5CEPA

Dlk in complex with inhibitor n-(1-isopropyl-5-(piperidin-4-yl)-1h-pyrazol-3-yl)-4-(trifluoromethyl)pyridin-2-amine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 12
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cepA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cepA01
1IEPA 2XKEA 3VF8A 1OITA 4RJ3A 2HXLA 4UX9A 2W0JA 1M2RA 3FKLA 4NKAA 2QQ7A 2IVVA 5C03A 4PMPA 2A4LA 2OJJA 3EFLA 5CF8A 2X9FA 4O0UA 5KMOA 4H05A 2YACA 3QTZA 4QP4A 3PIYA 4EH9A 1ZRZA 3PE2A 3S2PA 2H9VA 3QCXA 4FK6A 1R0PA 4S31A 4NIFA 2NRUA 5H8GA 3VBWA 3U54A 4HJOA 3Q4ZA 4BDDA 3GU8A 3KXXA 4IBMA 2ITWA 4O2ZA 4YZBA 4EWQA 3ZDUA 4BVUA 5E8UA 4AZTA 2X39A 3FKNA 5LARA 4YPSA 3E88A 1JVPP 2J0MB 3MY1A 4ASZA 4XX9A 4C38A 4EEVA 1W98A 5KE0A 5I4NA 1U5RA 3ZMMA 3QZHA 4QQJA 5AR8A 2FVDA 5CU3A 4AW0A 4EUTA 4IXPA 4E8AA 3VF9A 4O83A 5AUXA 3VBTA 2BAKA 1CM8A 2OKRA 2EB3A 3R63A 3RAWA 1P14A 2WPAA 4IC8A 5B0XA 5KMMA 4FTRA 5CQWA 5DMZA 5IF1A 1WVYA 1J7UA 1PMNA 4D5HA 5G6VA 5CI6A 3TNPC 3ZEWA 3QZIA 2QG5A 4MEDA 4F9WA 4CFMA 3VS3A 5HVKA 1S9JA 3R7OA 2JKOA 4CMOA 2O2UA 4EBVA 1YRPA 1BX6A 4NH1A 3TV6A 4RFMA 4RIXA 3ZRLA 3R7UA 2J2IB 5IUHA 4FYOA 4O38A 5BVNA 4R1YA 4BDAA 3T8OA 4EC8A 2WMUA 3PJCA 1YDTE 2W1CA 3DJ5A 2W1IA 5GZ9A 4OTQA 5HNBA 4JIAA 5K3YA 3SD0A 2RFNA 4DG3E 2WTWA 3G51A 5JSMA 4RSSA 2OZOA 4G9CA 3VHEA 1YHWA 2JIUA 3TKIA 1YVJA 4IAFA 4CSVA 5C4KA 4C33A 4Y83A 1H26A 3ZO3A 5IZFA 3FI3A 5M4CA 4ZLZA 3BQRA 3AD6A 4BCNA 2F7ZE 1Q8YA 1YXSA 4AW1A 3OCSA 3RAHA 3O7LD 1OL5A 2FB8A 3MJ1A 5EYCA 3UNKA 2VU3A 2XEZA 3Q5IA 4HYIA 3IDPA 4D58A 2CHLA 2ERZE 2YM4A 5GJFA 3VBXA 3VBVA 2J5EA 4HCVA 4HVSA 5KUPA 3VRZA 4ERKA 5TR6A 1H24A 3K54A 3QD0A 5BYYA 3I5NA 3C7QA 3CP9A 2F7EE 5KBRA 1G5SA 1UU3A 5ACKA 3VS7A 4ENYA 3LIJA 4CKIA 4X3JA 2EXMA 4W8EA 4ZSAA 2G1TA 1FBNA 1GIHA 4FTLA 3RCDA 2X81A 2QC6A 2WTJA 4FUYA 3QQFA 4OUCA 4WHZA 3VWAA 2QONA 5D7AA 3VS5A 3O8TA 3QWKA 4C58A 2PHKA 1I44A 3FLNC 3GC8A 2ITOA 5CF4A 4RFZA 2F9GA 3RM7A 4KS7A 4O96A 4XP2A 5I0BA 4FTKA 1OGUA 3F5GA 4KIKB 1Q61A 2CJMA 4R8QA 4AA5A 5KMKA 5T3QA 3W16A 3CTQA 4DHFA 2XK8A 4IX3A 1KOAA 3H0ZA 4QP7A 4XG2A 5E8TA 3BHHA 4DYMA 5KMJA 3GCPA 3FE3A 4HNFA 3VS2A 3QUEA 2W4KA 3KC3A 4EUUA 3TM0A 4IX5A 1OZ1A 1XHAA 3FMLA 4WO5A 2IG7A 1EH4A 2WMTA 3W2PA 4DG2E 5L2WA 3UQCA 3ITZA 4C4EA 4E93A 5BX0A 4FEUA 1KE9A 1REJA 2C69A 2BFYA 3LXLA 2IZTA 4UMPA 2X4ZA 4KAOA 2A2AA 3H9FA 1L8TA 5EDRA 2EUFB 2VTRA 5LVPA 4HZSA 2A1AB 3KMUA 4X7QA 3PPJA 4AN9A 5AEPA 4AOJA 4USDA 5ETCA 3FMMA 3R00A 2HWOA 3C4CA 4PPBA 4QTCA 3WF6A 4F1TA 1REKA 3ZTXA 4IM3A 4OTFA 5CSVA 4UXLA 2X2KA 2JITA 4JIKA 4RBLA 1MUOA 2PMIA 5EHLA 2BIKB 2GQRA 2W5HA 2YM3A 2BVAA 3EQCA 4YJTA 1FINA 5CALA 1ZOHA 4ZTNA 5AP2A 4MCVA 1L3RE 4BDBA 3R8PA 3AGMA 3ZLXA 1ZARA 4J96A 3PA4A 2R0UA 4MAOA 4TYHA 2R9SA 3PG3A 2VN9A 3VNTA 3W8QA 3UIMA 2OWBA 4CLIA 4ENXA 4E5WA 4A06A 1R78A 3T3UA 4ARKA 5A4QA 1MRUA 2PVJA 3SHEA 2ACXA 4FV0A 1OKVA 2H8HA 4IVBA 3II5A 3KXGA 2E9PA 1V0BA 3IS5A 3NNWA 5ETIA 3UOKA 3TNIA 2H6DA 1W84A 1M7QA 4JRNA 4OW8A 4U44A 4YSMA 4JL9A 5DOSA 4IIRA 4C37A 3QALE 4G3EA 5HI2A 4J7BA 5G1XA 4JG7A 1FGKA 2ETRA 4I6QA 2VAGA 2FA2A 5CEMA 4EK8A 3CGOA 5EG3A 2XK4A 3MV5A 4FKQA 4ZSLA 4IM0A 4AT5A 3RHXA 4CFVA 5IQFA 4QP3A 3ZM9A 2J90A 3BEGA 5AA9A 3UO4A 3PXYA 5CI7A 4E5BA 3R04A 5I9XA 5KZ0A 4NK9A 1BKXA 1SNUA 5EKOA 5JRSA 3BE2A 3PP1A 5I9ZA 4EJ7A 3PSBA 4X6QC 4HCUA 5DI1A 4M8TA 3ZYAA 3DAKA 5GZ8A 3BWJA 5D12A 2I7QA 2QOHA 2BDWA 3NMUF 3D14A 4FGRA 2B53A 3BGQA 4XYFA 3NUUA 4I0SA 4YLJA 4C4JA 2WU7A 2BUJA 1URWA 3GCQA 2JD5A 3C0GA 3ORLA 4M97A 4ZJIA 5J7BA 5CT7A 4QD6A 1JNKA 5AUVA 2JAMA 3IW7A 3ROCA 3TG1A 3WOWA 4AAAA 5K5XA 3DXQA 4ONAA 4D9UA 3H3CA 2XIKA 5LMKC 1H8FA 2QNJA 2OLCA 3OT8A 4WD5A 3BE9A 4A9YA 3WARA 4I24A 5HCXA 1UU9A 4LV5A 4PDYA 3COIA 4LOPA 3QC4A 3MY0A 4BI0A 2WGJA 2YCRA 4L45A 4MQ1A 2C30A 3DFAA 3PXFA 4A9SA 3F82A 4ZY4A 1Y6AA 2E2BA 3PRIA 5EQEA 2PY3A 3LJ1A 4EOLA 3AQVA 2OJFE 3OBJA 3V6SA 4GYIA 4NKSA 3NDMA 4QP8A 3RHKA 3MBLA 5HQ0A 3RALA 5FDPA 4GG7A 4LI5A 4R7IA 4KSPA 1KV1A 4FSZA 3TL8A 4E4MA 2VD5A 4I3ZA 2VWUA 1Q41A 4A07A 4GRBA 1BMKA 4BZOA 4F1OA 2YCFA 4PWNA 4FT9A 4G31A 4U97A 2JIIA 2W99B 4FV2A 4CFXA 3DKFA 2YERA 1ZMUA 5K5NA 1R0EA 2VGOA 3Q9ZA 1NXKA 4CFNA 3EZVA 5BYZA 4DEDA 4X21A 5A4CA 4FTIA 3EWHA 2R0IA 5JGDA 2NRYA 3VQUA 5IMEA 4GJ3A 5JGBA 3M2WA 5AUZA 3M1SA 4UEUA 1CKJA 2XZSA 4MXYA 2VNWA 2ZM3A 5DVRA 3MS9A 4WA9A 4YU2A 2XM9A 2VV9A 2CKQA 1F0QA 4BKZA 3PLSA 4IAIA 4FNYA 2HW7A 4FSTA 4L7SA 1YOMA 3K5VA 5AP6A 2XIYA 5E1SA 3ELJA 4D2RA 4YJUA 3VHKA 5A4TA 1KE8A 3ZLSA 4OTIA 5HD4A 3QTRA 5HHWA 4D1SA 3TNQB 3Q5ZA 4M15A 4IANA 1NVSA 3PXRA 2VTLA 3FLSA 3JPVA 2EXEA 2BILB 1E9HA 2FSOX 3W18A 3L9PA 2QD9A 3TTJA 3BU6A 3N9XA 3NYNA 2GS6A 1PYXA 3QLGA 1APME 2NNWB 2C5OA 2CSNA 2WIHA 3OW3A 4RZVA 5D41A 3KGAA 5EYDA 2X9EA 3UC4A 2VTNA 4LL0A 4HOKA 4PP9A 3ULZA 2PMLX 4D1ZA 5EKNA 5B7VA 4IWQA 2XCKA 2VRXA 2VTQA 1JKSA 4NJ3A 2XK6A 3A62A 2XRWA 3P7CA 2OH4A 3UJGA 3SOCA 3Q52A 3A2CA 4LL5A 4I94A 1FPUA 1O9UA 2Z7QA 4XG3A 4DGMA 4L7FA 4IFGA 4H3BA 1ERKA 1Q8UA 4F08A 2CMWA 1FQ1B 3EL7A 4J95A 4NEUA 4AA0A 4BKYA 4O1OA 5CF5A 4BTKA 3SA0A 5HZNA 3VBYA 2UV2A 5JZJA 5FXSA 2UZEA 4IC7A 3TN8A 3R30A 