4L00A

Crystal structure of the apo jak1 pseudokinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
277
Chain Sequence
WQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK1
publication title Structure of a pseudokinase-domain switch that controls oncogenic activation of Jak kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 277
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l00A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l00A01
3OG7A 3ZO3A 3WZEA 3VIDA 2BRNA 2QOQA 4I5MA 4QP8A 3OY1A 4E4NA 4H1JA 4F4PA 3OEZA 4RFYA 5H9BA 4BYIA 3SG9A 2YM8A 4H58A 2X81A 4GV1A 1A48A 5CI6A 5C4LA 5EDQA 5IQIA 5LWNA 4K1BA 3I6WA 3VJNA 4F65A 5D1JA 3O2MA 2GSFA 5DVRA 4GYGA 1EH4A 1CKIA 2I1MA 1KE8A 4AW5A 3DJ7A 2C3LA 2C6DA 2FB8A 4AN2A 2OXXA 4L00A 4KUJA 4RQKA 3NLBA 3DY7A 5LMAA 2PUUA 4G31A 2QOIA 5M07A 4LM5A 4USDA 1W82A 3CIKA 2R7BA 2XK8A 2R3OA 4F1MA 3KRXA 4F9AA 1NW1A 3AXWA 3FMNA 3Q4CA 4O38A 4QNAA 4DEAA 1E1VA 3LMHA 2XKDA 2EWAA 3K5VA 5HIDA 4LV8A 2J0IA 2W4OA 3QHRA 3MIYA 3Q4UA 4L46A 4TNBA 1OIUA 2IJMA 3QWJA 3ATSA 4WA9A 2XK9A 4E4XA 2C5YA 4R3PA 3T9IA 4Y8DA 4YC6A 2XKCA 1TVOA 3HEGA 3HP5A 2QLQA 4O0RA 4QP3A 3S3IA 2X7OA 3R1NA 4N0SA 1M2QA 2JBPA 3V01A 5JK3A 2C6OA 4KS7A 1FGIA 3DQXA 4NYEA 1Y6AA 3PXKA 5ANIA 1H1WA 3P08A 4FBXA 4L45A 1H27A 1U5QA 3ORIA 3NMUF 3OTVA 3DGKA 2G01A 2W1CA 4WRSA 1KE7A 3NW5A 5CU6A 1YWRA 4G1WA 4TWOA 3SOAA 2W5AA 2YAKA 3NUXA 4C0TA 4F99A 5JFXA 2JKOA 4X2NA 4EKLA 4EUUA 4ENYA 2X6DA 5ICPA 3VUMA 4I41A 2XEZA 1H07A 2AUHA 4NM7A 4XHKB 4BCGA 4EONA 4W8DA 3D5WA 3LQ3A 2ONLA 4UWCA 3TDVA 5E8VA 3LZBA 3MY1A 2W1GA 4E3CA 2RKUA 3MFRA 4DGGA 5DN3A 2BHHA 3Q6UA 1OL5A 3QGYA 4HGLA 4E5BA 3TUBA 3HA8A 2JIUA 2B54A 4BCPA 3A4OX 3NUNA 2HZNA 3DK6A 4OGRA 3MB7A 5GJFA 4MBIA 4YJRA 3SGCA 4CMTA 2W1IA 5HBJA 3FC2A 4DG2E 3TL8A 1UU9A 4PMSA 2W7XA 4P5QA 4XG2A 1XH9A 3MW1A 4JI9A 3TIYA 1LP4A 2J6MA 3ORKA 4EEVA 5CX9A 4FNZA 4FVRA 5A46A 3F61A 3FPQA 1XBCA 4G9RA 4GG5A 2BZIB 3D83A 4H36A 1Q24A 3BX5A 4XLVA 4EQMA 4RX9A 5EI8A 4E6QA 2YM4A 4HNFA 5AV3A 2RF9A 5AP2A 3PVBA 1GIJA 4QRCA 3HX4A 4RVLA 3M2WA 3ODYX 4ZP5A 1HCKA 4IJPA 4JL9A 4BDHA 4U40A 3QRKA 3WF6A 3ZC5A 3CE3A 4MAOA 1R0EA 2UZVA 4HW7A 3U4UA 1Y8YA 5J1WA 3QTRA 4FZAB 4C4FA 2J5EA 3FMLA 2QG7A 4JG8A 5AUXA 1J7UA 4DTKA 4EL9A 4O21A 5I3RA 3G2FA 3V3VA 2QU6A 4FIJA 3RZBA 1PXNA 2HAKA 5JMSA 4UN0C 5HTCA 2F4JA 2QKRA 3MA6A 2I7QA 5BYZA 2Q0BA 3KCKA 1Z5MA 3PXQA 4IJ9A 4IAYA 4XG8A 3LHJA 3R8MA 2YLEA 4H05A 2EXCX 4EHEA 3ZM9A 3KN5A 3OC1A 4R3CA 5CXHA 4EKKA 4FV2A 5EKOA 3REPA 3VS1A 2GTMA 2X2MA 4BZNA 4TL0A 3C4CA 2GS6A 2C1AA 3OOMA 3ZO1A 4BDDA 4YJOA 3P23A 2WEIA 3MSSA 2OH0E 4FUYA 4XRLA 3OFMA 5L4QA 1WVXA 5AV1A 2VTMA 4Q5HA 3E3PA 3OUNB 3QQKA 3C4ZA 4BGHA 4CT1A 5AA9A 5CYIA 4R78A 3DKCA 4JG7A 4M8TA 4BDBA 1MRVA 1WVWA 5D11A 1SNUA 2HZIA 2A1AB 3F6XA 5HICA 4O6LA 3G9NA 4MF0A 3TKHA 3TNWA 4QYYA 2CGWA 2XB7A 3E62A 3E8DA 5TKDA 4R8QA 4DG3E 4EH3A 4LL0A 4ZY4A 1JOWB 3WF8A 3HRBA 4II5A 1UWJA 4PF4A 4RZVA 3IGOA 3QD3A 4Z7GA 5K9IA 5KMOA 2GHGA 3V5WA 3D0EA 3MPMA 4WG4A 4C59A 4C62A 3SX9A 3A4PA 1OKWA 3IW4A 2FSLX 5ACKA 4NM0A 1Q61A 4YTHA 4I20A 4XV1A 3DDQA 1DI9A 3GC0A 4D0WA 1U4DA 3CXWA 3A7JA 4PL3A 1ZAOA 3NPCA 3LFCA 1LUFA 3TNHA 4DGNA 4ZS4A 4EH6A 3VUIA 2W5HA 3PA3A 2OIQA 4FYNA 4AX8A 1OL2A 3P4KA 4M69B 3UNKA 2IVVA 4KKHA 4GCJA 4IVDA 3UMXA 3WZUA 4XH6A 5LVMA 2BFYA 2XZSA 5E9EA 1OVEA 4FL3A 4FVPA 2YDJA 2FGIA 4BC6A 1J7IA 4FZDB 5DRDA 1YXUA 3QQGA 3GCQA 2X7FA 2VX1A 4O7WA 3KMWA 3N9XA 2QO2A 2VTNA 4D4SA 2XYUA 1CTPE 4UZHA 2EB3A 4GL9A 5J87A 3OWJA 4L7FA 1IRKA 3R8UA 5AMNA 2R3FA 4FG7A 3W8LA 4YR8A 4EI4A 4JAIA 4ERKA 3VQHA 5A6NA 2CKPA 4EH9A 2C3JA 2JIIA 3F82A 4ZSJA 2VTJA 2OJ9A 4TRLA 2ITQA 1CKJA 4FGBA 5AR7A 1P14A 2QC6A 2YDKA 2BAKA 4YMJA 3MFUA 4DCAA 1YXVA 4BKZA 3FLWA 4AT5A 2X4FA 1W83A 2UVZA 3EQHA 4A06A 3Q9YA 3AGLA 4JX7A 2J4ZA 3R7GA 4K6ZA 4U44A 1CKPA 4CFMA 4CZYB 5J9YA 5HESA 5TE0A 4UY9A 1U59A 4AS0A 3EKKA 3WZJA 4FNYA 2JAVA 3KY2A 5DRBA 4EK4A 2ZV7A 5ANEA 3LLTA 3BYSA 3G6GA 4PPCA 2JDVA 4E6CA 3FXWA 3EZVA 3L9PA 3QXOA 5CNNA 4JBOA 3AT2A 2X4ZA 4KKGA 3A62A 3FY2A 4FL2A 4M84A 4BCIA 1OITA 4O81A 4DLIA 4ZAUA 4PPBA 1OKZA 3C4XA 5CEQA 5IQEA 5BMSA 2ZVAA 3I60A 4BKYA 5HEZA 4FEUA 3UTOA 3LOKA 2WMUA 4YJNA 1QMZA 2IW6A 4D4YA 4IFGA 4QO9A 3VUTA 1AQ1A 4FZFB 4ASEA 1Q62A 3P1AA 5CS6A 5BUEA 2PK9A 4ASZA 4B99A 3IQ7A 5AR8A 3CY3A 2QO7A 2GNLA 4MX9A 2XIKA 3D4QA 4X3FB 5HNGA 3D2IA 3KF4A 5FM3A 4NCTC 4F09A 3QD2B 3DDPA 4YPDA 5E8XA 4Z3VA 1O9UA 4IE9A 1F3MC 4P4CA 3CC6A 3R7UA 2NRYA 4TKSA 5I9YA 4DCEA 4OBOA 5AP0A 3I81A 3OWLA 4YLLA 3VN9A 5IF1A 3O8PA 4L9IA 4XEYA 2ZM4A 4TN6A 1PXKA 4FKTA 4RC3A 2I0VA 3EKNA 1YWNA 1YQJA 4WG3A 5DGZA 3ZO2A 5IQBA 4CQGA 3JY0A 3Q53A 4XV9A 5HLNA 1QPJA 4IVAA 3W16A 2PVLA 2Z60A 4IAFA 1ZYCA 4YSMA 1GZNA 4O0YA 2E9VA 5E90A 4CFNA 3KREA 1U5RA 2J51A 3BU6A 4TT7A 1M7NA 4AWIA 2OH4A 3GU5A 4YZCA 5I9ZA 1BLXA 3F5XA 3PYYA 4QMOA 1XO2B 3MA3A 5HU9A 1RE8A 2Y4IC 3KXGA 2W0JA 1J91A 3ZRMA 2YIWA 4PMTA 2YZAA 2ITTA 2PVHA 5BYLA 3TUDA 1UKIA 4C3PA 3FY0A 4PDSA 4QMPA 4RG0A 2XK4A 4L53A 3UO5A 3PXRA 3FV8A 4FX3A 4IADA 4K77A 2W4KA 4C4HA 4X2KA 3GU7A 3UZRA 3VUDA 1ZYJA 3ZHPC 2HY0A 4IWQA 2JBOA 3EFKA 3KRWA 5TO8A 5IMEA 