA 3JUHA 2FH9A 3PWYA 4QP4A 4IACA 5FLFA 3WOWA 3V8WA 3ZO3A 4BN1A 2XNOA 4YMJA 3MPMA 5LCKA 1MRYA 4YPDA 4YJVA 5CLPA 4WNMA 3C4EA 4EK5A 2C4GA 3PZEA 5EOBA 5HO7A 4O7VA 2EXCX 3TKUA 5CEMA 4DT9A 2R3GA 1Q3DA 4XNEA 4OTIA 3V5LA 2CCIA 3A7GA 5F9EA 2VTRA 4L3JA 2WTVA 4PUZA 3UNKA 2B9JA 2UZNA 4CVAA 3N9XA 3MFRA 3HMPA 5EOLA 3UC4A 5DLSA 3UP2A 2J0LA 4NCTA 4IAIA 5M08A 2XIXA 2JFMA 3B2TA 3NPCA 4IZAA 3RCJA 4JG7A 5HCYA 4I92A 2HY0A 3FXWA 4IM2A 4L6QA 4ZTQA 5BNJA 1Y8GA 3U9NA 3LCDA 5EYDA 4Z7HA 3OTVA 2VGOA 3BHHA 3G6HA 4H1MA 4NJ3A 3QWKA 4QYYA 5JGBA 1DAYA 3ZLSA 4M3QA 1ZOHA 4CYIA 2W5BA 4W8EA 3ANQA 3G51A 3KMMA 4IAKA 5FM2A 2W99B 4FZ7A 4II5A 4FG7A 5KO1A 4O6LA 1IAHA 5C03A 1IA8A 3FLYA 1XH5A 3DAEA 4PRJA 3ZZWA 4IANA 1J1BA 4C3FA 3F5UA 4XP2A 5HNGA 1S9IA 2GQRA 2I0VA 5EW8A 4RZVA 1YXTA 3OD6X 3QKKA 5K3YA 2QLUA 2UZOA 2QR8A 2BZIB 3I5ZA 3JYAA 1IASA 3OS3A 3PA4A 4DC2A 5EFQA 2NRYA 4XBUA 3L8PA 5KNJA 3DJ6A 2X9EA 3UIBA 3HVCA 5AUYA 4BBMA 1R1WA 4Y95A 4RPVA 1U54B 4LV8A 3HGKA 2BMCA 3Q32A 1UV5A 4WRGA 4YLKA 3CP9A 3MJ2A 3MESA 3A7IA 3NGAA 2IG7A 2PHKA 2J6MA 4GK2A 4H39A 3BHYA 1H0WA 1GZKA 1WVYA 3UZPA 5FEEA 3DNDA 4BDBA 2OH4A 3W2SA 4FYNA 5CF4A 3MV5A 3O2MA 3HRFA 1YXUA 3RHKA 5HO8A 5JH6A 3D94A 3TZ9A 1UNGA 4EHVA 3ORIA 4UMTA 3LCSA 3P7CA 5J9ZA 5HTIA 3R1QA 4FK3A 4QP9A 3T9TA 5A6NA 3KQ7A 4PP9A 4UMRA 3TUDA 5T68A 4D1XA 4QD6A 3UYSA 3CIKA 3P23A 4PX6A 5IQGA 4I5CA 4J96A 3WZJA 5AEPA 3RHXA 3QX4A 3QTQA 1UU3A 5IUIA 2YERA 3QZHA 5JKGA 3KMWA 2CLQA 2R0IA 3HZTA 2VN9A 5JFVA 5JQ8A 2XK6A 3I79A 4C36A 1Q24A 1ZRZA 2GTNA 4AT5A 4HCVA 4NK9A 4G9CA 5BUIA 4ITHA 3IS5A 4CG9A 2BTSA 3KXZA 4W4YA 3E8CA 2OBJA 4G17A 4RZWA 4YJQA 4ZSJA 2VX1A 1NVQA 2UZDA 4DH1A 1CKIA 5J1VA 3EMGA 5EI6A 1Q8WA 1PHKA 4IZYA 2CSNA 3RM6A 3C4XA 1PXKA 3MDYA 1J91A 4FV4A 5GNKA 5C27A 3ZYAA 3UQCA 1U59A 3O8PA 4EONA 4JVGA 3NUAA 4JIAA 5DR2A 1XQZA 3BBTB 3ZHPC 2IN6A 5AX3A 2X2MA 3IDPA 3EQHA 2AC3A 3GBZA 4A9SA 4N57A 4LGGA 4FEUA 4O1OA 3FYKX 4IDTA 2PMLX 4AE6A 1PXPA 1NW1A 3QRTA 2PULA 4MX9A 4ZJIA 4ALVA 1NY3A 4MXZA 3UBDA 2YIXA 4NFNA 2FGIA 5AR4A 4NM3A 5CSHA 5AADA 2YABA 5L6PA 4UEUA 4ASZA 4LUEA 3KRXA 2R64A 3PDTA 5DVRA 4MXAA 4RC4A 4M97A 3BYVA 3DXNA 3PJ2A 2QOFA 5KE0A 3R8VA 3FZSA 4JG8A 5CXZA 4HVDA 3D14A 1NT2A 3AD6A 4DLJA 2ERZE 4CT1A 4ITJA 2QOHA 3CY2A 2QOCA 3VS4A 3P7AA 3W33A 4CCUA 5IA3A 2VTOA 4FZFB 5EHYA 4F6SA 4RA4A 3V8TA 4JRVA 4D5HA 5E7RA 4GG5A 4TY1A 5M4CA 3LFFA 2Z2WA 4UV0A 1OKVA 2EUFB 2ZM4A 5BX0A 5AMNA 5I0BA 1SM2A 4FTJA 1OVEA 2ZV9A 4C2VA 1KSWA 1FMKA 1GIHA 4X2KA 1XWSA 4LUDA 2X0GA 3EN7A 5DOSA 1LUFA 2PUUA 4PTCA 5AJQA 2WQOA 5TE0A 3LHJA 2OF2A 4I22A 4OBPA 3DAJA 4XG3A 4GFOA 3E63A 4CV8A 2W1CA 5HIEA 3W2CA 4O7ZA 3FLZA 2YHVA 4FTRA 3G0FA 3FUPA 1UA2A 4W4XA 3L9LA 3RTPA 4DFNA 3OWJA 2VWXA 5IZFA 5ACKA 1P4OA 3LJ0A 4C35A 2B54A 4NTSA 4Z55A 5A9UA 2VTIA 4M13A 3WZKA 4F70A 2O5KA 4AP7A 4MEDA 5ACBC 1IG1A 4BDHA 3Q60A 4TPTA 1KV1A 4UMQA 1MQBA 4Z7GA 3AG9A 1HCKA 3S1HA 1IR3A 4FSZA 4BBFA 2YM6A 4XCUA 2VTAA 4FIIA 4M67A 4GS6A 2F4JA 1YXVA 2H34A 4NIFB 3IKAA 4D2PA 4ZZNA 3OF0A 3R28A 3BV3A 5DNRA 4MHAA 3MVMA 3PVGA 4MWHA 2JKKA 3VUDA 4Z9LA 2ITOA 5E8SA 4DCAA 3R22A 3KY2A 2P3GX 4XG2A 1OGUA 3F3TA 3O0GA 5D7VA 4B6LA 3V6SA 3GU8A 4RIWA 1DM2A 2Z7SA 3FZ1A 3FAAA 2VNWA 3Q2MA 3FSKA 3PVBA 3WE8A 4F0IA 3NUYA 3B2WA 2E9PA 5EHLA 5CASA 3VW8A 4FE2A 3JVRA 3JXWA 4RIXB 5AA8A 3QAME 2UV2A 