3G9NA 1A48A 2UZWE 3A7JA 3SOAA 4LYNA 4RC2A 3SRVA 2WQMA 3NYOA 2R3FA 3RPYA 3KEXA 4KSQA 3WZUA 4D2PA 5DT4A 3FLQA 4QYHA 4IX6A 3GC9A 5FG8A 2CN5A 4HVGA 2BAJA 4CZTA 4DFZE 3C4ZA 2QOIA 2QOBA 3ATSA 4UZHA 1XH7A 4X2FA 4QT1A 2B9IA 4GV1A 5HX8A 2CKPA 4F0FA 4MD7E 3Q96A 5I9YA 3EFJA 1IRKA 2QOCA 3GCSA 3NW5A 4XG8A 5KHWA 2C6MA 3ALNA 4G6NA 5DFPA 4Y5HA 4CTBA 2QR8A 3PXKA 4OR5A 3V5QA 4EH8A 3S00A 2R5TA 4G6OA 4OTRA 4P5QA 4P2KA 3SDJA 1YWRA 4EOOA 4WRGA 2JKKA 3UVRA 3PE1A 4NT4A 3TWJA 1H08A 3MH2A 4ZOGA 4ANLA 2VWWA 4DLIA 1H1PA 2WAJA 3C4XA 4O84A 3ERKA 1HCLA 4L01A 3OT3A 4D2SA 2CGUA 2XP2A 4PPCA 4Y8DA 3JUHA 5HE1A 4Y95A 3R83A 3F3TA 3RI1A 4NTTA 1A9UA 4RC3A 3G5DA 3AC5A 3VS4A 4L44A 4GK3A 4ORKA 2WEIA 3MYGA 4ALUA 3ZHPC 4QTEA 3NS9A 3K3JA 3G2FA 3P5KA 4RIOA 3OS3A 4D0XA 2WQBA 5EQPA 4RVMA 2PMNX 3SLSA 3QA0A 2PE0A 2PZPA 2QU5A 3V6RA 3ZC6A 4B99A 4C2WA 5EQYA 2BALA 1ZXEA 3O50A 3RWQA 5JFXA 4FOBA 3HV6A 4U5JA 1JPAA 3HMIA 3QKKA 5AP3A 1IA9A 4D1XA 2JBOA 3PPZA 4A9UA 1OL2A 3ZZWA 4CKRA 1U5QA 3FI2A 1H1RA 3ENMA 3Q32A 4D55A 5BMSA 5AX9A 3DB8A 1SZMA 2YHVA 4FKOA 3LQ3A 4QYYA 4YSJA 1PY5A 3RTPA 2QOFA 2UVZA 4F7NA 4YGAA 3B2TA 2KULA 3NSZA 3OWPA 4HPTE 5FQDC 5IG1A 3I6UA 3UVQA 3PZHA 3KVXA 2QVSE 3L9MA 3LM5A 5FM2A 4KIKA 3TIZA 2WQNA 1P4FA 2HYYA 2XNOA 4GG5A 4WUNA 3OXTA 4AGCA 4D4SA 3R02A 4PTCA 5KHXA 4GT3A 5CAPA 2JDSA 2QKRA 3BYMA 1UKHA 2IZUA 4O0YA 4YPDA 5CZHA 2JEDA 2ZV7A 2X0GA 2VWYA 3DZOA 4H1JA 4MBLA 3MIYA 3O96A 5A4EA 5IPJA 2PVLA 2PZ5A 4AW2A 4FL2A 2R3QA 3A7IA 2GMXA 4BIDA 3UOHA 3ENHA 3ID6C 4Y46A 3CIKA 5E4HA 1GIJA 4WNKA 3LCKA 4FIEA 4YHFA 4JLCA 4IDTA 3MA6A 4TWCA 5ANKA 3UIXA 3CJFA 4TNBA 3E64A 4K6ZA 4TTHB 3JYAA 3P7AA 5LOHA 2SRCA 4ACHA 3QUDA 4TYHB 1STCE 2VO3A 4CYJA 2VX0A 4EZ5A 3DU8A 1ZMWA 3LXNA 4ZJJA 3FI4A 4XLVA 3G9LX 5A4LA 3TDWA 3GT8A 2ZV2A 3OOGA 5J87A 4XG4A 1AQ1A 4CEGA 3P08A 2UW9A 4FKRA 4KIPA 2GNLA 3CQEA 4O7TA 2WOTA 4QYGA 1UNGA 3FZRA 3QBNA 3QWJA 2WMWA 3U51A 4DF3A 3QF9A 1JSTA 1SVGA 1Y8GA 1QL6A 3OCBA 4EH2A 1UNHA 5FTGA 4I4FA 5JQ8A 4ASXA 4UYNA 2HXQA 3G0EA 2AYPA 4TXCA 3QZGA 2Q83A 5C4LA 3OOMA 4PY1A 2DUVA 5L2TA 1YHVA 4AQCA 4GSBA 3E7OA 1H25A 5DG5A 4KWPA 3N51A 3ZS5A 2BKKA 1H1WA 4BHNA 4QMMA 1GJOA 3NIZA 4USEA 3EZRA 4KRCA 2YJSA 3D15A 4L3LA 3ORNA 4FG7A 2HW6A 3VQHA 5CXZA 4TKSA 2X2LA 2G9XA 1F5QA 4I6FA 4X2GA 4WIHA 3FMNA 2Z8CA 4I20A 4QNAA 2GHGA 4YZ9A 5DWRA 1WCCA 4APPA 4CZUA 4DBNA 1YQJA 1XKKA 4RWIA 3G90X 4RIWA 3TKHA 5HIEA 4N6YA 3WYYA 4ZZNA 2RG5A 3FV8A 2QI8A 2P2HA 4PQNA 4Q5HA 5L2IA 4AT3A 1YOJA 3WYXA 5HD7A 4K2RA 3L9NA 2B55A 4DT9A 5AR4A 2ITXA 1FVVA 3CSVA 5I9WA 3D2IA 1H0WA 3GOKA 3DT1A 3LFQA 3PXQA 4G2FA 4I5MA 3LW0A 3RAIA 3PLAE 3FSKA 3MDYA 3QTWA 5IUIA 5A6NA 5CU6A 3MPMA 4YJQA 5AAEA 4BDKA 5DGZA 4IW0A 4DG0E 1H1SA 2X6EA 4QMPA 2W17A 4WBOA 1M2PA 3E62A 3F7WA 3UIBA 4AGDA 1J1CA 3HV4A 5TKDA 1VYZA 2X8IA 4EH6A 4BBFA 4F0IA 2UZLA 4BGQA 5BVFA 5TO8A 2XRUA 2XYUA 3MW1A 2C4GA 3O71A 2WIPA 4B8LA 2DQ7X 3R9HA 2ERKA 3GGFA 5K4IA 5KCVA 3O51A 5LCJA 3QQUA 5L4QA 1K9AA 4JI9A 4L68A 3QQGA 4MXAA 3R73A 5CVFA 5IQAA 5AR2A 1DM2A 1W8CA 2BHEA 5D11A 2WD1A 3HZTA 2PZRA 4MVFA 4S32A 5CU2A 4EOSA 3LXPA 3PA5A 2GS2A 4DA5A 2C6KA 2BFXA 2XS0A 4IACA 5I3OA 1P5EA 3R9NA 5CYIA 2GU8A 3DKCA 2WB8A 3WBLA 5KKRC 3FZSA 3BI6A 4MQ2A 3QHWA 2C6DA 4G5JA 4X0MA 4QQCA 5DLSA 4E20A 2IN6A 2OBJA 3NIEA 1CMKE 4F9BA 3MJ2A 3DBCA 2J9MA 2C6IA 2FUMA 5J1WA 4F6WA 5HNIX 2R2PA 3OZ6A 2JIVA 4W4WA 4F9AA 3D0EA 4XS2A 3JY0A 1V0PA 4WG5A 3QKLA 4MXOA 4CNHA 4EZ7A 4TYIA 5F4NA 3IW4A 5J5TA 5EHYA 4MNEB 3HGKA 4NYEA 3GBZA 2YIRA 3RNIA 5FP5A 2YFXA 3DBDA 4IH8A 1XO2B 2BKZA 3F3WA 3BGZA 2C5YA 3WF8A 4FV9A 2PVRA 1JKKA 3QCQA 4XJ0A 1VR2A 4O21A 4EOKA 3Q2MA 1RQQA 5T68A 3SXSA 3E7VA 5IQCA 5IA5A 3QQKA 4BTFA 1BI7A 5FWKK 5HE0A 3WZKA 4EHEA 2EU9A 5EFQA 4RGJA 5BPYA 4O81A 4IAKA 1NT2A 5DYJA 2ITYA 5AA8A 4R3PA 2FSLX 1AD5A 2V7AA 4XV1A 2QG7A 3LHJA 4DH3A 2XK7A 4S34A 4I92A 3QU0A 4Q2AA 2G01A 3NW6A 4W9WA 3A7FA 3ZLYA 2XBAA 3GI3A 3R8VA 5LMBA 5AUWA 2XIRA 3QC9A 1JAMA 3GCVA 5E8WA 4XEYA 5ANJA 2OXYA 2J0KA 2C3IB 3NCZA 2G2IA 3CPBA 3GC7A 5AR3A 3VUMA 4L52A 1XH9A 3R1QA 4TRLA 4HW7A 2VWVA 2JBPA 3BHTA 3KN6A 3MH1A 4RRVA 3UMXA 3VUHA 4CT1A 3FQSA 4E4XA 3F2RA 2IZRA 5AWMA 3EKKA 3ULIA 3U87A 4Z55A 4FSWA 2C6LA 2WMBA 5BUJA 2W5AA 3FYKX 3LXKA 3MFTA 5T6KA 5IA4A 5IISA 3FI8A 3HV3A 5BVKA 2YM5A 3QRIA 4FKSA 3BELA 3OWJA 4L9IA 4R1VA 3SRVB 3HDNA 2BTRA 2UZDA 3QXOA 4W4XA 3GP0A 3IPHA 4ANQA 3UE4A 4EH3A 5J5SA 5EW8A 3MVMA 5HOAA 4A4XA 2WFYA 2YAAA 4F99A 3FZOA 3R1NA 3R1SA 3W2CA 2O0UA 5IQEA 1Q24A 4DLJA 1URCA 3PJ2A 5AV0A 3W2RA 3Q2JA 2Z7SA 5CEIA 4QTAA 3RK9A 2J6MA 4BGGA 1PMEA 3WE8A 1CKIA 4JAIA 5M44A 4OLIA 5EM5A 4MBIA 3TJDA 4FSRA 2IW6A 3VUTA 3HRFA 4ITJA 4G17A 4M68A 4BDEA 1FGIA 1G8SA 3V5LA 1OKYA 1X8BA 1PF8A 4FKLA 4V01A 3I6WA 4WBBB 4WSQA 3UODA 5ITAA 2A19B 3TI1A 3R7GA 2UZUE 3A61A 4E4LA 2CCHA 4F7LA 3FLWA 5J1VA 3NUSA 1UWHA 4NUSA 3UIUA 3UYSA 3WI6A 4HVIA 1BI8A 4Y85A 2BZKB 3AC1A 3SXRA 3ZFYA 4APCA 4O1PA 5AMNA 3R2BA 4DEHA 3C13A 5M06A 4FNWA 3H30A 4FVPA 4GVAA 2ITQA 5HO8A 4BCIA 5KMIA 3DDPA 4LRKA 3E87A 4R5YA 5GINE 2WMAA 5AV3A 2YM8A 3BLRA 3ZFMA 3OG7A 3UG2A 2GNJA 4PP7A 5JZNA 3NAYA 4ASDA 1YDSE 1XJDA 