4L00A

Crystal structure of the apo jak1 pseudokinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
277
Chain Sequence
WQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK1
publication title Structure of a pseudokinase-domain switch that controls oncogenic activation of Jak kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 277
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l00A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l00A01
4HGSA 4FEVA 3EHAA 5C01A 2WTVA 4BIEA 1YOJA 4NIFA 1H08A 5CTPA 2J0LA 3R22A 4L53A 1G3NA 5D11A 1H4LA 4DGNA 5HIEA 3KXMA 4PPAA 4M0YA 3LFSA 3EKNA 4XP0A 3LXLA 3HA6A 5HBHA 3RK9A 3PJ3A 4BBEA 4CT2A 2OIQA 3S00A 4QQJA 4H39A 4I5CA 1M2PA 3TL8A 3LMIA 4FTJA 3MI9A 5AP7A 4ZS4A 3EN6A 5FDPA 4AGUA 2RG5A 3U55A 2XM9A 3NYVA 3ERKA 3EZVA 4NIFB 1H07A 4D2TA 4I24A 4TNDA 2C6TA 3B2WA 3HKOA 1RDQE 5AX9A 3RNIA 2CKPA 2GDOA 4QPMA 3LFNA 1FMKA 4GUEA 1V0OA 2EUFB 4PMTA 3ZTXA 5L2WA 4RJ8A 4LOPA 4Y5HA 4C4EA 3OOMA 1G5SA 2XKCA 3SV0A 4YSMA 3QKKA 3R7UA 1ZLTA 1OVEA 2RGPA 1VYWA 3C1XA 3EN5A 3ORMA 2UZVA 2FYSA 2J0MB 5KBRA 3U6JA 3Q2MA 3QTRA 3NIZA 5FQDC 3GU8A 4E7WA 3HDNA 2H9VA 3UYSA 1Q4LA 1Q61A 3AT2A 3OTVA 3M11A 5IQHA 1R1WA 4WBOA 3NLBA 4EUTA 1BLXA 4EKLA 3E62A 4LRKA 3HEGA 2B9HA 1XH6A 2C0TA 5JN2A 3OD6X 1NVSA 5A6OA 2PMOX 3PZHA 1CSNA 2RL5A 2PUPA 3VBVA 3PIZA 2GPHA 3SOAA 4L3LA 3QCSA 3MN3A 3JS2A 3SLSA 4EK6A 4ACDA 5HTIA 5JEBA 5J1VA 2VWUA 4CFVA 3F9NA 4EOJA 3R28A 3R73A 3DT1A 2IW6A 3CGOA 1ERKA 2E9OA 3DXQA 3Q96A 3LXPA 3PP1A 4CFMA 3HYHA 1Z9XA 3VS6A 4XV3A 4BTKA 2FVDA 3CD3A 4C8BA 3IK3A 2FA2A 4D9UA 3A62A 2W1FA 2YCRA 5KUPA 3NMUF 3DKGA 4KBKA 4KIKA 4PDOA 3H9RA 3Q9WA 1JVPP 1LR4A 4O0TA 5E8TA 2RFDA 3ZO3A 4DH7A 4O7ZA 1U54A 5CU4A 4EHEA 3D83A 2E9VA 2OH4A 3QCXA 2Y9QA 5AP5A 4FV2A 4WNOA 5EM7A 4B99A 4C3FA 2BRBA 4A4LA 2GHLA 1YXXA 5DYJA 3DNEA 4Z9LA 5AR7A 5HVYA 4BWXA 4O7RA 3FKNA 2Y6OA 4KIKB 4FK6A 3U9NA 3UQFA 5IUGA 1ZY4A 3A8XA 4Y46A 3K3JA 2C3LA 5HTBA 5ACKA 4YTIA 2BTSA 2X7FA 2XIRA 2GS2A 2GTNA 2XF0A 4ASXA 5AMNA 1PXJA 1FGKA 2BRHA 1YHVA 2PZRA 3A7HA 5AUTA 4LRJA 4ASZA 1NW1A 2W1DA 2BKKA 3SGCA 3P9JA 3F88A 3MJ2A 2YCQA 5GJFA 1T45A 4W8DA 5DEYA 1PXPA 3PFQA 3PY1A 4AZEA 3LCOA 4K2RA 4BKYA 3I7BA 1H1SA 4AT3A 2QD9A 4XLIA 4FVRA 2ZM1A 3ZFYA 2X4FA 5IDNA 3VUHA 1BMKA 2GNGA 2ZM3A 3GCSA 4UMTA 1OKYA 5HQ0A 5EKOA 5IQFA 1UKIA 3WF6A 5BUJA 3TEIA 3D4QA 1YHWA 3AOXA 3ACJA 5CX9A 4DH5A 5KMKA 2YZLA 3UVRA 3N4UA 4XLVA 3DTWA 2PZYA 3G90X 3TV4A 1R0PA 2BVAA 4IAFA 4EEVA 3EQBA 5CEPA 3CC6A 4J97A 3GQLA 5LQFA 2WMUA 2PE0A 4DINA 5BMMA 4QP2A 5LWMA 2XNGA 1NXKA 4B0GA 2FSMX 1JWHA 4BWKA 3QZHA 4OLIA 3PXKA 5AIKA 4X2JA 3VJOA 4DTKA 2ERKA 4HPUE 4YJQA 4DEGA 3EYHA 3GI3A 3TUBA 4W9WA 4FKQA 3FXZA 3LFFA 3MW1A 4IVBA 2BMCA 2HZNA 4KWPA 4FKTA 4WOVA 2BCJA 1X8BA 3DB6A 4BIBA 4EBWA 5E92A 5DT3A 2GQGA 3GU4A 2AC3A 3OWKA 1I44A 4ANMA 3UC3A 5GJGA 3NYOA 5FGKA 4GJ3A 3SOCA 1Z5MA 1ZAOA 3C50A 3ORLA 5I9ZA 1XH9A 5J9ZA 2GNFA 2JDOA 2W1HA 3F7WA 2GTMA 3GXLA 2G2FA 1M17A 3L8PA 4XP2A 1OPKA 2CLXA 3FXXA 4USFA 4ANSA 5ACBC 2UW5A 3ENMA 3C4EA 4DFLA 4UXQA 4M14A 4F6WA 3H30A 4YZNA 5IA4A 2ITYA 1ZMWA 2WD1A 3AT3A 5CU6A 3TIYA 5IG1A 1YDSE 3W2RA 4WNKA 4JR7A 4E5WA 3NNWA 5JZNA 4RIYA 3GB2A 3VRZA 3IDCA 3BGPA 4XP3A 3ALOA 3KMUA 4IZ7A 5DI1A 3EN7A 2DQ7X 1IR3A 2BALA 2R9SA 4HYSA 3G5DA 5HHWA 4ZTNA 4EOPA 2AUHA 2Y4IC 2YLFA 3FLYA 3MWUA 2R3JA 3R7GA 4ZOGA 2XBJA 2P2HA 3TNHA 3TNWA 2PMNX 3I1AA 2WQEA 2PY3A 4KRCA 4HVHA 5FTGA 5I5ZA 5FUTA 3LPBA 2BRNA 3HNGA 4RIYB 2HXQA 4FGRA 4O7NA 4UV0A 2OG8A 5K9IA 3AT4A 4FKUA 4L00A 2ONLA 5JGDA 3EN4A 4ACHA 3ZS5A 4O21A 4C3RA 4V0GA 4BI2A 5EDPA 5AUXA 4EUUA 4TWNA 4EJ7A 4ZSAA 4UWYA 2OJIA 2OXYA 4QP7A 3R71A 3R8VA 5CAVA 3IS5A 2XS0A 3QF9A 1JAMA 4Q2AA 2OSCA 1PW2A 1OZ1A 2WMRA 2IZRA 2YFXA 4KS7A 3BYMA 5B2KA 2PVKA 4E6AA 3PA4A 5LCJA 4V0GB 4I23A 4FZ6A 2QOQA 4RBLA 1H01A 1OKVA 4UZDA 5LMKC 3SC1A 3O8PA 4UN0C 4FNYA 5A6NA 4FI1A 2UUEA 4Q5EA 2VTLA 2XNOA 3FKLA 1OUKA 4ID7A 3P1AA 3TJDA 4BWPA 2Z7RA 4PTGA 3V04A 3ZM9A 2BHEA 3QU0A 5AUYA 2C68A 3SW4A 3C4FA 2V7OA 4Y5QA 4CMTA 4JX7A 4D2SA 5EDRA 2BAKA 1JNKA 3H0YA 3NPCA 2WQBA 3U9CA 4GYIA 4AGDA 1PRYA 3CPCA 3VS0A 2PUIA 4QTBA 4PMMA 3TWJA 4USDA 4YTFA 1RJBA 2GFSA 4YJUA 4I21A 3OEZA 3ZBFA 5IF1A 4FK3A 3AMYA 4CEGA 3VUKA 3FZSA 1K2PA 5B0XA 4I5MA 4DEIA 4CFUA 3IW4A 4OBPA 2UW3A 2I0VA 5M4IA 4MXZA 3R8UA 5FP6A 3B2TA 2XIZA 2RSVA 2OO8X 3Q6WA 4F64A 4D55A 2XUUA 3DOGA 5FDXA 4Y85A 3SKCA 4UALA 5IISA 3CE3A 1U4DA 5M06A 4FKJA 5KMIA 3JPVA 4IDVA 3PE2A 5JZJA 3LQ8A 3L9MA 4Y95A 5KZIA 3DK6A 3QQKA 5L3AA 4YNOA 3P79A 2JKQA 3MB7A 1OL5A 3R9DA 3UOLA 4XS2A 2XM8A 3DS6A 3GFEA 3S4QA 4FT5A 1EH4A 3VN9A 2G9XA 4S30A 4BDFA 4RWLA 2HW6A 3FSFA 1PKDA 3VS1A 4CSVA 4D1ZA 4O0YA 3NAXA 5B2MA 2WPAA 2XH5A 5HBJA 4FC0A 3GGFA 3CQEA 2DUVA 4C4HA 2FO0A 3OOGA 1UA2A 4HOKA 4EKKA 4EWHA 1GIIA 3COKA 4GU9A 4OTGA 2A2AA 5IH6A 4YNEA 2VWXA 3AC1A 3OT3A 2OI4X 3RHKA 3DY7A 4RVLA 3D7TA 1UU9A 1ZZ2A 3A7JA 4XG7A 5EDQA 3UJGA 4CVAA 4M68A 2Q83A 5C03A 4EC9A 5JFWA 5DGZA 4FEWA 4IE9A 2H96A 3PTGA 5LARA 5J79A 5IQBA 5GIOE 4EZ7A 1MQ4A 4C4GA 3O2MA 4C61A 3O7LB 4EYJA 4G1WA 4CQEA 4C4JA 3DKCA 5CY3A 1ZZLA 2XJ1A 5D7VA 4KSPA 3BEAA 4AOIA 2Z2WA 4GRBA 