3R30A 4AS0A 3QC4A 4JR3A 1SVHA 1P4FA 4BDJA 2JFLA 4Y83A 2ESMA 4GSBA 3UVPA 2X2LA 2ZM1A 5AP7A 3RCDA 1HCLA 5C8MA 3OCGA 3DT1A 3Q5IA 5CEQA 3UOHA 2JBOA 3C7QA 3CTHA 5A14A 4QMMA 4UMPA 1VJYA 1MRUA 1ZMWA 4BZNA 4EHZA 3E92A 3UPXA 1JQHA 3TIZA 2C5OA 3UIMA 3R7VA 2XNEA 5J5TA 2WMSA 1JBPE 3U87A 2C0IA 3DB8A 4PNKA 5CSPA 4S34A 5HICA 3ZSGA 4FNXA 4UB7A 5LVOA 1RDQE 4CRSA 3N4VA 5L2SA 3SW4A 4PDOA 4ACGA 3KULB 4IEBA 3BU5A 1W8CA 5CTPA 3RWPA 3VJNA 3A60A 4BCJA 2GPHA 5JGDA 2QOIA 3DJ7A 4FYOA 3MY5A 3KCFA 4GFMA 5JFWA 1U5RA 2OK1A 2QKWB 2GS6A 2WB8A 4G2FA 4YC8A 5CAVA 5JRQA 5JFSA 5DRBA 5LARA 3A4OX 4DAWA 3R6XA 3C50A 5LVPA 3IDCA 4ZSEA 4F7SA 3JY9A 2XNPA 4KS8A 1OL6A 3KEXA 3LM0A 4FKWA 4TTHB 2XIRA 3RNYA 1M2PA 5AR8A 4DGOA 4G3FA 1TQPA 3GCQA 5EM8A 2YJSA 1JSTA 4X21A 2A0CX 4FKGA 4GT3A 1R0EA 1MRVA 2J5EA 5HG5A 4AW2A 2J0MB 4M68A 3E8NA 5LWNA 4QPAA 4BICA 4O0VA 1PYEA 1AD5A 2A2AA 4DITA 4EZ5A 2PK9A 3EL8A 3BU6A 3I0QA 3IO7A 4XV2A 4UXLA 1YWNA 4XRLA 4BCGA 4DT8A 3NW5A 3WYYA 5J79A 5JMSA 1OL7A 2OZOA 4LOOA 4G3EA 2G9XA 1WVXA 4C4FA 5E9EA 2YDKA 2W7XA 4KA3A 3GFWA 2UW5A 1V1KA 5AAEA 1YXXA 1WBWA 1OIQA 4YC6A 5CVHA 1I09A 4E5AX 4D4SA 2BDFA 4FKIA 2XEYA 4D58A 3DTWA 3TWJA 3UOKA 1YHSA 3U9CA 3LCOA 1QCFA 5KMMA 3F5XA 2EWAA 2R3LA 3U54A 4GIIA 2VTNA 3HEGA 3V5JA 4NL0A 4LQMA 4DTKA 3ODZX 2VO7A 1UWJA 2XIKA 3BLQA 3NYVA 4NZWB 2YAAA 5EG3A 5E92A 3MGYA 5EYKA 3AC4A 4LL0A 5LCJA 2W1FA 3CQEA 3O50A 4FTIA 4A9UA 3M2WA 3LFNA 2BFYA 2PZ5A 3FQSA 3EOCA 4ACMA 5C26A 1VEBA 3MA6A 2PZRA 3BYMA 5T3QA 3IW6A 3ZUVA 4W4VA 3OZ6A 4GJ2A 4J8MA 2X39A 3C5IA 4GVJA 4F7LA 5JZNA 3EFKA 4CT2A 5HLNA 5IG1A 5JT2A 4QT1A 1U46A 2CDZA 2QO2A 4JIKA 3ULIA 5M4UA 1OBDA 4WNKA 1LP4A 4IX3A 3AT3A 3TDWA 3Q9WA 4LRJA 2C6EA 2E2BA 1F0QA 3VUKA 4ZS4A 1DI8A 2PVLA 3DKOA 3PSBA 2QCSA 3T9IA 3AC2A 3O8TA 2R4BA 1SNXA 3G33A 3M42A 3KREA 4DG3E 3VULA 2BAKA 2VTMA 3OBGA 5AM6A 4X6RA 4USDA 3P4KA 4WNOA 2XCKA 4BL1A 2ZVAA 5KKRB 4O84A 5HHWA 2Y6OA 4L53A 3O7LD 2C3KA 4YZMA 4IVAA 5HE2A 2UW3A 2VNYA 3K3JA 3RPOA 2IVTA 4C59A 1PMEA 2OXDA 4AZSA 5KCVA 2R3PA 3U6HA 2ITQA 4TW9A 4AA0A 4F63A 2NPQA 3QX2A 2VTLA 2WTKC 2JITA 4LV5A 4NM5A 3W2PA 3A61A 4MYGA 2W1EA 2H9VA 3QD0A 4MXCA 3ZEPA 3REPA 3PA5A 3MB6A 4UX9A 2WPAA 5KMJA 2ETRA 4YZCA 5I9XA 3ZFYA 3P0MA 2OJJA 5EHOA 5ANDA 2BROA 5JEBA 4EH6A 2W1GA 3JR1A 4M14A 3VBXA 4EH4A 4CQGA 2EXMA 4ZTRA 4GRBA 2HWPA 3DBFA 3E7OA 4FEWA 2GNFA 1OL2A 4WG3A 4K1BA 5DN3A 3ORLA 2HYYA 3NVMB 3MJ1A 3KF4A 4ZTHA 3RGFA 4DYMA 4G31A 2I40A 4KINA 5FM3A 4V05A 4IX5A 5ANIA 3VS1A 4CFMA 4EZ3A 3Q6WA 4TNBA 3ROCA 1ZZ2A 2RFNA 2OU7A 2VD5A 4P5QA 2O64A 4F6UA 4FTAA 2J0KA 1XH8A 3CTJA 4AN9A 4IFCA 2VWYA 4YC3A 2B4SB 3O51A 2B53A 3VW6A 1FQ1B 2CGVA 4F0FA 4BIDA 2BRGA 2JDTA 3F6XA 4N70A 5ETIA 4IJ9A 3ZXTA 4R7BA 4QMVA 1WBTA 4FT9A 2HELA 5CSXA 4XHKB 5H9BA 3RPVA 2ETKA 4F9BA 4ANNA 2PVFA 4F0GA 4MVFA 1Q8TA 3NUUA 4JLCA 1URWA 5HG8A 4EL9A 4FIJA 1WZYA 4J53A 1JKKA 1PMNA 3ZEWA 5M56A 3FY2A 4XG7A 3W2OA 4L43A 5DT3A 2JAVA 4DEEA 2WMTA 4OT5A 4ZSAA 1ZYCA 4RA5A 4AOJA 1NA7A 4KIKA 3NWWA 3GT8A 4NWMA 3HUBA 4NW5A 1QPCA 2G2FA 2Y4IB 3ZZEA 1NVRA 5HVJA 4CKJA 2GCDA 4WD5A 4EQUA 2GNJA 3GP0A 3KXMA 3BYUA 3QCXA 5HIBA 4CMUA 2XBJA 4FIHA 4FSRA 2ZB1A 5IMXA 2JKMA 4H58A 4BCNA 5HNIX 3RPRA 3UJGA 3A2CA 3PXYA 5EM5A 3OWKA 4FT7A 4UWBA 3P7BA 3QQKA 5HBHA 3Q04A 5CZIA 4QO9A 4FV7A 2GFCA 4IVCA 3KU2A 2BFXA 3MVLA 