2OICA 1YHSA 2QU5A 3NAXA 4E93A 5IA1A 2VTHA 5ETIA 3RGFA 4DYMA 1Q97A 2B9HA 2WQOA 3ERKA 3BU5A 4IDTA 2CNVA 3FMMA 2XH5A 2BTSA 2R3PA 3PA5A 1A06A 3U6IA 1H1PA 5I5ZA 3I0QA 4RIXB 3EQPA 4OTIA 4EWQA 1H1QA 3IPHA 3A8WA 4APCA 2CGVA 4FG8A 2PZRA 2XP2A 3ZXZA 2XVDA 5FTQA 3SV0A 2ZB1A 4Z55A 3CS9A 4JBVA 2FSTX 3O17A 2BROA 4FGRA 2R4BA 2OKRA 5AX3A 3U9CA 2WU6A 1YVJA 5IKWA 4CVAA 3SW4A 4I5PA 2J90A 4JS8A 4JOAA 3BGPA 4PV0A 4K0YA 3F3WA 3QTIA 5JSMA 4GS6A 1LEWA 2VX3A 4V0GB 3AC1A 3ULIA 4RA4A 3BHYA 5A4EA 1NY3A 2ETKA 4FKGA 2DQ7X 5EW9A 3DA6A 1JQHA 2JC6A 3P78A 3PJ3A 4FNXA 5EKNA 3F69A 1O6LA 4O0VA 2Z2WA 4TYEA 2BZHB 4UWYA 2EXEA 3ZRKA 4AUAA 5CAOA 2X0GA 4FT0A 1KV2A 4FICA 2W05A 4IXPA 4EK8A 5BVNA 3UQCA 1H00A 3DBFA 1UNHA 4QP2A 4RZWA 3R9RA 4HVDA 1RQQA 2UW4A 4JRVA 4J99A 3R9DA 2JFLA 4IVBA 3OT8A 3FQSA 1JSVA 3ZLWA 5A6OA 4U3ZA 1JPAA 2O64A 4FG9A 4FVQA 2XJ2A 5FTOA 5L2WA 5IPJA 4XG6A 2YIQA 3IGGA 4FSYA 3H9FA 4UXQA 2B0QA 3OWPA 4EZ3A 5GZAA 4NJ3A 3AOXA 3R2YA 5L8KA 1UU8A 3HDMA 4GU9A 3MTLA 3AC3A 4FIEA 4AZWA 3E87A 5KMJA 2ZB0A 4M69A 3NVKI 4XP2A 1G5SA 3VUKA 4C4JA 4G3DA 2GFCA 2J0JA 4MD9E 2CKQA 4R7IA 2H96A 4LMNA 3A99A 4AA0A 2GPHA 2RL5A 2P33A 3KQ7A 3VUGA 2X2LA 2UW0A 3IG7A 4PP9A 4CXAA 3V5PA 2VUWA 3C13A 4ITIA 4IEBA 4IZ5A 4AFEA 4X21A 3R8ZA 5A4CA 3UOKA 4GG7A 2WEVA 3OMVA 4JX3A 4LOQA 4XV2A 5LVNA 3QKLA 4AOTA 2CDZA 4LRMA 3U55A 2R7IA 3L8SA 4WD5A 4Y95A 3TZ9A 4L6QA 5C27A 1OMWA 3KXMA 3QXPA 2QOHA 3MY0A 1U54B 2VTOA 3QUDA 4F64A 4HNIA 5DBXA 4F9WA 4QTEA 5EDRA 3D9VA 4GVAA 1WAKA 5CT0A 4U41A 3I5ZA 3QQLA 4G34A 5HIBA 3NSZA 4K11A 4HPTE 4YNEA 4XNEA 3AT3A 4NTTA 5DPVA 2WELA 2E9OA 1OPLA 5KNJA 5LXMA 1E1XA 2CGUA 1CM8A 4M7IA 4C02A 5JGDA 3HZTA 3QX2A 4IWOA 4UWBA 4YBKA 4I21A 1VR2A 2WNTA 4LGDA 4GT5A 3HMNA 3W33A 4E1ZA 3BWFA 1Y91A 1ZMVA 3BYUA 4RJ4A 5JQ5A 5J8IA 4R6VA 4IX4A 4W9XA 1PJKA 4EQCA 4IB0A 4A4OA 5KE0A 4F6UA 1KWPA 2ITWA 2ITPA 3II5A 4L67A 4TNDA 2R3IA 5D7VA 5DA3A 4CTBA 4ANNA 4BIBA 4X3FA 3FQEA 4IZYA 2C6EA 4AZEA 1UA2A 1BI7A 4U0IA 4FSMA 5FUTA 1VZOA 4DBNA 2WPAA 3BLQA 4LQMA 3F3VA 5IU2A 3V6RA 5K4IA 5HO7A 3PLAE 2BRBA 3I79A 1IEPA 2ZMDA 2HIWA 3TUCA 5AIKA 1CDKA 3C5IA 2X8DA 3IK3A 4I6HA 5DEYA 4W4VA 1STCE 3CPBA 2CLXA 4BHZA 4QT1A 3LJ0A 2VWVA 4RVTA 4A9SA 3EQGA 5K3YA 5M4FA 3UOJA 3DKOA 1M17A 4OT5A 4JBQA 3LM0A 5KBQA 5J9LA 3EN9A 4I0RA 2YLFA 5K0KA 3PWDA 3PA4A 3JS2A 4JQEA 4MWIA 5HOAA 3MVHA 5LWMA 5L2QA 2YM5A 4DEIA 3K3IA 5JZNA 3VQUA 3MFTA 5L2IA 4S34A 3HECA 3QBNA 3QD4A 4EH4A 4DN5A 1O6YA 3PY0A 1H25A 1OL6A 2WU7A 2R3LA 3PUPA 4I94A 4U8ZA 3I1AA 4IX6A 5EI6A 4GK2A 3DK7A 4YO6A 1H26A 4J96A 4DH3A 4ZTHA 3EN6A 1P5EA 1URCA 3POZA 4OTGA 5C4KA 4EK6A 3TKUA 4O7YA 2O8YA 2OZOA 3A7FA 3MH0A 4Q9SA 5CEIA 3V6SA 3L9NA 3RI1A 4EH2A 3FLSA 3QTWA 3CLYA 3MIAA 4RIYB 5EM5A 2OLCA 1M2RA 2HENA 3BWJA 4MCVA 3RPYA 3QZFA 2JIVA 4OBPA 4YUQA 4EJ7A 1GOLA 4XP0A 5L2SA 5M53A 5KMMA 4BCMA 3FHRA 2XIXA 2IZTA 5JRQA 4DC2A 3RHKA 5JT2A 2OXYA 3OBJA 4O0XA 4HYIA 3R04A 3LFBA 2YEXA 5HIEA 4GFOA 5A9UA 5CENA 3I7BA 5FBNC 2ERZE 4AW0A 4UMUA 4L3PA 1W84A 1H01A 4U45A 3F9NA 4XBUA 2V55A 4D9UA 3SW7A 4XP3A 3UO4A 2VO6A 3TV6A 3HGKA 4BTKA 1G3NA 4E5WA 3CP9A 2HYYA 3FXXA 2XRUA 3LPBA 4JDHA 3VW6A 2UUEA 4RMZA 3E64A 1XBAA 4TWPA 3ODZX 3UPXA 2JEDA 3CCNA 3MVJA 3PPJA 3ATTA 2RFSA 2ZMCA 3V5QA 4NEUA 4FKPA 3B8QA 3GXLA 2BRHA 3FC1X 4YPSA 5F1ZA 3RP9A 5KHWA 4YGAA 1DI8A 4I3ZA 4AZFA 4CMOA 4BDJA 4WT6A 5E91A 3TI1A 4TYIA 2ZM1A 1WVYA 2RG5A 5CSPA 3QU0A 2F9GA 3WI6A 3D7ZA 1JVPP 3NRMA 4I92A 4D55A 4ID7A 1SMHA 2X7GA 3ORMA 4O2ZA 1YKRA 3R8LA 5IG1A 1FMKA 3EQCA 3ZLSA 3R7VA 5M4UA 5I9VA 3Q6WA 2CLQA 1XKKA 4QMXA 1IASA 4ANSA 4D0XA 2QG5A 3HMIA 4V0GA 4AFJA 3O23A 2VWBA 2PULA 4FSWA 2HOGA 2PSQA 4XG3A 3U8WA 3ZM4A 1HCLA 4APPA 2GNIA 5E4HA 4EOLA 3KF7A 4U3YA 2R3QA 5DT3A 1JSUA 4E4MA 3LKMA 2ZDTA 1PXPA 2B4SB 3QC9A 3QL8A 3NEWA 5FEEA 4AOIA 3HUCA 3LQ5A 4ZXTA 3RHXA 2UZBA 3UC4A 3Q52A 4AF3A 3R1YA 3DFAA 4EZ5A 4OT6A 4AZVA 2IVSA 3UQGA 5L8LA 3KMUA 1SVEA 5HVJA 2C6KA 5HORA 4X7QA 2BKZA 3LMGA 2GNJA 3A61A 4LUEA 4EH7A 3IOKA 4UX9A 4CT2A 5BVOA 1YOLA 3A2CA 4C57A 3QALE 5EQYA 2OG8A 4QMQA 4OAUC 4K8AA 5GNKA 4B8MA 1PMVA 1Q8UA 3MYGA 2Q83A 4HCTA 3R9HA 2WTKB 3QLFA 4G5JA 3QUPA 3DV3A 3QKMA 3FUPA 5J95A 4BDGA 2OJIA 3GB2A 3OF0A 4NH1A 4L68A 3A60A 2VGPA 4U9AA 3AG9A 4PY1A 3Q04A 5ETFA 2YABA 2YIXA 5AUZA 5M57A 4KA3A 3R21A 4FNWA 4M68A 4W8EA 4L3LA 4PDPA 1PKDA 4D1XA 5JQ8A 1ZMUA 5CANA 2BAQA 2BIYA 3F7ZA 3MVMA 4O86A 1YDRE 4X6QC 5AR5A 3AGMA 4BF2A 3GU4A 4QNYA 2WQBA 5HG9A 2QR8A 4JDJA 2VWUA 1GY3A 4D4RA 4F9BA 2HK5A 3QRIA 3LCTA 4F0IA 1T45A 3OWKA 3ZDUA 4CNHA 4I0SA 4QMYA 1GZ8A 1FVRA 2Z7SA 3IDCA 3PWYA 4MKCA 5I4NA 2XJ0A 3I6UA 1P2AA 4C3FA 4HZSA 3BE2A 3EN7A 5HE3A 2IZRA 4HGTA 3Q9ZA 2OFVA 3MWUA 2XYNA 4GVJA 4D2WA 3BYVA 5M55A 1XQZA 5C26A 2WMSA 2F2UA 5A14A 1U54A 3BLRA 2A27A 4S33A 3ZSHA 3QTUA 4FK3A 4I6BA 3H4JA 2HXLA 3E5AA 4M67A 3UODA 5IA3A 5IQGA 2GNGA 4IM2A 2Z7QA 1ATPE 4EOOA 4ZMFA 4ZJVA 4WIHA 1APME 4N6ZA 4FIIA 3R8VA 1KE9A 2BALA 3NGAA 4O27B 1I09A 4YJQA 3Q96A 4UV0A 2X8EA 4XX9A 4J7BA 4FV8A 4ZTRA 5J5SA 3QQUA 5ITAA 2GQRA 2UZLA 4LL5A 5IQDA 3BCEA 3HAVA 2PUPA 1IAJA 3ORPA 5JFWA 3R8PA 4TYHA 3IW7A 4RX8A 3MPAA 3RJCA 4FKWA 3WILA 3ZZEA 5I9UA 3RPSA 