4QMWA 2ZMCA 4EK8A 4L3PA 1JSUA 5EQEA 4ZLOA 1KE7A 3P78A 3HMOA 4YPSA 1E9HA 4EC8A 2R3KA 3TCPA 4ZTHA 4OTFA 3O71A 4NWMA 3PPKA 2C5OA 4IWQA 4L43A 4NW5A 4AXAA 3KRXA 3R0TA 3D5WA 3KULB 5AP2A 4F9WA 2WXVA 1H26A 1R3CA 4L52A 4MVFA 5EYDA 3ZRMA 3ZUVA 3E5AA 2CPKE 4RMZA 3RWPA 3SG8A 4U44A 4AN9A 3EZRA 2QOKA 4DEHA 2F7EE 4BBFA 3BYUA 4GU6A 2P33A 4JBVA 3F3VA 1SNUA 4EHZA 3ANQA 4C0TA 3TZ7A 3LCDA 4WRGA 4PDSA 5M4FA 2XP2A 2VTAA 4OW8A 3LJ0A 2YM6A 4TRLA 4I0RA 3EFKA 5CVHA 4Y8DA 1M7QA 3FJQE 1SM2A 3HMPA 2EB3A 4RGJA 3DKOA 5DLSA 5M57A 1SMHA 3DGKA 2FH9A 4Z7HA 2YM8A 4IW0A 4M8TA 3WYYA 4Z3VA 5JFVA 3QXPA 2UW4A 2YAAA 4AZFA 3LLTA 3KFAA 4KNBA 3TV6A 2W5AA 3RAWA 3I6WA 3BKBA 2F7ZE 3R63A 1V0BA 2CN8A 3CPBA 4NZWB 5F20A 3FMMA 3UOKA 3QQLA 4TY1A 4KBAA 3CXWA 1JSTA 4DFYA 4HYIA 1Q8YA 3QTQA 4I4FA 3AQVA 4IC8A 4LI5A 3VF8A 5A3XA 3QC9A 4MHAA 3ZEWA 4BYIA 2XIXA 3GENA 2JIUA 2R3RA 4FT7A 4F0GA 4RQKA 3UZPA 4KD1A 3F2NA 3VC4A 3FC1X 3TKHA 3F3ZA 2JAVA 3L9NA 3MH1A 5F95A 4IWOA 2W1GA 4JR3A 2C1AA 2CKOA 4QMLA 3TTIA 4E6CA 5HCXA 4O84A 1P4OA 4R6VA 3UTOA 1VYZA 2QOIA 3QTSA 1WCCA 2UVXA 4NFMA 4AE6A 2QOCA 4MXAA 3CTJA 3E7VA 3IW6A 3R7VA 3V5PA 4F7NA 4YMJA 3CKXA 5E8UA 5LVPA 2C0IA 4BKJA 4MD8E 4FV3A 4DG2E 3UNZA 4EONA 2C5VA 3MESA 2HOGA 2YWPA 2C3IB 3TM0A 4YSJA 5AAGA 3LAUA 4FG7A 3LXNA 4FEQA 3MA3A 3W16A 3IQ7A 1XH7A 2BAQA 2XK6A 2YN8A 1Q41A 4RLLA 3WZDA 4DE4A 3BHYA 2O64A 1UWHA 3TKIA 3C0HA 3FLZA 3QRTA 2QC6A 2J7TA 2ZB0A 3LOKA 3RPOA 4ZY5A 4O0VA 4MNEB 4XV1A 4G3DA 3TDWA 4CV9A 4XBRA 4F6SA 2P0CA 5HNIX 2R3FA 2NPQA 4FTQA 2CNVA 1PYXA 3TNPC 4R5YA 2G2IA 4BR3A 3A61A 4IM2A 5CSWA 3KCFA 4FBXA 4C34A 2I1MA 5J7HA 4ALWA 4F6UA 3FI2A 4DH1A 2ZM4A 3C4ZA 3ACKA 4ZLYA 1OPJA 1UU7A 4OT5A 3P86A 1H24A 2UW7A 3NW5A 3ITZA 1JSVA 3L8VA 4XUFA 3LFEA 4PP9A 2P3GX 3NNUA 4PPBA 4FV5A 2I40A 3MGYA 5DPVA 3RWQA 4E93A 4WIHA 3ODZX 3QGYA 1ZYJA 3GUBA 4QPAA 4FNXA 3W33A 4I0TA 2GU8A 3UPXA 3QTIA 4GKIA 4MBLA 4RRVA 3T3VA 4AE9A 2OJFE 3F3UA 3VULA 3GCPA 2YIWA 3BU3A 4J96A 4X3FC 3QUEA 3H0ZA 1GJOA 4P7EA 5TE0A 3ZMMA 4P5QA 2HK5A 5AA8A 1JBPE 3RNYA 5E1SA 3BIZA 3FE3A 3G2FA 4UB7A 3KK9A 3KN5A 2XMYA 3OBGA 1H1QA 3BHUA 4D5KA 5ANKA 2XIYA 3QLGA 1FGIA 2ZMDA 1W98A 4RX9A 4NM5A 4RT7A 4R1YA 4U81A 2CNUA 4DGMA 2BZIB 1WZYA 3AG9A 5HLNA 5K0XA 2QG7A 2EU9A 3F3TA 3FYJX 5HI2A 4IADA 4UYNA 2WGJA 3QZIA 1YOMA 2WMXA 4IACA 5CU2A 5C4LA 4DFBA 3NIEA 5IQEA 5ICPA 4C37A 3DBQA 3ZCLA 5J95A 3F5XA 3BLQA 3OS3A 3AGLA 3ZDUA 5J9LA 3QUDA 4AW1A 2BUJA 4I4EA 5FTOA 3BHTA 2LGCA 4YZCA 3KMWA 2IW8A 3ZO4A 4YJSA 5J5TA 5LVLA 2ETMA 5C1QB 3PPJA 2QLQA 5EOLA 3U6HA 3ORPA 5CLPA 1WBNA 2Y7JA 3BZ3A 5FM2A 4BBMA 3UQCA 3LLAA 1KWPA 3W8LA 3ZSGA 3DBFA 3G6HA 2PE2A 2UVZA 4MNFA 1G8SA 3KRWA 5EI8A 4ZSJA 3K5VA 5CEOA 2VGPA 3A8WA 3BBTB 4BZOA 3U54A 3R1NA 4FSYA 4E1ZA 4IZ5A 5ETFA 4ITHA 4R7IA 5FG8A 5HORA 3K5UA 3S0OA 3NUXA 3UZTA 4I93A 4EORA 1AQ1A 2PUUA 3NX8A 1YRPA 5IEXA 3SW7A 3I79A 2QO7A 2IJMA 3ET7A 4OTPA 3D94A 3FHRA 4IMYA 4PNIA 4PMSA 4RSSA 4LOOA 4NM0A 2YDIA 4G3EA 1TQPA 1PXIA 4FEUA 2AYPA 2VRXA 2X7GA 5A4TA 5AEPA 5A4EA 2QOFA 3FAAA 4XRJA 5AUZA 1UNGA 3KXZA 1H8FA 3RP9A 2GQRA 2B9JA 4MF1A 4GIIA 5KMLA 3DDPA 3MY0A 4N4SA 1WBSA 3DJ7A 1YI6A 3PE1A 3UOHA 3ZBXA 4ZEGA 2NO3A 4FSWA 2X2KA 4HYHA 4OTRA 1YQJA 3WI6A 4FV4A 3HX4A 4AU8A 2CKEA 2O5KA 2IVSA 1YXUA 2J0IA 3KK8A 4H3QA 5M55A 3UC4A 4E26A 3OFMA 5C8NA 5G6VA 2R7IA 3MTLA 4WBBB 5D9HA 3R7EA 3V5LA 5BPYA 3G0FA 3NSZA 4FTMA 4FSQA 2DS1A 3P4KA 4NW6A 3JY0A 4CG8A 2OKRA 1DAWA 3ETAA 4H3PA 1XH8A 1W8CA 3EQGA 3H9OA 5GZ9A 2Z02A 4DLIA 4A4XA 4Z7GA 3U4UA 2C5NA 2NRYA 4BGGA 4OBOA 2ITOA 4YHTA 5FXSA 1O6KA 2Y4IB 3NUAA 4CYJA 3TT0A 2VGOA 2VWBA 2WQOA 3T9IA 4PTEA 4DC2A 4Z55A 3DAKA 3KB7A 2B1PA 1BKXA 2V7AA 3QD3A 4QQTA 4FKGA 3GCUA 3F69A 2HIWA 4IX6A 4JQ8A 2J50A 4OTDA 3SHEA 3SAYA 5KMNA 4ZJJA 5CSPA 1M2RA 3KEXA 3R1YA 1A06A 3L1SA 3OEFX 4IC7A 3P7BA 3PWDA 4WSYA 4ANLA 4HJOA 4NCTC 1RW8A 2IVTA 5CF4A 4QNAA 5EHOA 2HXLA 5LMKA 3W2PA 4A7CA 5L8KA 3A2CA 3UGCA 1WBTA 4FVQA 2QONA 2G01A 4S32A 2QOOA 4LV8A 3A4PA 3ROYA 2E9PA 5FTQA 3FLNC 5EW8A 3Q9XA 1ZOHA 1ATPE 2YM4A 2VTOA 3DTCA 4QO9A 1A9UA 3QWJA 3FL5A 4TWCA 4OAUC 2JC6A 4JJRA 2XZSA 4CTBA 2LAVA 1CMKE 2BFXA 5AWMA 3QCQA 2W1CA 4RZWA 3AMBA 4YPDA 2F2UA 3TKUA 3LMHA 4MWHA 4FTOA 3HECA 1MQBA 4FYNA 5HBEA 3DQWA 4TZRA 2H6DA 2JDVA 3WARA 3UIBA 4EHGA 4YHFA 2V55A 1P14A 2UV2A 3KCKA 3FQSA 5D12A 2BIKB 4DEBA 3WBLA 2BTRA 4XCUA 2PWLA 1QPEA 3OZ6A 4MQ2A 4IJPA 3MPMA 1UNLA 3W8QA 4L68A 4WUNA 4GKHA 2FGIA 3QTUA 3BYVA 1O6LA 3PA5A 4DFUA 1B39A 4FKRA 3UNKA 1GNGA 2JITA 2WOTA 3F3WA 2W9FB 2WMVA 3WE8A 5JSMA 3GCVA 3K54A 3DAEA 4EH3A 5HIDA 5L8JA 3TZMA 3PP0A 4M69A 5IA0A 3EWHA 2BZJA 3O96A 2RFSA 4F0FA 4F99A 1TVOA 4IJ9A 5E91A 4CG9A 2ETRA 3FHIA 5DBXA 2OBJA 3I5NA 5AV1A 3C4CA 1DS5A 5EW9A 3AC2A 4G16A 2QO9A 2BDWA 3LHJA 1H1WA 1TQMA 3A7FA 3DBDA 2WEIA 3GFWA 3UNJA 3RPRA 5EYCA 3QGWA 4IAZA 4M69B 4FOBA 4TYIA 4FV0A 4X2NA 4YLJA 4ZTMA 4FIHA 3V51A 2R3HA 3ZZEA 3U8WA 4NT4A 3BE2A 5HE0A 4AGWA 1L8TA 5E90A 3FEGA 3CKWA 3KGAA 4XNEA 4USEA 1FPUA 4FV8A 4O96A 3KMMA 5A54A 4UZHA 3E3BX 4FNWA 2UW9A 5BVFA 5CEMA 3FBVA 4EQCA 3FI3A 1J7UA 2A19B 1BL7A 3A60A 3DKFA 4JQ7A 2PSQA 2XIKA 4FIEA 1MP8A 3I60A 3N9XA 4IDTA 4YBJA 4DH3A 