3VS0A 5LVOA 4R7BA 4FG9A 4IWPA 2CKEA 2QU6A 3NAXA 3U55A 1Y8YA 5TF9A 2FYSA 2H96A 2BMCA 2WQOA 3FHRA 3SV0A 3T3VA 4DAWA 3EHAA 4L42A 2I6LA 4JQEA 2XK9A 3OY3A 4IVAA 2XEYA 1ZZLA 4K1BA 4TYEA 2W5BA 4MH7A 4RPVA 3ZXTA 3HP5A 1Q8ZA 4C2VA 1FMOE 3EQIA 3Q6WA 5H3QA 2GQSA 3BZ3A 2CPKE 3UNJA 2FO0A 4GU9A 4U0IA 2C68A 3DJ7A 3F7ZA 5DE2A 2YN8A 5FTOA 2J0IA 3TACA 4C62A 1Q3DA 3I0OA 4FTMA 4CCBA 4DGNA 4E6QA 3L8VA 1RE8A 2XKCA 1V1KA 5FGKA 1PKGA 3SG9A 2IPXA 1ZYJA 3T9IA 3EFKA 2I0HA 3CTHA 4JXFA 4FV7A 2PL0A 4BDIA 4YTFA 3REPA 1QPDA 2EWAA 3RJCA 3G33A 4KABA 3OW4A 4GW8A 5AIRA 1J7IA 1PKDA 3LKMA 2YABA 3UZTA 2ZB0A 2YDKA 3LFEA 3OUKA 5CU4A 4LRJA 4ANNA 4GKIA 3OMVA 1JWHA 5LMKA 5EI2A 3FHIA 3HMNA 4QMUA 4EK6A 3NVMB 5CEOA 3UNZA 3HP2A 5BMMA 3BCEA 4W9XA 2AUHA 2RG6A 4FG8A 2CLXA 4RZWA 4ZAUA 1PXOA 2QR7A 4C4IA 3LAUA 1YDRE 5FUTA 1OBDA 4FV4A 1VZOA 3MIAA 4DE4A 3S1HA 2HELA 3FEGA 4FTCA 4AN3A 4B6LA 3PVGA 2Z7RA 2R3PA 3OC1A 5EM6A 5HESA 4C4GA 4FF8A 2XNGA 4TPTA 4RJ8A 1Z9XA 3Q53A 4QMSA 4UBAA 3JXWA 2OXDA 3BLHA 5DEWA 5EYMA 5CSHA 2Y4PA 4FNZA 2JLDA 5IA1A 3GENA 2C3JA 5KKRB 4A4OA 3EB0A 2F4JA 2HAKA 2UW7A 3Q60A 4J71A 3PZEA 3P86A 4PMSA 2YEXA 4C59A 2HY81 4RX9A 2DS1A 3JS2A 4I0TA 2XBJA 4PNIA 3CY3A 4U40A 3MA3A 5JEBA 5KX8A 5HKMA 3NUPA 1B6CB 3PWDA 3RZFA 4BBMA 3I0QA 1RDQE 4NM3A 2WMSA 3TDVA 2C0TA 1YWNA 2W96B 4FEWA 2B7AA 4IADA 2VO7A 3BX5A 4JS8A 3M42A 3BV3A 1OM1A 3DBEA 3ZEPA 3DK3A 4RVLA 2VTHA 4HZRA 4CKJA 5JT2A 3AOXA 3IW5A 4TYGA 4K9YA 5AP1A 1XWSA 3MI9A 3TIYA 1JLUE 3BHVA 2IVSA 4RIWB 2JGZA 3VS1A 3D5WA 5J9YA 4FX3A 4BYIA 4CFWA 3WZEA 3LFSA 4ZZMA 4DFNA 4KKEA 1DAWA 3GU7A 3PIZA 5CTPA 3DDQA 3EFWA 4NM7A 2WO6A 5JRQA 2WHBA 4D2WA 3SG8A 5I5ZA 2Y6OA 3V5TA 5L6WL 5DA3A 1OUKA 5HLPA 5L2SA 3QX2A 4I41A 5C8NA 3UTOA 4P5ZA 5AP7A 3FMKA 3R0TA 2GTNA 3R9OA 4AZSA 4JJRA 1U54B 4FT3A 5HG8A 3O17A 3LFNA 4FI1A 1MRVA 5FD2A 3RPRA 3P79A 4ZMFA 4KB8A 4LGDA 2P33A 3WIGA 2X7OA 3MPAA 1WBNA 4JDKA 4PL3A 5HE3A 3R1YA 3TZMA 1KE7A 3ATTA 4AWIA 1TQMA 4IFCA 4YJVA 4C61A 5GHVA 4X6RA 2ETKA 5CY3A 2PMOX 4JX7A 5FEEA 5CAUA 2YJRA 5IDPA 4C34A 1HOWA 5L6PA 2YIWA 4I23A 4Q9ZA 1PMUA 4F65A 5JK3A 4PUZA 4LQMA 1YXTA 1IR3A 4YZNA 3C51A 2CLQA 1JBPE 3MFUA 4FE2A 2WQEA 2PZIA 1V0OA 2RFEA 2R3LA 3E8CA 4JBOA 5DNRA 2PUIA 4R5SA 3A60A 3GB2A 4WKQA 3PSCA 5E1EA 2O3PA 4AX8A 3TUDA 4ZS4A 2IWIA 3IONA 3CR0A 4M3QA 4CFFA 3U6JA 3QFVA 4YBKA 5FEQA 3HAVA 2Y0AA 1XH5A 3ANRA 2VTAA 4IVDA 4M69A 1UKIA 4EKLA 5FTQA 3QYWA 2C6EA 1W7HA 2BTSA 4EHVA 3DNDA 3NNUA 2LAVA 4KBAA 4J8NA 4F7SA 3EN4A 4FV6A 4DTAA 3OBGA 4RX8A 2W1FA 3R8LA 2E9VA 4H3QA 3W55A 1GIIA 4BDJA 3ANQA 4XG7A 5HCZA 4AZEA 3QA8A 1KE6A 3EMGA 4ZTSA 4LM5A 3DFCB 3QTIA 3HNGA 3LQ5A 4EONA 4YJPA 3CXWA 4XBRA 2PUPA 2W4JA 1YKRA 1B38A 1JKLA 3E63A 3KKVA 5A46A 3DXPA 3Q4TA 3TXOA 3C1XA 3HEGA 2WXVA 4GIHA 5HG5A 1H1QA 3E8DA 3POOA 4QPAA 3VAPA 4D0WA 1KWPA 3OTVA 4MXXA 5M4FA 5DR6A 4YR8A 3RPVA 3IDCA 1RW8A 4BTMA 4DFBA 3NEWA 5EOLA 4MNEA 5CQUA 2ZJWA 1WBWA 2O8YA 4RX7A 3BRBA 5JQ5A 2XIXA 4LG4A 4S33A 4JDJA 1MRYA 1B39A 4BCKA 3QD3A 4U6RA 4F6SA 1NA7A 4L00A 3QHRA 3KXNA 4GUEA 3BHYA 2DYLA 4OT5A 1H0VA 4F63A 3ALOA 2PZYA 1IASA 3ODYX 3R8UA 3QTUA 3TNWA 4A9RA 4CYIA 3ORTA 2GSFA 2OSCA 2IZSA 4AF3A 1TQIA 2PVKA 1YXXA 3NNXA 4F09A 3GQLA 3OUNB 5EOBA 4M12A 3HMMA 3H9OA 3TKUA 3OWLA 2BDFA 5LWNA 2VZ6A 3G15A 2HENA 4U42A 4D2VA 4O7ZA 5FDXA 5E90A 1UWJA 2RSVA 4L43A 4AE9A 3WF7A 2UW5A 4YMJA 4J52A 4C57A 3DQXA 3D7ZA 3C4WA 2QO2A 3SVVA 2OZAA 4XOYA 3A8XA 4CT2A 4UZDA 3V8WA 5LVMA 4ZP5A 4GU6A 2W9ZB 4J99A 5BUEA 4XHKB 3F66A 4U43A 4Y73A 4QMYA 4QP1A 4E5AX 4UWBA 4BWXA 1W82A 4TZRA 4D4YA 3D94A 4HNIA 3R71A 1PRYA 2HZNA 2XYNA 4EHZA 2OO8X 4ZY6A 4M66A 5ETFA 3MVLA 5L2QA 3GCUA 2W4OA 3IW8A 1YI4A 4FZ6A 2VNYA 5HVYA 3ZOSA 3ACJA 4FEQA 4ANMA 4QMQA 3P7BA 1T46A 1W0XC 4ZTRA 4RA5A 2ZM1A 3UOLA 5AX3A 4IZ7A 3LFCA 1HCKA 2H34A 4ACMA 4M14A 4U8ZA 4UXQA 4F9CA 1Y57A 3RP9A 4UV0A 5IMXA 3TCPA 4UMTA 3W1FA 1JQHA 4V0GB 3EQHA 1QPJA 4GS6A 4BCPA 5BUIA 4FICA 3KN5A 4LFIA 4E26A 4RIYA 5AR5A 4U45A 4BI1A 4ANOA 4FEVA 4QYEA 2XMYA 3ZUUA 4BZNA 4UALA 3DGKA 1XBCA 4PTEA 5HIBA 2HZ0A 3UZPA 3IG7A 3D7TA 4EI4A 5EDQA 2GFSA 4TL0A 3BYOA 4EYJA 2RKUA 4O22A 3F3ZA 3GOPA 3L8XA 5L8KA 4JG6A 3DK7A 1WMKA 1PXIA 2OF2A 2QOKA 4OTWA 4BIBA 4U79A 5IQHA 2Y6MA 2ZMCA 3EYHA 3F61A 1XBBA 2W1DA 1R1WA 4FIJA 4GJ2A 1LR4A 3DAEA 2C5NA 2OJIA 3QAME 3UQFA 3QYZA 3EN9A 4O0WA 3FQHA 3HUBA 3I1AA 5H9BA 5HVJA 5C8MA 5BVWA 5J79A 2W9FB 2W1GA 2P3GX 1Q3WA 1T45A 3ACKA 5JH6A 4NCTA 4IWOA 5HGIA 3OF0A 2J50A 1H28A 3R22A 4RJ7A 5CANA 2YM7A 4RWLA 4IQ6A 5JMSA 2X2MA 4LUDA 3BYUA 4FTUA 4DH7A 2PVMA 5IH4A 5ACBC 2BRNA 4B0GA 4YURA 4E4NA 1Q62A 4IJPA 4QOXA 3CY2A 3QRTA 3W10A 4E6DA 2Z02A 2VWIA 1M2QA 3PSDA 3ZBXA 4C4FA 3R28A 2UVXA 2BRMA 5IU2A 3OCGA 3ORZA 4USFA 1Z57A 3CTJA 3NWWA 2BR1A 2EB2A 4L3JA 5AM7A 2RIOA 4WG3A 4BRXA 2YLFA 2UW4A 3VS6A 4OBPA 4XV3A 2ITPA 4W4YA 1NVQA 3LPBA 1JOWB 3P0MA 2JFMA 2OIQA 4WNMA 1GY3A 2GS7A 3U9NA 5D7VA 4OAVB 3L8SA 3ORMA 2C3LA 3ROYA 4LOQA 1SMHA 2KTYA 3C0IA 4YZCA 1LEZA 2YIXA 2WMXA 1H00A 2B1PA 3C50A 2I1MA 3IGOA 3P23A 4I5HA 3H9RA 3HRBA 4MBJA 5CU0A 3QTSA 1Y91A 3DB6A 3BKBA 1NVRA 4MF1A 2DWBA 1E1XA 4NTSA 2C5VA 4DFLA 