3W16A 5FXRA 4LM5A 5HIDA 4EI4A 5GJFA 1ZYLA 3QTSA 1GZOA 4BB4A 4O83A 3ZRKA 3R7UA 2QR7A 3ULZA 3PXQA 1PJKA 3WF8A 3ZCLA 4FNWA 1Z9XA 3LKMA 3RI1A 4DG0E 4EWQA 3RPSA 4K9YA 4W4WA 3ZBFA 2R3IA 3E87A 4G16A 3WZEA 4YJNA 2HZNA 4KAOA 4CD0A 2XKFA 5I9WA 4O81A 3ITZA 4LI5A 1R39A 5ANGA 4KKHA 4PL5A 5BVEA 2XH5A 4C4GA 3AQVA 3W2QA 2E9NA 4RX8A 3OG7A 5J5SA 3QCSA 4WUNA 2WEIA 3TUBA 2QNJA 4F4PA 3LFDA 4DBXA 4G5PA 2YISA 3DS6A 4RJ7A 5JSMA 4DG2E 1M2RA 3UNZA 3F3UA 4EH9A 4OTHA 2XB7A 3OEFX 2C5YA 3W8QA 4HGEA 1GNGA 4JX7A 4F9YA 4M69A 2WGJA 4TYIA 1Q62A 5CWZA 4AZTA 4LRKA 4MK0A 4YBKA 2ITNA 3R1YA 1O6YA 2IW9A 2WTJA 3SXSA 3SKCA 2VTQA 3PXFA 4YSJA 4WT6A 3NUPA 2UW8A 2UUEA 4TYHA 1BL7A 2F7EE 3H10A 3LPBA 1Q8YA 1WBPA 3GFEA 4ZLZA 4PTEA 4QMLA 5KMIA 1H08A 2F7XE 2ZDTA 3PRIA 4H05A 3FY0A 4I5MA 4Y8DA 4RX5A 4UYNA 4AX8A 4RVLA 3L9NA 3D5WA 3TN8A 4NM7A 1KE6A 3EKKA 4IJPA 3AMYA 3R21A 5DHJA 3NSZA 1KOBA 5CNOA 4U6RA 3GC0A 2WU7A 5KZIA 5HCXA 2OW3A 3R02A 1W83A 4CSVA 3QQFA 3HV7A 3BWFA 1YKRA 3F2NA 4FKOA 5EM6A 3ZU7A 2C0OA 3DNEA 4M7IA 1QL6A 2I6LA 3SW7A 5EW3A 2RG5A 4LG4A 5CF8A 3QD3A 3RZBA 3LFAA 4P4CA 4DFUA 4FIEA 2HENA 2RG6A 2WIHA 4EHGA 3UYTA 2HIWA 2YLEA 2UW6A 3Q9YA 3ZRLA 4L52A 4GJ3A 3AD5A 1Q8UA 4CLIA 2X7GA 5J1WA 2Y7JA 3V01A 3V51A 2WXVA 3KMUA 4TWCA 4W9XA 4BWKA 1OKZA 4YU2A 5ETAA 2ITWA 4L7SA 5IKWA 5ETFA 2J2IB 4FBXA 3OBJA 2BIYA 2XM9A 5HX8A 1L3RE 4V01A 4O7LA 5M09A 2X6DA 2FSMX 4LYNA 4Y73A 5L8JA 1QPDA 4EHEA 3GNIB 4FT0A 3DBDA 5BMMA 1V0BA 3R1SA 5K5NA 2JC6A 5EKOA 4E4NA 2FVDA 3DLZA 3OUKA 4BI0A 3EZRA 5AAGA 2C6TA 3RAWA 2QHNA 3QL8A 3QXPA 5HI2A 3WF5A 3ZONA 4PF4A 5HO6A 4O1PA 3A8XA 2C68A 3CQWA 4S31A 3ZXZA 3LFEA 4FKLA 2BZHB 2RFDA 2JEDA 3DOGA 3G5DA 4FV1A 4EOJA 5J7BA 3UO5A 3PSDA 3SV0A 3KN6A 3SQQA 5I4NA 5K0XA 2XNMA 2B55A 2VWIA 5CU6A 1XH9A 3KB7A 3D5UA 3NYOA 3UODA 5CSVA 4X3FA 4M15A 3PE2A 4GKIA 3HRCA 3VS6A 5A6OA 4J97A 5IQAA 4RVKA 4ASDA 1PYXA 2QOBA 4BDFA 4U3YA 2FSTX 4HYIA 3TNIA 4L3LA 5A4QA 3H9RA 4C0TA 4BCOA 4BWXA 5IA2A 4FEQA 4CFNA 4BZDA 2WIPA 5FG8A 3BE2A 3FMDA 3H4JA 3VBWA 1Y57A 2PWLA 4EOKA 1OITA 4FR4A 4BDGA 4I5PA 4DFXE 3TL8A 2CNVA 1UNLA 3UIUA 2X4ZA 2UVYA 3D5XA 3R7GA 4A06A 4GL9A 4XX9A 5H8GA 3LFCA 4H36A 4JNWA 4EK4A 3FSFA 4O82A 3IOPA 5CX9A 4LGHA 3W55A 4B8LA 3CTQA 3EFWA 2PTKA 2YM4A 4D55A 4IAYA 4DH8A 2E9OA 3OCSA 5CEOA 5D12A 5IEVA 1J1CA 2C3LA 2QOKA 4IW0A 2X9FA 1V0OA 1DAWA 3E7VA 3R7OA 1Q3WA 3C0IA 2R0UA 3R2YA 2BDJA 3G9NA 4AGUA 3EIDA 5EKNA 4AN3A 4YPSA 3RK9A 3C0HA 5AV3A 2HZIA 5C1QB 4IAFA 4PV0A 3ZMMA 3NDMA 5FTGA 4CG8A 3NAYA 2XYNA 5HD4A 3LXNA 4PPAA 5FBNC 5CQWA 2BALA 5D9HA 3KRWA 4I6FA 1YI3A 3CGOA 5TF9A 4EKKA 1PXIA 1VR2A 3LFSA 5L8LA 4LMUA 3EFJA 4BHNA 3JS2A 4JX3A 4OTGA 4X0MA 5IDPA 2XZSA 3EFLA 5CANA 4X2FA 1LEZA 3AMAA 4BVUA 3NCGA 3E8EA 5DBXA 2HW6A 2RIOA 4IWDA 4OTFA 2JDSA 3GOPA 4I21A 3TACA 1H28A 1Q99A 4DLIA 2OJIA 4Q9ZA 2RGPA 3GQLA 4FGBA 3VWAA 3CE3A 3OTUA 3ALOA 5JRSA 2Q0BA 3LIJA 4HNIA 4EOLA 2ITZA 5A4EA 2WMRA 3POOA 4USFA 5DPVA 2QG5A 3BX5A 4U45A 4MXXA 2XBAA 2ZAZA 4ZTNA 3EQRA 4QMXA 4RT7A 4EEVA 3R2BA 4D1ZA 3PVWA 4RIYA 5LMKA 2OZAA 3DAKA 4E6QA 3QUEA 2HZ4A 1KE9A 1P14A 4AW0A 3QF9A 4FSNA 4IQ6A 2NRUA 2QODA 1TVOA 4EOIA 4JR7A 3O96A 2DS1A 3NR9A 3DBCA 3MFSA 3ZH8A 4OTWA 1UU7A 3G0EA 2O0UA 4WIHA 4QTBA 2P33A 3MI9A 3D5VA 2EXEA 4IZ5A 4DN5A 3ROYA 4RIWB 4FKQA 4FV8A 4XG9A 4RRVA 3EN9A 3ZM4A 1OM1A 