4JDJA 3OWJA 4JQEA 1NA7A 2QQ7A 4BCMA 3QHWA 3VS4A 3FY0A 4D28A 5AX3A 2WHBA 3BRBA 1BI8A 3DQXA 4FIIA 1URWA 2ITXA 4TYEA 4W4WA 3UVPA 5HD4A 5KO1A 3Q04A 4I6QA 4IAAA 2ZYBA 4I5PA 2RKUA 2ZDUA 5HKMA 3UIMA 3AXWA 3EQHA 1W7HA 1ZYLA 2ZVAA 3EB0A 4IX5A 4J8NA 4NTTA 4QMZA 1PJKA 4G6LA 4G9RA 5F1ZA 4M84A 5IH5A 4X2FA 5HEZA 2W7XA 2R3QA 4JAJA 3Q60A 2E9NA 1Q24A 3CBLA 5H2UA 3UMWA 5CZIA 4A07A 4AT4A 3DLZA 4L67A 5DHJA 4O7TA 1LEZA 3OCBA 5LVOA 3ZXZA 4MK0A 3FI4A 2GCDA 1S9IA 4FT0A 4ITIA 4AGCA 5I9VA 2CHLA 4QTAA 4AW2A 4MXYA 2EWAA 1KUTA 3MYGA 1U54B 5KZ0A 4FTTA 1F3MC 4TL0A 3F61A 5HO7A 4C33A 4MD7E 3ZC6A 2YCFA 5I9YA 4RJ5A 3RPVA 3LIJA 4FT9A 5CI6A 1WMKA 3ELJA 3A7GA 5IKWA 5E1EA 3VUIA 4FX3A 1AGWA 4YTCA 4IFCA 4FTNA 1JOWB 4JOAA 2WO6A 5CSXA 1KE6A 2BILB 3R1QA 5DT0A 3L8SA 3Q2JA 1LEWA 4GK4A 5BVEA 5H8EA 2BHHA 4JS8A 2ZJWA 1KOAA 4RIOA 5HNBA 2OJGA 2WTKC 3TNIA 1Y6BA 2B54A 2XCHA 4KINA 2OICA 2VNWA 4GMYA 2BDFA 5HD7A 1VR2A 4WT6A 3QTXA 4F7LA 1IA9A 3DA6A 2I7QA 2YIRA 3HVCA 3GOPA 3C4XA 4EBVA 4NSTA 3QTZA 3W2SA 2X8EA 4ZLZA 2YISA 5K4JA 4C2VA 4XEYA 4YURA 1VZOA 3CJFA 4Z16A 3E7OA 4YJPA 3RBWA 2QR7A 5AR2A 2CMWA 4AS0A 4EYMA 4DTBA 2J2IB 4FKIA 3MVMA 3QYWA 5EYKA 4RFMA 4BCHA 1PY5A 3QRJA 2I0HA 2ETKA 2WTIA 4OGRA 2OF4A 3RPYA 4LRMA 3QRKA 2VTHA 2VUWA 4D2RA 4ZJVA 3P7CA 3LFCA 3KN6A 3RVGA 3KXNA 4F08A 2RFEA 2JKOA 3GQIA 4FV9A 4UY9A 3SRVA 4F7SA 2BAJA 4PL5A 3AD4A 4FTRA 4ZIMA 3AC3A 3PXQA 3BLHA 4BCFA 4DCEA 1FVRA 1P4FA 3NNXA 5FD2A 1REKA 3AC8A 2O8YA 1U5RA 3QZGA 2PE1A 2RIOA 4FL1A 4IXPA 1OKWA 3VS5A 3G9LX 5AM7A 4XG4A 5DH3A 5A14A 1PYEA 4F65A 2NRUA 3QALE 4MXCA 2W1IA 4NK9A 5CNOA 4APCA 4M3QA 5KKRB 2J4ZA 1ZY5A 3GVUA 3IGGA 4XG2A 3CIKA 5CF6A 3NYXA 3SRVB 3IOKA 4QYEA 4BKZA 2R3LA 3KKVA 2WKMA 1R0EA 4QMNA 3F82A 2OFUA 3I0QA 5GNKA 1KE8A 2XKEA 4D2PA 4FL2A 3MVHA 5FXRA 2PVHA 3HRBA 3HV4A 4C57A 4YZBA 4ACCA 5IA3A 3UP7A 4XMOA 3RMFA 4HYUA 4BZDA 3AMAA 3ZLSA 2W0JA 3ORIA 1DI9A 3DU8A 3QKMA 4OAVB 5F94A 4FV1A 2VN9A 1RQQA 5GHVA 4B7TA 2XKDA 3RJCA 4BDJA 2A0CX 4IIRA 4YC3A 2REIA 3NUYA 4IAIA 1YDRE 3B8QA 1YXVA 4FTIA 3G9NA 4UYAA 4EOIA 2C0OA 5C4KA 4KIOA 4AZSA 4O1PA 3NDMA 4YJOA 4IZYA 1SVHA 4X3FA 3IDBA 1ZYSA 1IAHA 4IAKA 4YTHA 3W2CA 4BDEA 3BBWA 3ZO1A 3SXSA 4ANQA 1R78A 4XG9A 3C0GA 3C4WA 1YVJA 3PWYA 5TOZA 1M7NA 5I3RA 3R83A 4LUDA 5ETCA 4EQUA 4O38A 4YC8A 5E8WA 5I9UA 4AFEA 2Z8CA 4CZUA 1W83A 4YLLA 4RFZA 2VTNA 2IO6A 4X3FB 4I0SA 3E93A 3IDPA 3ZRKA 4DEAA 2WNTA 3F2AA 4BVUA 1CKIA 2IZSA 2QHNA 2W06A 5DT4A 5BQ0A 5T6KA 1UU3A 4EOSA 4F7JA 2F4JA 3OVVA 1Y57A 2QOBA 5JQ8A 5FM3A 2VU3A 3ID6C 4TNBA 2R3OA 3HRFA 2HY81 3UIXA 4LGGA 3S1HA 2PPQA 3PSBA 4XV9A 2A4LA 2ITNA 1G8AA 4TN6A 1O9UA 3DJ5A 3RK5A 4JBQA 4A06A 4G31A 4CKIA 3NCGA 2KTYA 4BDCA 3LFBA 4GUBA 4NUSA 5ANDA 3TI1A 2CKQA 4DFXE 4F70A 1XBAA 3CQUA 3QXOA 4QYYA 3WIGA 5I0BA 1OITA 2ITQA 3M42A 1H0VA 4DITA 2CLQA 4EOOA 3TUCA 1DM2A 4C36A 4K9YA 1PMEA 4WG4A 4HPTE 4EK3A 3FLQA 2NNWB 4TWPA 4PL4A 3LFQA 4CT1A 3DXPA 4L45A 4H05A 3JVSA 2R64A 2EXEA 4M7IA 4MQ1A 4Q9SA 2PVYA 3F7ZA 4G5JA 3PJCA 4D0XA 4X2GA 2ZV9A 3BHVA 4MCVA 1DI8A 2C5XA 5BYYA 3JXWA 4MBIA 3H10A 4MWIA 3WF5A 1OL1A 4YZ9A 3FQHA 1AD5A 3UG2A 4AF3A 2UZNA 3MS9A 2BZKB 3VAPA 4IZAA 2ITTA 2QLUA 3OUNB 1XH5A 4BDKA 5IA2A 4FOCA 3IW5A 1UWJA 3PSDA 5CASA 1TQIA 2CGVA 4BDBA 4HGTA 3RM7A 4XOYA 3V3VA 1BX6A 3DFCB 4O6LA 4JVGA 4JRVA 4JIKA 2ITWA 4QP8A 2IZTA 4BDDA 4QQCA 4O81A 2VWYA 2VTQA 2A27A 1KV2A 4ZY6A 3ATTA 5FEEA 4K11A 4AG8A 2OF2A 3EKKA 2ESMA 1BUHA 1O6YA 4FGBA 4I1ZA 4LFIA 5K4IA 4RQVA 1QPDA 3F5GA 3E92A 3Q4CA 4QTDA 2F57A 1VJYA 2W5HA 4AN2A 2BZHB 4U40A 2FSOX 5IU2A 3RPSA 5D1JA 3W32A 5AFVA 3RCDA 2PK9A 4LUEA 4OTIA 4A9UA 2HWOA 5EM5A 3UO6A 4RC2A 2Y6MA 2XRUA 1S9JA 4AZTA 2IZUA 2B55A 2WZJA 4TW9A 4B9DA 2HZIA 3BQCA 2CNQA 2RFNA 1BI7A 3KRRA 2QI8A 5ANGA 3GC0A 1KE5A 1XO2B 3VUTA 3HL7A 5FEQA 2BR1A 3LCKA 5BX0A 5HTCA 4M0ZA 3D7TB 4QMTA 3POZA 4JG7A 4PY1A 4ALVA 3V5JA 4JIAA 2XYUA 2JD5A 4L6QA 4C02A 3LFDA 3UIUA 1P2AA 2P2IA 3W1FA 1R39A 3S95A 2UVYA 3FMKA 4GFMA 4QMPA 5LMBA 4I41A 3OW4A 4XG3A 5ANEA 1E1VA 2C6MA 4FIJA 3ODYX 2DYLA 3C9WA 2R0UA 4APPA 4PRJA 3PRFA 4RX7A 3RK7A 5BVKA 4BTFA 2YEXA 2X6DA 5CT0A 5J9YA 3PLSA 2YZAA 4FSMA 4RPVA 2PHKA 3OG7A 3L9PA 3LZBA 5CALA 2PVJA 5CAPA 5CSHA 2O3PA 2VO3A 2XK9A 4L3JA 1T46A 2C6LA 2RG6A 2VWWA 4W4YA 3PJ8A 4ENYA 1YOLA 5M09A 4E5AX 2XK3A 2ZV2A 3V8SA 4GG7A 3BELA 3E8CA 4ZS0A 1H00A 3WOWA 3T9TA 1Q3WA 5AV3A 4M15A 2BKZA 4TYHA 2VAGA 5E8SA 5L2TA 1PXMA 2GS7A 4C58A 3WIKA 3IONA 3KF7A 3U4WA 3PG1A 4O83A 4WO5A 3HUBA 4U5JA 2YWVA 3GCQA 3TUDA 4CZYB 1M52A 5AUVA 5HO8A 4O22A 5ANOA 4EH6A 3DBCA 2X8IA 4BCQA 1MUOA 3F66A 4TYHB 2P4IA 4MEDA 5DIAA 4ZJIA 3UBDA 3VW8A 5M4CA 2VTSA 5DFPA 4JBPA 4JDKA 3IPHA 3A99A 3PVUA 5KX8A 3HUCA 2V62A 3I7CA 2IVUA 3UQGA 3EQFA 3FYKX 4C4IA 4O0WA 3EH9A 3D5VA 4F9CA 3V5WA 1U46A 4UWBA 2OIDA 3V6RA 4CQGA 3CD8A 2IPXA 4L8MA 3S2PA 3AD5A 4QMQA 2YCSA 2V5QA 5J87A 4EOQA 4O7LA 1YDTE 3R8LA 2R4BA 3VHEA 3IKAA 5D10A 3VBXA 3WZEA 3PXZA 4BTMA 3MPAA 5CAQA 4DF3A 1XHAA 4N6YA 3EQRA 4OT6A 3RAHA 4CFWA 3OXZA 5HICA 4WNPA 5LCKA 5CI7A 5H8BA 3HV5A 2V22A 3FUPA 4B6LA 3O51A 4ASDA 4YJNA 5A4QA 3TDVA 2OFVA 2QU5A 1H28A 2XK4A 3EMGA 3HV7A 4FR4A 4U9AA 5CEKA 5KCVA 2PUNA 