4FTQA 3AMYA 4LUEA 1U59A 3HLLA 4PPAA 1YW2A 3NGAA 3QQHA 2PU8A 4EOMA 3GU4A 4TY1A 2C1BA 2E9UA 5FM3A 3RZBA 1WAKA 2RFSA 3COMA 3ZC5A 2R64A 4E1ZA 2CKOA 4GIIA 3QGWA 5DRBA 2J5FA 5JN2A 2OJ9A 3FL5A 4UYAA 4O7YA 4RQVA 2VTPA 2IO6A 2QOLA 4O82A 3RNYA 3LFFA 2RFDA 1Q5KA 4KIQA 4FT7A 4RC4A 3DAJA 4BCHA 5HG7A 4HYHA 1K2PA 3BU3A 5AADA 3TZ8A 1KSWA 3AC3A 3EN7A 3B8RA 3OY1A 4FEXA 4FZAB 4RWKA 4IB5A 3QTQA 4I22A 2J0JA 3VW8A 3C9WA 4O86A 4JNWA 2V62A 3DA6A 5CNOA 3PJ8A 2XM8A 3SW4A 4B7TA 3SQQA 5M07A 4FNXA 3GFEA 4FIFA 3C0HA 4I21A 1LEWA 5D1JA 5AP0A 2F7XE 3DQWA 4NCTC 4HCTA 1XH8A 4QNYA 4JAJA 4J1RA 5L8LA 3EKNA 2W7XA 2V55A 5E9EA 3NVKI 3UBDA 4GMYA 4RLKA 4IEBA 3EYGA 3FYJX 5JFVA 2PE1A 2VTTA 4OBOA 5I9VA 3W8LA 3F3UA 3PJ1A 3K3IA 4AN2A 2X8EA 5CF6A 5CSWA 2ZAZA 4I6HA 3FDNA 3W32A 2Y7JA 5CEPA 5CSXA 3NUXA 3AT3A 5CEKA 3SX9A 2Q0NA 3DLZA 4J8MA 4O0XA 3I79A 3CGFA 4RMZA 4O6LA 3PDTA 3MH3A 1DI9A 1QMZA 2VX1A 3HX4A 4LMUA 4UMQA 4XLIA 4F7JA 4EK4A 2VTJA 2PVNA 4FUXA 2X7FA 4PF4A 2HZ4A 1IA8A 1OL7A 4FODA 5IDNA 5KZIA 4IE9A 5J9ZA 1J7LA 2RGPA 3KL8A 3VO3A 2YLEA 3OXIA 3KCKA 4I6BA 3DBFA 5FP6A 2PYWA 3OXZA 3LOKA 4LOOA 4MF0A 3AMBA 4P4CA 4FZ7A 2W05A 1JKTA 4L8MA 3KMWA 2F49A 4CCUA 3N4TA 3HV7A 3UDBA 1VEBA 1XH6A 5DT3A 4JDIA 3POZA 3S0OA 4CV9A 4O7SA 2E9OA 5B2MA 3CD3A 4RVTA 3EIDA 1OBGA 3ZSIA 2R3NA 3RBWA 4L6QA 3AT2A 3W2QA 1SYKA 4NJDA 3OCTA 4U3ZA 2R3JA 5A6OA 2UZNA 4C7TA 3K5UA 1ZMVA 3PWYA 5LVNA 3KA0A 3PY0A 4FIGA 4AG8A 5HO7A 4Q9SA 5AV1A 1UVRA 4UWYA 1WVWA 3WZJA 5EW3A 5K4JA 1U54A 1XBAA 2GHMA 5B2KA 4O0RA 5HNGA 4M13A 2UVYA 4TYJA 3RMFA 3FSFA 3KY2A 4MXZA 2BIYA 5DHJA 3WIKA 4AACA 4B4LA 4EJNA 5A9UA 5IQIA 3KU2A 4ZEGA 4PDOA 2F2UA 5DIAA 5LXMA 5E8XA 4YTCA 2OXXA 3LLTA 4YJRA 2Y8OA 4FSUA 4FVRA 4ZSGA 3LMHA 4L53A 2X7GA 4BI2A 4E73A 5C8KA 4J97A 5IEYA 3S95A 2YDJA 4EK3A 4BFMA 4ACCA 2R3GA 5FEDA 5KBQA 4K33A 5AFVA 1XQZA 2VWXA 4FTTA 3S3IA 4M69B 2C6TA 4XV9A 2BRHA 3LM0A 3HDMA 4FSYA 4F6UA 1NY3A 3DLSA 4CTCA 3EN5A 5BVEA 1AGWA 4XNEA 3VC4A 4BBEA 1PXJA 4LV8A 5AAFA 4CFUA 3EQFA 1S9IA 3ZZEA 1QPCA 4Z7GA 4O0SA 2BZHB 4ZTMA 1ATPE 4JQ7A 4V05A 1ZWSA 3FL4A 4IWDA 4BY9E 4JBVA 3DTCA 3BPRA 5ANOA 3GXLA 1WBSA 5HLWA 3KRWA 3FLZA 4FKIA 4B8MA 3V5PA 2O64A 3LLAA 4GT4A 2CGWA 3OVVA 4X2KA 1VJYA 1PHKA 5HICA 2R3KA 4FMQA 1M7NA 2BRBA 5FXRA 4AGUA 5F95A 2YWVA 5DR2A 2IW9A 3KULB 2PUUA 5CWZA 3SKCA 3UQGA 2Y4IB 2OIDA 2UW6A 2XNMA 4ZY5A 5HTCA 4XRJA 4QQ5A 3JY9A 1LPUA 4LMNA 4MWIA 2VO0A 4MD8E 3OP5A 4IM2A 2P2IA 1YI3A 3PA3A 2YAKA 3UVPA 2QO7A 4C36A 1YXUA 2QO9A 2PVYA 2FH9A 3IK3A 2YM6A 3ORKA 4MNFA 4IZYA 1VYWA 4QTBA 1J3HA 5CVGA 4GH2A 2R4BA 3FAAA 3VBQA 4MHAA 2ITNA 1SM2A 4G16A 4BZDA 2GNHA 3G6HA 5I3RA 3ZSHA 4JDHA 3PVWA 5C27A 3VULA 3BBWA 3P9JA 5AP4A 5ANDA 3PJ3A 1WFCA 5E92A 3F5PA 2XNEA 2Z60A 4H58A 2OZAB 4QP9A 3THBA 2I40A 1QCFA 2ZV9A 5GIPE 4IVCA 3PP0A 2UW0A 2QLUA 3RWPA 1U4DA 2YZAA 3RK7A 1IG1A 3B8QA 3G0FA 4UN0C 4IMYA 5FBOA 4BICA 4FYNA 3CQWA 3R6XA 2REIA 4FL3A 4QTDA 3AC8A 4A9TA 5ANEA 3VUDA 1KE5A 4BDCA 4JBQA 4X2NA 2X1NA 3FXXA 3GU5A 5J95A 3EJ1A 1P4OA 3WE4A 5AJQA 5K0KA 4PV0A 3P4KA 3SW7A 5M51A 2OFVA 4PNKA 1PXNA 1Q4LA 4HGEA 2R3RA 5HO6A 4GT5A 4RIYB 1WBVA 4YLLA 4I4EA 4YJOA 3IQ7A 4G34A 5EI8A 3U9CA 4YC6A 3EQBA 3D7TB 4MYGA 2J4ZA 1PXMA 4JQ8A 4BHZA 1BYGA 4U3YA 4V0GA 4Z3VA 3ZO2A 1GAGA 3LFBA 1OIUA 4XBUA 4GFGA 5CAOA 5HBHA 3AD4A 3QUPA 3AD5A 4AFJA 4DH5A 3BYVA 3D83A 4KS8A 3DJ6A 4NM0A 1OKZA 3B2WA 4QMWA 4JG8A 1G3NA 3PVUA 5I9UA 1G8AA 1UA2A 5J9LA 3O23A 2UZVA 3W2SA 5BVDA 3QRUA 4GFOA 3LQ8A 3PVBA 2OK1A 3DBQA 2WMRA 3KCFA 3GC0A 3PIXA 3QTXA 2QHMA 1OMWA 3DTWA 3IGGA 3TZ9A 4IX4A 4DGLC 5E8SA 4C02A 1YHSA 1M14A 3ZBFA 5JGAA 2CGVA 2WMVA 3M11A 4IJ9A 4KRDA 3BWFA 5DT0A 1ZOGA 2B9FA 2JAVA 3KF7A 5H2UA 4CVAA 5JFWA 4QMOA 4K18A 4M0ZA 4M0YA 4IDVA 5EK7A 3VUGA 3O2MA 1R3CA 4HPUE 2J0LA 3FWQA 4WG4A 3PPKA 5F20A 5DRDA 4NSTA 4QP2A 5GNKA 1DAYA 4XMOA 3DXNA 1M52A 3V5WA 4A4LA 5HIDA 3CQUA 3Q6UA 1CDKA 1TVOA 4FIHA 3P78A 3SC1A 2J7TA 5KMNA 3IDBA 4Z9LA 3TT0A 1FMKA 2OIBA 3C4EA 2GNIA 3MH0A 4HGLA 4EWHA 1PYEA 3CBLA 2UZBA 3FUPA 3PY3A 3LE6A 4MK0A 4YNOA 5GJDA 3ZU7A 3U4WA 4BDGA 4JOAA 3K2LA 4XCUA 4ZLOA 2B9JA 3FJQE 4ZSJA 2O63A 3F3VA 4O2PA 3VJNA 1SVEA 1Z5MA 3KB7A 4EZ3A 2QOOA 1O6LA 4BL1A 5FRIA 5ETAA 2V7OA 3BU5A 3DOGA 5BYLA 3U4UA 3UGCA 4FL1A 3R8ZA 4Z7HA 1ZOEA 4FT0A 3H4JA 5CAQA 4YBJA 4FTOA 5M56A 2IVUA 3FZPA 3COKA 1ZY5A 3MVHA 4OTPA 5HG9A 2AC5A 1GZKA 3V51A 3UPXA 4ACDA 4R78A 3GNIB 1MQ4A 3F2NA 1F3MC 4YNEA 3OROA 4P90A 3IOPA 3IECA 3HAMA 3LZBA 3QLFA 4D9TA 5E91A 5J8IA 2OICA 3N4VA 4M7IA 1LP4A 4LGHA 3HV5A 4OT6A 4O27B 4CMTA 4X3FA 3FPQA 1MP8A 1Y6BA 4X2JA 3LCTA 3ORXA 1XH4A 2WTCA 4F0GA 2PUNA 2ITZA 4J98A 3TTIA 2JDTA 3SGCA 1ZYDA 2GQGA 3A8WA 4F70A 3VW6A 2RL5A 4YLKA 2I0YA 3OD6X 4R6VA 4PL4A 4FV3A 4CQGA 5DN3A 3D5XA 4RLLA 4FBXA 4QO9A 3UZRA 3FXZA 4RA4A 4O7NA 3VJOA 1OL1A 3RM6A 2JDRA 3DS6A 2ETMA 2PE2A 3PTGA 5M55A 3LMIA 4KKHA 4GUBA 4DC2A 5AM6A 3HA8A 2UW3A 4OTDA 1FVTA 2QKWB 4ZLYA 3RKBA 4FV8A 4PX6A 4YZMA 5ANGA 4AOIA 4CXAA 1ZAOA 4H39A 4JVGA 3KRXA 2OGVA 2V22A 4CQEA 3ZM4A 5KO1A 4DTBA 5IQGA 3DZQA 3R7VA 4AXAA 3QZFA 3FMJA 5JKGA 2CCIA 4FTNA 3O8UA 3IO7A 3TZ7A 5HX6A 4G1WA 4R77A 1WVXA 3C5IA 