4G5JA 5C9CA 1JVPP 4KBCA 3Q52A 4DEGA 5IPJA 4U79A 3UVRA 1IA9A 2R3QA 3HMIA 3HNGA 4J8NA 4O7SA 1NXKA 3OOGA 4DEBA 2O63A 3DJ5A 3I81A 3CJGA 3PTGA 4DH3A 2ZOQA 3TZ7A 3WE4A 5IDNA 4F1OA 2OG8A 1DS5A 1K2PA 3KF7A 2VO0A 3C1XA 4WG4A 3RALA 2OSCA 4K2RA 2ONLC 2PVJA 3FL4A 4YNEA 2WTWA 3KCKA 5AR3A 5J7HA 4FIFA 3N51A 1XJDA 3L9MA 4FK6A 3HKOA 4RC2A 2GHLA 4DTAA 2C5VA 4FTOA 5EW9A 1KE5A 2WMQA 4M8TA 5BVKA 1PKDA 5L4QA 3DXPA 1OPLA 2SRCA 3FI8A 5CVFA 1M14A 1SVGA 3FKOA 5CZHA 1IEPA 3PLAE 4AQCA 2W5AA 3DK3A 3H0YA 4X3JA 3DZQA 5GHVA 5EQYA 4DE4A 3U4UA 3ET7A 5E8ZA 1F3MC 2XK4A 3RNIA 3D9VA 4NTTA 3CLYA 4I3ZA 2UZLA 3BI6A 3KVWA 3R83A 4YJRA 4E6DA 3T3VA 2J50A 2B9HA 4E5BA 4TYJA 4FODA 2Y6MA 2VWUA 3OW3A 2XK9A 4K8AA 3SOCA 1S9JA 4K33A 2J51A 3ORZA 5E8YA 3HAMA 2QU6A 1ZOGA 4FIGA 3FQHA 3GOKA 4W9WA 3ZDIA 4LOPA 5BVOA 3BBWA 3UG2A 4CKIA 1U5QA 3LW0A 4IB0A 1PXLA 4HVIA 3FMJA 5DG5A 2Z7LA 4YZBA 3AC1A 5ITAA 3EQDA 3R8ZA 4JT3A 1B39A 3CKXA 5F1ZA 4PPBA 3QD4A 2VV9A 4U80A 4ZIMA 3IG7A 3ZFXA 3W18A 2FA2A 1OB3A 2OLCA 3I60A 2HXQA 4FVPA 4MQ1A 4IIRA 4HZSA 4B8MA 4ANLA 4C4JA 5E8VA 2BRMA 3R0TA 5BPYA 3Q9XA 3TNWA 4YHFA 4E8AA 4PMSA 3FZTA 2ZM3A 2W4KA 2CGXA 4L00A 2GSFA 5FWKK 2BAQA 2WMAA 3SLSA 4IM0A 4G1WA 3UP7A 4RJ6A 2PMOX 2VRXA 5DFPA 5C01A 3QCYA 3FKNA 5DR6A 1YQJA 5CI6A 2VO3A 1H0VA 4WBOA 3TNQB 2BZJA 3EQPA 4EYJA 4AFEA 3CD3A 5BQ0A 5K0KA 2X81A 4HGTA 4GFGA 3LZBA 3TXOA 5L6OA 4D5KA 5C8NA 1FMOE 2PVRA 4XOYA 4YZNA 3TTIA 4KSPA 1IAJA 4H3PA 3V3VA 4K77A 4E26A 2C5NA 4LGDA 5L2WA 1Y6BA 3NZ0A 2C3JA 4U41A 2JIUA 4HGSA 2DUVA 4XYFA 2W17A 3FXZA 4DEIA 4I4FA 4YR8A 4USEA 5KKRC 4GUEA 1PXMA 2R3RA 3PJ1A 4YTIA 3HLLA 3MY0A 3PFQA 3QU0A 4ZY6A 5HE0A 4O2PA 4ASEA 5ANOA 1W98A 3E62A 4O96A 5FRIA 5CSWA 4GYGA 3FDNA 4WSYA 4TXCA 3K54A 4QP1A 1OI9A 3IONA 5C8KA 5HVKA 5C4KA 1ZMUA 3FHIA 5CY3A 4RGJA 3DQXA 4MAOA 2VTJA 4HVGA 4N6YA 1FBNA 5CT7A 4ALWA 3C4CA 3GC7A 4O0TA 2WELA 4QOXA 5T6KA 2W06A 4A07A 2XNNA 4L9IA 4OTRA 1VYWA 4QRCA 4JS8A 2QQ7A 3KXHA 2YCSA 4V04A 1H1WA 4JQ8A 4CYJA 4HPUE 3GC9A 3VS0A 4ARKA 4TT7A 3CJFA 5BVWA 3OXTA 3ZUUA 3CD8A 3GUBA 3U55A 2XKEA 3RBWA 3PLSA 1O6KA 4ZZOA 1F5QA 3PXRA 1I44A 4XRJA 4U7ZA 4YHJA 3I6WA 5LWMA 3BLRA 2G15A 3DFCB 3ETAA 3EQCA 4Y46A 4YTCA 5CEKA 4OGRA 3QZIA 2C1BA 3DA6A 4R3CA 4BDEA 4K6ZA 3WBLA 3FMNA 4L46A 4IZ7A 4D2TA 4DTBA 2EB3A 2YACA 4X2JA 5ETCA 4FV5A 3TTJA 2WFYA 4JXFA 1J7UA 1GJOA 4LL5A 3UO4A 2CHLA 2YIRA 2X2KA 4G3GA 1GIJA 3VUMA 3WIKA 2H8HA 2Y4IC 4CZYB 5HU9A 1P5EA 4QTEA 4NFMA 4WUAA 2RFSA 4E4MA 3F7ZA 1AQ1A 3ACKA 3WILA 4QMQA 2Z02A 5M4IA 4MNEA 2GDOA 3Q4ZA 4M0YA 3UOJA 2Z8CA 3QALE 2G1TA 2VTSA 2A1AB 3QTZA 3QTXA 2PMIA 3MFTA 2XP2A 4QTCA 4BZOA 3QC9A 4PDYA 2RFEA 4PMPA 5K4JA 5CT0A 4DEDA 4C58A 4H3QA 4L45A 3M1SA 3F2AA
chains in the Genus database with same CATH superfamily
5AR2A 5M53A 2B0QA 3HUCA 1ZOEA 2XK8A 4TZRA 2UZEA 4TNDA 2I0YA 5DGZA 3VN9A 2CPKE 4DFLA 4F65A 3GCVA 2W05A 1Q41A 1H01A 4AAAA 3BL7A 5J87A 4JDIA 2Z7QA 2BRBA 4GK4A 3V5TA 3ZO1A 4O7TA 3E5AA 2QOLA 3VBQA 4CFFA 4ENXA 4GCJA 1WBVA 3KK9A 4EYMA 4EJ7A 1Z57A 4RWIA 5CNNA 1H1SA 4BDIA 2GNIA 3HA8A 1BUHA 1JSUA 2QOQA 1YI6A 3DTCA 3PIYA 4XJ0A 4Y85A 4YTHA 5FEDA 4BKZA 5HTBA 2C6IA 2HY81 3QYZA 4R3RA 1ZZLA 4WSQA 4EH7A 5IQDA 2YCQA 2CNUA 2BDWA 2WHBA 1OIRA 5M4FA 4ZLOA 4FG9A 2PVKA 4ERKA 4RFYA 1ZWSA 4CFVA 2UVXA 5AV0A 3HECA 1ZAOA 3R8PA 2OO8X 1JKTA 5FBOA 