5LJJA 3PG3A 4XJ0A 1OUYA 2J5FA 3GT8A 3HRCA 5ANIA 4EK5A 4KAOA 4GK3A 4LL0A 5CVGA 2R2PA 4QMOA 1MRYA 5C26A 5GIPE 5DNRA 1J7IA 4FICA 1BYGA 2R3IA 2VV9A 4DH8A 5BVNA 5HVKA 2X39A 4GH2A 3GEQA 5B2LA 3FMEA 3U87A 5HX6A 3SQQA 4NJ3A 1OL6A 4LG4A 5EM8A 3DV3A 4EH9A 1BL6A 1QCFA 3VUGA 4TYJA 4QMSA 4YHJA 3I0OA 4CLIA 4DAWA 2ERZE 4XG6A 4EQMA 5CQWA 2FSLX 2GNIA 3R9HA 3R21A 5CXZA 5IZFA 4EJNA 3FZRA 5AR3A 4U43A 3WF7A 5LOHA 3DNDA 5KMOA 3R1SA 1HCKA 4E6DA 2PVLA 2WMQA 4FNZA 2J6MA 3T3UA 2X81A 3ZM4A 3F6XA 3EJ1A 4O27B 4C35A 5EYMA 3VW6A 2C4GA 4YR8A 4U80A 2NP8A 2WQMA 5FWKK 4MH7A 4U79A 4QP6A 4DT9A 4B8LA 3EFLA 3T8OA 1FVTA 4BHNA 3D2IA 1OL2A 5HCYA 2WMAA 4KKGA 1H0WA 4ZZNA 4R77A 1NVRA 5AR8A 3CGFA 3QYZA 5TKDA 1YHSA 3REPA 3NW6A 2PYWA 3ZRLA 2CSNA 4QT1A 5EK7A 1J1CA 1P5EA 5DOSA 1QPJA 3P0MA 4IB1A 4OUCA 2JIIA 5CU3A 4ERWA 1JKSA 3AD6A 3F5PA 3MFTA 1Q5KA 1OL7A 4UBAA 4WG3A 4ZSGA 5JH6A 5M51A 3OCGA 1PMNA 1OKZA 2FUMA 4H36A 2QOLA 3VBTA 4D4SA 4ZK5A 5LXMA 2HCKA 5IUHA 2C5YA 3DJ6A 4JX3A 1HOWA 3D14A 1K9AA 2F7XE 4EK4A 2WEVA 3NVMB 3CTQA 4NFNA 4U3YA 2WIHA 1STCE 2F2CB 4FSUA 4IH8A 5CENA 4ANOA 4ZMFA 4S33A 2J0JA 2WU7A 4J1RA 4N57A 3ZO2A 4O7YA 2PVNA 4RIWA 4U0IA 4O86A 4KB8A 3D9VA 1SVEA 2G1TA 2JBPA 2WMSA 4I6FA 3TV7A 3W2QA 5I4NA 5DA3A 2YITA 2ONLC 2PVRA 3QQGA 2XNNA 3UG1A 4EOKA 4WHZA 4RX5A 4GCJA 3KRJA 3P5KA 1PXLA 2XA4A 3BYSA 4AP7A 2FSTX 4ACGA 1SYKA 3NVKI 3EL8A 3FMJA 5EI6A 4FZFB 4FA2A 2UZWE 3ZLYA 4AZWA 3R9RA 2OJ9A 4P5ZA 3OHTA 3CR0A 1GOLA 4RIWB 4CYIA 4ZSEA 4DN5A 4RJ4A 5BUIA 3FWQA 4A9TA 5D41A 4U45A 4K33A 2HWPA 2J9MA 3MVLA 4IB0A 4O0UA 5EW3A 5EKNA 4BN1A 2VO6A 3TACA 2I0EA 3PIYA 4BI1A 4N0SA 5HG8A 2F49A 4FKOA 4U97A 2Z60A 3BYOA 5I9XA 4JDHA 4E4XA 1K3AA 4KRDA 3V8WA 4MTAA 3G33A 5BVWA 4C7TA 5L2SA 4WSQA 2WTCA 3U6IA 4LQMA 3VBYA 4NYEA 2YDJA 2R3MA 3BV2A 3FKOA 1WFCA 5JGAA 1ZARA 3A7IA 5K3YA 4NKAA 4X6RA 4IWPA 2JFLA 3MA6A 3NS9A 4IX4A 3KVXA 3PXFA 1KE9A 2QOHA 2YAKA 1FVVA 5JRQA 3GBZA 3KXGA 2B9FA 1KV1A 3OTUA 4M12A 5HG9A 5J1WA 3Q53A 4I22A 2WMBA 3MBLA 2IW9A 4BGQA 4YLKA 5AP6A 3V5QA 1IRKA 3G0EA 3QQJA 4HNFA 4IX3A 3BWJA 4EZ5A 3CJGA 4CLJA 2AC5A 3GC9A 4I20A 5KE0A 3BGZA 3D0EA 4FF8A 4GJ2A 3UO4A 3CP9A 5E8XA 4U42A 2C3KA 4QP9A 4HVIA 4JNWA 1H27A 4JL9A 2B53A 3EOCA 4G9CA 5L2QA 5L6WL 3VUMA 4F9YA 4O91A 4P90A 2JGZA 2QU6A 4S34A 2UZOA 4PWNA 4AOTA 3EYGA 4U3ZA 5AADA 4NTSA 4HVDA 5EHLA 5DR6A 4YJTA 5C8MA 1CKPA 2WMTA 2YHVA 1JLUE 4DTAA 3BX5A 5TO8A 1ZYCA 4GK2A 3E64A 2ITUA 1OBDA 1REJA 4G2FA 3NCZA 2Z7QA 1CM8A 2BRGA 5AAFA 1GZNA 1ZOEA 3BEGA 4M97A 3ZUTA 4BCGA 3IO7A 1XH4A 3MY1A 4HGEA 4C2WA 5B7VA 4BYJA 1PMVA 3AGMA 1U5QA 2HYYA 3DB8A 4L44A 4U7ZA 3FLSA 3KF4A 5IDPA 2GMXA 3SXFA 4ACMA 3EQCA 5CNNA 4WKQA 5HG7A 2GNHA 3NUUA 2JAMA 1YKRA 3CTHA 1MRUA 2YJRA 4P4CA 4S31A 4KIPA 5I9WA 1U59A 2PMIA 5AP3A 3THBA 4BDIA 3VS3A 3QKLA 2OXDA 2Z7LA 4QMMA 3ROCA 4D1SA 4BHZA 2JDSA 5T3QA 1CTPE 1V0PA 3E8DA 3MSSA 4QNYA 3PXYA 5HLWA 4IAYA 3DK3A 2XNMA 1ND4A 3OT8A 3FPQA 4C59A 4IANA 3KRLA 4G3GA 4BTJA 2XCKA 3UO5A 2QHMA 3I81A 4V01A 4NKSA 3QX4A 3BWFA 4FKWA 5EQYA 4D2VA 5EI2A 3R6XA 4DGOA 4XYFA 4AW5A 2R3NA 3EL7A 3SVVA 1XQZA 3NWWA 2Y8OA 2OJJA 3K2LA 3LQ5A 4J99A 4J7BA 5TF9A 4W4XA 1E1XA 1PXKA 3MDYA 4XG8A 5CSVA 3ZUUA 4AWIA 4BCPA 2WQNA 2E2BA 4U8ZA 3UDBA 3WZUA 5M44A 1Q8WA 4ORKA 1WAKA 2Y0AA 3HMNA 3PJ1A 5HG5A 3KU2A 3LVPA 3LCTA 3RAIA 3I6UA 3Q9ZA 4X6QC 2HZ4A 4NU1A 3OW3A 1XWSA 4X2KA 4GFGA 4GS6A 4JG6A 3MJ1A 3K3IA 3QD0A 1XBBA 1KSWA 5G1XA 2O2UA 3PXRA 3FXWA 2XNBA 1UKHA 1OIYA 1XJDA 2R7BA 5CXHA 4C62A 4CD0A 2HY0A 3E87A 5CZHA 5FRIA 4ZSLA 2PZ5A 1V1KA 2UZEA 3RGFA 4ZAUA 4CZTA 4L42A 3ALNA 1ZRZA 4YJRA 4CMUA 3MTFA 5KMMA 2R5TA 2QG5A 5AV0A 3VWAA 3U51A 5E8ZA 3VBWA 1LUFA 2OW3A 2Q0BA 3DBEA 3FZOA 4PV0A 4YBKA 2EXCX 3ZYAA 2X9FA 4FODA 5A9UA 3PUPA 3ZHPC 5EOBA 3ZFMA 1Q62A 3Q5ZA 2W99B 4FL3A 4NL0A 1W82A 3MFUA 3MH3A 5M53A 4L7SA 4RIXA 3UOJA 3GOKA 5AR4A 5GJDA 4GT3A 1OGUA 2WU6A 3MFRA 3RHXA 3RINA 1ZWSA 1QMZA 1YWVA 3GP0A 4R3CA 5TR6A 3V6SA 4AT5A 3NYNA 3E8NA 5TT7A 3UMXA 5JQ5A 5IA1A 5IUIA 3UE4A 3ZZWA 1W84A 4UMQA 4FV7A 4EH5A 5IQAA 4KBCA 4RIXB 4G6NA 4RWKA 3WZJA 5L8LA 4D2WA 4X0MA 4N6ZA 2CCIA 4YC6A 4BCJA 2DWBA 4LV5A 5J8IA 4AW0A 1NT2A 3D5XA 3OCTA 4IB3A 4H1JA 3PIXA 4ARKA 3PDTA 3TNQB 3GNIB 4YO4A 5CT7A 2X9EA 1ZMVA 3ORKA 3ULIA 4B4LA 3PJ2A 4CRLA 5DVRA 3LCSA 4W9XA 2IG7A 3RI1A 4CFNA 3R04A 4R1VA 3ZOSA 4A9RA 2X4ZA 4XBUA 1UNHA 2VNYA 1IAJA 5ANJA 5FBNC 2PVFA 1IEPA 4XV2A 4IEBA 3C5IA 3PLAE 3LM0A 5BYLA 3N4TA 2W96B 1PXOA 1Y6AA 4TTHB 3PA3A 2CGWA 4Y72A 2KULA 1J1BA 4QOXA 4TPTA 4AQCA 5C9CA 4UMPA 4HCTA 4AOJA 1FMOE 3DFAA 3LFAA 3H9FA 1Q97A 3QFVA 4W8EA 5CVFA 1J7LA 4I5HA 2EXMA 1UU8A 1YI4A 5GZAA 4O0XA 3RZBA 5M4UA 3WE4A 4MKCA 4TYGA 4AUAA 5ITAA 4V04A 2B0QA 4RJ6A 2JLDA 4FIFA 3GU5A 3QRIA 2P55A 3PYYA 1H25A 4IWDA 4RA5A 2W5BA 4C3PA 3OY3A 3EQIA 2QO2A 3QQUA 4DGGA 5HU9A 2B4SB 4BI0A 4L7FA 2PU8A 4FKLA 1NVQA 4YZMA 4F1TA 3LW0A 4CXAA 1CKJA 4D4RA 2I6LA 2VTIA 4CFFA 3MIYA 1SNXA 3GC8A 3KXHA 4XRLA 3UYTA 4EWQA 5HO6A 2C6OA 3SDJA 4X3JA 3AC5A 1GIHA 3H3CA 2OZOA 4BRXA 4EH2A 4JXFA 5M08A 4MD9E 4TWOA 3SA0A 4D4YA 4AA5A 3NUNA 4S2ZA 4CMOA 2ZV8A 4FUYA 2HAKA 5FEDA 4FTKA 4EZ3A 5BYZA 4E4MA 5F9EA 3COMA 5AM6A 3CSVA 3CY3A 