4CMUA 4PQNA 3RWQA 4NWMA 4CCBA 2ITYA 2V5QA 3MH2A 5E92A 4E6DA 3LFQA 4F7LA 3NYOA 5AP7A 4BCJA 2WHBA 3WZDA 3ORNA 2NRUA 2EUFB 3ROYA 5B2MA 2WQNA 4MTAA 4ALUA 4DTBA 4AQCA 3BBWA 5AP1A 5EOBA 4FT7A 3D5UA 1BX6A 1YDTE 3K2LA 4FTCA 4IZAA 3SDJA 2RIOA 3BE9A 2YM3A 5IA5A 2BIKB 3PP1A 3SC1A 4QTBA 5CT7A 4FKSA 4XG4A 3DTCA 4D1ZA 4V04A 3JR1A 4FIHA 4FKJA 3OCGA 2A0CX 4QOXA 5JRSA 4O2PA 3FYKX 2ZV8A 3NNVA 4J97A 4Y73A 1XWSA 4TWCA 3N4TA 2BHEA 3VS3A 5CNOA 5M4IA 4ASXA 2R0IA 5K5XA 1OI9A 3L8PA 2YN8A 2C3IB 3U4WA 4EQUA 2P55A 2QNJA 2ZOQA 4WRGA 3WE8A 4BI0A 3UIXA 1CSNA 4WNMA 2OIDA 3G0FA 4XS2A 3QQJA 3L9LA 1OM1A 5CAQA 3K3JA 4FTAA 4XMOA 4OLIA 5AR2A 4PMMA 2XKFA 1JAMA 4O7RA 2OJFE 5HVYA 2WMWA 1WBVA 1YI3A 4GH2A 3TN8A 3VBQA 4F70A 3PY1A 2B52A 2C30A 1DS5A 2AC3A 3ZUTA 5J7BA 2G2FA 2WMRA 3G5DA 3F3UA 3R2BA 4FR4A 3ORZA 4N6YA 2A2AA 3PG1A 4RIYA 5FXQA 4BI2A 5C8KA 4PUZA 2OIBA 3MFSA 3CKXA 3LFDA 4LRKA 4WUNA 3PPZA 4X3JA 4I6QA 1TQMA 1ERKA 3W2PA 3DZOA 4NT4A 4RJ7A 3FWQA 4F1OA 5KMLA 4XLIA 1BMKA 2W1EA 3BHVA 4J52A 4C2VA 5CEMA 2VV9A 3W32A 5IA4A 5E8YA 3OOGA 4YC8A 4ARKA 5CQWA 2UW6A 3OUKA 5GJDA 4FKRA 3UNZA 4R7BA 3V51A 5LMBA 5H8GA 4D2PA 5L6PA 4HZRA 1J1CA 5A4QA 3FYJX 2C5NA 4QMMA 4U42A 4Y83A 4J98A 3E8NA 3ZC6A 4E8AA 2XNGA 5EDPA 5CI7A 3PSDA 2UW3A 3VBWA 3S0OA 2PE2A 3RPVA 1IAHA 2OBJA 3O8UA 4EYMA 4I4EA 4ACMA 3MN3A 4BB4A 1KV1A 5DR6A 3U87A 2E2BA 5FP6A 3UOLA 3PDTA 3VF9A 3GC7A 4NUSA 3T8OA 2W99B 4YZDA 3E3BX 5CXZA 3QCSA 5DE2A 3COKA 5BVFA 5KKRB 4FIFA 2HZ4A 4IH8A 1XH8A 4RFZA 3ZSGA 4O7VA 1Q8YA 3GT8A 4QMLA 5BYYA 4BIDA 5EHYA 4Y46A 4BY9E 2DS1A 2CCHA 3CD8A 3UG2A 3C1XA 3POOA 3NCZA 5EYDA 3TNQB 3C50A 4IB3A 1KOBA 4OTHA 4UB7A 4D9TA 4RGJA 4O0TA 3U51A 3HV5A 5A54A 5IH6A 3NUSA 3UMWA 2J0LA 4I22A 3DNDA 2B9JA 3ENMA 2QCSA 3ZH8A 5KZ0A 1S9IA 3EZRA 5CZHA 4ERWA 2CCIA 3RZFA 2LAVA 4O7SA 2UV2A 2A19B 2JKQA 4IWPA 3SKCA 2W1HA 5HE1A 1KUTA 3LQ8A 4YZBA 5JGAA 2BRGA 4MH7A 3R63A 4O7ZA 4IB5A 1AGWA 2X9EA 3FLQA 3VBVA 4R5SA 4DEHA 3SA0A 4PNIA 3C0GA 2VTSA 1OIQA 5HG8A 3NX8A 4QYEA 4Y5QA 2PMIA 4C4IA 4OW8A 1GIIA 1M7QA 2VTRA 4FKVA 3GFWA 4DBXA 3Q9XA 2V62A 1JKSA 4LOOA 3MV5A 2VWXA 4OTQA 3TIZA 3W2RA 4C2WA 3OEFX 4AN3A 3NUYA 4DFYA 4M3QA 3VS7A 3RAHA 2WTCA 3SG8A 3JVRA 3PVGA 1Q8WA 3RM6A 4I5CA 5CLPA 4W4YA 4FV7A 3GCSA 3R7EA 3TXOA 4ACCA 4I24A 3GCUA 4ZJIA 4Z9LA 1RW8A 4U81A 3KA0A 3LFEA 3UJGA 3QHWA 3V04A 4AOJA 4BWKA 2B55A 5CY3A 3GEQA 5HCZA 3ZSIA 4BR3A 3HRFA 4ORKA 4FT9A 1OGUA 3PY3A 2WO6A 4I23A 4C35A 4FTQA 4L3JA 3TWJA 4Z7HA 5HE0A 5M44A 1G8SA 1Q41A 3CR0A 3QCXA 2W06A 4GW8A 1Q99A 4AGUA 2IPXA 5CSVA 3QFVA 3L8XA 3FLNC 4MXXA 3QQFA 1PKGA 5CU0A 4QMUA 3Q9WA 5KMIA 2GHMA 5AA8A 2WFYA 4EK3A 4TPTA 1NXKA 1SVHA 3BYMA 4FKOA 4S32A 5CAPA 4AT3A 2P0CA 3MS9A 2YWPA 4AW2A 1QPDA 1R78A 3R73A 3QZIA 3FXZA 2JGZA 4J8MA 5HCYA 5TOZA 3VF8A 4FV3A 4BWXA 4EZ7A 4FV4A 4W4WA 1UV5A 4NM5A 4RJ5A 3ZBFA 3LCKA 2OJJA 4EYJA 3DBEA 4DEBA 3HV3A 3PG3A 4EC9A 1BI8A 2H9VA 2WMQA 3DTWA 4WG5A 3RVGA 5EI2A 4AA4A 5FXRA 1Q8TA 1GJOA 2PZYA 3TEIA 3SAYA 2OF2A 5A4LA 4YTIA 4CYIA 3KK8A 3JXWA 2AC5A 3TM0A 2EVAA 3QYWA 5E7RA 3EWHA 3R9OA 4AP7A 3R71A 1PXLA 3BHTA 1V1KA 4KSQA 3ZUVA 5BUJA 3E88A 2GQGA 4YTFA 1WFCA 3RALA 2WZJA 1GNGA 5AUVA 4K33A 3EL8A 4QP7A 4QMZA 4IIRA 4DFLA 2EXMA 1LR4A 4YLJA 4EHGA 3IW8A 1ND4A 2WOTA 3BIZA 3S4QA 4PTEA 3FI3A 1YDSE 3PSCA 2QO9A 4BCNA 2F7XE 4FMQA 4KBAA 5HE2A 2R3NA 5DIAA 5CAUA 3PJ1A 1ZY5A 3FI8A 3LM5A 5EYMA 4ZTSA 4DFUA 3O51A 2PVKA 5DWRA 2QOBA 3RNYA 4YZNA 5BNJA 3F5UA 5T68A 4X2GA 5GHVA 4DH8A 5CAVA 2WTWA 2XBJA 3EQIA 1UU3A 3OXTA 1M2PA 2HW6A 2XF0A 3ORXA 1MP8A 4JQ7A 4RC2A 3OS3A 3R7YA 1IA8A 5HI2A 2W1FA 4L52A 2YZLA 3FL4A 3R01A 5D12A 1H08A 3DU8A 3G0EA 5AUWA 5K5NA 4CEGA 4UMTA 2V7OA 4G16A 2ZM3A 5DR2A 4BI1A 2HXQA 5A4TA 2PL0A 3FMDA 3GC9A 5BQ0A 1J7LA 3DJ6A 3W55A 2HZ0A 4JIAA 2Q0NA 2GNHA 3KKVA 4O1PA 2J9MA 5FBOA 5EHLA 3P5KA 5HLWA 2PVJA 3FPMA 2CN8A 1WBPA 5ANKA 4C34A 4F7NA 3BHUA 5EM7A 2VTPA 2XNEA 3LXKA 3QGWA 2J50A 3ITZA 1ZZLA 1NVRA 3H9OA 3PJCA 5TT7A 1PXIA 5AEPA 1SYKA 5AV0A 4WNPA 4HYHA 5LCJA 4CG9A 2R2PA 2W4JA 1UNGA 3BPRA 4F6WA 4QMSA 4FEWA 2R64A 3NS9A 4OUCA 4JR3A 3R02A 4TYJA 4EBWA 2XNBA 4XRJA 2YJRA 4IM0A 4XBRA 1YWVA 3B8RA 3KMMA 5IZFA 3CEKA 4C4EA 2BCJA 2YIRA 3VS6A 3UG1A 1UWHA 3LIJA 5IQAA 1V0BA 4JDKA 1FPUA 2B7AA 3ZLXA 1WMKA 1B39A 3RPRA 4FTJA 2YACA 3LAUA 3OZ6A 4A9RA 3TACA 1YXXA 3QF9A 3UVPA 2C3KA 2Z7RA 1XH4A 5FTGA 4BTMA 3FI2A 4MWHA 1PW2A 3TZ8A 3NIEA 3NAYA 4KINA 2F2CB 3V5JA 2C5OA 4RWLA 3F88A 2UVYA 4QYGA 4YZ9A 5EQPA 4TW9A 2CKOA 1PXMA 3F3ZA 3MGYA 1PMEA 4U79A 2P3GX 3GGFA 5EM8A 5KMNA 3FKLA 1ZRZA 4KBKA 3F5PA 4BDIA 2OFUA 3C51A 4D2SA 3UIUA 2IZUA 2XEYA 2IZSA 3O7LD 5DFPA 2PVMA 3D94A 3HV7A 3ORTA 2BPMA 3TG1A 3KXNA 2GS2A 3LW0A 4F7SA 3KXHA 1XR1A 4E5AX 5CEKA 4GUBA 3QTSA 1OPKA 2PVRA 4MYGA 3FMHA 2VTAA 1JSTA 2WMTA 4ANLA 3BKBA 1NVQA 5M4CA 4NKAA 1OUKA 3G9LX 5G1XA 4AZSA 2HW7A 4ZZNA 2JKKA 4FSNA 4JVGA 3BRBA 3MBLA 3P7AA 2CKEA 4A9UA 4QPMA 2Z8CA 1CMKE 3ZBXA 2ITNA 5J5TA 3F2AA 1KE6A 3NNUA 4UALA 4I0TA 5LVPA 5KX8A 3HA6A 5IEYA 2C69A 1YHVA 3LVPA 4YC3A 5HBHA 5KUPA 5L2TA 4AN9A 3HMPA 3FQHA 3R7OA 4F7JA 4IQ6A 2P2IA 2UVXA 5DI1A 2R3HA 1WBSA 2ETRA 3EH9A 3E8CA 4JRNA 2GDOA 2O65A 4CFFA 4N57A 