5CEPA

Dlk in complex with inhibitor n-(1-isopropyl-5-(piperidin-4-yl)-1h-pyrazol-3-yl)-4-(trifluoromethyl)pyridin-2-amine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
b'LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 12
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cepA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cepA01
4RWLA 5K3YA 4FTJA 1SYKA 3QTSA 5DRDA 1JOWB 3EFJA 3ORPA 4IAFA 4M3QA 5HNBA 2WQNA 4JG8A 2WTWA 4IJPA 2YM8A 2IW9A 3ZU7A 4USFA 3ZLYA 5DEWA 4R1VA 1UKIA 2WD1A 5A3XA 1ZWSA 2G2HA 4QMQA 2W0JA 4ZJVA 2O65A 4NW6A 1OUYA 3PXZA 3VUMA 2G9XA 2QNJA 4PL3A 2E9UA 4FZ6A 5I0BA 4CFVA 2W1HA 1H8FA 4ANBA 3ENMA 3OXIA 1U59A 1OL1A 4FI1A 4JG7A 5I9YA 4IAKA 4C59A 4JRNA 5L2WA 3AMBA 4FC0A 4O0RA 4D2SA 2OIBA 3DTCA 1HCKA 4DH1A 4RA5A 4FSQA 2HW6A 3F3VA 4M15A 2QU6A 5AP2A 2OZAA 4YBJA 4DYMA 4FKRA 3OOGA 3RHXA 3DPKA 4IB1A 3CSVA 1PXLA 2W96B 3WF6A 3NCZA 3PLAE 4O83A 2B52A 1QPEA 2PZ5A 3COKA 5EM5A 3L8XA 2BRNA 5DR6A 4XRJA 4RVKA 3S4QA 4EWHA 1JSTA 2OH0E 3COMA 3GB2A 3FJQE 3FQHA 3SRVA 2W4KA 4ALUA 4LOOA 5FXQA 1OBDA 4ITJA 2CKQA 3C50A 4L01A 1YWVA 2ITWA 3QXPA 4KB8A 5D1JA 2WXVA 3NIEA 4ACHA 3MVJA 3EN4A 2EVAA 3I81A 4MTAA 1PMEA 4DEGA 3F7ZA 2SRCA 2O64A 2OJ9A 2XVDA 3Q4ZA 4ZOGA 4BDKA 3OXZA 4IEBA 3SXSA 1ZOGA 4PRJA 4BKZA 4O91A 4BBEA 1QPJA 4F9WA 2OF2A 4JIKA 3EHAA 4P5ZA 3ORZA 4PY1A 5CU6A 4O27B 3DBEA 4FL1A 1GY3A 1UNHA 5FM2A 4G17A 5CU2A 4BDHA 4R3CA 4KIKA 2CDZA 1Q8ZA 2JDRA 3B2TA 3ZO3A 3KRJA 3HNGA 4O7ZA 2VX3A 4I5CA 4TW9A 4CG9A 4J98A 4F9AA 2BAKA 3GT8A 3MB7A 5FRIA 2WMWA 3IQ7A 4QP4A 4UWCA 3K2LA 4FTLA 4GVAA 2J6MA 2BILB 1OIYA 4MXOA 4E6CA 4PPCA 3KCKA 4B6LA 2WIPA 3FMLA 3LPBA 2YIXA 3LXNA 3SX9A 2R7IA 4IADA 4M69B 1W98A 1FOTA 4TYJA 5EW9A 4MXZA 2FB8A 4D58A 4ZTSA 4BYIA 1DM2A 5EYMA 4IIRA 3ENHA 3RZBA 4X6QC 3BE2A 3BV3A 5JGBA 3S00A 