3L8XA 1B38A 3NEWA 4Q9ZA 5JFXA 2VTJA 4MBJA 4PF4A 3PSCA 4JG8A 5AR5A 4ZTRA 3HAMA 4K0YA 5DRDA 4O2PA 3QA0A 3II5A 1TKIA 2OLCA 4NM7A 1M2QA 3ORZA 3B8RA 4GW8A 2XNPA 4KS8A 2WTJA 5BVDA 4AAAA 2ACXA 4HZSA 3ZFXA 1VEBA 4CGAA 3FMDA 4ITJA 4ZY4A 5BNJA 3TZ9A 3WILA 3VRYA 5LVNA 3JR1A 2PTKA 4WA9A 1A48A 3MFSA 2XEZA 1GY3A 4MXOA 4RC4A 3TTJA 3ORTA 3C51A 4LGDA 3UPZA 4QP3A 1Y91A 4FKSA 4Y83A 3WF8A 3KXXA 3QHRA 5CF8A 3BGQA 2X2LA 3M2WA 2YACA 5H3QA 1YXSA 3W10A 3ZC5A 4U6RA 4D9TA 3NGAA 2UZTA 4G3CA 1OM1A 3ZSIA 4HCVA 1L3RE 4JAIA 4QD6A 4YO6A 1URCA 4DBXA 2YDKA 4A4OA 2RF9A 3QWKA 2W4JA 4AZVA 1H1PA 4BCKA 5CAUA 4DHFA 3OXTA 2OZAA 2C69A 4ZXTA 4FTAA 2C1BA 3FMLA 3IG7A 4DEEA 3MIAA 4E20A 4F1OA 4FSZA 3QAME 4BIDA 3IW7A 4O1OA 5ETIA 2GHGA 4DLJA 2W1ZA 3Q4TA 4FSNA 2VWZA 4OTQA 3DXNA 4LM5A 3BU5A 1Y8GA 2W1EA 1UVRA 5JRSA 2UZLA 3ZXTA 2GHMA 3ZLWA 2XYNA 2WAJA 2UZDA 4WG5A 4J53A 3BLRA 5I3OA 2OZAB 4I6HA 5HE3A 5KMJA 4R8QA 3S3IA 2JDTA 4O2ZA 4CRSA 4DG3E 1M14A 1LPUA 1YI3A 3P23A 5AA9A 4EH7A 3C0IA 1Q3DA 2XKFA 4CKRA 2WTDA 4J71A 3EQPA 3SX9A 4O7SA 3HDMA 3D15A 4ONAA 4ALUA 4C4FA 1QL6A 3NZ0A 3PVWA 4R5SA 5CEQA 3FLWA 4JDIA 4F4PA 4G5PA 3QQHA 3QL8A 2J90A 2XB7A 3RTPA 4PQNA 4OBQA 1QPCA 2UW0A 3HAVA 2W9ZB 4N70A 3IECA 1OPLA 2XJ2A 3NAYA 4PNKA 4KSQA 2BDJA 2JKMA 3F5UA 2WTWA 4IB5A 4CCUA 5DE2A 3BQRA 2YIYA 5KHXA 3PY0A 4PP7A 1I09A 1SZMA 2VTPA 3OWPA 4UXLA 3JUHA 4LMUA 3BE9A 4O7VA 2ITVA 2YM5A 4H58A 1Z57A 5IQGA 1PHKA 5IMXA 3JY9A 4EOMA 4J95A 4MXXA 1ZOGA 5H8GA 2VTMA 1B6CB 3VS2A 3O8UA 3HMIA 4RZVA 4BDGA 3PVBA 4O7WA 4W4VA 3JVRA 4DCAA 4DT8A 5AP4A 3FL4A 4V05A 4GVJA 5CWZA 4D4VA 5LVMA 4L9IA 4YGAA 4UMUA 4K6ZA 2QKRA 4QTCA 3TJCA 1Q8UA 3E63A 5C27A 3DZOA 3MH2A 4FG9A 4HVSA 1JKKA 4LYNA 2HW7A 4R7HA 4EL9A 4MAOA 4R3RA 4M13A 5HE1A 4X21A 4R3PA 4BL1A 4I6BA 2J5EA 1DAYA 1LP4A 2OIBA 2VX1A 4IFGA 4MF0A 3DPKA 1OBGA 2VTTA 4XHKB 5L4QA 5HESA 4R78A 4L01A 2BIYA 4IM3A 2SRCA 4FTLA 2W17A 4WRSA 3CEKA 3QUPA 3AC4A 4QPSA 3RCJA 1WBOA 4BC6A 4BCNA 5K5NA 2C6DA 4BY9E 4MYGA 3EFWA 3KC3A 3ZH8A 3D5UA 4EH4A 2VWIA 3C13A 3R01A 4DBNA 1PKGA 3VO3A 2YA9A 3EIDA 1PF8A 3MB6A 4QP4A 3HLLA 4GIHA 3KA0A 4HW7A 2YERA 3HP2A 5IQDA 3SXRA 2W05A 5GZ8A 1JKLA 3PZEA 4NEUA 4WNMA 1OI9A 4E4LA 4PUZA 3UVQA 2OU7A 3HZTA 4DEDA 4E6QA 5GINE 2ZOQA 3O23A 1PMUA 5JT2A 2QVSE 1FOTA 2GNJA 1GZOA 3G15A 4Y73A 4NCTA 3DZQA 3EQDA 1YWRA 3QTWA 2UZBA 2BFYA 2CGXA 3DLSA 5JK3A 2B9IA 1UV5A 3OUKA 4GV1A 5E7RA 3KULA 3RZFA 3POOA 4UWCA 4ERKA 5AP0A 2ITZA 3HA8A 4AA0A 4BF2A 3ZU7A 3CS9A 4RC3A 4PX6A 4O0SA 4FMQA 2XRWA 1JKTA 4ASEA 2XBAA 5AJQA 2WB8A 3VQUA 5IQCA 3MVJA 4FUXA 3FDNA 4J8MA 2O65A 3BPRA 3VNTA 4CCBA 4R7BA 2O63A 4IVAA 2E9UA 2HELA 4XOZA 4UX9A 2X8DA 5EM6A 3Q6UA 1XR1A 2UW6A 2H8HA 2PULA 5HNGA 3RALA 5KBQA 3EFJA 3Q52A 3DDQA 3NUSA 3R30A 3CLYA 3NRMA 4GT4A 4IBMA 4NM3A 5ETAA 2JBOA 4FEXA 5F4NA 1ZYDA 3GU6A 1PXNA 3R2YA 3R02A 3OBJA 3VS7A 2C6KA 1Y8YA 4FZ7A 5FXQA 2XVDA 1GIJA 3FMNA 4DFNA 2CGUA 1WVYA 2VWVA 3QZFA 4BCIA 4FZAB 3D7ZA 3FY2A 5M07A 2X2MA 3QLFA 1RE8A 3QD4A 4GSBA 5HVJA 4EH8A 5JFSA 3PVGA 4RA4A 3V5TA 3QRUA 4Q5HA 4AA4A 3OXIA 2JKKA 3FZTA 3PY3A 1FQ1B 3WF9A 3DK7A 4KKHA 4NH1A 4DFZE 3O0GA 3FMHA 3VF9A 5EHYA 3R9OA 2CJMA 1GZKA 3CCNA 4KKEA 3MH0A 4M67A 3PPZA 3KREA 4LMNA 2R0IA 3NW7A 5AUUA 3QQFA 3ZLXA 2R3PA 2QNJA 4GL9A 3COIA 3KY2A 3PRIA 3ZEPA 1IG1A 4O6EA 5HZNA 4H3BA 4HGLA 1WVXA 4PPCA 4FIGA 3OP5A 3G6GA 4KA3A 2A1AB 4KABA 4YUQA 2F9GA 2VTRA 3GU7A 5IEYA 5HIBA 5L2IA 3QA8A 1FBNA 3OF0A 4CNHA 4F0IA 5IH4A 1F0QA 2ITPA 4E3CA 3A4OX 4KUJA 2QODA 3R00A 2XK8A 2YM3A 3FV8A 5CEIA 4KIQA 2QCSA 4JRNA 4UEUA 4E4NA 2XNEA 3LJ1A 4GT5A 3HV6A 4MNEA 3LXKA 2QKWB 2R3GA 5EFQA 3RAKA 3N4VA 5KKRC 1NY3A 3W18A 3VJNA 4B8MA 3O50A 4LL5A 2J51A 5FBOA 4GFOA 2FB8A 4QRCA 5AIRA 4ZTSA 5E9EA 4WUAA 3BCEA 2PZPA 4O0RA 4OR5A 4I94A 4FYOA 5H9BA 3VVHA 2OH0E 3ENHA 2OGVA 4GG5A 2QURA 4L46A 3UP2A 2CCHA 3FSKA 4EI4A 5CU0A 1Q99A 3FC2A 3GC7A 3IOPA 4IQ6A 2VD5A 3L9LA 3QCYA 4RWIA 4RWJA 5DWRA 2HENA 3C5UA 1F5QA 3Q5IA 5E8VA 3O17A 5DEWA 5JGBA 1WBWA 4HNIA 3IW8A 3TZ8A 1WVWA 3MY5A 3OWLA 3KVWA 5CF5A 4IM0A 5DR9A 5AP1A 4ZMEA 2I0YA 2C6IA 1Q8TA 3MV5A 5IA5A 3VIDA 4FSRA 1Q8ZA 3RKBA 2IN6A 3LMGA 4D1XA 4DG0E 5JMSA 2BROA 4WD5A 4FTUA 3LE6A 3UODA 3LJ2A 4D58A 1GZ8A 3R8ZA 5IPJA 2ZV7A 4FSTA 1SVGA 1YXTA 3V8TA 5K5XA 4BCOA 1FINA 2WELA 2X1NA 1ZXEA 3I4BA 3C7QA 5DN3A 4BDAA 2Q0NA 4BDHA 4CTCA 5DMZA 2VO7A 3D2KA 4EOLA 3QX2A 1W0XC 4F9BA 4QTEA 3O8TA 4FTCA 3ZSHA 1CDKA 5HU3A 3SD0A 4DYMA 2X0GA 3W55A 3Q32A 1MRVA 2O0UA 4TXCA 5AV2A 4H1MA 1OECA 3R8MA 3R9NA 1OIUA 3R7OA 4I92A 2C6EA 2YLEA 3BU6A 2V0DA 4QYGA 3N51A 4AX8A 4J52A 2YIXA 3P7AA 4QYHA 5HLPA 3VBQA 4A9YA 2PL0A 3R2BA 3R7IA 4QMUA 4RVKA 4QMXA 4J98A 4F63A 5L6PA 4YJVA 5J5SA 2WTKB 3BV3A 4RFYA 2BRMA 1APME 5IEVA 4XX9A 5HX8A 3MPTA 5M56A 1OB3A 4JBOA 4E73A 3QC4A 4AFJA 4MX9A 2GQSA 2GFCA 2XK7A 3JYAA 3E88A 3WYXA 2C3JA 2GSFA 4M66A 2QR8A 4BZNA 3G51A 4FKPA 3TN8A 4FKVA 3E8EA 4G3FA 4RJ7A 5HE2A 4RLKA 5DRBA 2WFYA 4UMRA 3DAJA 2Y4PA 2CN5A 4YU2A 3HV3A 2GS6A 4FG8A 3W2OA 2VO0A 4IHPA 4F09A 2JIVA 4IVDA 4F1MA 3Q4ZA 4IVCA 4X7QA 1GAGA 1H1RA 2OXXA 4PDPA 4K8AA 4TT7A 4PMPA 2VX3A 5CANA 4GVAA 2X7OA 5EH0A 4G34A 1KOBA 5DR2A 4EHVA 4DGLC 2BPMA 