5K4IA 5CENA 3NMUF 4M0ZA 2BHEA 3ELJA 4ZZMA 3QQLA 4GW8A 1BKXA 3AGLA 4O0UA 5TOZA 4A7CA 4DH7A 5F94A 3VRYA 2CKPA 5HLPA 4YJTA 4QP6A 1OUYA 2J90A 2F2UA 4IWQA 4NCTC 1UWHA 5CYIA 2AC5A 3S00A 3SRVA 2WTIA 4FL3A 1BI7A 4HYHA 5M07A 4EZ7A 4H1JA 3QRJA 3KRRA 4AAYA 4IVBA 5FP6A 3S0OA 3QFVA 2CKQA 3BYOA 3HA6A 2RKUA 4M69B 4MBJA 3FLWA 4OBOA 4QP8A 3F2RA 2F49A 5BVDA 3EN6A 4KWPA 3G90X 1XKKA 4O0XA 4MD7E 4U5JA 4YZDA 3KKVA 5LVNA 3ENMA 1DI9A 3G6GA 3O8UA 2CJMA 3FZPA 5L2IA 3DU8A 4APPA 5K5XA 4TYHB 3BCEA 3D7TA 3QTWA 4KIPA 2PZPA 3KXGA 3IGGA 1ZARA 3TYKA 3AKJA 1WBNA 1WCCA 2O65A 4I4EA 4V0GA 1PMUA 4IBMA 3V5QA 3QKLA 3FE3A 3GCUA 3QQGA 4IXPA 2XJ2A 2YAKA 3UDBA 3ZSIA 2ETMA 5HG7A 4Z16A 4XG8A 1PXOA 3VF8A 3UMXA 2JD5A 3LXLA 4XP0A 5FEQA 3BQRA 3S95A 4QEBA 2WAJA 2ZB0A 2JDVA 3II5A 4WKQA 2OIQA 3F3VA 1BI8A 1X8BA 3HDNA 5GZ9A 4APCA 1OPKA 4D2RA 4ZY4A 1G8KA 3RAHA 3KL8A 4G6OA 2QURA 4GIHA 2X8DA 2VX0A 1FVRA 3BGPA 4MNFA 1ND4A 3VUIA 1OECA 5FXQA 2CGUA 2BRNA 4O27B 5G1XA 5D41A 4G9RA 5CU3A 1MUOA 1YHVA 3SX9A 3ID6C 4CNHA 4MXYA 4O7NA 4QQ5A 2XK3A 5IA1A 3P5KA 4MBLA 2QG7A 2CGWA 4YLJA 4CCBA 3RJCA 3IDBA 3G2FA 3LMGA 1OIYA 3PA3A 3D0EA 3BU3A 3LAUA 2R3FA 1M17A 2OXXA 4RX9A 4FEVA 4UWYA 3A4PA 3IW5A 3OCTA 5E8WA 4ZP5A 4I0TA 1KUTA 3A7JA 3HV5A 3TNPC 3VS2A 3PZHA 4CFWA 5KMOA 5GIOE 3SG9A 3THBA 5BYYA 4Y5QA 3B8QA 3PY3A 4FMQA 2CKOA 5BYLA 4AQKA 1YVJA 2W1DA 5AFVA 3KULA 3FZRA 3MYGA 3P9JA 3RVGA 3NVKI 2GU8A 2WZJA 3PIXA 3RAIA 3F5PA 2GS7A 5AIRA 3UVQA 1VYZA 5LMAA 3D2KA 5IQEA 4BRXA 3SAYA 1XBAA 1WFCA 4MD8E 4YNOA 5E90A 4DGMA 4OAVB 3W8LA 4DCEA 4DF3A 5B2MA 3L9PA 4FEXA 4HW7A 4FG8A 2J5FA 1W2DA 2UVZA 3PY0A 4X3FB 3I7CA 3O7LB 1SYKA 4A9YA 2ITPA 3GU5A 4ZJJA 5KBRA 4ZOGA 3BELA 5LOHA 2YM5A 4RFZA 4O21A 1M7QA 2F57A 4QMOA 4EBVA 3VC4A 1O9UA 4MF1A 3LLTA 5JN2A 4I6BA 2R7IA 2PL0A 3KGAA 2HW7A 3OROA 3Q9ZA 4I24A 1CKPA 1JOWB 1P2AA 3ML1A 5HTCA 2X7OA 4JAIA 2X0PA 3FI3A 3FWQA 5CQUA 5JGAA 2Q0NA 3NX8A 3OHTA 4RJ5A 4KABA 3F9NA 4QPMA 3P79A 2W0JA 4D9UA 3WARA 4XV9A 3U6JA 3ORKA 4WG5A 4BGQA 3ZLWA 1KV2A 4YJPA 4HCUA 2J9MA 4G6LA 3V5WA 4FZAB 3SA0A 2FO0A 3RPYA 2LGCA 2X8IA 3QUDA 4E5WA 4FA2A 5IA5A 4L8MA 4E7WA 4MXOA 5HKMA 1KE7A 5IEYA 1W0XC 2HZ0A 5BVFA 5EDQA 5M51A 5E8TA 4GMYA 2XEZA 1RJBA 4ZSLA 2WU6A 4EQCA 4IADA 3PJ8A 3PUPA 4FSQA 3PY1A 5E4HA 4KNBA 4PWNA 4QMZA 4OW8A 3R00A 4WHZA 3PPKA 4GV1A 2PPQA 2XS0A 2YFXA 4Y72A 4BKYA 3RMFA 3BHUA 3DK6A 2PY3A 5LVMA 5J9LA 1JNKA 2IW8A 4FF8A 4QPSA 2PVHA 3U4WA 2XUUA 5EQPA 1BLXA 3BEGA 5AIKA 4D4YA 3LE6A 3V5PA 3IW8A 3DB6A 4AGWA 1ATPE 3AT4A 3KK8A 3R9HA 1GAGA 4NYEA 1OL5A 1OPJA 2OJGA 4BDCA 4OTPA 4AGDA 1JSVA 3FHRA 3MVHA 3FQEA 4I20A 4LRMA 3MA3A 2UZUE 5DI1A 4F7NA 5BUEA 4BJJB 3KXNA 5AP2A 3QXOA 4AZVA 4B99A 2PUIA 2C6MA 4XH6A 2OJ9A 2Z7RA 4FNZA 3Q4CA 1OBGA 3TUCA 1SZMA 2ITYA 3ACJA 4S33A 4P90A 4CFXA 2E9VA 4XV1A 5L8KA 4A4LA 2WMUA 4CFUA 4MCVA 3OW4A 4J95A 2YWVA 5I9UA 2WTDA 3D7ZA 4YJSA 2FYSA 5D10A 2QD9A 4FICA 3I0OA 4IC7A 4RIYB 2OZAB 4UYAA 1H07A 5CS6A 3PJCA 3FYJX 1XR1A 1Y6AA 3QTIA 2C47A 4LMNA 4M84A 1ZYJA 4O38A 3VNTA 4EOQA 2RSVA 2C6OA 4MBIA 3ZFMA 5EQEA 3PXZA 3DZOA 1ZY4A 5AWMA 5HX6A 2OF4A 2YIQA 3O71A 3Q4UA 4ORKA 2VUWA 4FTTA 5CU0A 4RWKA 1KWPA 2WMWA 3AC5A 3E3BX 4AT3A 1SVEA 3SC1A 4QP7A 4AA5A 4NUSA 1OMWA 4A4OA 3ZM9A 4AF3A 3QCQA 4EOPA 5IUHA 4JI9A 4Q5HA 2WMVA 4CLJA 2V0DA 1M52A 2ZMDA 4R7HA 4RVTA 5BMSA 