3MESA 3NYXA 3RK5A 3R7IA 3OWKA 3AMAA 4M67A 3A7GA 2ITTA 4XH6A 4ANBA 3JVRA 3VRYA 4J53A 2WELA 4YHTA 1CSNA 5HCYA 2HIWA 4PDPA 3U6HA 4NFMA 4YJNA 5DBXA 1YWVA 3AGLA 4DN5A 4E6AA 3LVPA 4KBCA 1GOLA 3D2KA 3QD4A 4YTIA 3IW6A 4D5KA 3UP2A 4QP6A 4NW5A 5L8JA 2ZDTA 5DEYA 3V5JA 2R3HA 1K3AA 4EL9A 2C0OA 3BGPA 3F5UA 4FR4A 3KF4A 1BLXA 3TUBA 2VWZA 1UNLA 1OUYA 2NO3A 3BLQA 3KRLA 4C8BA 2YWPA 1ZLTA 3AXWA 1WBOA 4ZZOA 2XF0A 4FKWA 5L6OA 4BCMA 3IKAA 3F9NA 3R2YA 3RAKA 1P2AA 3A7HA 3I5ZA 4DGOA 4O7VA 1U46A 3VUIA 4FA2A 3O8PA 2V5QA 4FGBA 5HBEA 4AGWA 2PVFA 3KK8A 4O7WA 4FTJA 1YXVA 1R39A 2CNUA 4X3FC 4GVJA 2HCKA 4DINA 1KV2A 1TQPA 3KXMA 1H27A 1OIQA 4K77A 5M53A 4AUAA 4GK4A 2XNNA 2EVAA 4CZYB 3HA6A 3SXFA 4EORA 1A06A 4GEOA 4GK2A 4ZIMA 3E8EA 4ALWA 4G5PA 4GL9A 4HGTA 4O91A 2W1ZA 4RJ4A 4WSYA 3NUYA 5IQBA 2BDJA 4N70A 4WRSA 4TW9A 5DH3A 4G3FA 4DFXE 4NL0A 3LCOA 3R8MA 2ITUA 4YP8A 3RPOA 3DV3A 2XNPA 2W06A 3C5UA 2VTIA 4ZTLA 4QRCA 4MD9E 3NLBA 2Z2WA 2HWPA 3ORIA 4DFYA 4FZDB 5IA3A 3CKWA 1SNXA 3FZ1A 4F64A 1IAHA 5E7RA 2Y9QA 3PRFA 2XB7A 3FXWA 2XH5A 4YO4A 2E9NA 2X6DA 3OEFX 5C9CA 5KNJA 3ZCLA 4FV1A 5HORA 3MN3A 2VGPA 4DEBA 2PVHA 2GFCA 3E3BX 4BIEA 4ERWA 4G3GA 2R7BA 5TOZA 4I93A 3IOKA 5CENA 5AR7A 2I0VA 3E8NA 3F5XA 3HMOA 3MY5A 4ITIA 4C3FA 4K0YA 4AA4A 2UUEA 5KMLA 2R3OA 1ZYCA 4QMLA 3UO5A 2ZYBA 5E8ZA 3Q9YA 2BRGA 4BF2A 1OIRA 2HK5A 3FQEA 3MGYA 5EHOA 4EOJA 4FKVA 3ZSGA 5EDPA 1WBTA 3LJ0A 2B9HA 3D5VA 2QODA 4G3CA 4AFEA 4QMNA 3JVSA 2CN8A 3ET7A 2PPQA 4A7CA 4JR7A 3AT4A 2VWBA 2CDZA 4C3RA 1OIYA 1SVHA 4AZVA 2ZV8A 3KULA 3MB6A 5H8BA 3U6IA 4L3PA 3Q3BA 2BHHA 5GZAA 2HOGA 3FKOA 5LVLA 3GFWA 4E7WA 5GIOE 4RVKA 4L67A 5HU9A 3PXZA 4ZJVA 4FVQA 4BKJA 4H3PA 4DEEA 5M4IA 3EOCA 3QD2B 4BCFA 3FMDA 2WTKC 4EH5A 2WU6A 2UZTA 1OECA 2XJ1A 5F94A 3MFSA 1OKWA 2JDVA 4KKGA 3ZO1A 3N4UA 4R3RA 1NW1A 1BL6A 2AC3A 3FY2A 5C26A 4H1MA 2OW3A 3MTLA 2GNFA 3QKMA 2XVDA 4BCJA 4TWNA 3BQCA 4ZXTA 4I5CA 4AZFA 2XKDA 5CAVA 5H8EA 2YITA 4K8AA 3VVHA 3KQ7A 4ASEA 3EL8A 2WEVA 4FC0A 4RT7A 2C5XA 2ZM4A 3O0GA 4XG9A 4ZSEA 4YUQA 3BEAA 5C01A 4GFMA 3EQPA 2FGIA 3O7LB 2QURA 2XK3A 5TE0A 2P0CA 3D4QA 5C1QB 3CCNA 4NW6A 4YC8A 5FLFA 1PW2A 2OF4A 4ID7A 2VTMA 3LMGA 4XRLA 2QHNA 5EW9A 1ZY4A 1TKIA 4YZDA 3UC3A 4AU8A 4NIFB 5FXQA 3V8TA 2O5KA 2XJ2A 3CEKA 2X4FA 3I4BA 4MXCA 4U41A 3V01A 2JKQA 4NFNA 4DEGA 3PFQA 4OTGA 4EC9A 4DFUA 2YISA 1ND4A 3R9DA 5CASA 4EQUA 3NX8A 4YC3A 3WF5A 4BWPA 4DITA 4UMUA 5ICPA 3DK6A 5AIKA 4BGHA 4QMVA 1WBPA 2UW8A 5BQ0A 4DH1A 1XR1A 1UV5A 2XCHA 3ORPA 3MWUA 5CSPA 3FMEA 3NZ0A 3QGYA 4KUJA 3FMHA 4FK3A 2YIYA 4UB7A 4PRJA 4UWCA 4NWMA 5F9EA 2C1AA 2IW8A 4GKHA 3ZUVA 4LRMA 3I60A 2CGXA 4G3DA 5IH5A 4IAYA 5CX9A 4D2TA 2ZMDA 2UZOA 3GU6A 3QCSA 4XP0A 3EQDA 4EOPA 2XIZA 4O6EA 5EH0A 3ZFXA 3BYSA 2XKFA 2ZOQA 4XUFA 4AS0A 4BCQA 4RIXB 2W1HA 5IEVA 3HUCA 4DBXA 3MVJA 3COHA 4HGSA 4PMMA 2C47A 4Q5EA 3DCVA 2Q0BA 3LFDA 4QMTA 3PG1A 4QYFA 4UMRA 4N4SA 3RINA 4QMZA 4WUAA 2Y4IC 4D28A 4TNDA 3QQJA 4FSQA 1Q8TA 3U8WA 5AUTA 4CG9A 2YDIA 4RJ6A 4N57A 3DKOA 3ZRKA 4QPSA 3CE3A 3NNVA 2RF9A 3ZH8A 3KRJA 1RJBA 3I81A 4HYUA 5L3AA 5D9HA 3NUAA 2PK9A 1GZNA 2O65A 3QQLA 5EYKA 3VN9A 4R3CA 2GNGA 2QCSA 5BVOA 3F69A 1ZYLA 3FZTA 3A99A 2OFUA 4BB4A 2JC6A 4WT6A 4ANSA 4HYSA 5CT0A 3R9RA 3HYHA 5B2LA 4LGGA 3W2OA 1GZ8A 5BNJA 5GJGA 5K9IA 3FC1X 3JR1A 4I5PA 3WZDA 1WZYA 1KUTA 4AOTA 5IQDA 4I1ZA 3W33A 4G6LA 4E3CA 4IHPA 4F4PA 4JR3A 2V0DA 4EK5A 4IB0A 3UMWA 4V04A 3SAYA 2BZIB 5IKWA 2ZB1A 3QXPA 4CLJA 1JSVA 4KD1A 3R7YA 3QL8A 4MX9A 2CNVA 2OI4X 4XG6A 3CLYA 3D5UA 2C0IA 3F2AA 3I7CA 4N6ZA 4O7LA 1QPEA 5IUGA 3T9TA 3QRJA 5AUYA 3LCDA 5A14A 2C3KA 1W83A 4DCEA 5LMAA 4X3FB 3HRCA 3KXHA 3CPCA 3BIZA 4FOCA 3ZDIA 5CNNA 4O0TA 5J7HA 3ZXZA 5ANIA 4CRLA 2IVTA 3RVGA 3E3PA 1BL7A 5E8YA 1PXPA 3ETAA 1OI9A 2VX3A 2WKMA 5CS6A 2WMQA 4L46A 3OEZA 3ZLWA 5LCKA 2LGCA 5EM8A 3TUCA 3LJ2A 2YCSA 3BV2A 4RQKA 1CTPE 2GPHA 4KNBA 5DR9A 2EXCX 3KMMA 4ALVA 4O0VA 4G9RA 5CEQA 1OPJA 3GVUA 5AAGA 4ZMEA 4Z16A 3E92A 3ZRMA 3KK9A 4PDSA 4FKTA 3R01A 4KBKA 4RJ5A 5IA2A 3UG1A 3G6GA 4PL5A 4BCOA 4NZWB 4WNOA 2I0EA 3PYYA 4Y5QA 3KREA 3V3VA 1H01A 4MWHA 1GZOA 2PULA 4CG8A 1OPLA 5CLPA 4BYJA 5LJJA 3UOJA 4FZFB 1YOLA 3NPCA 1O6YA 3HKOA 4OGRA 3OHTA 3Q9WA 1OPKA 2B4SB 4FKJA 4BDFA 2P55A 4II5A 4XV2A 4CD0A 2BAQA 3Q4UA 5JFSA 4FKGA 3HVCA 2R3IA 4R7HA 4P7EA 4U81A 3GEQA 3MFRA 4OBQA 4HVHA 2PWLA 2CNQA 1LUFA 5TT7A 2XA4A 3DNEA 3GQIA 3ZONA 5A3XA 3EQGA 4U7ZA 1OVEA 4IAAA 3FBVA 4IB1A 4ITHA 3V04A 4BWKA 1OL6A 1ZYSA 2YCQA 3UO6A 4EH4A 4FT5A 4Y72A 2JDOA 4ACGA 4H36A 3P1AA 3L1SA 3PY1A 3CJGA 4QMXA 4JT3A 4N0SA 3WILA 4F1MA 5HBJA 4DH8A 4OTHA 2ONLA 3RCJA 1PXLA 4F9YA 4TWOA 4C0TA 4QPMA 1ZZ2A 3EQRA 2J51A 4BR3A 5AUUA 4DT8A 5LWMA 1O6KA 1Q8WA 1Q99A 2QOQA 4EQCA 2PTKA 5HU3A 3EN6A 5M08A 4CGAA 3NW7A 3CS9A 3QX4A 5IH6A 4RWJA 2YA9A 4CRSA 4RFYA 2VTOA 4D4RA 2WTKB 1MQBA 2G2FA 4TWPA 3VIDA 2XJ0A 2F2CB 3C4FA 1DI8A 2B0QA 2R3MA 1J1BA 1DS5A 2C6OA 2OU7A 3LFAA 5D10A 3RPSA 3L9LA 5CZIA 4M84A 3LCSA 2W1EA 3ODZX 4U9AA 3MTFA 4WNPA 4D4VA 4TT7A 2BPMA 2JKMA 3E5AA 3KXZA 4DTKA 3OFMA 2WTIA 3DKGA 4RG0A 2OG8A 3HMPA 3OTUA 4MTAA 2ZVAA 2F57A 2X8DA 2ZDUA 4KINA 4NU1A 4AZWA 3DY7A 4W4VA 