4U41A 4P2KA 4XH6A 5A46A 1HCLA 2YIQA 4QMYA 4E8AA 3EN9A 4D5HA 3FZ1A 3BHHA 3LQ3A 4FT3A 4I3ZA 4K77A 4LGHA 5KHWA 3CQWA 4O82A 4AN3A 2W4KA 3HMMA 4D0WA 3I5ZA 4ZTLA 5L6OA 2HZ0A 3ATSA 3R7YA 4F9AA 3ANRA 4RVMA 5HCZA 2OK1A 1OIQA 4HCUA 4AACA 5IMEA 4QMVA 3FI8A 3WZKA 3LKMA 4ANNA 2IVVA 2UZUE 4RVTA 2G2HA 3VHKA 2GNLA 2WIPA 3O7LD 3F2RA 5EQPA 4JLCA 1JQHA 4PDYA 2ZB1A 4FV6A 5CYIA 5FP5A 2XJ0A 3CY2A 2JDRA 4BFMA 5IQIA 2JFMA 4GYGA 3R8PA 1J3HA 5AV4A 5JKGA 1IASA 4ANBA 2ZAZA 3ULZA 1YW2A 2H34A 3HGKA 4NJDA 2XEYA 5CQUA 5HOAA 4ZTQA 5AAEA 4ENXA 2VX0A 3DCVA 2PMLX 3KQ7A 4HZRA 4RJ3A 4TKSA 3ZONA 4FVPA 4CV8A 3Q9YA 2YM7A 2ZDTA 4YP8A 2J0KA 4E5BA 4K18A 3H4JA 4G6OA 1WBVA 5D7AA 3QD2B 5LWNA 3SG9A 2C30A 2IWIA 3ORNA 3E3PA 1WBPA 3NR9A 2WMWA 4HVGA 3OY1A 3ZDIA 4BB4A 3TIZA 3FQEA 1JPAA 2YABA 4BICA 2C47A 5CAOA 3M1SA 4OTHA 3HP5A 5EG3A 4II5A 3NNVA 2EVAA 3BI6A 4PL3A 2W4OA 1OMWA 4RX8A 5AUWA 5FLFA 3VQHA 1IA8A 4G17A 5K0KA 3COHA 4GEOA 3V01A 4LOQA 3Q4UA 5C8KA 5HGIA 1XBCA 4PTCA 4QQ5A 5A4LA 2UW8A 5E4HA 4YZDA 1ZMUA 2JEDA 2PVMA 3FZPA 3FPMA 2OWBA 4CFXA 4OTWA 2X6EA 3OMVA 5BMSA 5BVOA 5KNJA 5CS6A 3OROA 2B52A 4CKJA 4A9SA 2EB2A 2WOUA 2YJSA 4BGHA 2Z7SA 2B7AA 4JT3A 3P08A 3IGOA 3Q3BA 3TXOA 4FE2A 5E8YA 2PZIA 1OIRA 4QYFA 4ZP5A 2VZ6A 4C38A 3ORXA 1YWNA 3TG1A 3KL8A 3VUDA 4RG0A 3OC1A 4QP1A 3OCSA 3QBNA 5A4CA 3LM5A 3RM6A 4K1BA 4JI9A 5T68A 2CDZA 2G15A 1XKKA 1J91A 4ZZMA 4ZZOA 5J7BA 3UZRA 5LMAA 4DA5A 5BUEA 4FZDB 3NUPA 5DG5A
chains in the Genus database with same CATH superfamily
4HGSA 4FEVA 3EHAA 5C01A 2WTVA 3UDSA 4BIEA 1YOJA 4NIFA 1H08A 5CTPA 2J0LA 3R22A 4L53A 1G3NA 5D11A 1H4LA 4DGNA 5HIEA 3KXMA 4PPAA 4M0YA 3LFSA 3EKNA 4XP0A 3LXLA 3HA6A 5HBHA 3RK9A 3PJ3A 4BBEA 4CT2A 2OIQA 3S00A 4QQJA 4H39A 4I5CA 1M2PA 3TL8A 3LMIA 4FTJA 3MI9A 5AP7A 2XARA 3EN6A 4ZS4A 5FDPA 3NFFB 4AGUA 2RG5A 3U55A 2XM9A 3NYVA 3ERKA 3EZVA 4NIFB 1H07A 4D2TA 4I24A 4TNDA 2C6TA 3B2WA 3HKOA 1RDQE 5AX9A 3RNIA 2CKPA 2GDOA 4QPMA 3LFNA 1FMKA 4GUEA 1V0OA 2EUFB 4PMTA 3ZTXA 5L2WA 4RJ8A 4LOPA 4Y5HA 4C4EA 3OOMA 1G5SA 2XKCA 3SV0A 4YSMA 3QKKA 3R7UA 1ZLTA 1OVEA 2RGPA 1VYWA 3C1XA 3EN5A 3ORMA 2UZVA 2FYSA 2J0MB 5KBRA 3U6JA 3Q2MA 3QTRA 3NIZA 5FQDC 3GU8A 4E7WA 3HDNA 2H9VA 3UYSA 1Q4LA 1Q61A 3AT2A 3OTVA 3M11A 5IQHA 1R1WA 4WBOA 3NLBA 4EUTA 1BLXA 4EKLA 3E62A 4LRKA 3HEGA 2B9HA 1XH6A 2C0TA 5JN2A 3OD6X 1NVSA 5A6OA 2PMOX 3PZHA 1CSNA 2RL5A 2PUPA 3VBVA 3PIZA 2GPHA 3SOAA 4L3LA 3QCSA 3MN3A 3JS2A 3SLSA 4EK6A 4ACDA 5HTIA 5JEBA 5J1VA 2VWUA 4CFVA 3F9NA 4EOJA 3R28A 3R73A 3DT1A 2IW6A 3CGOA 1ERKA 3BL9A 2E9OA 3DXQA 3Q96A 3LXPA 3PP1A 4CFMA 3HYHA 1Z9XA 3VS6A 4XV3A 4BTKA 2FVDA 3CD3A 4C8BA 3IK3A 2FA2A 4D9UA 3A62A 2W1FA 2YCRA 5KUPA 3NMUF 3DKGA 4KBKA 4KIKA 4PDOA 3H9RA 3Q9WA 1JVPP 1LR4A 4O0TA 5E8TA 2RFDA 3ZO3A 4DH7A 4O7ZA 1U54A 5CU4A 4EHEA 3D83A 2E9VA 2OH4A 3QCXA 2Y9QA 5AP5A 4FV2A 4WNOA 5EM7A 3W0QA 4B99A 4C3FA 2BRBA 4A4LA 2GHLA 1YXXA 5DYJA 3DNEA 4Z9LA 5AR7A 5HVYA 4BWXA 3PFYA 4O7RA 3FKNA 2Y6OA 4KIKB 4FK6A 3U9NA 3UQFA 5IUGA 1ZY4A 3A8XA 4Y46A 3K3JA 2C3LA 5HTBA 5ACKA 4YTIA 2BTSA 2X7FA 2XIRA 2GS2A 2GTNA 2XF0A 4ASXA 5AMNA 1PXJA 3O5AA 1FGKA 2BRHA 1YHVA 2PZRA 3A7HA 5AUTA 4LRJA 4ASZA 1NW1A 2W1DA 2BKKA 3SGCA 3P9JA 3F88A 3MJ2A 2YCQA 5GJFA 1T45A 4W8DA 5DEYA 1PXPA 3PFQA 3PY1A 4AZEA 3LCOA 4K2RA 4BKYA 3I7BA 1H1SA 4AT3A 2QD9A 4XLIA 4FVRA 2ZM1A 3ZFYA 2X4FA 5IDNA 3VUHA 1BMKA 2GNGA 2ZM3A 3GCSA 4UMTA 1OKYA 5HQ0A 5EKOA 5IQFA 1UKIA 3WF6A 5BUJA 3TEIA 3D4QA 1YHWA 3AOXA 3ACJA 5CX9A 4DH5A 5KMKA 2YZLA 3UVRA 3N4UA 4XLVA 3DTWA 2PZYA 3G90X 3TV4A 1R0PA 2BVAA 4IAFA 4EEVA 3EQBA 5CEPA 3CC6A 4J97A 3GQLA 5LQFA 2WMUA 2PE0A 4DINA 5BMMA 4QP2A 5LWMA 2XNGA 1NXKA 4B0GA 2FSMX 1JWHA 4BWKA 3QZHA 4OLIA 3PXKA 5AIKA 4X2JA 3VJOA 4DTKA 2ERKA 4HPUE 4YJQA 4DEGA 3EYHA 3GI3A 3TUBA 4W9WA 4FKQA 3FXZA 3LFFA 3MW1A 4IVBA 2BMCA 2HZNA 4KWPA 4FKTA 4WOVA 2BCJA 1X8BA 3DB6A 4BIBA 4EBWA 5E92A 5DT3A 2GQGA 3GU4A 2AC3A 3OWKA 1I44A 4ANMA 3UC3A 5GJGA 3NYOA 5FGKA 4GJ3A 3SOCA 1Z5MA 1ZAOA 3C50A 3ORLA 5I9ZA 1XH9A 5J9ZA 2GNFA 2JDOA 2W1HA 3F7WA 2GTMA 3GXLA 2G2FA 1M17A 3L8PA 4XP2A 1OPKA 2CLXA 3FXXA 4USFA 4ANSA 5ACBC 2UW5A 3ENMA 3C4EA 4DFLA 4UXQA 4M14A 4F6WA 3H30A 4YZNA 5IA4A 2ITYA 1ZMWA 2WD1A 3AT3A 5CU6A 3TIYA 5IG1A 1YDSE 3W2RA 4WNKA 4JR7A 4E5WA 3NNWA 5JZNA 4RIYA 3GB2A 3VRZA 3IDCA 3BGPA 4XP3A 3ALOA 3KMUA 4IZ7A 5DI1A 3EN7A 2DQ7X 1IR3A 2BALA 2R9SA 4HYSA 3G5DA 5HHWA 4ZTNA 4EOPA 1TZDA 2AUHA 2Y4IC 2YLFA 3FLYA 3MWUA 2R3JA 3R7GA 4ZOGA 2XBJA 2P2HA 3TNHA 3TNWA 2PMNX 3I1AA 2WQEA 2PY3A 4KRCA 4HVHA 5FTGA 5I5ZA 5FUTA 3LPBA 2BRNA 3HNGA 4RIYB 2HXQA 4FGRA 4O7NA 4UV0A 2OG8A 5K9IA 3AT4A 4FKUA 4L00A 2ONLA 5JGDA 3EN4A 4ACHA 3ZS5A 4O21A 4C3RA 4V0GA 4BI2A 5EDPA 5AUXA 4EUUA 3W0SA 4TWNA 4EJ7A 4ZSAA 4UWYA 2OJIA 2OXYA 4QP7A 3R71A 3R8VA 5CAVA 3IS5A 2XS0A 3QF9A 1JAMA 4Q2AA 2OSCA 1PW2A 1OZ1A 2WMRA 2IZRA 2YFXA 4KS7A 3BYMA 5B2KA 2PVKA 4E6AA 4AXEA 3PA4A 5LCJA 4V0GB 4I23A 4FZ6A 2QOQA 4RBLA 1H01A 1OKVA 4UZDA 5LMKC 3SC1A 3O8PA 4UN0C 4FNYA 5A6NA 4FI1A 2UUEA 4Q5EA 2VTLA 2XNOA 3FKLA 1OUKA 4ID7A 3P1AA 3TJDA 4BWPA 2Z7RA 4PTGA 3V04A 3ZM9A 2BHEA 3QU0A 5AUYA 2C68A 3SW4A 3C4FA 2V7OA 4Y5QA 4CMTA 4JX7A 4D2SA 5EDRA 