5HG9A 3CGFA 2P2HA 2CMWA 5B2LA 4OAUC 4Q5EA 3LJ1A 4OTDA 2IF8A 2VWWA 2XKDA 3QUPA 4RQVA 3U6IA 4QNYA 3G15A 3DDPA 5E8XA 3BHTA 3ZUTA 3FI4A 5B7VA 4TL0A 4ACHA 3FMKA 4AGCA 3COMA 4WA9A 4FKSA 2A4LA 5DMZA 4C7TA 5LJJA 3UQGA 3VS3A 4PDPA 4G3DA 5J8IA 3ZSHA 2A98A 5AA9A 1URCA 4TWNA 5L6WL 5I9ZA 3RINA 1W84A 3CQUA 5G6VA 1YXSA 3TJDA 3Q6UA 3AKKA 3FZOA 3PSCA 4RVMA 4ANSA 4L3PA 1GZNA 3JPVA 3MSSA 1ZXEA 4FTUA 2X7FA 4NSTA 3QTUA 4G3CA 5HBJA 5CEIA 1YWVA 5E1SA 1TQIA 4C57A 4QMNA 5TKDA 3BEAA 1RQQA 2KTYA 1H1QA 3MTLA 4M12A 4D9TA 2BUJA 2HOGA 4FSWA 3VUHA 4ANBA 2GNLA 2RF9A 3WZUA 4KD1A 2WTCA 4BCIA 3DLSA 4JOAA 4DEHA 4F9WA 3DCVA 3H9FA 3Q3BA 4KUJA 2V7OA 3C0GA 2YZLA 1Y8YA 5HORA 3NUSA 3VO3A 3VQHA 5HQ0A 2BTRA 3QHRA 1TQMA 3CBLA 1QPEA 3OWPA 4JDHA 4ALUA 2OH0E 3DV3A 4RJ4A 4DGGA 3A7HA 2R5TA 4YJUA 2PSQA 3QTRA 4KIOA 1SNUA 4X2GA 3QRUA 2WQBA 4FZ6A 3H3CA 3TG1A 4MF0A 4RX7A 3EQFA 3LXKA 4TN6A 4UXQA 3RKBA 2BRHA 2UW9A 3JY0A 4KBAA 3NCZA 5HD7A 3WIGA 4G34A 4XUFA 5AR7A 4DHJA 4BCMA 3DBEA 4AZEA 4J1RA 2VTPA 2AYPA 3R7YA 4LFIA 2G2HA 1TZDA 3LLAA 2IJMA 3UO6A 3FC1X 3QLFA 4L01A 4RSSA 5HE3A 3S2PA 2W5HA 1STCE 2XKCA 3C4WA 3HV3A 4WOVA 5AV1A 5HEZA 5DWRA 4AZFA 4R1YA 2H96A 4RLKA 2P4IA 5AP1A 2QOOA 3DFAA 4BKJA 4CZUA 4FKVA 4MUQA 3IPHA 3LVPA 3K5VA 4C33A 2GS2A 1KOAA 3UDSA 4BBEA 1H25A 5BVNA 3S4QA 3P86A 1H24A 3E93A 5DR9A 5DT0A 3CPBA 5LVLA 4Y5HA 3RM7A 2O2UA 3DKFA 4FVQA 4BTJA 4DFZE 3F5GA 3PYYA 2V22A 4KBKA 3ATTA 4EK8A 3L1SA 2XNGA 4ZMFA 3BGQA 2W96B 2OFUA 4TRLA 1BMKA 4BCFA 4O7WA 2C0TA 3R8LA 1ZYDA 2BKZA 2VWVA 3PJ3A 4W8DA 2R2PA 3FLSA 5H3QA 4BI2A 4EK3A 3COKA 4GH2A 3ORPA 1ZYSA 4GT5A 5FP5A 4ZY5A 4IWPA 4U9AA 4ERWA 2QC6A 3R7EA 4HYUA 4L67A 2PMNX 1OKWA 4FVRA 1J7IA 2HK5A 3NIZA 1BL6A 5HZNA 3R8MA 4C3RA 4PDSA 4PP7A 4Q9SA 1CMKE 3NS9A 3ORNA 3PE1A 4EK6A 2XF0A 3QYWA 3KC3A 5I5ZA 3BYSA 4J52A 3I6UA 3W2RA 2PE1A 4ANMA 4CRLA 2VX3A 4R77A 4ID7A 4C62A 2IVSA 4O2ZA 5ICPA 3OXIA 1GZ8A 4MH7A 4ANQA 4UN0C 3QBNA 1TFFA 3L8SA 5GJGA 4S2ZA 5KMLA 3MWUA 4PQNA 2CKEA 3UMWA 5CU4A 3D83A 2J0IA 4TWPA 1O6LA 5KX8A 3GU6A 2IVVA 1WMKA 4UWCA 1GY3A 5DEYA 4U3ZA 5I9VA 4EUTA 2ITUA 3O17A 3TV7A 3ENHA 4HJOA 3SVVA 1XHAA 3PG3A 3C4FA 5AUXA 3VS5A 3HMMA 5K9IA 4CEGA 4ANOA 2ITVA 2XYUA 3S3IA 5IH6A 5KUPA 3BWJA 4R3PA 4YJOA 5LQFA 2HXLA 3W0RA 2CNQA 3R1NA 5AR5A 3TM0A 4A4XA 2C3IB 4FRFA 3CXWA 2YJRA 2WMBA 1JLUE 3EJ1A 2IPXA 4XP3A 2YIYA 2JDRA 2VWBA 2GFSA 4XOZA 3UNJA 3DBQA 1E1VA 3KVXA 2PE2A 1W7HA 4D2SA 2BPMA 5JK3A 5CF6A 1OKYA 1U4DA 1UNHA 2W4JA 2Y9QA 2ZJWA 1CTPE 1ZMVA 4HOKA 4X6QC 4BIEA 2UW7A 3VBYA 1JKLA 3HMNA 2GNHA 4EOSA 4YUQA 2I0HA 4J71A 3W32A 4JG6A 4FV9A 4BGHA 2WEVA 2UZBA 4C34A 1LPUA 3UOLA 3TZMA 1WBOA 2H6DA 4AE9A 3UDTA 1H1RA 4DBNA 3ORTA 4QTAA 4F09A 4FL2A 4P2KA 5CEPA 1H8FA 3FV8A 1YDRE 5M57A 4ZTMA 4B4LA 3EHAA 4F1MA 1E9HA 3NRMA 2V5QA 3PPZA 4CGAA 2OICA 3QGYA 4EC9A 4YSMA 4F7JA 3GGFA 5EYCA 2EB2A 3TKHA 1YWRA 1OIUA 3SOAA 4MNEB 4BDAA 4FSMA 2I0EA 3H30A 4KIQA 3KA0A 2C5XA 2YLFA 2FSLX 2YM3A 4EBWA 3HMOA 2G2IA 3GC8A 4DA5A 2GNGA 2UW4A 3Q5ZA 5L2TA 1LEWA 4I5HA 3SD0A 4IE9A 5AAFA 1EH4A 4EKLA 3DGKA 3ZO4A 2C6DA 3FPMA 4TKSA 1G8AA 3R9RA 4NU1A 2WD1A 4EUUA 3BL9A 2CN8A 2XM8A 3EWHA 3COIA 4AACA 1Q8ZA 4R5SA 4RMZA 4EOOA 4M66A 5HBEA 4UMUA 3F3ZA 1G8SA 3MTFA 4EQMA 5J9YA 3K3IA 4BTKA 3AGMA 3TCPA 3UZRA 3CS9A 4FTCA 3L8XA 5ANJA 4NH1A 4FKRA 2CLXA 4YO6A 4IAZA 