4FE2A 3NIZA 4HCUA 2C4GA 3D14A 4O96A 1ZY4A 4XV3A 4D58A 5KMKA 5LVLA 4CGAA 3UNJA 3OCBA 3DLSA 4NFMA 3LXPA 3OCTA 5BUIA 5DMZA 4YHTA 3RNIA 3EHAA 2FSMX 2NPQA 4MXCA 2UZTA 5C9CA 4ACGA 4E20A 4LYNA 5HTIA 5HBEA 2VTLA 4CRSA 4J1RA 5BX0A 1XHAA 4B6LA 5B2LA 4FTIA 2X39A 3I4BA 4KIOA 2FYSA 4S30A 5BVWA 2BDFA 3S2PA 4H1MA 3VRYA 3VULA 3Q2JA 3QKKA 4QP4A 3BLHA 3CY2A 4G6NA 3R00A 4W4XA 5AR4A 4FTMA 4A4XA 3QX4A 4LGGA 1PXOA 1ZOEA 5BVEA 5E8WA 4ITJA 3MI9A 3UZPA 4C61A 4FTUA 2BILB 4HVGA 1QL6A 4PRJA 1YRPA 2OWBA 3EQFA 3UYSA 4EOJA 4K9YA 2ZYBA 4CG8A 1H8FA 4TYHB 4CCUA 2ONLC 4Y85A 5AUUA 5M08A 4GK3A 2IG7A 4IAAA 4KIKA 2XRWA 2IO6A 5IUHA 3DCVA 3FMKA 4XOYA 3VWAA 2UZEA 2VRXA 3GOKA 4NKSA 4BCQA 4EC8A 3QTXA 2QD9A 3CTJA 4UMPA 2G1TA 4RWJA 3VO3A 2QONA 3QA0A 4FF8A 3FJQE 5JGBA 2OK1A 3TDWA 3O71A 4LRJA 2XCHA 3DB8A 5E8UA 2GU8A 4L42A 2YISA 4Z16A 2BDWA 4PL4A 4KD1A 1URWA 4CRLA 4BDAA 2QI8A 2PY3A 5CF8A 3GQIA 4DT8A 3LFAA 4WBBB 3PZEA 3AQVA 3KXXA 2O2UA 4G3EA 4NCTA 2BMCA 4RWKA 5AUYA 3TZ7A 3I5NA 3ZOSA 3U54A 2PWLA 4C37A 4UBAA 4FKLA 1FBNA 5GINE 3VAPA 5J79A 4DT9A 1GIHA 3EJ1A 2V0DA 3G90X 4O7NA 5FEDA 4QYFA 2HWPA 5ANOA 2HY81 4DH7A 4FTNA 3LXLA 4Y5HA 3VHEA 4GT4A 2YJSA 3UGCA 2E9PA 4AZTA 3A7IA 5H8EA 1BUHA 4LUDA 1A9UA 2YERA 3D7TB 2W9ZB 5D10A 4DGLC 4I6FA 2VN9A 5DEWA 4O84A 3PJ8A 1VYZA 3AT4A 4NTSA 4BDEA 2YIYA 3EFLA 3HP2A 1SZMA 2VWWA 4JT3A 2XCKA 3FE3A 3FLZA 3QTZA 4MVFA 3OCSA 1ZWSA 5AM6A 4ZSEA 1DM2A 4BFMA 3ZFMA 1OBDA 2ESMA 3GCPA 4ANBA 3F5GA 4ANMA 2XKEA 4FTTA 4RLKA 3AMAA 4ZSLA 4ZIMA 1Q3DA 5AAGA 1QCFA 3G51A 4F9CA 5IDNA 3QCQA 3FKNA 5LVOA 2JLDA 1M52A 1YI6A 1RDQE 5L8JA 3BGQA 1SM2A 3ETAA 2I6LA 5EM6A 4HJOA 5JFSA 5JH6A 3CBLA 4PL5A 2IN6A 5KBRA 4XG9A 2V22A 1W8CA 5IUGA 2RFDA 3D2KA 2UZNA 3MY5A 4YTCA 3BEGA 1SNXA 2C68A 3UDBA 3VBXA 4ZZMA 5IDPA 3BV3A 2UZDA 5AV4A 2PVFA 2OXDA 4MK0A 5LJJA 4XOZA 3Q2MA 4B0GA 5CF5A 4MXZA 3M11A 1XBBA 4J8NA 3BZ3A 2W5BA 4ACDA 3ZEWA 4ZY5A 2QVSE 2ITUA 3LFSA 4GK4A 4KABA 3TNPC 4D4VA 3PRFA 4X0MA 1DAWA 2XM9A 4GUEA 3TZMA 1PY5A 2C6LA 3FI4A 4QP1A 4FA2A 5DOSA 1VEBA 2QQ7A 4IHPA 3DB6A 1WZYA 1H24A 2XA4A 3VW8A 4BYJA 5GZ8A 2Z02A 3VNTA 1PXJA 3N4UA 4G6LA 3WOWA 5J9ZA 3BQCA 3PXFA 2SRCA 4FV9A 4C38A 1OZ1A 3DBDA 5HO6A 3ZEPA 2J7TA 4BN1A 4L8MA 4D1SA 4U6RA 4Q5EA 3E7OA 5AV2A 4U7ZA 2OZAB 3KN6A 1B6CB 2XK3A 4WNOA 5HQ0A 3CD3A 3NUPA 4MHAA 3RMFA 2W96B 2PUNA 3H3CA 2NNWB 5IQCA 2FUMA 3VC4A 4BIEA 3C4FA 3FSFA 4JDIA 5L6WL 4JXFA 2QLUA 4J53A 3PVUA 5JKGA 4M0ZA 3V5LA 3CKWA 1I44A 4FSTA 2ITVA 5AUTA 4G5PA 4TYGA 4AT4A 4RQVA 2V7AA 4HYSA 3Q4TA 4IDVA 4IZ7A 3KRLA 3OBGA 3KU2A 2JAMA 5CEPA 5AJQA 4JJRA 4Q2AA 2OGVA 1OIYA 2YCFA 3BELA 4RWIA 4U43A 3JYAA 4P2KA 1OUYA 2WTKC 3KRJA 2GQSA 5E8SA 3DS6A 2YCSA 4YHJA 4ZLOA 4FEVA 3ET7A 4GJ2A 3C9WA 3FHIA 4M0YA 3O8TA 3SRVB 4DA5A 2B1PA 3A8XA 4O91A 4AGCA 4MXAA 5I0BA 3COHA 4G9CA 4QQ5A 3UZTA 4PDYA 5C01A 4DFBA 4FZ6A 2PYWA 3NWWA 5DNRA 5CSXA 4ZOGA 3ELJA 2YCQA 4I4FA 3F66A 4NSTA 3BV2A 3R1SA 2R3MA 2DWBA 4L7SA 5CVHA 2WQMA 3ZMMA 3G33A 5AP6A 1GZOA 3DXQA 5IH4A 4RJ3A 4FV1A 3SD0A 4AE9A 2FSOX 2VU3A 2XNOA 4DE4A 4TXCA 1WCCA 4NK9A 1U46A 3PXYA 5AAFA 4MNEB 4YJVA 3NVMB 3QD0A 4FTRA 3H10A 1H28A 2YFXA 4U97A 5GJGA 5I9XA 4C58A 5JFVA 3DQWA 4ANOA 4CV8A 5M51A 1FINA 3SXRA 5C8MA 4DFXE 3F7WA 4JAJA 5DH3A 2H6DA 4HPUE 3PP0A 4ZSAA 3QZHA 4FV0A 5JZJA 3VVHA 4D2RA 4DINA 2H8HA 5GIOE 4EHZA 4YJPA 4TY1A 4FKUA 4B7TA 3G15A 3UOHA 3UVQA 4L01A 3H9RA 3COMA 3HKOA 4N4SA 2RSVA 3QRJA 4M97A 2YM6A 4RC4A 3HLLA 4D2TA 4KSPA 1L3RE 4HGEA 5IUIA 5FDXA 4BHNA 3S1HA 4ZTNA 3W8QA 2WIPA 5KCVA 1S9JA 1KSWA 4CD0A 3KULB 5D9HA 4IC8A 3GC8A 4ZTLA 4DLJA 1YHWA 3ANQA 4MNFA 4GU6A 3ZS5A 3ZUUA 3JY9A 1MUOA 4UYNA 3CQWA 2WIHA 4KAOA 4OTWA 3W2CA 3QZGA 4V01A 3GNIB 4YP8A 4HCVA 3SHEA 4YU2A 1XH6A 1R3CA 3ZDIA 5EFQA 1BYGA 4AW1A 2JDRA 4DGMA 5IQFA 3H0YA 5CVFA 3DNEA 5E8TA 3OW4A 2WTIA 3AMYA 4F9YA 5IQHA 3PJ2A 4IAZA 5HCXA 1UVRA 3RTPA 1ZZ2A 4WOVA 3CSVA 2Y6MA 5HX6A 1OECA 1OBGA 1F5QA 2VO0A 4BDCA 5IEXA 2ZDUA 4YJTA 2JDTA 3LFNA 3ZYAA 4ZTMA 5CF6A 4EK5A 5BVDA 4H39A 3WF7A 4DHFA 3RCJA 4QQTA 1H4LA 4BCHA 3NYVA 3THBA 4AE6A 5TR6A 2BR1A 2R3GA 4EUTA 3LMIA 3EQRA 4KB8A 3D7TA 3MDYA 1WBWA 2PU8A 2ZAZA 2C47A 5CEOA 1JKKA 2F57A 4QYHA 1ZLTA 3VHKA 3DXNA 4FODA 5KO1A 4G3GA 3PRIA 4XUFA 5AP3A 4AXAA 4G3CA 3PFQA 2IWIA 3O96A 2DYLA 3TT0A 5IMXA 2E9NA 2WD1A 1T46A 4P5ZA 3TCPA 4F08A 4BZOA 1M14A 3OHTA 3LJ1A 3CJFA 3MJ2A 3ROCA 2NO3A 1H1SA 3G6HA 2J2IB 2C5XA 5FQDC 4EOPA 3BYOA 4YHFA 2OW3A 4B8LA 4RX7A 4IVCA 4RJ8A 2J5FA 1PYEA 4TTHB 3TTJA 5DLSA 2CNUA 1RJBA 1R39A 4A9YA 4I93A 5LQFA 4LGHA 3HV4A 4NZWB 1K3AA 2CJMA 3IONA 1OL1A 4GRBA 5HD4A 5AFVA 3CTQA 3KGAA 4RIWA 5CSHA 5CTPA 5ANDA 5DR9A 3EQDA 5CU2A 3KB7A 4YSJA 1PMNA 5B2KA 4PPAA 2Y9QA 3R0TA 3DZQA 4OTDA 4R3RA 1W98A 3O50A 3NYXA 3CQUA 4FI1A 4LFIA 4CFUA 4CZTA 4I1ZA 1ZMWA 3C4EA 2O3PA 3UYTA 3IDPA 4ANQA 5HO8A 3KRRA 1Q8ZA 2NP8A 3PZHA 4C4GA 5T3QA 5HVKA 2BVAA 2ETMA 3W2OA 4QP6A 3IW6A 4RRVA 2EU9A 3JPVA 3MH1A 4YLKA 3FLYA 2B53A 4I5HA 3OROA 4G2FA 4CV9A 2CPKE 3NNXA 4NW5A 3PXZA 4DEDA 4V05A 3DBQA 5CZIA 3NW7A 3DKFA 3V5TA 3L8VA 4FEXA 1AD5A 5LCKA 3D5VA 2PVNA 4IC7A 3VRZA 3ZTXA 5G6VA 3QA8A 4QTDA 5HD7A 2X6EA 3AC5A 4EOMA 3IKAA 4QMTA 3ALOA 4O1OA 