2BAKA 1JNKA 3H0YA 3NPCA 2WQBA 3U9CA 4GYIA 4AGDA 1PRYA 3CPCA 3VS0A 2PUIA 4QTBA 4PMMA 3TWJA 4USDA 4YTFA 1RJBA 2GFSA 4YJUA 4I21A 3OEZA 3ZBFA 5IF1A 4FK3A 3AMYA 4CEGA 3VUKA 3FZSA 1K2PA 5B0XA 4I5MA 4DEIA 4CFUA 3IW4A 4OBPA 2UW3A 2I0VA 5M4IA 4MXZA 3R8UA 5FP6A 3B2TA 2XIZA 2RSVA 2OO8X 3Q6WA 4F64A 4D55A 2XUUA 3DOGA 5FDXA 4Y85A 3SKCA 4UALA 5IISA 3CE3A 1U4DA 5M06A 4FKJA 5KMIA 3JPVA 4IDVA 3PE2A 5JZJA 3LQ8A 3L9MA 4Y95A 5KZIA 3DK6A 3QQKA 5L3AA 4YNOA 3P79A 2JKQA 3MB7A 1OL5A 3R9DA 3UOLA 4XS2A 2XM8A 3DS6A 3GFEA 3S4QA 4FT5A 1EH4A 3VN9A 2G9XA 4S30A 4BDFA 4RWLA 2HW6A 3FSFA 1PKDA 3VS1A 4CSVA 4D1ZA 4O0YA 3NAXA 5B2MA 2WPAA 2XH5A 5HBJA 4FC0A 3GGFA 3CQEA 2DUVA 4C4HA 2FO0A 3OOGA 4F78A 1UA2A 4HOKA 4EKKA 4EWHA 1GIIA 3COKA 4GU9A 4OTGA 2A2AA 5IH6A 4YNEA 2VWXA 3AC1A 3OT3A 2OI4X 3RHKA 3DY7A 4RVLA 3D7TA 1UU9A 1ZZ2A 3A7JA 4XG7A 5EDQA 3UJGA 4CVAA 4M68A 2Q83A 5C03A 4EC9A 5JFWA 5DGZA 4FEWA 4IE9A 2H96A 3PTGA 5LARA 5J79A 5IQBA 5GIOE 4EZ7A 1MQ4A 4O4CA 3O2MA 4C4GA 4C61A 3O7LB 4EYJA 4G1WA 4CQEA 4C4JA 3DKCA 5CY3A 1ZZLA 2XJ1A 5D7VA 4KSPA 3BEAA 4AOIA 3W0PA 2Z2WA 4GRBA 4QMWA 2ZMCA 4EK8A 4L3PA 1JSUA 5EQEA 4ZLOA 1KE7A 3P78A 3HMOA 4YPSA 1E9HA 1W2DA 2R3KA 3TCPA 4EC8A 4ZTHA 4OTFA 3O71A 4NWMA 3PPKA 2C5OA 4IWQA 4L43A 4NW5A 4AXAA 3KRXA 3R0TA 3D5WA 3KULB 5AP2A 4F9WA 2WXVA 1H26A 1R3CA 4L52A 4MVFA 5EYDA 3ZRMA 3ZUVA 3E5AA 2CPKE 4RMZA 3RWPA 3SG8A 4U44A 4AN9A 3EZRA 2QOKA 4DEHA 2F7EE 4BBFA 3BYUA 4GU6A 2P33A 4JBVA 3F3VA 1SNUA 4EHZA 3ANQA 4C0TA 3TZ7A 3LCDA 4WRGA 4PDSA 5M4FA 2XP2A 2VTAA 4OW8A 3LJ0A 2YM6A 4TRLA 4I0RA 3EFKA 5CVHA 4Y8DA 1M7QA 3FJQE 1SM2A 3HMPA 2EB3A 4RGJA 3DKOA 5DLSA 5M57A 1SMHA 3DGKA 2FH9A 4Z7HA 2YM8A 4IW0A 4M8TA 3WYYA 4Z3VA 5JFVA 3QXPA 2UW4A 2YAAA 4AZFA 3LLTA 3KFAA 4KNBA 3TV6A 2W5AA 3RAWA 3I6WA 3BKBA 2F7ZE 3R63A 1V0BA 2CN8A 3CPBA 4NZWB 5F20A 3FMMA 3UOKA 3QQLA 4TY1A 4KBAA 3CXWA 1JSTA 4DFYA 4HYIA 1Q8YA 3QTQA 4I4FA 3AQVA 4IC8A 4LI5A 3VF8A 5A3XA 3QC9A 4MHAA 3ZEWA 4BYIA 2XIXA 3GENA 2JIUA 2R3RA 4FT7A 4F0GA 4RQKA 3UZPA 4KD1A 3F2NA 3VC4A 3FC1X 3TKHA 3F3ZA 2JAVA 3L9NA 3MH1A 5F95A 4IWOA 3UDTA 4AXFA 2W1GA 4JR3A 2C1AA 2CKOA 4QMLA 3TTIA 4E6CA 5HCXA 4O84A 1P4OA 4R6VA 3UTOA 1VYZA 2QOIA 3QTSA 1WCCA 2UVXA 4NFMA 4O4EA 4AE6A 2QOCA 4MXAA 3CTJA 3E7VA 3IW6A 3R7VA 3V5PA 4F7NA 4YMJA 3CKXA 5E8UA 5LVPA 2C0IA 4BKJA 4MD8E 4FV3A 4DG2E 3UNZA 4EONA 2C5VA 3MESA 2HOGA 2YWPA 2C3IB 3TM0A 4YSJA 5AAGA 3LAUA 4FG7A 3LXNA 4FEQA 3MA3A 3W16A 3IQ7A 1XH7A 2BAQA 2XK6A 2YN8A 1Q41A 4RLLA 3WZDA 4DE4A 3BHYA 2O64A 1UWHA 3TKIA 3C0HA 3FLZA 3QRTA 2QC6A 2J7TA 2ZB0A 3LOKA 3RPOA 4ZY5A 4O0VA 4MNEB 4XV1A 4G3DA 3TDWA 4CV9A 3BL7A 4XBRA 4F6SA 2P0CA 5HNIX 2R3FA 2NPQA 4FTQA 2CNVA 4DHIB 1PYXA 3TNPC 4R5YA 2G2IA 4BR3A 3A61A 4IM2A 5CSWA 3KCFA 4FBXA 4C34A 2I1MA 5J7HA 4ALWA 4F6UA 3FI2A 4DH1A 2ZM4A 3C4ZA 3ACKA 4ZLYA 1OPJA 1UU7A 4OT5A 3P86A 1H24A 2UW7A 1ST4A 3NW5A 3ITZA 1JSVA 3L8VA 4XUFA 3LFEA 4PP9A 2P3GX 3NNUA 4PPBA 4FV5A 2XALA 2I40A 3MGYA 5DPVA 3RWQA 4E93A 4WIHA 3ODZX 3QGYA 1ZYJA 3GUBA 4QPAA 4FNXA 3W33A 4I0TA 2GU8A 2IF8A 3UPXA 3QTIA 4GKIA 4MBLA 4RRVA 3T3VA 4AE9A 2OJFE 3F3UA 3VULA 3GCPA 2YIWA 3BU3A 4J96A 4X3FC 3QUEA 3H0ZA 1GJOA 4P7EA 5TE0A 3ZMMA 4P5QA 2HK5A 5AA8A 4AXCA 1JBPE 3RNYA 5E1SA 3BIZA 3FE3A 3G2FA 4UB7A 3KK9A 3KN5A 2XMYA 3OBGA 1H1QA 3BHUA 4D5KA 5ANKA 2XIYA 3QLGA 1FGIA 2ZMDA 4I6LA 1W98A 4RX9A 4NM5A 4RT7A 4R1YA 4U81A 2CNUA 4DGMA 2BZIB 1WZYA 3AG9A 5HLNA 5K0XA 2QG7A 2EU9A 3F3TA 3FYJX 5HI2A 4IADA 4UYNA 2WGJA 3QZIA 1YOMA 2WMXA 4IACA 5CU2A 3UDZA 4DFBA 5C4LA 3NIEA 5IQEA 5ICPA 4C37A 3DBQA 3ZCLA 5J95A 3F5XA 3BLQA 3OS3A 3AGLA 3ZDUA 5J9LA 3QUDA 4AW1A 2BUJA 4I4EA 5FTOA 3BHTA 2LGCA 4YZCA 3KMWA 2IW8A 3ZO4A 2XANA 4YJSA 5J5TA 5LVLA 2ETMA 5C1QB 3PPJA 2QLQA 5EOLA 3U6HA 3ORPA 3PUFC 5CLPA 1WBNA 2Y7JA 3BZ3A 5FM2A 4BBMA 3UQCA 3LLAA 1KWPA 3W8LA 3ZSGA 3DBFA 3G6HA 2PE2A 2UVZA 4MNFA 1G8SA 3KRWA 5EI8A 4ZSJA 3K5VA 5CEOA 2VGPA 3A8WA 3BBTB 4BZOA 3U54A 3R1NA 4FSYA 4E1ZA 4IZ5A 5ETFA 4ITHA 4R7IA 5FG8A 5HORA 3K5UA 3S0OA 3NUXA 3UZTA 4I93A 4EORA 1AQ1A 2PUUA 3NX8A 1YRPA 5IEXA 3SW7A 3I79A 2QO7A 2IJMA 3ET7A 4OTPA 3D94A 3FHRA 4IMYA 4PNIA 4PMSA 4RSSA 4LOOA 4NM0A 2YDIA 4G3EA 1TQPA 1PXIA 4FEUA 2AYPA 2VRXA 2X7GA 5A4TA 5AEPA 5A4EA 2QOFA 3FAAA 4XRJA 5AUZA 1UNGA 3KXZA 1H8FA 3RP9A 2GQRA 2B9JA 4MF1A 4GIIA 5KMLA 3DDPA 3MY0A 4N4SA 1WBSA 3DJ7A 1YI6A 3PE1A 3UOHA 3ZBXA 4ZEGA 2NO3A 4FSWA 2X2KA 4HYHA 4OTRA 1YQJA 3WI6A 4FV4A 3HX4A 4AU8A 2CKEA 2O5KA 2IVSA 1YXUA 2J0IA 3KK8A 4H3QA 5M55A 3UC4A 4E26A 3OFMA 5C8NA 5G6VA 2R7IA 3MTLA 4WBBB 5D9HA 3R7EA 3V5LA 4FRFA 3G0FA 3NSZA 4FTMA 4FSQA 5BPYA 2DS1A 3P4KA 4NW6A 3JY0A 4CG8A 2OKRA 1DAWA 3ETAA 4H3PA 1XH8A 1W8CA 3EQGA 3H9OA 5GZ9A 2Z02A 4DLIA 4A4XA 4Z7GA 3U4UA 2C5NA 2NRYA 4BGGA 4OBOA 2ITOA 4YHTA 5FXSA 1O6KA 2Y4IB 3NUAA 4CYJA 3TT0A 2VGOA 2VWBA 2WQOA 3T9IA 4PTEA 4DC2A 4Z55A 3DAKA 3KB7A 2B1PA 1BKXA 2V7AA 3QD3A 4QQTA 4FKGA 3GCUA 3F69A 2HIWA 4IX6A 4JQ8A 2J50A 4OTDA 3SHEA 3SAYA 5KMNA 4ZJJA 5CSPA 1M2RA 3KEXA 3R1YA 1A06A 3L1SA 3OEFX 4IC7A 3P7BA 3PWDA 4WSYA 4ANLA 4HJOA 4NCTC 1RW8A 2IVTA 5CF4A 4QNAA 5EHOA 2HXLA 5LMKA 3W2PA 4A7CA 5L8KA 3A2CA 3UGCA 1WBTA 4FVQA 2QONA 