5IUGA 1BYGA 4KSQA 4FV6A 4LOQA 4QYHA 2W4OA 3FLQA 3C51A 3K2LA 2IW6A 3BKBA 3F61A 5BYZA 3TDVA 3GENA 3IW4A 4ZJVA 1CM8A 2V62A 1VLRA 3NLBA 5KHWA 2VZ6A 4IB5A 4JBVA 1H27A 4PNIA 5AP5A 4QMUA 5DYJA 3TV4A 3BHVA 3UQFA 2UZWE 3PPJA 4Z3VA 4O91A 5DT4A 4FTNA 5F20A 4XS2A 3MFUA 3VBVA 5FXSA 4N4SA 1XH6A 3MS9A 3K5UA 3LCTA 3EQIA 1OZ1A 1QMZA 4P5ZA 3SHEA 4YTFA 5GZAA 5IQBA 3UPZA 1R3CA 5EM7A 4A9RA 2JKQA 3R9DA 2OIBA 4FL1A 3SRVB 4AA4A 3QZGA 3OOMA 3LCKA 4ZK5A 2WOUA 1UKHA 4HVHA 1XBCA 3GCPA 3IW7A 3OY3A 4FSYA 4WNPA 3ZC6A 4F99A 5IF1A 3MH2A 2PU8A 3W0PA 2B52A 5A4CA 2YCRA 2OKRA 3FMEA 2YWPA 4AU8A 2WO6A 2V7AA 4QP2A 4AXEA 2YA9A 2IO6A 2NYAA 4ONAA 3F88A 3NIEA 4ZTSA 2XARA 3T3UA 3QHWA 2QONA 2X4FA 2WQMA 3CR0A 2R3HA 3FKLA 4D28A 3C5UA 1YDSE 3PFYA 5M06A 3W10A 3DK7A 5B2KA 4FJVA 2PZYA 2Y8OA 3DKGA 5HGIA 4MQ2A 2OXYA 4BCQA 1YI4A 3DPKA 4TWOA 2R7BA 2UZTA 4DGNA 3D7TB 3DQWA 2ZMCA 4FTKA 4BIBA 1G5SA 4XLIA 1A9UA 1Q61A 2VGPA 3KRLA 3ZC5A 4HYSA 3TV6A 4HNFA 4E4XA 3F3WA 2O3PA 3C4ZA 4BDKA 4V0GB 5EDPA 4P7EA 4BHZA 2B1PA 4OR5A 2UW0A 2BCJA 3C9WA 2J4ZA 5CALA 3SGCA 4U97A 5FUTA 3FXXA 3MPAA 4I1ZA 5DA3A 3BQCA 1U54A 4U0IA 5HLWA 4FV2A 4GK3A 5EDRA 3VHKA 3F69A 3LM5A 3HP5A 3R63A 4RJ3A 3WI6A 5CAOA 4OTQA 3EB0A 3ANRA 1J7LA 3R04A 3RWQA 3VAPA 3G9LX 4U40A 5KMKA 2QHMA 3ORMA 3O23A 4DINA 2QO7A 3EL7A 4KB8A 3SXRA 1G8JA 5D7AA 1HOWA 5H8BA 5A3XA 1H4LA 2VU3A 4FUYA 2JKOA 2P2IA 4KRCA 5GJDA 2QI8A 3QQHA 2QVSE 2IVUA 4B9DA 2RL5A 5GZ8A 3VUTA 5TT7A 4DH5A 3OCBA 4NT4A 2VTTA 3CY3A 2C69A 3F82A 4OLIA 4WO5A 4YO4A 3FPQA 3L8VA 4JRNA 4U43A 2QO9A 2Y0AA 2A27A 4PMMA 3OT3A 4WRSA 4E73A 5IMEA 5HE1A 3DDQA 4JL9A 4JDJA 4DDIA 3EYHA 1Y91A 3PG1A 1BX6A 2VO6A 2W1IA 4X3FC 5A46A 3FMLA 1FGKA 5CU2A 3AC8A 1A06A 1Z5MA 5TO8A 1WBSA 2V55A 4HZRA 3R73A 3TKIA 4K18A 1PXJA 3MW1A 3OEZA 4KKGA 2P55A 4FZDB 3TI1A 1FGIA 4E3CA 1JKSA 2XIYA 4FTMA 4O0WA 4RIOA 1E1XA 1GOLA 3FLNC 4QMYA 5DEWA 4IWOA 5IH4A 2YITA 3P08A 2WOTA 2XA4A 4HGLA 3PWDA 4RQKA 5I3RA 5JQ5A 2ZV8A 3QQJA 5H2UA 2GQSA 1UVRA 4KIKB 3P5JC 3QQUA 5IA0A 3E88A 4KKEA 5HNBA 2B7AA 2DQ7X 3POZA 3A8WA 4L44A 4OUCA 5E8UA 1IRKA 4U8ZA 2R3OA 3E3PA 2GHMA 2ZV2A 3E8DA 3EQBA 4JBOA 2HCKA 4PPCA 5DH3A 3VJOA 2NO3A 2VWZA 3GEQA 4KS7A 2J0JA 4CKRA 3CPCA 3MY1A 4EH2A 3HV4A 1YW2A 4AZWA 2HWOA 2WQEA 1OL1A 2JIIA 3LOKA 2C6LA 3GCSA 3AC3A 4FC0A 4O22A 4ZXTA 3CC6A 4UBAA 4CV9A 2BILB 2UZVA 2XJ0A 3D4QA 3PRFA 4FUXA 4ZSGA 5KZ0A 4QTDA 4PL3A 2EVAA 5AUVA 3BIZA 4I0RA 5AX9A 4OBQA 4L68A 4GU6A 4CXAA 5CAQA 5D11A 1PMVA 4BR3A 1K9AA 4FKPA 5LMBA 2ZV7A 5HESA 2EU9A 1XMMA 4NKAA 1NVSA 2BVAA 3VBTA 3VUGA 3HRBA 4EH5A 2VAGA 2DYLA 4EC8A 2R3NA 2AUHA 3D2IA 3OUNB 4QYGA 5FD2A 4C37A 4F64A 3OC1A 4PMTA 1R78A 2F9GA 3WYXA 3ZS5A 2REIA 3NUXA 4BYJA 3MIYA 2W9ZB 3GQIA 4IHPA 4BTMA 4YURA 4IH8A 4F9CA 3ODYX 5ANKA 5AV2A 3NUNA 2XVDA 5H8EA 3UGCA 3FEGA 3TT0A 2YIWA 3EQGA 4ZTLA 3ZRMA 4QMWA 4JAJA 4QQTA 3VF9A 4AW1A 5AP0A 2C1AA 1FPUA 2R3MA 4BCPA 1CKJA 4H3BA 5E91A 3F66A 5LMKC 1FOTA 3Q96A 4QMSA 1UKIA 4MKCA 1OUKA 1PKGA 2XRWA 4C4HA 2XRUA 5A4LA 4I41A 2XAOA 5GINE 3QA8A 2YZAA 4IVDA 4ZLYA 3ERKA 4JQ7A 4QQCA 3CCNA 5F4NA 3LMHA 4MTAA 3AT2A 2OWBA 3PXKA 2IWIA 3LMIA 2XJ1A 4NIFA 4DFYA 3LFQA 3MIAA 4I94A 2WKMA 1W82A 2XNBA 4YP8A 4PY1A 4AN2A 4D0WA 2YDIA 1UU8A 2G01A 2IZRA 3UZTA 1YOLA 3QGWA 4UY9A 4NM0A 2X1NA 3BZ3A 3PP0A 5CAPA 5IA4A 4PTGA 4O0YA 1KE8A 3C13A 3IECA 