3D5XA 5TF9A 4X6RA 5KKRC 4FL1A 3VS4A 4NJDA 4GYIA 2CNQA 4JLCA 5K4JA 4IMYA 2BAJA 2UW8A 4KRCA 5CSWA 2I0HA 4C7TA 4MEDA 2C0IA 2FO0A 2WKMA 3QQHA 1JBPE 5EYKA 4IANA 2OZAA 2WXVA 3WZKA 4ZMEA 3H30A 4ZSGA 1FGKA 3UP7A 3GUBA 4HVIA 1Y6BA 2JDSA 2PTKA 4B4LA 3NUUA 1PMUA 4CSVA 4BVUA 5CVGA 3DAKA 3IDBA 1YOJA 3CGFA 2VTTA 4BGQA 2VD5A 4BCFA 1FOTA 4KRDA 3OY3A 4BDFA 3FKOA 4J95A 4WHZA 5DHJA 3PPKA 5H3QA 2R0UA 3L1SA 4WSYA 3UC3A 5ANGA 4PWNA 3QLGA 4FV5A 5EW8A 4NL0A 5L3AA 2CSNA 3E92A 1WBNA 2BDJA 4MXOA 5M06A 2R3JA 2QKWB 4FYOA 5EG3A 4QQCA 4ACHA 3I7CA 2VWIA 5HLPA 3U6JA 1XH5A 4DTAA 1ZXEA 4ZZOA 4M14A 4MBLA 3T3VA 4D2VA 3FZ1A 2X2KA 3UIBA 3W2QA 1FQ1B 2E9UA 4JR7A 4M66A 4ZEGA 3SOCA 4BDKA 4YNOA 2UW9A 4CLIA 3SRVA 1DAYA 4YJUA 5EW3A 3TV4A 3NUAA 2P4IA 3KXZA 5M09A 3WIKA 1TKIA 3FZSA 3ZLYA 4O0SA 2VZ6A 4XYFA 4EH8A 2O63A 4KS8A 2CN5A 5ETCA 5EOLA 3R28A 2W1ZA 2X9FA 3JUHA 4RLLA 5GZ9A 4FKQA 1Q4LA 2C6MA 4FC0A 3FDNA 3TJDA 2HWOA 4LI5A 4QD6A 4P90A 5F20A 4ZY6A 3VJOA 1R1WA 3DBCA 1YOMA 3LCOA 3QYZA 3AC2A 5EQEA 1E9HA 2ACXA 2FVDA 2GCDA 2JITA 1MQBA 3PVWA 3BGZA 4G6OA 2PVYA 3VBYA 3ZRLA 5LMKC 3DK3A 3NDMA 2OSCA 3HUBA 4MNEA 4KIKB 4GKIA 2W17A 4GFMA 3KCFA 2IW8A 2RG6A 2WB8A 5FRIA 4EH5A 4O6EA 2W1DA 1XJDA 5HHWA 3E7VA 3TTIA 3LXNA 3S95A 2W9FB 1K2PA 2QHMA 3OW3A 3FEGA 4EWHA 2QOCA 5FXSA 3HMOA 4FTOA 3GENA 1UU7A 3PSBA 2CMWA 4FEQA 5FG8A 5C1QB 4X3FC 4F6SA 1OKVA 4KIQA 5GIPE 2G15A 2OU7A 4OTRA 5ACBC 5F9EA 4DITA 3CTHA 3ZO4A 1W0XC 3Q4ZA 4S31A 1MRUA 3GI3A 5LARA 5HNIX 4ITHA 3C0IA 5J1VA 3F2RA 3QUEA 5AIRA 5BMMA 5CF4A 3DOGA 3LCSA 3N51A 4YO4A 4QPAA 4D5KA 4CKIA 3KULA 4CKRA 5K0XA 3NNWA 5A3XA 3MESA 5AADA 4R5YA 3TKIA 3EFJA 3UE4A 3MPTA 4DF3A 3SXSA 1PF8A 3E63A 4KNBA 2XIYA 3KFAA 4IACA 3RAIA 3EN4A 1O6KA 1REKA 4JBPA 3W1FA 4BCOA 1OIRA 3HDNA 3KC3A 4PMPA 2GMXA 4FUXA 2EB2A 5AX9A 5LOHA 1YI4A 1REJA 4FT5A 3EMGA 4BCKA 3S00A 4HOKA 2QOKA 3QC4A 5EHOA 2OO8X 4IAIA 4Y72A 4FTKA 4TZRA 2JKMA 4DH1A 1W7HA 2GS7A 4WSQA 2XS0A 2Y6OA 2XK6A 1ZYSA 5HG5A 3QWKA 2BFXA 4WKQA 3ID6C 4JG6A 1X8BA 4GJ3A 3RPOA 5DT0A 3CQEA 3V8WA 2YCRA 3U9NA 3WIGA 3ZU7A 4ONAA 3UQFA 4UZDA 2BUJA 3PLSA 3TNIA 3DJ5A 2G2IA 3R30A 4YURA 3BHHA 2VNYA 4FZ7A 3WE4A 4CKJA 3DXPA 2J0KA 4M13A 2Y7JA 4MF1A 4FTLA 4RJ6A 3UO6A 1BL7A 2Y4IB 4BWPA 4XCUA 2Y4PA 3GCVA 2VO7A 3ORLA 4ZLZA 4EOQA 4QMNA 4MBJA 4JIKA 2CGXA 2QURA 2G2HA 5F94A 1ZARA 2PMOX 3PTGA 4QP9A 2H34A 5ETAA 5FGKA 1H0WA 5KHXA 2RGPA 3IO7A 4YBJA 4CFXA 4CFVA 1JWHA 3DLZA 3HRCA 5HU3A 1Y8GA 5FM2A 4ZJJA 5F95A 4MQ2A 1GAGA 2J0MB 4OBQA 2ZJWA 3BU3A 1XH7A 3TV7A 3EN5A 3VBTA 4O0WA 3AMBA 3FAAA 1ZYDA 4A07A 2I0EA 3EYGA 3KL8A 5CALA 5FD2A 4WNKA 2WTJA 2XIZA 2XNNA 4A7CA 1JNKA 4QTAA 2HELA 4QMWA 3LFFA 3ZCLA 2BKKA 4O7TA 4FSRA 1UKHA 4KWPA 4NU1A 4GIHA 3EQBA 3SXFA 3OXIA 4O83A 3DT1A 1NA7A 2C6TA 3NR9A 1ZOGA 3Q32A 4F0FA 4D5HA 1JLUE 3P79A 4PTCA 4BZDA 1Q3WA 3GQLA 2IVTA 4C36A 5E8ZA 4AG8A 2QR7A 3F2NA 5E1SA 4R77A 4MD8E 1G8AA 4O7LA 4TWNA 4GFGA 4RVMA 2CHLA 2KULA 2OJGA 4ZS0A 2UW7A 3KK9A 4NW6A 2BZKB 3T3UA 3HAMA 5LMKA 2KTYA 3K54A 4FSUA 5JN2A 3A7GA 1NVSA 2UZWE 2LGCA 2WQEA 1B38A 4G17A 3LLAA 5DG5A 4DG0E 1OB3A 1OKYA 3FZOA 4NIFB 3PIYA 4IAKA 4RT7A 5HGIA 3FSKA 4ENXA 3D15A 2QODA 3HV6A 3H0ZA 3IW5A 4W9WA 5IH5A 1NT2A 4M15A 1ZOHA 1V0PA 2Y0AA 4IM3A 5FWKK 4ZLYA 3EB0A 2ITOA 3P7BA 2DUVA 2PMLX 4F63A 2B9FA 3CJGA 2F7ZE 5HX8A 1P4OA 2O0UA 3P9JA 5M56A 2ZV2A 4PTGA 4QPSA 3R22A 2UW5A 3HNGA 3DAEA 4FSZA 2C1BA 1UNLA 2YA9A 2VGOA 5CWZA 4LOPA 3RK9A 3ZFXA 5FLFA 2WMVA 4S2ZA 2YHVA 3LCDA 2OF4A 4KKEA 4FV6A 5EK7A 5H8BA 2GNFA 4IWDA 3GVUA 2ERKA 4QQJA 5AP5A 4Q9ZA 1YXTA 3MH3A 3IS5A 2XNPA 3Q5IA 1IR3A 4RSSA 5T6KA 2PHKA 3OP5A 5E1EA 3FMEA 3BQRA 4GSBA 2C0TA 2YWVA 1TQPA 3B2TA 4OTFA 4R7HA 4RBLA 4OR5A 1PRYA 3W10A 2X1NA 1F0QA 5C03A 4D28A 4E26A 3NYNA 2YDIA 3ZZWA 3R83A 3RINA 2JDOA 4CQEA 3AD6A 2YAAA 4K2RA 5EH0A 4H3QA 3GU8A 3K5UA 4HGSA 3EFWA 3WF5A 5FEQA 2VTIA 2WTVA 2XNMA 4CTCA 4H3BA 4UMRA 1QPCA 3UBDA 4LG4A 1JKLA 4P7EA 3A7HA 4DEEA 3EOCA 2F49A 4IX5A 1SVGA 4X2JA 5B0XA 4GMYA 4IW0A 1VYWA 4O22A 5HKMA 3WBLA 3MTFA 4BICA 2RFEA 2UZUE 4RPVA 5AWMA 5JEBA 1YXSA 2XK7A 3KVXA 3GU6A 2GTNA 5HZNA 4AGDA 2JFMA 3F3TA 5AM7A 5CU3A 3R6XA 2IVUA 4IBMA 3V8TA 3CPCA 4R1VA 4UYAA 4MXYA 3HYHA 4CZUA 5I3OA 4F0GA 3COIA 3FMJA 2ZV9A 3P0MA 3CGOA 1LEZA 4ZTQA 1WBTA 3FBVA 4FKIA 3UIMA 4ALVA 4E73A 2ITXA 3RCDA 3UP2A 5L6OA 3IECA 4E4LA 3RK5A 3BBTB 1Q5KA 2IW9A 4QMVA 4C33A 2PE0A 3FL5A 4BTFA 4BKJA 5HTBA 3UPZA 1PHKA 3MB6A 3EYHA 4L44A 4EORA 5BPYA 5FDPA 1VJYA 3Q5ZA 4MD7E 2GFSA 5ANJA 3ACKA 2PMNX 3Q60A 4RFMA 5D7AA 3SQQA 3DPKA 2R5TA 3BEAA 3RWPA 2PZPA 3I0OA 4XJ0A 4YZMA 4O82A 2XUUA 3L9MA 2PZIA 4WBOA 3C7QA 5AP4A 3ACJA 4GEOA 2FH9A 4HYUA 4OAVB 4OTPA 3JVSA 2VWZA 4ALWA 3P86A 3BI6A 4AGWA 3V8SA 1OL7A 4MQ1A 1GZKA 3LJ2A 5EYCA 1P4FA 1FVVA 5D41A 1FVTA 3NW6A 4ZK5A 3WYYA 1IG1A 1Z9XA 4G3FA 4PNKA 5B7VA 3W18A 3TJCA 2PUIA 4K18A 3AC8A 1Z57A 3EL7A 3MJ1A 4DFZE 4USFA 3ENHA 1MQ4A 1J3HA 4ASDA 4UEUA 3P7CA 2GHLA 2XIRA 4NM3A 4AACA 3O7LB 1KOAA 1OPJA 4BL1A 5F4NA 3GFEA 3HVCA 3RBWA 1MRYA 3NZ0A 5C8NA 3DAJA 4JQ8A 4KBCA 2WOUA 5I9WA 3U6HA 4FT3A 4O0UA 4EBVA 3WYXA 4EOSA 4HVSA 2WMAA 2XJ1A 1FMOE 3VS2A 4FSQA 3N4VA 3IOPA 4GT3A 3AD5A 2QOOA 