4CV8A 1PXKA 2PSQA 1J91A 2WTVA 4JBPA 1H07A 2BZJA 3Q04A 2HZIA 5LQFA 3VUKA 4WOVA 1E1VA 3DPKA 4AP7A 4NM5A 4DEIA 1GNGA 3CC6A 4IZAA 3PUPA 2WTDA 2B54A 2Z7LA 4UY9A 5HTBA 5M4UA 5AV4A 3KRRA 4IZ5A 4KIOA 4K11A 4C4HA 2VUWA 3D9VA 1H4LA 4ZTHA 4ZS0A 4I0RA 3F88A 5E8VA 1JSUA 3QCYA 4C35A 4FTAA 4FSMA 4DGGA 4EH7A 4EOIA 5M09A 3H10A 3TJCA 3AC4A 3CD8A 4GYGA 4MKCA 3TNHA 4DCAA 2YIQA 5FBNC 2BROA 3RGFA 1IAJA 3KVWA 3A4OX 2GTMA 2VO6A 3H0YA 2IJMA 4FV5A 4EQMA 2GCDA 2OJGA 2WZJA 4YO6A 4JX3A 3FC2A 4BDHA 2GHLA 3A4PA 3WF9A 1Q97A 4B9DA 2P4IA 4E6CA 1UU8A 3CKXA 1YI6A 2NP8A 2HY0A 4KA3A 1BUHA 2BCJA 4EKKA 3I7BA 4OAUC 5AP5A 5F1ZA 1CKPA 4XP3A 4GCJA 3NCGA 3GUBA 3TV4A 3ZO4A 2R7IA 4AE6A 2ONLC 5CVHA 4CMUA 3FLYA 4FIIA 4TN6A 4EHGA 2VTSA 5K0XA 3NYVA 3Q9XA 1UU7A 1PMVA 2ESMA 5EI6A 4HVDA 5HTIA 2OH0E 3FY0A 1I09A 5IEXA 5EM7A 2ITVA 3AC2A 4EYMA 4BTJA 3TEIA 3V8SA 4BN1A 4C3PA 4AT4A 4PMTA 4DEAA 4AW5A 4ZTQA 3E93A 2YZLA 4YTHA 2QLQA 4FKUA 4PTGA 3NR9A 4W8DA 3R7EA 1PJKA 2XNBA 4QQTA 5A54A 2A0CX 2WNTA 3L8PA 4BC6A 2NPQA 4IAZA 4EBWA 4RX5A 5HE2A 4ZK5A 1FVRA 3KFAA 2B52A 3QRKA 5HEZA 5DPVA 3UP7A 3MB7A 3MSSA 1M17A 3R21A 3BHUA 4FSNA 2G15A 2GDOA 3HECA 5CXHA 4XOZA 4S30A 3ZUTA 3FPMA 1OB3A 3BBTB 3Q4CA 4JRVA 4YHJA 2FSTX 3EH9A 4YJSA 4S2ZA 3S4QA 4U80A 3UYTA 3MPTA 2FSMX 4IB3A 5AV2A 2G2HA 4FKPA 5M57A 2A27A 1KOBA 2WOUA 3UPZA 3TV7A 2JFLA 2XUUA 1FOTA 4BCGA 3AG9A 3HL7A 3F6XA 5HLNA 5IA0A 4EOQA 3NRMA 3NUNA 4O7RA
chains in the Genus database with same CATH superfamily
1IEPA 2XKEA 3VF8A 1OITA 4RJ3A 2HXLA 4UX9A 2W0JA 1M2RA 3FKLA 4NKAA 2QQ7A 2IVVA 5C03A 4PMPA 2A4LA 2OJJA 3EFLA 5CF8A 2X9FA 4O0UA 5KMOA 4H05A 2YACA 3QTZA 4QP4A 3PIYA 4EH9A 1ZRZA 3PE2A 3S2PA 2H9VA 3QCXA 4FK6A 1R0PA 4S31A 4NIFA 2NRUA 5H8GA 3VBWA 3U54A 4HJOA 3Q4ZA 4BDDA 3GU8A 3KXXA 4IBMA 2ITWA 4O2ZA 4YZBA 4EWQA 3ZDUA 4BVUA 5E8UA 4AZTA 2X39A 3FKNA 5LARA 4YPSA 3E88A 1JVPP 2J0MB 3MY1A 4ASZA 4XX9A 4C38A 4EEVA 1W98A 5KE0A 5I4NA 1U5RA 3ZMMA 3QZHA 4QQJA 5AR8A 2FVDA 5CU3A 4AW0A 4EUTA 4IXPA 4E8AA 3VF9A 4O83A 5AUXA 3VBTA 2BAKA 1CM8A 2OKRA 2EB3A 3R63A 3RAWA 1P14A 2WPAA 4IC8A 5B0XA 5KMMA 4FTRA 5CQWA 5DMZA 5IF1A 1WVYA 1J7UA 1PMNA 4D5HA 5G6VA 5CI6A 3TNPC 3ZEWA 3QZIA 2QG5A 4MEDA 4F9WA 4CFMA 3VS3A 5HVKA 1S9JA 3R7OA 2JKOA 4CMOA 2O2UA 4EBVA 1YRPA 1BX6A 4NH1A 3TV6A 4RFMA 4RIXA 3ZRLA 3R7UA 2J2IB 5IUHA 2XANA 4FYOA 4O38A 5BVNA 4R1YA 4BDAA 3T8OA 4EC8A 2WMUA 3PJCA 1YDTE 2W1CA 3DJ5A 2W1IA 5GZ9A 4OTQA 5HNBA 4JIAA 5K3YA 3SD0A 2RFNA 4DG3E 2WTWA 3G51A 5JSMA 4RSSA 2OZOA 4G9CA 3VHEA 1YHWA 2JIUA 3TKIA 1YVJA 4IAFA 4CSVA 5C4KA 4C33A 4Y83A 1H26A 3ZO3A 5IZFA 3FI3A 5M4CA 4ZLZA 3BQRA 3PFYA 3AD6A 4BCNA 2F7ZE 1Q8YA 1YXSA 4AW1A 3OCSA 3RAHA 3O7LD 1OL5A 2FB8A 3MJ1A 5EYCA 3UNKA 2VU3A 2XEZA 3Q5IA 4HYIA 3IDPA 4D58A 2CHLA 2ERZE 2YM4A 5GJFA 3VBXA 3VBVA 2J5EA 4HCVA 4HVSA 5KUPA 3VRZA 4ERKA 5TR6A 1H24A 3K54A 3QD0A 5BYYA 3I5NA 3C7QA 3CP9A 2F7EE 5KBRA 1G5SA 1UU3A 5ACKA 3VS7A 4ENYA 3LIJA 4CKIA 4X3JA 2EXMA 4W8EA 4ZSAA 2G1TA 1FBNA 1GIHA 4FTLA 3RCDA 2X81A 2QC6A 2WTJA 4FUYA 3QQFA 4OUCA 4WHZA 3VWAA 2QONA 5D7AA 3VS5A 3O8TA 3QWKA 4C58A 2PHKA 1I44A 3FLNC 1XMMA 3GC8A 2ITOA 5CF4A 4RFZA 2F9GA 3RM7A 4KS7A 4O96A 4XP2A 5I0BA 4FTKA 2XAMA 1OGUA 3ML1A 3F5GA 4KIKB 1Q61A 2CJMA 4R8QA 4AA5A 5KMKA 5T3QA 3W16A 3CTQA 4DHFA 2XK8A 4IX3A 3NFGB 1KOAA 3H0ZA 4QP7A 4XG2A 5E8TA 3BHHA 4DYMA 5KMJA 3GCPA 3FE3A 4HNFA 4LDTA 3VS2A 3QUEA 2W4KA 3KC3A 4EUUA 3TM0A 4IX5A 1OZ1A 1XHAA 3FMLA 4WO5A 2IG7A 1EH4A 2WMTA 3W2PA 4DG2E 5L2WA 3UQCA 3ITZA 4C4EA 4E93A 5BX0A 4FEUA 1KE9A 1REJA 2C69A 2BFYA 3LXLA 2IZTA 4UMPA 2X4ZA 4KAOA 2A2AA 3H9FA 1L8TA 5EDRA 2EUFB 2VTRA 5LVPA 3PUFC 4HZSA 2A1AB 3KMUA 4X7QA 3PPJA 4AN9A 5AEPA 4BJJA 4AOJA 4USDA 5ETCA 3FMMA 3R00A 2HWOA 3C4CA 4PPBA 4QTCA 3WF6A 4F1TA 1REKA 3ZTXA 4IM3A 4OTFA 5CSVA 4UXLA 2X2KA 2JITA 4JIKA 4RBLA 1MUOA 2PMIA 5EHLA 2BIKB 2GQRA 2W5HA 2YM3A 2BVAA 3EQCA 4YJTA 1FINA 5CALA 1ZOHA 4ZTNA 5AP2A 4MCVA 1L3RE 4BDBA 3R8PA 4QDVA 3AGMA 3ZLXA 1ZARA 4J96A 3PA4A 2R0UA 4MAOA 4TYHA 2R9SA 3PG3A 2VN9A 3VNTA 3W8QA 3UIMA 2OWBA 4CLIA 4ENXA 4E5WA 4A06A 1R78A 3T3UA 4ARKA 5A4QA 1MRUA 2PVJA 3SHEA 2ACXA 4FV0A 1OKVA 2H8HA 4IVBA 3II5A 3KXGA 2E9PA 1V0BA 3IS5A 3NNWA 5ETIA 3UOKA 3TNIA 2H6DA 1W84A 1M7QA 4JRNA 4OW8A 4U44A 4YSMA 4JL9A 5DOSA 4IIRA 4C37A 3QALE 4G3EA 5HI2A 4J7BA 5G1XA 4JG7A 1FGKA 2ETRA 4I6QA 2VAGA 2FA2A 5CEMA 4EK8A 3CGOA 5EG3A 2XK4A 3MV5A 4FKQA 4ZSLA 4IM0A 4AT5A 3RHXA 4CFVA 5IQFA 4QP3A 3ZM9A 2J90A 3BEGA 5AA9A 3UO4A 3PXYA 5CI7A 4E5BA 3R04A 5I9XA 5KZ0A 4NK9A 1BKXA 1SNUA 5EKOA 5JRSA 3BE2A 3PP1A 5I9ZA 4EJ7A 3PSBA 4X6QC 4HCUA 5DI1A 4M8TA 3ZYAA 3DAKA 5GZ8A 3BWJA 5D12A 2I7QA 2QOHA 2BDWA 3NMUF 3D14A 4FGRA 2B53A 3BGQA 4XYFA 3NUUA 4I0SA 4YLJA 4C4JA 2WU7A 2BUJA 1URWA 3GCQA 2JD5A 3C0GA 3ORLA 4M97A 4ZJIA 5J7BA 5CT7A 4QD6A 1JNKA 5AUVA 2JAMA 3IW7A 3ROCA 3TG1A 3WOWA 4AAAA 5K5XA 3DXQA 4ONAA 4D9UA 3H3CA 2XIKA 5LMKC 1H8FA 2QNJA 2OLCA 3OT8A 4WD5A 3BE9A 4A9YA 3WARA 4I24A 5HCXA 1UU9A 4LV5A 4PDYA 3COIA 4LOPA 3QC4A 3MY0A 4BI0A 2WGJA 2YCRA 4L45A 4MQ1A 2C30A 3DFAA 3PXFA 4A9SA 3F82A 4ZY4A 1Y6AA 2E2BA 3PRIA 5EQEA 2PY3A 3LJ1A 4EOLA 3AQVA 