3RK7A 2JLDA 5EI2A 4CZTA 3BLHA 5KHXA 3DY7A 3HYHA 5EI8A 4C8BA 2JGZA 2BAJA 2CCHA 2GHGA 3QA0A 4J99A 1QPJA 1YDTE 2PE0A 4RIXA 2PUPA 3A99A 1YHWA 4FV3A 4LV7A 5IISA 5A4TA 1JWHA 2FUMA 2IZUA 4CQEA 4EJNA 3E64A 4JJRA 4FKJA 2A19B 3TEIA 2Z60A 4R8QA 4ACDA 4BDDA 4MWIA 4JQEA 3QZFA 4BWPA 5IQFA 4O0SA 3VHEA 3EZVA 3OY1A 4CTCA 4O4CA 5L3AA 3IQ7A 4U42A 5DIAA 2I1MA 4S32A 3ALNA 3WZDA 3EN4A 3OP5A 3T8OA 4FKUA 3RP9A 4D4VA 4R1VA 4BYIA 3MH0A 4FOBA 1FVTA 3HX4A 2BHHA 5IQIA 5CI7A 4C4EA 4ENYA 1A48A 1XO2B 4Q2AA 4N0SA 2O8YA 3CKWA 2HAKA 4RLLA 3U8WA 2ZDUA 4EOMA 3NNWA 3AD4A 1REKA 4EORA 4FTQA 3SDJA 3R9OA 4O7RA 4O6EA 1UU9A 4YLLA 4XG6A 3TNHA 3R01A 2ITXA 2ONLA 3UE4A 2WMXA 4RWLA 4DHFA 4DGLC 4IC8A 4XLVA 3TIYA 4BI1A 4KRDA 5DRDA 5HCZA 5AUUA 4ZS0A 5AP4A 3PP1A 4AT4A 5IEXA 4D1SA 4YBJA 3IGOA 4BY9E 4I93A 2OFVA 1FVVA 1MQ4A 1T46A 3HDMA 3ZO2A 2FB8A 4BF2A 4BCKA 3QLGA 3RAKA 3HAVA 3W0MA 3U51A 5FQDC 4O4BB 5BUJA 1GIIA 3VIDA 3VQUA 4E93A 5JZJA 2P0CA 4E6CA 5J95A 1ZLTA 3ZLYA 1FINA 4FGRA 2QU5A 1XH4A 4AG8A 1VZOA 4O86A 1ERKA 3LFBA 2E9UA 3A62A 4QMTA 3COHA 5B0XA 3H9OA 4EWHA 4N6ZA 5AV4A 4I6QA 5HVYA 3HP2A 2ACXA 3OMVA 1W2CA 2XK7A 4BFMA 3BGZA 2Q83A 4RC3A 4UALA 4D4RA 2W1ZA 3OVVA 3R8UA 5KBQA 3AOXA 4E1ZA 1SMHA 3NW6A 3DKCA 2X8EA 4O4DA 3PVUA 2BR1A 3VS7A 3EH9A 2ERKA 1M2QA 2YM8A 4BGGA 2IZTA 1H26A 3A7FA 4B7TA 5FDXA 5M55A 1RE8A 4XMOA 2OIDA 4QMPA 5C4LA 3QRKA 2WQNA 4NW6A 4HPTE 3AXWA 1Q5KA 3FMHA 2F2CB 4XBRA 2OI4X 3I1AA 3I5NA 3OT8A 1PY5A 4G6NA 4QQJA 1JPAA 4IDVA 3FC2A 5FTOA 1W2FA 1MP8A 4R6VA 4QYFA 2VTHA 5FTQA 4RFMA 5EK7A 3JVSA 3ZTXA 4X7QA 4R5YA 3UG1A 1TKIA 4NEUA 4XV3A 3QRIA 3GU7A 5CXHA 5JFXA 2ITTA 3F7WA 2YEXA 3UIXA 4QNAA 3NEWA 4U44A 1XBBA 2LAVA 4GG7A 4E20A 3CEKA 3NYNA 2YCFA 5FGKA 3FI2A 5IH5A 4R78A 4ZMEA 4O0RA 3MN3A 3GXLA 4AW5A 4D2WA 3N4UA 2NP8A 4FSUA 3KFAA 2I7QA 3M11A 1APME 2W9FB 3Q4TA 3FJQE 1B6CB 3LXPA 1REJA 4PL4A 4IAAA 5ANEA 4AOTA 3NNUA 5FDPA 2PVNA 3HV6A 1Q4LA 1T45A 2PZIA 2C6KA 4C61A 3N4TA 2PVMA 3GB2A 3OXZA 4IX4A 5F95A 4TYGA 4X2NA 3IK3A 3MVJA 4NKSA 5EH0A 4R7IA 2GMXA 1V0PA 2KULA 2X6EA 4ASXA 3MB7A 3EKNA 4FKTA 4F1TA 2NNWB 3B8RA 4AUAA 5E1EA 4C02A 4O4FA 5M44A 3EN5A 4E4LA 1CDKA 3ZLXA 4FI1A 5LXMA 3LJ2A 1R0PA 3W1FA 1RW8A 4DEAA 4RWJA 3MH3A 4C3PA 4YHTA 1M7NA 4BCHA 3ORXA 4RG0A 4AOIA 4TYEA 2JBPA 2JDOA 1Q97A 2R9SA 4C2WA 4WBBB 3BPRA 3TJCA 4RBLA 3SG8A 2BIKB 3NNXA 3CSVA 3BRBA 3BE9A 5AUTA 2XIZA 4NJDA 3EYGA 2QLQA 3AMBA 3QWJA 5IQHA 4CMTA 5DE2A 5TR6A 5HU3A 2F7ZE 4DFBA 3I7BA 3P1AA 2GTMA 2XMYA 4XEYA 4YGAA 1AGWA 3QKMA 4FNYA 3D15A 1YOMA 5L2QA 4GU9A 2CN5A 5I3OA 3R71A 5AP6A 3P78A 4GKHA 2QKRA 4I0SA 2PUNA 2WNTA 4ZEGA 3ZDUA 5AP3A 2WTKB 3KXXA 5CAUA 4EH3A 3NNVA 2JAMA 4B0GA 1PRYA 5IQCA 2J7TA 3NW7A 4CMOA 3Q53A 5CVGA 1YRPA 5I9YA 3WF6A 3LQ5A 3OWLA 3IOKA 3DXQA 4DHIB 4C4IA 4AXAA 5HOAA 4K0YA 4JBPA 1CSNA 4GYIA 4AWIA 2R3JA 4FOCA 4C38A 5IU2A 2W1HA 4IB1A 3LQ3A 3FBVA 4ACCA 2XCHA 3R9NA 3W0QA 4A9TA 4ZAUA 5GIPE 3VRZA 1B38A 4FSTA 1WAKA 2OJFE 4IFGA 4L7FA 4QP3A 4E6AA 3UTOA 3UC3A 3VVHA 5A54A 2FSOX 3LQ8A 3H0ZA 3GVUA 4QYEA 4F9AA 4GUBA 2IZSA 4GT4A 3V8SA 5CF5A 3NYXA 1H00A 4F6WA 3RZFA 5KMNA 1H1PA 4CTBA 3R7IA 3PIZA 4IB3A 4F08A 1LR4A 3ZOSA 2PYWA 2DWBA 4FTLA 1G3NA 1PXNA 2ZYBA 4IX6A 4J7BA 2R3KA 4JDKA 4IM3A 4GEOA 4UZDA 4AFJA 4K11A 4HCTA 5AUZA 2YN8A 3TZ8A 4JBQA 4ITIA 4O7YA 4FT5A 4I6HA 4YZ9A 5EYMA