3GU5A 5EQPA 2E9PA 3P7AA 5CEPA 4YR8A 5ANKA 2QKRA 2RFEA 3A4PA 3AGLA 4ZSEA 3FMMA 1OL6A 2V0DA 3AC3A 1L8TA 3G5DA 3OCGA 3W16A 3R73A 4G3FA 3R6XA 5TOZA 3CKWA 4D5KA 2XJ0A 3BHHA 5J87A 3QHWA 3R8LA 3I0QA 1UU9A 3FMHA 4RWKA 3QQLA 5K4IA 1J7UA 4PUZA 4FNYA 3G6GA 4DEIA 3NZ0A 3F3WA 4ZTNA 4O7TA 3DLZA 3JYAA 4AE6A 3TTIA 2W4JA 3PJ3A 4O7NA 4Q9SA 4UZDA 5EHOA 2PU8A 5KHXA 3N4TA 3OEZA 4J8MA 2Z2WA 3HGKA 3L9MA 4P90A 4U40A 5EK7A 3C4XA 5IEXA 3OW3A 3HV4A 3R2BA 3PXKA 4NIFB 4DG2E 1PXNA 2W99B 4NKAA 5KMMA 2NP8A 2RG5A 3KVXA 4RBLA 1PKGA 4NK9A 4QPSA 3MB6A 2GMXA 4XG4A 3V6SA 4ERWA 4GK4A 4I24A 1YHVA 4FL2A 1YXUA 2W5HA 1ZLTA 3D14A 4CFWA 2WAJA 3UZTA 2IJMA 3Q60A 3SV0A 2F7ZE 4O38A 1G8AA 1OL2A 2R3QA 3VUGA 2JD5A 3QCYA 3R2YA 2VWIA 3E3PA 3QA8A 3CPCA 2BDFA 3ZLXA 1BKXA 4CKIA 2WMBA 3FMJA 3PP0A 1PJKA 4EYJA 4QQJA 3IOKA 3ORKA 3AC2A 2WTIA 3LFBA 4PDSA 3I60A 2V5QA 4A06A 1SVHA 1G5SA 3DOGA 4TYEA 1OVEA 4QQCA 3V5WA 3NUAA 4DFUA 2HZ4A 4O1OA 2J50A 3ZLWA 4FTIA 4IC7A 4BZOA 4ASXA 4N6ZA 3DKCA 5CXHA 5C27A 2O0UA 4XUFA 1OPKA 3QF9A 4GK2A 4G2FA 4CQGA 3AC4A 3FI4A 4LFIA 4IVCA 5J9ZA 3FQSA 3UDBA 2YM6A 4H39A 5H8BA 4QP2A 2OICA 2CKPA 3TDWA 3QC9A 3NYVA 5DRBA 2I6LA 5IH5A 2WTKB 3V5QA 5BMSA 5JH6A 3E5AA 1YVJA 4IX5A 4O0UA 4CCUA 5AWMA 2J2IB 2WTKC 4PMTA 4YGAA 3F2AA 3RJCA 2I0HA 4R6VA 1M17A 1PRYA 3GXLA 4Y46A 3UOHA 3FLNC 1BI7A 4C58A 4CXAA 5AUTA 4JI9A 4X2KA 2PMLX 4HYIA 4ZSJA 2OW3A 3EB0A 3EL8A 4NTTA 2OXYA 4RX8A 3BBWA 3C0IA 4CD0A 3BZ3A 3ZXTA 4NJ3A 2KTYA 1YWRA 2EUFB 2XIRA 4FT7A 3R8ZA 3ROYA 2UZVA 2XIKA 4U0IA 4ZSAA 3F5XA 4XV3A 2UUEA 3TIZA 4WBBB 5EG3A 1LUFA 2PVJA 4XEYA 4YHTA 1OPJA 1L3RE 2XIXA 2GHLA 2IZSA 3BQCA 3QQKA 5ACBC 1SVGA 3W2RA 3R7VA 3MFTA 1I09A 4RIWB 4R8QA 3DK3A 2EB2A 3GNIB 2HYYA 2XNBA 5E8WA 3RAHA 3ZDIA 4C36A 5ICPA 1V0PA 4Z16A 5IQEA 3AXWA 4YU2A 3OROA 5M4IA 4DEAA 1OKVA 3DS6A 3GU4A 