2OJFE 3OBJA 3V6SA 4GYIA 4NKSA 3NDMA 4QP8A 3RHKA 3MBLA 5HQ0A 3RALA 5FDPA 4GG7A 4LI5A 4R7IA 4KSPA 1KV1A 4FSZA 3TL8A 4E4MA 2VD5A 4I3ZA 2VWUA 1Q41A 4A07A 4O4FA 4GRBA 1BMKA 4BZOA 1TZDA 2YCFA 4F1OA 4PWNA 4FT9A 4G31A 4U97A 2JIIA 2W99B 3UDSA 4FV2A 4CFXA 3DKFA 2YERA 1ZMUA 5K5NA 1R0EA 2VGOA 3Q9ZA 1NXKA 4CFNA 3EZVA 5BYZA 3VONA 4DEDA 4X21A 5A4CA 4FTIA 3EWHA 2R0IA 5JGDA 2NRYA 3VQUA 5IMEA 4GJ3A 1XMLA 5JGBA 3M2WA 5AUZA 3M1SA 4UEUA 1CKJA 2XZSA 4MXYA 2VNWA 2ZM3A 5DVRA 3MS9A 4WA9A 4YU2A 2XM9A 2VV9A 2CKQA 1W2DA 1F0QA 4BKZA 4QEBA 3PLSA 4IAIA 4FNYA 2HW7A 4FSTA 4L7SA 1YOMA 3K5VA 5AP6A 2XIYA 5E1SA 3ELJA 4D2RA 4YJUA 3VHKA 5A4TA 1KE8A 3ZLSA 4OTIA 5HD4A 3QTRA 5HHWA 4D1SA 3TNQB 3Q5ZA 4M15A 4IANA 1NVSA 3PXRA 2VTLA 3FLSA 3JPVA 4O4DA 2EXEA 2BILB 1E9HA 2FSOX 3W18A 3L9PA 2QD9A 3TTJA 3BU6A 3N9XA 3NYNA 2GS6A 1PYXA 3QLGA 1APME 2NNWB 2C5OA 2CSNA 2WIHA 3OW3A 4RZVA 5D41A 3KGAA 5EYDA 2X9EA 3UC4A 2VTNA 4LL0A 4HOKA 4PP9A 3ULZA 2PMLX 4D1ZA 5EKNA 5B7VA 4IWQA 2XCKA 2VRXA 2VTQA 1JKSA 4NJ3A 2XK6A 3A62A 2XRWA 3P7CA 2OH4A 3UJGA 3SOCA 3Q52A 3A2CA 4LL5A 4I94A 1FPUA 1O9UA 2Z7QA 4XG3A 4DGMA 4L7FA 4IFGA 4H3BA 1ERKA 1Q8UA 4F08A 2CMWA 1FQ1B 3EL7A 4J95A 4NEUA 4AA0A 4BKYA 4O1OA 5CF5A 4BTKA 3SA0A 5HZNA 3VBYA 2UV2A 5JZJA 5FXSA 2UZEA 4IC7A 3TN8A 3R30A 3G9NA 1A48A 2UZWE 3A7JA 3SOAA 4LYNA 4AQKA 4QDEA 4RC2A 3SRVA 2WQMA 3NYOA 2R3FA 3RPYA 3KEXA 4KSQA 3WZUA 4D2PA 5DT4A 3FLQA 4QYHA 4IX6A 3GC9A 5FG8A 2CN5A 4HVGA 2BAJA 4CZTA 4DFZE 3C4ZA 2QOIA 2QOBA 3ATSA 4UZHA 1XH7A 4X2FA 4QT1A 2B9IA 4GV1A 5HX8A 2CKPA 4F0FA 3UDTA 4MD7E 3Q96A 5I9YA 3EFJA 1IRKA 2QOCA 3GCSA 3NW5A 4XG8A 5KHWA 2C6MA 3ALNA 4G6NA 5DFPA 4Y5HA 4CTBA 2QR8A 3PXKA 4OR5A 3V5QA 4EH8A 3S00A 2R5TA 4G6OA 4OTRA 4P5QA 4P2KA 3SDJA 1YWRA 4EOOA 4WRGA 2JKKA 3UVRA 3PE1A 4NT4A 3TWJA 1H08A 3MH2A 4ZOGA 4ANLA 2VWWA 4DLIA 1H1PA 2WAJA 3C4XA 4O84A 3ERKA 1HCLA 4L01A 3OT3A 4D2SA 2CGUA 2XP2A 4PPCA 4Y8DA 3JUHA 5HE1A 4Y95A 3R83A 3F3TA 3RI1A 4NTTA 1A9UA 4RC3A 3G5DA 3AC5A 3VS4A 4L44A 4GK3A 4ORKA 2WEIA 3MYGA 4ALUA 3ZHPC 4QTEA 3NS9A 3K3JA 3G2FA 3P5KA 4RIOA 3OS3A 4D0XA 4FRFA 2WQBA 5EQPA 4RVMA 2PMNX 3SLSA 3QA0A 2PE0A 2PZPA 2QU5A 3V6RA 3ZC6A 4B99A 4C2WA 5EQYA 2BALA 1ZXEA 3O50A 3RWQA 5JFXA 4FOBA 3HV6A 4U5JA 1JPAA 3HMIA 3QKKA 5AP3A 1IA9A 4D1XA 2JBOA 3PPZA 4A9UA 1OL2A 3ZZWA 4CKRA 1U5QA 3FI2A 1H1RA 3ENMA 3Q32A 4D55A 5BMSA 5AX9A 3DB8A 1SZMA 2YHVA 4FKOA 3LQ3A 4QYYA 4YSJA 1PY5A 3RTPA 2QOFA 2UVZA 4F7NA 4YGAA 3B2TA 2KULA 3NSZA 3OWPA 4HPTE 5FQDC 5IG1A 3I6UA 3UVQA 3PZHA 3KVXA 2QVSE 3L9MA 3LM5A 5FM2A 4KIKA 3TIZA 2WQNA 1P4FA 2HYYA 2XNOA 4GG5A 4WUNA 3OXTA 4AGCA 4D4SA 3R02A 4PTCA 5KHXA 4GT3A 5CAPA 2JDSA 2QKRA 3BYMA 1UKHA 2IZUA 4O0YA 4YPDA 5CZHA 2JEDA 2ZV7A 2X0GA 2VWYA 3DZOA 4H1JA 4MBLA 3MIYA 3O96A 5A4EA 5IPJA 2PVLA 2PZ5A 4AW2A 4FL2A 2R3QA 3A7IA 2GMXA 4BIDA 3UOHA 3ENHA 3ID6C 4Y46A 3CIKA 5E4HA 1GIJA 4WNKA 3LCKA 4FIEA 4YHFA 4JLCA 4IDTA 3MA6A 4TWCA 5ANKA 3UIXA 3CJFA 3BL9A 4TNBA 3E64A 4K6ZA 4TTHB 3JYAA 3P7AA 5LOHA 2SRCA 4ACHA 3QUDA 4TYHB 1STCE 2VO3A 4CYJA 2VX0A 4EZ5A 3DU8A 1ZMWA 3LXNA 4ZJJA 3FI4A 4XLVA 3G9LX 5A4LA 3TDWA 3GT8A 2ZV2A 3OOGA 5J87A 4XG4A 1AQ1A 4CEGA 4AXFA 3P08A 2UW9A 4FKRA 4KIPA 2GNLA 3CQEA 4O7TA 2WOTA 4QYGA 1UNGA 3FZRA 3QBNA 3QWJA 2WMWA 3U51A 4DF3A 3QF9A 1JSTA 1SVGA 1Y8GA 1QL6A 3OCBA 4EH2A 1UNHA 1ST4A 4I4FA 5FTGA 5JQ8A 4ASXA 4UYNA 2HXQA 3G0EA 2AYPA 4TXCA 3QZGA 2Q83A 5C4LA 3OOMA 4PY1A 2DUVA 5L2TA 1YHVA 4AQCA 4GSBA 3E7OA 1H25A 5DG5A 4KWPA 3N51A 3ZS5A 2BKKA 1H1WA 4BHNA 4QMMA 1GJOA 3NIZA 4USEA 3EZRA 4KRCA 2YJSA 3D15A 4L3LA 3ORNA 4FG7A 2HW6A 4O4EA 3VQHA 5CXZA 4TKSA 2X2LA 2G9XA 1F5QA 4I6FA 4X2GA 4WIHA 3FMNA 2Z8CA 4I20A 4QNAA 2GHGA 4YZ9A 5DWRA 1WCCA 4APPA 4CZUA 4DBNA 1YQJA 1XKKA 4RWIA 3G90X 4RIWA 3TKHA 5HIEA 4N6YA 3WYYA 4ZZNA 2RG5A 3FV8A 2QI8A 2P2HA 4PQNA 4Q5HA 5L2IA 4AT3A 1YOJA 3WYXA 5HD7A 4K2RA 3L9NA 2B55A 4DT9A 5AR4A 2ITXA 1FVVA 3CSVA 5I9WA 3D2IA 1H0WA 3GOKA 3DT1A 3LFQA 3PXQA 4G2FA 3W0PA 4I5MA 3LW0A 3RAIA 3PLAE 3FSKA 3MDYA 3QTWA 5IUIA 5A6NA 5CU6A 3MPMA 4YJQA 5AAEA 4BDKA 5DGZA 4IW0A 4DG0E 1H1SA 2X6EA 4QMPA 2W17A 4WBOA 1M2PA 3E62A 3F7WA 3UIBA 4AGDA 1J1CA 3HV4A 5TKDA 1VYZA 2X8IA 4EH6A 4BBFA 4F0IA 2UZLA 4BGQA 5BVFA 5TO8A 2XRUA 2XYUA 3MW1A 2C4GA 3O71A 2WIPA 4B8LA 2DQ7X 3R9HA 2ERKA 3GGFA 5K4IA 5KCVA 3O51A 5LCJA 3QQUA 2IF8A 5L4QA 1K9AA 4JI9A 4L68A 3QQGA 4MXAA 3R73A 5CVFA 5IQAA 5AR2A 1DM2A 1W8CA 2BHEA 5D11A 2WD1A 3HZTA 2PZRA 4MVFA 4S32A 5CU2A 4EOSA 3LXPA 3PA5A 2GS2A 4DA5A 2C6KA 2BFXA 2XS0A 4IACA 5I3OA 1P5EA 3R9NA 5CYIA 2GU8A 3DKCA 2WB8A 3WBLA 5KKRC 3FZSA 3BI6A 4MQ2A 3QHWA 2C6DA 4G5JA 4X0MA 4QQCA 5DLSA 4E20A 2IN6A 2OBJA 3NIEA 1CMKE 4F9BA 3MJ2A 3DBCA 2J9MA 2C6IA 2FUMA 5J1WA 4F6WA 5HNIX 2R2PA 3OZ6A 2JIVA 4W4WA 4F9AA 3D0EA 4XS2A 3JY0A 1V0PA 4WG5A 3QKLA 4MXOA 4CNHA 4EZ7A 4TYIA 5F4NA 3IW4A 5J5TA 5EHYA 4MNEB 3HGKA 4NYEA 3GBZA 2YIRA 3RNIA 5FP5A 2YFXA 3DBDA 4IH8A 1XO2B 2BKZA 3F3WA 4LV7A 3BGZA 2C5YA 3WF8A 4FV9A 2PVRA 1JKKA 3QCQA 4XJ0A 1VR2A 4O21A 4EOKA 3Q2MA 1RQQA 5T68A 3SXSA 3E7VA 5IQCA 5IA5A 3QQKA 4DHZA 4BTFA 1BI7A 5FWKK 5HE0A 3WZKA 4EHEA 2EU9A 5EFQA 4RGJA 5BPYA 