2WGJA 3PE1A 4C8BA 4GKHA 1ZYLA 4U80A 2Z7LA 5DT4A 3VS5A 2VNWA 2QOLA 3LE6A 3VS0A 3GOPA 2RFNA 3PIXA 5IA0A 2OI4X 3MVLA 4QTCA 4E6AA 4YJSA 3O0GA 1HOWA 2I40A 4DEGA 5CU4A 1QPEA 2PE1A 3M1SA 3HMMA 1H0VA 3OD6X 4KIPA 4UMQA 4XG7A 5H2UA 4HVHA 3T9TA 4PP7A 4J71A 2XM8A 3R9NA 2VO3A 2Y8OA 3UVRA 2I0YA 3ULZA 4CYJA 2XBAA 3ZFYA 3C5UA 4USEA 3M42A 2HCKA 2C0OA 1LPUA 3PIZA 4RIWB 3RAKA 4RX5A 2BZJA 2VTQA 5CQUA 3RAWA 3WF9A 4IFCA 4RVKA 4AA5A 2BTRA 2VAGA 1PYXA 2F7EE 1IA9A 1YW2A 1Y57A 4JNWA 3OT3A 2C5VA 4DGOA 1K9AA 4A9TA 4RIOA 4M12A 3QTQA 4B9DA 4BBEA 2WAJA 3ZXTA 1J1BA 3RKBA 3KVWA 3R7IA 3W2SA 4BRXA 1KE5A 5J7HA 4U5JA 3ANRA 2PZ5A 5DYJA 2VWYA 3AC4A 2JD5A 4L43A 4RA5A 4H3PA 3R1QA 4DH5A 4FIGA 4LV5A 4EOIA 2C6IA 1L8TA 3RK7A 1BKXA 4EHVA 4GIIA 5IISA 3OVVA 3E93A 3PE2A 4C3RA 3DKGA 2WTDA 2YM7A 3C4WA 3QRTA 2XMYA 5AR3A 3SVVA 4BGGA 2R3KA 3E8EA 3QCYA 4RIXA 1H1RA 4WO5A 4E7WA 2QOFA 4LMUA 4CLJA 2X8IA 1WBOA 4PX6A 5KZIA 3HL7A 4WUAA 4A4LA 3DFCB 3FZTA 3RM7A 2ITZA 2P2HA 2A4LA 5IA2A 3KEXA 2FA2A 3VUHA 5BVKA 3B2WA 4NFNA 3ALNA 4IB1A 3FZRA 1V0OA 4N70A 3C0HA 2R9SA 2AYPA 4DAWA 4EJNA 4BBMA 5HG7A 2B9IA 3GP0A 4NIFA 4DFNA 4EOKA 4FOBA 4FK6A 3QRUA 2REIA 2PPQA 5AAEA 1R0PA 2YITA 1JKTA 3Q3BA 4F1TA 3WARA 4AAAA 4BTJA 2WMBA 4UXLA 1TQIA 3GBZA 3SLSA 2UZOA 2QHNA 2O5KA 3OXZA 4FOCA 4CFWA 4R1YA 5CASA 2WMXA 3FZPA 3AD4A 2G9XA 3QAME 3OTUA 3ZONA 5HNBA 5IEVA 2VX0A 3NCGA 4IX3A 5FP5A 3EIDA 1BL6A 4PDOA 4BBFA 2R3RA 2BRMA 4AU8A 4X2FA
chains in the Genus database with same CATH superfamily
3OG7A 3ZO3A 3WZEA 3VIDA 2BRNA 2QOQA 4I5MA 4QP8A 3OY1A 4E4NA 4H1JA 4F4PA 3OEZA 4RFYA 5H9BA 4BYIA 3SG9A 2YM8A 4H58A 2X81A 4GV1A 1A48A 5CI6A 5C4LA 5EDQA 5IQIA 5LWNA 4K1BA 3I6WA 3VJNA 4F65A 5D1JA 3O2MA 2GSFA 5DVRA 4GYGA 1EH4A 1CKIA 2I1MA 1KE8A 4AW5A 3DJ7A 2C3LA 2C6DA 2FB8A 4AN2A 2OXXA 4L00A 4KUJA 4RQKA 3NLBA 3DY7A 5LMAA 2PUUA 4G31A 2QOIA 5M07A 4LM5A 4USDA 1W82A 3CIKA 2R7BA 2XK8A 2R3OA 4F1MA 3KRXA 4O7LA 4F9AA 1NW1A 3AXWA 3FMNA 3Q4CA 4O38A 4QNAA 4DEAA 1E1VA 3LMHA 2XKDA 2EWAA 3K5VA 5HIDA 4LV8A 2J0IA 2W4OA 3QHRA 3MIYA 3Q4UA 4L46A 4TNBA 4I6LA 1OIUA 2IJMA 3QWJA 3ATSA 4WA9A 2XK9A 4E4XA 2C5YA 4R3PA 3T9IA 4Y8DA 4YC6A 2XKCA 1TVOA 3HEGA 3HP5A 2QLQA 4O0RA 4QP3A 3S3IA 2X7OA 3R1NA 4N0SA 1M2QA 2JBPA 3V01A 5JK3A 2C6OA 4KS7A 1FGIA 3DQXA 4NYEA 1Y6AA 3PXKA 5ANIA 2ZFYA 1H1WA 3P08A 4FBXA 4L45A 1H27A 1U5QA 3ORIA 3NMUF 3OTVA 3DGKA 2G01A 2W1CA 4WRSA 1KE7A 3NW5A 5CU6A 1YWRA 4G1WA 4TWOA 3SOAA 2W5AA 2YAKA 3NUXA 4C0TA 4F99A 5JFXA 2JKOA 4X2NA 4EKLA 4EUUA 4ENYA 2X6DA 5ICPA 3VUMA 4I41A 2XEZA 1H07A 2AUHA 4NM7A 4XHKB 4BCGA 4EONA 4W8DA 3D5WA 3LQ3A 2ONLA 4UWCA 3TDVA 5E8VA 3LZBA 3MY1A 2W1GA 4E3CA 2RKUA 3MFRA 4DGGA 5DN3A 2BHHA 3Q6UA 1OL5A 3QGYA 4HGLA 4E5BA 3TUBA 3HA8A 2JIUA 2B54A 4BCPA 3A4OX 3NUNA 2HZNA 3DK6A 4OGRA 3MB7A 5GJFA 4MBIA 4YJRA 3SGCA 4CMTA 2W1IA 5HBJA 3FC2A 4DG2E 3TL8A 1UU9A 4PMSA 2W7XA 4P5QA 4XG2A 1XH9A 3MW1A 4JI9A 3TIYA 1LP4A 2J6MA 3ORKA 4EEVA 5CX9A 4FNZA 4FVRA 5A46A 3F61A 3FPQA 1XBCA 4G9RA 4GG5A 2BZIB 3D83A 4H36A 1Q24A 3BX5A 4XLVA 4EQMA 4RX9A 4DHZA 5EI8A 4E6QA 2YM4A 4HNFA 5AV3A 2RF9A 5AP2A 3PVBA 1GIJA 4QRCA 3HX4A 4RVLA 3M2WA 3ODYX 4ZP5A 1HCKA 4IJPA 4JL9A 4BDHA 4U40A 3QRKA 3WF6A 3ZC5A 3CE3A 4MAOA 1R0EA 2UZVA 4HW7A 3U4UA 1Y8YA 5J1WA 3QTRA 4FZAB 4C4FA 2J5EA 3FMLA 2QG7A 4JG8A 5AUXA 1J7UA 4DTKA 4EL9A 4O21A 5I3RA 3G2FA 3V3VA 2QU6A 2XAOA 4FIJA 3RZBA 1PXNA 2HAKA 5JMSA 4UN0C 5HTCA 2F4JA 2QKRA 3MA6A 2I7QA 5BYZA 2Q0BA 3KCKA 1Z5MA 3PXQA 4IJ9A 4IAYA 4XG8A 3LHJA 3R8MA 2YLEA 4H05A 2EXCX 4EHEA 3ZM9A 3KN5A 3OC1A 4R3CA 5CXHA 4EKKA 4FV2A 5EKOA 3REPA 3VS1A 2GTMA 2X2MA 4BZNA 4TL0A 3C4CA 2GS6A 2C1AA 3OOMA 3ZO1A 4BDDA 4YJOA 3P23A 2WEIA 3MSSA 2OH0E 4FUYA 4XRLA 3OFMA 5L4QA 1WVXA 5AV1A 2VTMA 4Q5HA 2XALA 3E3PA 3OUNB 3QQKA 3C4ZA 4BGHA 4CT1A 5AA9A 5CYIA 4R78A 3DKCA 4JG7A 4M8TA 4BDBA 4F78A 1MRVA 1WVWA 5D11A 1ST4A 1SNUA 2HZIA 2A1AB 3F6XA 5HICA 4O6LA 3G9NA 4MF0A 3TKHA 3TNWA 4QYYA 2CGWA 2XB7A 3E62A 3E8DA 5TKDA 4LDTA 4R8QA 4DG3E 4EH3A 4LL0A 4ZY4A 1JOWB 3WF8A 3HRBA 4II5A 1UWJA 4PF4A 4RZVA 3IGOA 3QD3A 4Z7GA 5K9IA 5KMOA 2GHGA 3V5WA 3D0EA 3MPMA 4WG4A 4C59A 4C62A 3SX9A 3A4PA 1OKWA 3IW4A 2FSLX 5ACKA 4NM0A 1Q61A 4YTHA 4I20A 4XV1A 3DDQA 1DI9A 3GC0A 4D0WA 1U4DA 3CXWA 3A7JA 4PL3A 1ZAOA 3NPCA 3LFCA 1LUFA 3TNHA 4DGNA 4ZS4A 4EH6A 3VUIA 2W5HA 3PA3A 2OIQA 4FYNA 4AX8A 1OL2A 3P4KA 4M69B 3UNKA 2IVVA 4KKHA 4GCJA 4IVDA 3UMXA 3WZUA 4XH6A 5LVMA 2BFYA 2XZSA 5E9EA 1OVEA 4FL3A 4FVPA 2YDJA 2FGIA 4BC6A 1J7IA 4FZDB 5DRDA 1YXUA 3QQGA 3GCQA 2X7FA 4FRFA 2VX1A 4O7WA 3KMWA 3N9XA 2QO2A 2VTNA 4D4SA 2XYUA 1CTPE 4UZHA 2EB3A 4GL9A 5J87A 3OWJA 4L7FA 1IRKA 3R8UA 5AMNA 2R3FA 4FG7A 3W8LA 4YR8A 4EI4A 4JAIA 4ERKA 3VQHA 5A6NA 2CKPA 4EH9A 2C3JA 2JIIA 3F82A 4ZSJA 2VTJA 2OJ9A 4TRLA 2ITQA 1CKJA 4FGBA 5AR7A 1P14A 2QC6A 2YDKA 2BAKA 4YMJA 3MFUA 4DCAA 1YXVA 4BKZA 3FLWA 4AT5A 2X4FA 1W83A 2UVZA 3EQHA 4A06A 3Q9YA 3AGLA 4JX7A 2J4ZA 3R7GA 4K6ZA 4U44A 1CKPA 4CFMA 4CZYB 5J9YA 5HESA 5TE0A 4UY9A 1U59A 4AS0A 3EKKA 3WZJA 4FNYA 2JAVA 3KY2A 5DRBA 4EK4A 2ZV7A 5ANEA 3LLTA 3BYSA 3G6GA 4PPCA 2JDVA 4E6CA 3FXWA 3EZVA 3L9PA 3QXOA 5CNNA 4JBOA 3AT2A 2X4ZA 4KKGA 3A62A 