2G01A 4S32A 2QOOA 4LV8A 3A4PA 3ROYA 2E9PA 5FTQA 3FLNC 5EW8A 3Q9XA 1ZOHA 4AAYA 1ATPE 2YM4A 2VTOA 3DTCA 4QO9A 1A9UA 3QWJA 3FL5A 4TWCA 4OAUC 2JC6A 4JJRA 2XZSA 4CTBA 2LAVA 1CMKE 2BFXA 5AWMA 3QCQA 2W1CA 4RZWA 3AMBA 4YPDA 2F2UA 3TKUA 3LMHA 4MWHA 4FTOA 3HECA 1MQBA 4FYNA 5HBEA 3DQWA 4TZRA 2H6DA 2JDVA 3WARA 3UIBA 4EHGA 4YHFA 2V55A 1P14A 2UV2A 3KCKA 3FQSA 5D12A 2BIKB 4DEBA 3WBLA 2BTRA 4XCUA 2PWLA 1QPEA 3OZ6A 4MQ2A 4IJPA 3MPMA 1UNLA 3W8QA 4L68A 4WUNA 4GKHA 2FGIA 3QTUA 3BYVA 1O6LA 3PA5A 4DFUA 1B39A 4FKRA 3UNKA 1GNGA 2JITA 2WOTA 3F3WA 2W9FB 2WMVA 3WE8A 5JSMA 3GCVA 3K54A 3DAEA 4EH3A 5HIDA 5L8JA 3TZMA 3PP0A 4M69A 5IA0A 3EWHA 2BZJA 3O96A 2RFSA 4F0FA 4F99A 1TVOA 4IJ9A 5E91A 4CG9A 2ETRA 3FHIA 5DBXA 2OBJA 3I5NA 5AV1A 3C4CA 1DS5A 5EW9A 3AC2A 4G16A 2QO9A 2BDWA 3LHJA 1H1WA 1TQMA 3A7FA 3DBDA 2WEIA 3GFWA 3UNJA 3RPRA 5EYCA 3QGWA 4IAZA 4M69B 4FOBA 4TYIA 4FV0A 4X2NA 4YLJA 4ZTMA 4FIHA 3V51A 2R3HA 3ZZEA 3U8WA 4NT4A 3BE2A 5HE0A 4AGWA 1L8TA 5E90A 3FEGA 3CKWA 3KGAA 4XNEA 4USEA 1FPUA 4FV8A 4O96A 3KMMA 5A54A 4UZHA 3E3BX 4FNWA 2UW9A 5BVFA 5CEMA 3FBVA 4EQCA 3FI3A 1J7UA 2A19B 1BL7A 3A60A 3DKFA 4JQ7A 2PSQA 2XIKA 4FIEA 1MP8A 3I60A 3N9XA 4IDTA 4YBJA 4DH3A 4JDJA 3OWJA 4JQEA 1NA7A 2QQ7A 4BCMA 3QHWA 3VS4A 3FY0A 4D28A 5AX3A 2WHBA 3BRBA 1BI8A 3DQXA 4FIIA 1URWA 2ITXA 4TYEA 4W4WA 3UVPA 5HD4A 5KO1A 3Q04A 4I6QA 4IAAA 2ZYBA 4I5PA 2RKUA 2ZDUA 5HKMA 3UIMA 3AXWA 2IEWA 1W7HA 1ZYLA 2ZVAA 3EB0A 3EQHA 4IX5A 4J8NA 4NTTA 1PJKA 4G6LA 4G9RA 4QMZA 5F1ZA 4M84A 5IH5A 4X2FA 5HEZA 2W7XA 2R3QA 4JAJA 3Q60A 2E9NA 1Q24A 3CBLA 5H2UA 3UMWA 5CZIA 4A07A 4AT4A 3DLZA 4L67A 5DHJA 4O7TA 1LEZA 3OCBA 5LVOA 3ZXZA 4MK0A 3FI4A 3KIOC 2GCDA 1S9IA 4FT0A 4ITIA 4AGCA 5I9VA 2CHLA 4QTAA 4AW2A 4MXYA 2EWAA 1KUTA 3MYGA 1U54B 5KZ0A 4FTTA 1F3MC 4TL0A 3F61A 5HO7A 4C33A 4MD7E 3ZC6A 1XMMA 2YCFA 5I9YA 4RJ5A 3RPVA 3LIJA 4FT9A 5CI6A 1WMKA 3ELJA 3A7GA 5IKWA 5E1EA 3VUIA 2X0PA 4FX3A 1AGWA 4YTCA 4IFCA 4FTNA 1JOWB 4JOAA 2WO6A 5CSXA 1KE6A 2BILB 3R1QA 5DT0A 3L8SA 3Q2JA 1LEWA 4GK4A 5BVEA 5H8EA 2BHHA 4JS8A 2ZJWA 1KOAA 4RIOA 5HNBA 2OJGA 2WTKC 3TNIA 1Y6BA 2B54A 2XCHA 4KINA 2OICA 2VNWA 4GMYA 2BDFA 5HD7A 1VR2A 4WT6A 3QTXA 4F7LA 1IA9A 3DA6A 2I7QA 2YIRA 3HVCA 3GOPA 3C4XA 4EBVA 4NSTA 3QTZA 3W2SA 2X8EA 4ZLZA 2YISA 5K4JA 4C2VA 4XEYA 4YURA 1VZOA 3CJFA 4Z16A 3E7OA 4YJPA 3RBWA 2QR7A 5AR2A 2CMWA 4AS0A 4EYMA 4DTBA 2J2IB 4FKIA 3MVMA 3QYWA 5EYKA 4RFMA 4BCHA 1PY5A 3QRJA 2I0HA 2ETKA 2WTIA 4OGRA 2OF4A 3RPYA 4LRMA 3QRKA 2VTHA 2VUWA 4D2RA 4ZJVA 3P7CA 3LFCA 3KN6A 3RVGA 3KXNA 4F08A 2RFEA 2JKOA 3GQIA 4FV9A 4UY9A 3SRVA 4F7SA 2BAJA 4PL5A 3AD4A 4FTRA 4ZIMA 3AC3A 3PXQA 3BLHA 4BCFA 4DCEA 1FVRA 1P4FA 3NNXA 5FD2A 1REKA 3AC8A 2O8YA 1U5RA 3QZGA 2PE1A 2RIOA 4FL1A 4IXPA 1OKWA 3VS5A 3G9LX 5AM7A 4XG4A 5DH3A 5A14A 1PYEA 4F65A 2NRUA 3QALE 4MXCA 2W1IA 4NK9A 5CNOA 4APCA 4M3QA 5KKRB 2J4ZA 1ZY5A 3GVUA 3IGGA 4XG2A 3CIKA 5CF6A 3NYXA 3SRVB 3IOKA 4QYEA 4BKZA 2R3LA 3KKVA 2WKMA 1R0EA 4QMNA 3F82A 2OFUA 3I0QA 5GNKA 1KE8A 2XKEA 4D2PA 4FL2A 3MVHA 5FXRA 2PVHA 3HRBA 3HV4A 4C57A 4YZBA 4ACCA 5IA3A 3UP7A 4XMOA 3RMFA 4HYUA 4BZDA 4AQKA 3AMAA 3ZLSA 2W0JA 3ORIA 1DI9A 3DU8A 3QKMA 4OAVB 5F94A 4FV1A 2VN9A 1RQQA 5GHVA 4B7TA 2XKDA 3RJCA 4BDJA 2A0CX 4IIRA 4YC3A 2REIA 3NUYA 4IAIA 1YDRE 3B8QA 1YXVA 4FTIA 3G9NA 4UYAA 4EOIA 2C0OA 5C4KA 4KIOA 4AZSA 3NFGB 4O1PA 3NDMA 4YJOA 4IZYA 1SVHA 4X3FA 3IDBA 1ZYSA 1IAHA 4IAKA 4YTHA 3W2CA 4BDEA 3BBWA 3ZO1A 3SXSA 4ANQA 1R78A 4XG9A 3C0GA 3C4WA 1YVJA 3PWYA 5TOZA 1M7NA 5I3RA 3R83A 4LUDA 5ETCA 4EQUA 4O38A 4YC8A 5E8WA 5I9UA 4AFEA 2Z8CA 4CZUA 1W83A 4YLLA 4RFZA 2VTNA 2IO6A 4X3FB 4I0SA 3E93A 3IDPA 3ZRKA 4DEAA 3W0RA 2WNTA 3F2AA 4BVUA 1CKIA 2IZSA 2QHNA 2W06A 5DT4A 5BQ0A 5T6KA 1UU3A 4EOSA 4F7JA 2F4JA 3OVVA 1Y57A 2QOBA 5JQ8A 5FM3A 2VU3A 3ID6C 4TNBA 2R3OA 3HRFA 2HY81 3UIXA 4LGGA 3S1HA 2PPQA 3PSBA 4XV9A 2A4LA 2ITNA 1G8AA 4TN6A 1O9UA 3DJ5A 3RK5A 4JBQA 4A06A 4G31A 4CKIA 3NCGA 2KTYA 4BDCA 2X0QA 3LFBA 4GUBA 4NUSA 5ANDA 3TI1A 2CKQA 4DFXE 4F70A 1XBAA 3CQUA 3QXOA 4QYYA 3WIGA 5I0BA 1OITA 2ITQA 3M42A 1H0VA 4DITA 2CLQA 1W2FA 4EOOA 3TUCA 1DM2A 4C36A 4K9YA 1PMEA 4WG4A 4HPTE 4EK3A 3FLQA 2NNWB 4TWPA 4PL4A 4QEBA 3LFQA 4CT1A 3DXPA 4L45A 4H05A 3JVSA 2R64A 2EXEA 4M7IA 4MQ1A 4Q9SA 2PVYA 3F7ZA 4G5JA 2AQXA 3PJCA 4D0XA 4X2GA 2ZV9A 3BHVA 4MCVA 1DI8A 2C5XA 5BYYA 3JXWA 4MBIA 3H10A 4MWIA 3WF5A 1OL1A 4YZ9A 3FQHA 1AD5A 3UG2A 4AF3A 2UZNA 3MS9A 2BZKB 3VAPA 4IZAA 2ITTA 2QLUA 3OUNB 1XH5A 4BDKA 5IA2A 4FOCA 3IW5A 1UWJA 3PSDA 5CASA 1TQIA 2CGVA 4BDBA 4HGTA 3RM7A 4XOYA 3V3VA 1BX6A 3DFCB 4O6LA 4JVGA 4JRVA 4JIKA 2ITWA 4QP8A 2IZTA 4BDDA 4QQCA 4O81A 2VWYA 2VTQA 2A27A 1KV2A 4ZY6A 3ATTA 3P5JC 5FEEA 4K11A 4AG8A 2OF2A 3EKKA 2ESMA 1BUHA 1O6YA 4FGBA 4I1ZA 4LFIA 5K4IA 4AXDA 4RQVA 1QPDA 3F5GA 3E92A 3Q4CA 4QTDA 2F57A 1VJYA 2W5HA 4AN2A 2BZHB 4U40A 2FSOX 5IU2A 3RPSA 5D1JA 3W32A 5AFVA 3RCDA 2PK9A 4LUEA 4OTIA 4A9UA 2HWOA 5EM5A 3UO6A 4RC2A 2Y6MA 2XRUA 1S9JA 4AZTA 2IZUA 2B55A 2WZJA 4TW9A 4B9DA 2HZIA 3BQCA 2CNQA 2RFNA 1BI7A 3KRRA 2QI8A 5ANGA 3GC0A 1KE5A 1XO2B 3VUTA 3HL7A 5FEQA 2BR1A 3LCKA 5BX0A 5HTCA 4M0ZA 3D7TB 4QMTA 3POZA 4JG7A 4PY1A