4O81A 4IAKA 1NT2A 5DYJA 4DDIA 2ITYA 5AA8A 4R3PA 2FSLX 1AD5A 2V7AA 4XV1A 2QG7A 3LHJA 4DH3A 2XK7A 4S34A 4I92A 3QU0A 4Q2AA 2G01A 3NW6A 4W9WA 3A7FA 3ZLYA 2XBAA 3GI3A 3R8VA 5LMBA 5AUWA 2XIRA 3QC9A 1JAMA 3GCVA 5E8WA 4XEYA 5ANJA 2OXYA 2J0KA 2C3IB 3NCZA 2G2IA 3CPBA 3GC7A 5AR3A 3VUMA 4L52A 1XH9A 3R1QA 4TRLA 4HW7A 2VWVA 2JBPA 3BHTA 3KN6A 3MH1A 4RRVA 3UMXA 3VUHA 4CT1A 3FQSA 4E4XA 3F2RA 2IZRA 5AWMA 3EKKA 3ULIA 3U87A 4Z55A 4FSWA 2C6LA 2WMBA 5BUJA 2W5AA 3FYKX 3LXKA 3MFTA 5T6KA 5IA4A 5IISA 3FI8A 3HV3A 5BVKA 2YM5A 3QRIA 4FKSA 3BELA 3OWJA 4L9IA 4R1VA 3SRVB 3HDNA 2BTRA 2UZDA 3QXOA 4W4XA 3GP0A 3IPHA 4ANQA 3UE4A 4EH3A 5J5SA 5EW8A 3MVMA 5HOAA 4A4XA 2WFYA 2YAAA 4F99A 3FZOA 3R1NA 3R1SA 3W2CA 2O0UA 5IQEA 1Q24A 4DLJA 1URCA 3PJ2A 5AV0A 3W2RA 3Q2JA 2Z7SA 5CEIA 4QTAA 3RK9A 2J6MA 4BGGA 1PMEA 3WE8A 1CKIA 4JAIA 5M44A 4OLIA 5EM5A 4MBIA 3TJDA 4FSRA 4FJVA 2IW6A 3VUTA 3HRFA 4ITJA 4G17A 4M68A 4BDEA 1FGIA 1G8SA 3V5LA 1OKYA 1X8BA 1PF8A 4FKLA 4O4BB 4V01A 3I6WA 4WBBB 4WSQA 3UODA 5ITAA 2A19B 3TI1A 3R7GA 2UZUE 3A61A 4E4LA 2CCHA 4F7LA 3FLWA 5J1VA 3NUSA 1UWHA 4NUSA 3UIUA 3AKJA 3UYSA 3WI6A 4HVIA 4F78A 1BI8A 4Y85A 2BZKB 3AC1A 3SXRA 3ZFYA 4APCA 4O1PA 5AMNA 3R2BA 4DEHA 3C13A 5M06A 4FNWA 3H30A 4FVPA 4GVAA 2ITQA 5HO8A 4BCIA 5KMIA 3DDPA 4LRKA 3E87A 4R5YA 5GINE 2WMAA 5AV3A 2YM8A 3BLRA 3ZFMA 3OG7A 3UG2A 2GNJA 4PP7A 5JZNA 3NAYA 4ASDA 1YDSE 1XJDA 3VS0A 5LVOA 4R7BA 4FG9A 4IWPA 2CKEA 2QU6A 3NAXA 3U55A 1Y8YA 5TF9A 2FYSA 2H96A 2BMCA 2WQOA 3FHRA 3SV0A 3T3VA 4DAWA 3EHAA 4L42A 2I6LA 4JQEA 2XK9A 3OY3A 4IVAA 2XEYA 1ZZLA 4K1BA 4TYEA 2W5BA 4MH7A 4RPVA 3ZXTA 3HP5A 1Q8ZA 4C2VA 1FMOE 3EQIA 3Q6WA 5H3QA 2GQSA 2IEWA 3BZ3A 2CPKE 3UNJA 2FO0A 4GU9A 4U0IA 2C68A 3DJ7A 1VLRA 3F7ZA 5DE2A 2YN8A 5FTOA 2J0IA 3TACA 4C62A 1Q3DA 3I0OA 4FTMA 4CCBA 4DGNA 4E6QA 3L8VA 1RE8A 2XKCA 1V1KA 5FGKA 3TMOA 1PKGA 3SG9A 2IPXA 1W2CA 1ZYJA 3T9IA 3EFKA 2I0HA 3CTHA 4JXFA 4FV7A 2PL0A 4BDIA 4YTFA 3REPA 1QPDA 2EWAA 3RJCA 3G33A 4KABA 3OW4A 4GW8A 5AIRA 1J7IA 1PKDA 3LKMA 2YABA 3UZTA 2ZB0A 2YDKA 3LFEA 3OUKA 5CU4A 4LRJA 4ANNA 4GKIA 3OMVA 1JWHA 5LMKA 5EI2A 3FHIA 3HMNA 4QMUA 4EK6A 3NVMB 5CEOA 3UNZA 3HP2A 5BMMA 3BCEA 4W9XA 2AUHA 2RG6A 4FG8A 2CLXA 4RZWA 4ZAUA 1PXOA 2QR7A 4C4IA 3LAUA 1YDRE 5FUTA 1OBDA 4FV4A 1VZOA 3MIAA 4DE4A 3S1HA 2HELA 3FEGA 4FTCA 4AN3A 4B6LA 3PVGA 2Z7RA 2R3PA 3OC1A 5EM6A 5HESA 4C4GA 4FF8A 2XNGA 4TPTA 4RJ8A 1Z9XA 3Q53A 4QMSA 4UBAA 3JXWA 2OXDA 3BLHA 5DEWA 5EYMA 5CSHA 2Y4PA 4FNZA 2JLDA 5IA1A 3GENA 2C3JA 5KKRB 4A4OA 3EB0A 2F4JA 2HAKA 2UW7A 3Q60A 4J71A 3PZEA 3P86A 4PMSA 2YEXA 4C59A 2HY81 4RX9A 2DS1A 3JS2A 4I0TA 2XBJA 4PNIA 3CY3A 4U40A 3MA3A 5JEBA 5KX8A 5HKMA 3NUPA 1B6CB 3PWDA 3RZFA 4BBMA 3I0QA 1RDQE 4NM3A 2WMSA 3TDVA 2C0TA 1YWNA 2W96B 4FEWA 2B7AA 4IADA 2VO7A 3BX5A 4JS8A 3M42A 3BV3A 1OM1A 3DBEA 3ZEPA 3DK3A 4RVLA 2VTHA 4HZRA 4CKJA 5JT2A 3AOXA 3IW5A 4TYGA 4K9YA 5AP1A 1XWSA 3MI9A 3TIYA 1JLUE 3BHVA 2IVSA 4RIWB 2JGZA 3VS1A 3D5WA 5J9YA 4FX3A 4BYIA 4CFWA 3WZEA 3LFSA 4ZZMA 4DFNA 4KKEA 1DAWA 3GU7A 3PIZA 5CTPA 3DDQA 3EFWA 4NM7A 2WO6A 5JRQA 2WHBA 4D2WA 3SG8A 5I5ZA 2Y6OA 3V5TA 5L6WL 5DA3A 1OUKA 5HLPA 5L2SA 3QX2A 4I41A 2ZFYA 5C8NA 3UTOA 4P5ZA 5AP7A 3FMKA 3R0TA 2GTNA 3R9OA 4AZSA 4JJRA 1U54B 4FT3A 5HG8A 3O17A 3LFNA 4FI1A 1MRVA 5FD2A 3RPRA 3P79A 4ZMFA 4KB8A 4LGDA 2P33A 3WIGA 2X7OA 3MPAA 1WBNA 4JDKA 4PL3A 5HE3A 3R1YA 3TZMA 1KE7A 3ATTA 4AWIA 1TQMA 4IFCA 4YJVA 4C61A 5GHVA 4X6RA 2ETKA 5CY3A 2PMOX 4JX7A 5FEEA 5CAUA 2YJRA 5IDPA 4C34A 1HOWA 5L6PA 2YIWA 4I23A 4Q9ZA 1PMUA 4F65A 5JK3A 4PUZA 4LQMA 1YXTA 1IR3A 4YZNA 3C51A 2CLQA 1JBPE 3MFUA 4FE2A 2WQEA 2PZIA 1V0OA 2RFEA 2R3LA 3E8CA 4JBOA 5DNRA 2PUIA 4R5SA 4MUQA 3A60A 3GB2A 4WKQA 3PSCA 5E1EA 2O3PA 4AX8A 3TUDA 3AKKA 4ZS4A 2IWIA 3IONA 3CR0A 4M3QA 4CFFA 3U6JA 3QFVA 4YBKA 5FEQA 3HAVA 2Y0AA 1XH5A 3ANRA 2VTAA 4IVDA 4M69A 1UKIA 4EKLA 5FTQA 3QYWA 2C6EA 1W7HA 2BTSA 4EHVA 3DNDA 3NNUA 2LAVA 4KBAA 4J8NA 4F7SA 3EN4A 4FV6A 4DTAA 3OBGA 4RX8A 2W1FA 3R8LA 2E9VA 4H3QA 3W55A 1GIIA 4BDJA 3ANQA 4XG7A 5HCZA 4AZEA 3QA8A 1KE6A 3EMGA 4ZTSA 4LM5A 3DFCB 3QTIA 3HNGA 3LQ5A 4EONA 4YJPA 3CXWA 4XBRA 2PUPA 2W4JA 1YKRA 1B38A 1JKLA 3E63A 3KKVA 5A46A 3DXPA 3Q4TA 3TXOA 3C1XA 3HEGA 2WXVA 4GIHA 5HG5A 1H1QA 3E8DA 3POOA 4QPAA 3VAPA 4D0WA 1KWPA 3OTVA 4MXXA 5M4FA 5DR6A 4YR8A 3RPVA 3IDCA 1RW8A 4BTMA 4DFBA 3NEWA 5EOLA 4MNEA 5CQUA 2ZJWA 1WBWA 2O8YA 4RX7A 3BRBA 5JQ5A 2XIXA 4LG4A 4S33A 4JDJA 1MRYA 1B39A 4BCKA 3QD3A 4U6RA 4F6SA 1NA7A 4L00A 3QHRA 3KXNA 4GUEA 3BHYA 2DYLA 4OT5A 1H0VA 4F63A 3AKLA 3ALOA 2PZYA 1IASA 3ODYX 3R8UA 3QTUA 3TNWA 4A9RA 4CYIA 3ORTA 2GSFA 2OSCA 2IZSA 4AF3A 1TQIA 2PVKA 1YXXA 3NNXA 4F09A 3GQLA 3OUNB 5EOBA 3KIOC 4M12A 2XARA 3HMMA 3H9OA 3TKUA 3OWLA 2BDFA 5LWNA 2VZ6A 3G15A 2HENA 4U42A 4D2VA 1G8JA 5FDXA 4O7ZA 5E90A 1UWJA 2RSVA 4L43A 4AE9A 3WF7A 2UW5A 4YMJA 4J52A 1OGYA 4C57A 3DQXA 3D7ZA 3C4WA 2QO2A 3SVVA 2OZAA 4XOYA 3A8XA 4CT2A 4UZDA 3V8WA 5LVMA 4ZP5A 4GU6A 2W9ZB 4J99A 5BUEA 4XHKB 3F66A 4U43A 4Y73A 4QMYA 4QP1A 4E5AX 4UWBA 4BWXA 1W82A 4TZRA 4D4YA 3D94A 4HNIA 3R71A 1PRYA 2HZNA 2XYNA 4EHZA 2OO8X 4ZY6A 4M66A 5ETFA 3