3FY2A 4FL2A 4M84A 4BCIA 1OITA 4O81A 4DLIA 4ZAUA 4PPBA 1OKZA 3C4XA 5CEQA 5IQEA 5BMSA 2ZVAA 3I60A 4BKYA 5HEZA 4FEUA 3UTOA 3LOKA 2WMUA 4YJNA 1QMZA 2IW6A 4D4YA 4IFGA 4QO9A 3VUTA 1AQ1A 4FZFB 4ASEA 1Q62A 3P1AA 5CS6A 5BUEA 2PK9A 4ASZA 4B99A 3IQ7A 5AR8A 3CY3A 2QO7A 2GNLA 4MX9A 2XIKA 3D4QA 4X3FB 5HNGA 3D2IA 3KF4A 5FM3A 4NCTC 4F09A 3W0OA 3QD2B 3DDPA 4YPDA 5E8XA 4Z3VA 1O9UA 4IE9A 1F3MC 4P4CA 3CC6A 3R7UA 2NRYA 4TKSA 5I9YA 4DCEA 4OBOA 5AP0A 3I81A 3OWLA 4YLLA 3VN9A 5IF1A 3O8PA 4L9IA 4XEYA 2ZM4A 4TN6A 1PXKA 4FKTA 4RC3A 2I0VA 3EKNA 3W0NA 1YWNA 1YQJA 4WG3A 5DGZA 3ZO2A 5IQBA 4CQGA 3JY0A 3Q53A 4XV9A 5HLNA 1QPJA 4IVAA 3W16A 2PVLA 2Z60A 4IAFA 1ZYCA 4YSMA 1GZNA 4O0YA 2E9VA 5E90A 4CFNA 3KREA 1U5RA 2J51A 3BU6A 4TT7A 1M7NA 4AWIA 2OH4A 3GU5A 4YZCA 5I9ZA 1BLXA 3F5XA 3PYYA 4QMOA 1XO2B 3MA3A 5HU9A 1RE8A 2Y4IC 3KXGA 2W0JA 1J91A 3ZRMA 2YIWA 4PMTA 2YZAA 2ITTA 2PVHA 5BYLA 3TUDA 1OGYA 1UKIA 4C3PA 3FY0A 4PDSA 4QMPA 4RG0A 2XK4A 4L53A 3UO5A 3PXRA 3FV8A 4FX3A 4IADA 4K77A 2W4KA 4C4HA 4X2KA 3GU7A 3UZRA 3VUDA 1ZYJA 3ZHPC 2HY0A 4IWQA 2JBOA 3EFKA 3KRWA 5TO8A 5IMEA 2OICA 1YHSA 2QU5A 3NAXA 4E93A 5IA1A 2VTHA 5ETIA 3RGFA 4DYMA 1Q97A 2B9HA 2WQOA 3ERKA 3BU5A 4IDTA 2CNVA 3FMMA 2XH5A 2BTSA 2R3PA 3PA5A 1A06A 3U6IA 1H1PA 5I5ZA 3I0QA 4RIXB 3EQPA 3P5JC 4OTIA 4EWQA 1H1QA 3IPHA 3A8WA 4APCA 2CGVA 4FG8A 2PZRA 2XP2A 3ZXZA 2XVDA 5FTQA 3SV0A 2ZB1A 4Z55A 3CS9A 4JBVA 2FSTX 3O17A 2X0QA 2BROA 4FGRA 2R4BA 2OKRA 5AX3A 3U9CA 2WU6A 1YVJA 5IKWA 4CVAA 3SW4A 4I5PA 2J90A 4JS8A 4JOAA 3BGPA 4PV0A 4K0YA 4DHIB 3F3WA 3QTIA 5JSMA 4GS6A 1LEWA 2VX3A 4V0GB 3AC1A 3ULIA 4RA4A 3BHYA 5A4EA 1NY3A 2ETKA 4FKGA 2DQ7X 5EW9A 3DA6A 1JQHA 2JC6A 3P78A 3PJ3A 4FNXA 2XAMA 5EKNA 3F69A 1O6LA 4O0VA 2Z2WA 4TYEA 2BZHB 4UWYA 2EXEA 2IF8A 3ZRKA 4AUAA 5CAOA 2X0GA 4FT0A 1KV2A 4FICA 2W05A 4IXPA 4EK8A 5BVNA 3UQCA 1H00A 3DBFA 1UNHA 4QP2A 4RZWA 3R9RA 4HVDA 1RQQA 2UW4A 4JRVA 4J99A 3R9DA 2JFLA 4IVBA 3OT8A 3FQSA 1JSVA 3ZLWA 5A6OA 4U3ZA 1JPAA 2O64A 4FG9A 4FVQA 2XJ2A 5FTOA 5L2WA 5IPJA 4XG6A 2YIQA 3IGGA 4FSYA 3H9FA 4UXQA 2B0QA 3OWPA 4EZ3A 5GZAA 4NJ3A 3AOXA 3R2YA 5L8KA 1UU8A 3HDMA 4GU9A 3MTLA 3AC3A 4FIEA 4AZWA 3E87A 5KMJA 2ZB0A 4M69A 3NVKI 4XP2A 1G5SA 3VUKA 4C4JA 4G3DA 2GFCA 2J0JA 4MD9E 2CKQA 4R7IA 2H96A 4LMNA 3A99A 4AA0A 2GPHA 2RL5A 2P33A 3KQ7A 3VUGA 2X2LA 2UW0A 3IG7A 4PP9A 4CXAA 3V5PA 2VUWA 3C13A 4ITIA 4IEBA 4IZ5A 4AFEA 4X21A 3R8ZA 5A4CA 3UOKA 4GG7A 2WEVA 3OMVA 4JX3A 4LOQA 4XV2A 5LVNA 3QKLA 4AOTA 2CDZA 4LRMA 3U55A 2R7IA 3L8SA 4WD5A 4Y95A 3TZ9A 4L6QA 5C27A 1OMWA 3KXMA 3QXPA 2QOHA 3MY0A 1U54B 2VTOA 3QUDA 4F64A 4HNIA 5DBXA 4F9WA 4QTEA 5EDRA 3D9VA 4GVAA 1WAKA 5CT0A 4U41A 3I5ZA 3QQLA 4G34A 5HIBA 3NSZA 4K11A 4HPTE 4YNEA 4XNEA 3AT3A 4NTTA 5DPVA 2WELA 2E9OA 1OPLA 5KNJA 5LXMA 1E1XA 2CGUA 1CM8A 4M7IA 4O4FA 4C02A 5JGDA 3HZTA 3QX2A 4IWOA 4UWBA 4YBKA 4I21A 1VR2A 2WNTA 4LGDA 4GT5A 3HMNA 3W33A 4E1ZA 3BWFA 1Y91A 1ZMVA 3BYUA 4RJ4A 5JQ5A 5J8IA 4R6VA 4IX4A 4W9XA 1PJKA 4EQCA 4IB0A 4A4OA 5KE0A 4F6UA 1KWPA 2ITWA 2ITPA 3II5A 4L67A 4TNDA 2R3IA 5D7VA 5DA3A 4CTBA 4ANNA 4BIBA 4X3FA 3FQEA 4IZYA 2C6EA 4AZEA 1UA2A 1BI7A 4U0IA 4FSMA 5FUTA 1VZOA 4DBNA 2WPAA 3BLQA 4LQMA 3F3VA 5IU2A 3V6RA 5K4IA 5HO7A 3PLAE 2BRBA 3I79A 1IEPA 2ZMDA 2HIWA 3TUCA 5AIKA 1CDKA 3C5IA 2X8DA 3IK3A 4I6HA 5DEYA 4W4VA 1STCE 3CPBA 2CLXA 4BHZA 4QT1A 3LJ0A 2VWVA 4RVTA 4A9SA 3EQGA 5K3YA 5M4FA 3UOJA 3DKOA 3TMOA 1M17A 4OT5A 4JBQA 3LM0A 5KBQA 5J9LA 3EN9A 4I0RA 2YLFA 5K0KA 3PWDA 3PA4A 3JS2A 4JQEA 4MWIA 5HOAA 3MVHA 5LWMA 5L2QA 2YM5A 4DEIA 3K3IA 5JZNA 3VQUA 3MFTA 5L2IA 4S34A 3HECA 3QBNA 3QD4A 4EH4A 4DN5A 1O6YA 3PY0A 1H25A 1OL6A 2WU7A 2R3LA 3PUPA 4I94A 4U8ZA 3I1AA 4IX6A 5EI6A 4GK2A 3DK7A 4YO6A 1H26A 4J96A 4DH3A 4FJVA 4ZTHA 3EN6A 1P5EA 1URCA 3POZA 4OTGA 5C4KA 4EK6A 3TKUA 4O7YA 2O8YA 2OZOA 3A7FA 3MH0A 4Q9SA 5CEIA 3V6SA 3L9NA 3RI1A 4EH2A 3FLSA 3QTWA 3CLYA 3MIAA 4RIYB 5EM5A 2OLCA 1M2RA 2HENA 3BWJA 4MCVA 3RPYA 3QZFA 2JIVA 4OBPA 4YUQA 4EJ7A 1GOLA 4XP0A 5L2SA 5M53A 5KMMA 4BCMA 3FHRA 2XIXA 2IZTA 5JRQA 4DC2A 3RHKA 5JT2A 2OXYA 3OBJA 4O0XA 4HYIA 3R04A 3LFBA 2AQXA 2YEXA 5HIEA 4GFOA 5A9UA 5CENA 3I7BA 5FBNC 2ERZE 4AW0A 4UMUA 4L3PA 1W84A 1H01A 4U45A 3F9NA 4XBUA 2V55A 4D9UA 3SW7A 4XP3A 3UO4A 2VO6A 3TV6A 3HGKA 4BTKA 1G3NA 4E5WA 3CP9A 2HYYA 3FXXA 2XRUA 3LPBA 4JDHA 3VW6A 2UUEA 4RMZA 3E64A 1XBAA 4TWPA 3ODZX 3UPXA 2JEDA 3CCNA 3MVJA 3PPJA 3ATTA 2RFSA 2ZMCA 3V5QA 4NEUA 4FKPA 3B8QA 3GXLA 2BRHA 3FC1X 4YPSA 5F1ZA 3RP9A 5KHWA 4YGAA 1DI8A 4I3ZA 4AZFA 4CMOA 4BDJA 4WT6A 5E91A 3TI1A 4TYIA 2ZM1A 1WVYA 2RG5A 5CSPA 3QU0A 2F9GA 3WI6A 3D7ZA 1JVPP 3NRMA 4I92A 4D55A 4ID7A 1SMHA 2X7GA 3ORMA 4O2ZA 1YKRA 3R8LA 5IG1A 1FMKA 3EQCA 3ZLSA 3R7VA 5M4UA 5I9VA 3Q6WA 2CLQA 1XKKA 4QMXA 1IASA 4ANSA 4D0XA 2QG5A 3HMIA 4V0GA 4AFJA 3O23A 2VWBA 2PULA 4FSWA 2HOGA 2PSQA 4XG3A 3U8WA 3ZM4A 1HCLA 4APPA 3UDTA 2GNIA 5E4HA 4EOLA 3KF7A 4U3YA 2R3QA 5DT3A 1JSUA 4E4MA 3LKMA 2ZDTA 1PXPA 2B4SB 3QC9A 3QL8A 3NEWA 5FEEA 4AOIA 3HUCA 3LQ5A 4ZXTA 3RHXA 2UZBA 3UC4A 3Q52A 4AF3A 3R1YA 3DFAA 4EZ5A 4OT6A 4AZVA 2IVSA 3UQGA 5L8LA 3KMUA 1SVEA 5HVJA 2C6KA 5HORA 4X7QA 2BKZA 3LMGA 2GNJA 3A61A 4LUEA 4EH7A 3IOKA 4UX9A 4CT2A 5BVOA 3BL7A 1YOLA 3A2CA 4C57A 3QALE 5EQYA 2OG8A 4QMQA 4OAUC 4K8AA 5GNKA 4B8MA 3PFYA 1PMVA 1Q8UA 3MYGA 2Q83A 4HCTA 3R9HA 2WTKB 3QLFA 4G5JA 3QUPA 3DV3A 3QKMA 3FUPA 5J95A 4BDGA 3W0MA 2OJIA 3GB2A 3OF0A 4NH1A 4L68A 3A60A 2VGPA 4U9AA 3AG9A 4PY1A 3Q04A 5ETFA 2YABA 2YIXA 5AUZA 5M57A 4KA3A 3R21A 4FNWA 4M68A 4W8EA 4L3LA 4PDPA 1PKDA 4D1XA 5JQ8A 1ZMUA 5CANA 2BAQA 2BIYA 3F7ZA 3MVMA 4O86A 1YDRE 4X6QC 5AR5A 3AGMA 4BF2A 3GU4A 4QNYA 2WQBA 5HG9A 2QR8A 4JDJA 2VWUA 1GY3A 4D4RA 4F9BA 2HK5A 3QRIA 3LCTA 4F0IA 1T45A 3OWKA 3ZDUA 4CNHA 4I0SA 4QMYA 1GZ8A 1FVRA 2Z7SA 3IDCA 3PWYA 4MKCA 5I4NA 2XJ0A 3I6UA 1P2AA 4C3FA 1G8KA 4HZSA 3BE2A 3EN7A 5HE3A 2IZRA 4HGTA 3Q9ZA 2OFVA 3MWUA 2XYNA 4GVJA 4D2WA 3BYVA 5M55A 1XQZA 5C26A 2WMSA 2F2UA 5A14A 1U54A 3BLRA 2A27A 4S33A 3ZSHA 3QTUA 4FK3A 4I6BA 3H4JA 2HXLA 3E5AA 4M67A 3UODA 5IA3A 5IQGA 2GNGA 4IM2A 2Z7QA 1ATPE 4EOOA 4ZMFA 4ZJVA 4WIHA 1APME 4N6ZA 4FIIA 3R8VA 1KE9A 2BALA 3NGAA 4O27B 1I09A 4O4CA 4YJQA 3Q96A 4UV0A 2X8EA 4XX9A 4J7BA 4FV8A 4ZTRA 5J5SA 3QQUA 5ITAA 2GQRA 2UZLA 4LL5A 5IQDA 3BCEA 3HAVA 2PUPA 1IAJA 3ORPA 5JFWA 3R8PA 4TYHA 3IW7A 4RX8A 3MPAA 3RJCA 4FKWA 3WILA 3ZZEA 5I9UA 3RPSA 4CMUA 4PQNA 3RWQA 4NWMA 4CCBA 2ITYA 2V5QA 3MH2A 5E92A 4E6DA 3LFQA 4F7LA 3NYOA 5AP7A 4BCJA 2WHBA 3WZDA 3ORNA 2NRUA 2EUFB 3ROYA 5B2MA 2WQNA 4MTAA 4ALUA 4DTBA 4AQCA 3BBWA 5AP1A 5EOBA 4FT7A 3D5UA 1BX6A 1YDTE 3K2LA 4FTCA 4IZAA 3SDJA 2RIOA 3BE9A 2YM3A 5IA5A 2BIKB 2X0PA 3PP1A 3SC1A 4QTBA 5CT7A 4FKSA 4XG4A 3DTCA 4D1ZA 4V04A 3JR1A 4FIHA 4FKJA 3OCGA 2A0CX 4QOXA 5JRSA 4O2PA 3FYKX 2ZV8A 3NNVA 4J97A 4Y73A 1XWSA 4TWCA 3N4TA 2BHEA 3VS3A 5CNOA 5M4IA 4ASXA 2R0IA 5K5XA 3BL9A 1OI9A 3L8PA 2YN8A 4QEBA 2C3IB 3U4WA 4EQUA 2P55A 2QNJA 2ZOQA 4WRGA 3WE8A 4BI0A 3UIXA 1CSNA 4WNMA 2OIDA 3G0FA 4XS2A 3QQJA 3L9LA 1OM1A 5CAQA 3K3JA 4FTAA 4XMOA 4OLIA 5AR2A 4PMMA 2XKFA 1JAMA 4O7RA 2OJFE 5HVYA 2WMWA 1WBVA 1YI3A 4GH2A 3TN8A 3VBQA 4F70A 3PY1A 2B52A 2C30A 1DS5A 2AC3A 3ZUTA 5J7BA 2G2FA 2WMRA 3G5DA 3F3UA 3R2BA 4FR4A 3ORZA 4N6YA 2A2AA 3PG1A 4RIYA 5FXQA 4BI2A 5C8KA 4PUZA 2OIBA 3MFSA 3CKXA 3LFDA 4LRKA 4WUNA 3PPZA 4X3JA 4I6QA 1TQMA 1ERKA 3W2PA 3DZOA 4NT4A 4RJ7A 3FWQA 4F1OA 5KMLA 4XLIA 1BMKA 2W1EA 3BHVA 4J52A 4C2VA 5CEMA 2VV9A 3W32A 5IA4A 5E8YA 3OOGA 4YC8A 4ARKA 5CQWA 2UW6A 3OUKA 5GJDA 4FKRA 3UNZA 4R7BA 3V51A 5LMBA 5H8GA 4D2PA 5L6PA 4HZRA 1J1CA 5A4QA 3FYJX 2C5NA 4QMMA 4U42A 4Y83A 4J98A 3E8NA 3ZC6A 4E8AA 2XNGA 5EDPA 5CI7A 3PSDA 2UW3A 3VBWA 3S0OA 2PE2A 3RPVA 1IAHA 2OBJA 3O8UA 4EYMA 4I4EA 4ACMA 3MN3A 4BB4A 1KV1A 5DR6A 3U87A 2E2BA 5FP6A 3UOLA 3PDTA 3VF9A 3GC7A 4NUSA 3T8OA 2W99B 4YZDA 3E3BX 5CXZA 3QCSA 5DE2A 3COKA 5BVFA 5KKRB 4FIFA 2HZ4A 4IH8A 1XH8A 4RFZA 3ZSGA 4O7VA 1Q8YA 3GT8A 4QMLA 5BYYA 4BIDA 5EHYA 4Y46A 4BY9E 2DS1A 2CCHA 1VLRA 3CD8A 3UG2A 3C1XA 3POOA 3NCZA 5EYDA 3TNQB 3C50A 4IB3A 1KOBA 4OTHA 4UB7A 4D9TA 4RGJA 4O0TA 3U51A 3HV5A 5A54A 5IH6A 3NUSA 3UMWA 2J0LA 4I22A 3DNDA 2B9JA 3ENMA 2QCSA 3ZH8A 5KZ0A 1S9IA 3EZRA 5CZHA 4ERWA 2CCIA 3RZFA 2LAVA 4O7SA 2UV2A 2A19B 2JKQA 4IWPA 3SKCA 2W1HA 5HE1A 1KUTA 3LQ8A 4YZBA 5JGAA 4DDIA 2BRGA 4MH7A 3R63A 4O7ZA 4IB5A 1AGWA 2X9EA 3FLQA 3VBVA 4R5SA 4DEHA 3SA0A 4PNIA 3C0GA 2VTSA 1OIQA 5HG8A 3NX8A 4QYEA 4Y5QA 3NFGB 2PMIA 4C4IA 4OW8A 1GIIA 1M7QA 2VTRA 4FKVA 3GFWA 4DBXA 3Q9XA 2V62A 1JKSA 4LOOA 3MV5A 2VWXA 4OTQA 3TIZA 3W2RA 4C2WA 3OEFX 4AN3A 3NUYA 4DFYA 4M3QA 3VS7A 3RAHA 2WTCA 3SG8A 3JVRA 3PVGA 1Q8WA 3RM6A 4I5CA 5CLPA 4W4YA 4FV7A 3GCSA 3R7EA 3TXOA 4ACCA 4I24A 3GCUA 4ZJIA 4Z9LA 1RW8A 4U81A 3KA0A 3LFEA 3UJGA 3QHWA 3V04A 4AOJA 4BWKA 2B55A 5CY3A 3GEQA 5HCZA 3ZSIA 4BR3A 3HRFA 4ORKA 4FT9A 1OGUA 3PY3A 2WO6A 4I23A 4C35A 4FTQA 4L3JA 3TWJA 4Z7HA 5HE0A 5M44A 1G8SA 1Q41A 3CR0A 3QCXA 2W06A 4GW8A 1Q99A 4AGUA 2IPXA 5CSVA 3QFVA 3L8XA 3FLNC 4MXXA 3QQFA 1PKGA 5CU0A 4QMUA 3Q9WA 5KMIA 2GHMA 5AA8A 2WFYA 4EK3A 4TPTA 1NXKA 1SVHA 3BYMA 4FKOA 4S32A 5CAPA 4AT3A 2P0CA 3MS9A 2YWPA 4AW2A 1QPDA 1R78A 3R73A 3QZIA 3FXZA 2JGZA 4J8MA 5HCYA 5TOZA 3VF8A 4FV3A 4BWXA 4EZ7A 4FV4A 4W4WA 1UV5A 4NM5A 4RJ5A 3ZBFA 3LCKA 2OJJA 4EYJA 3DBEA 4DEBA 3HV3A 3PG3A 4EC9A 1BI8A 2H9VA 2WMQA 3DTWA 4WG5A 3RVGA 5EI2A 4AA4A 5FXRA 1Q8TA 1GJOA 2PZYA 3TEIA 3SAYA 2OF2A 5A4LA 4YTIA 4CYIA 3KK8A 3JXWA 2AC5A 3TM0A 2EVAA 3QYWA 5E7RA 3EWHA 3R9OA 4AP7A 3R71A 1PXLA 3BHTA 1V1KA 4KSQA 3ZUVA 5BUJA 3E88A 2GQGA 4YTFA 1WFCA 3RALA 2WZJA 1GNGA 5AUVA 4K33A 3EL8A 4QP7A 4QMZA 4IIRA 4DFLA 4JMQA 2EXMA 1LR4A 4YLJA 4EHGA 3IW8A 1ND4A 2WOTA 3BIZA 3S4QA 4PTEA 3FI3A 1YDSE 3PSCA 2QO9A 4BCNA 4QDEA 2F7XE 4FMQA 4KBAA 5HE2A 2R3NA 5DIAA 5CAUA 3PJ1A 1ZY5A 3FI8A 3LM5A 5EYMA 4ZTSA 4DFUA 3O51A 2PVKA 5DWRA 2QOBA 3RNYA 4YZNA 5BNJA 3F5UA 5T68A 4X2GA 5GHVA 4DH8A 5CAVA 2WTWA 2XBJA 3EQIA 1UU3A 3OXTA 1M2PA 2HW6A 2XF0A 3ORXA 1MP8A 4JQ7A 4RC2A 3OS3A 3R7YA 1IA8A 5HI2A 2W1FA 4L52A 2YZLA 3FL4A 3R01A 5D12A 1H08A 3DU8A 3G0EA 5AUWA 5K5NA 4CEGA 4UMTA 2V7OA 4G16A 2ZM3A 5DR2A 4BI1A 2HXQA 5A4TA 2PL0A 3FMDA 3GC9A 5BQ0A 1J7LA 3DJ6A 3W55A 2HZ0A 4JIAA 2Q0NA 2GNHA 3KKVA 4O1PA 2J9MA 5FBOA 5EHLA 3P5KA 5HLWA 2PVJA 3FPMA 2CN8A 1WBPA 5ANKA 4C34A 4F7NA 3BHUA 5EM7A 2VTPA <