3IS5A 3DXPA 4XP0A 4LGDA 3MYGA 4EOMA 5J9YA 3QCQA 4MF0A 3SC1A 5AV0A 2UVYA 3COIA 4GV1A 4G9RA 3OBGA 5I4NA 4S34A 5BVDA 1U54A 4HCVA 1W0XC 4Z7HA 2ETKA 3ALNA 2X1NA 3IK3A 3R83A 4BB4A 5D10A 2YZLA 4FIHA 4TYGA 4D1XA 2PPQA 2C68A 4CRLA 2YISA 5ANJA 3UJGA 4LI5A 1YI4A 4OTGA 3ELJA 1WZYA 4C61A 4NM5A 4D2PA 3V51A 5DEYA 4FTRA 3RPOA 2P3GX 3THBA 2YZAA 3FXZA 2YFXA 2XKDA 4IH8A 3F3UA 3AGMA 3QLFA 4QMPA 4L53A 2WQBA 4X21A 3SQQA 4Z55A 4BR3A 5HNIX 2J5FA 2VNYA 2J4ZA 3V3VA 1UU8A 3O8TA 1LEWA 2ZMDA 2X4ZA 3LE6A 4G5PA 4G6NA 4GIIA 4MWIA 4RIOA 3U6JA 4E6QA 4U8ZA 4G16A 4X2NA 2C6KA 5JKGA 3D7ZA 2ERZE 4O82A 3KKVA 3LKMA 3Q53A 3FMKA 3FMEA 3JY0A 3D15A 3GCUA 2BIKB 3U87A 4TT7A 5J1VA 4MXXA 1Z5MA 5DVRA 2WTVA 4AGCA 3SDJA 3QL8A 3Q6UA 4J71A 1OGUA 4FVQA 4HVIA 2OJGA 4HNFA 3VS7A 5F9EA 3HP2A 5L6PA 3PY1A 4F4PA 3A62A 4JBPA 1J7IA 2PMIA 2ZV2A 2VTMA 2EXMA 2CGWA 3TV7A 4LRMA 3U6IA 4O0TA 3FLQA 5ETIA 3L8PA 5DN3A 2OJJA 4DFXE 4UMPA 1ERKA 2UW3A 3ODYX 4I41A 4ANLA 5CEKA 2BTSA 4IZYA 5FXRA 3MN3A 3QUDA 3E8DA 5BVEA 1CKIA 1R78A 2Z60A 1V0OA 2JIUA 3HUBA 5CY3A 4RLLA 2A4LA 2AUHA 4PQNA 3LJ2A 4HGLA 4YHFA 2ACXA 1H1WA 4YBKA 3EN6A 3FWQA 4F7SA 5FM3A 4EOJA 4RWIA 3NCGA 3P1AA 4DTAA 3O7LD 4BZNA 3QD4A 2CJMA 4F6SA 3EZVA 4FODA 4FV6A 2UW7A 4PP7A 1DS5A 1FGIA 3FI2A 5E90A 3QYZA 2OJFE 2UZUE 1QL6A 4RVMA 3RMFA 4ZLZA 5AA9A 4M14A 5HIDA 2B55A 3HV6A 1ZYJA 4JAIA 5IA0A 2F2CB 3QD0A 3R8MA 4C2VA 4FGRA 2QONA 2ZV9A 4I4FA 4TTHB 2JEDA 3E3BX 5FDXA 3SW7A 4AGUA 3TWJA 3W10A 2PZIA 3DZQA 3MVMA 4J99A 2W06A 3BEAA 4JDHA 5D11A 3TZMA 3ORLA 4MD7E 2C5VA 3F61A 4V01A 4H3BA 2VO6A 4APCA 4CYIA 4YMJA 4AOTA 4BBMA 3QGWA 3SGCA 4Y85A 2ITXA 3CC6A 5K0XA 1ZRZA 4YJQA 4YC6A 4CFNA 5HBJA 2CSNA 3HKOA 3O17A 4D1SA 4I92A 4TL0A 3EL7A 4QTCA 4W9WA 4QNYA 2FSOX 4UB7A 3PUPA 4ZY5A 4WG5A 4IW0A 3LLAA 2YERA 4RIYB 3UTOA 4DC2A 2F9GA 4L43A 4RC2A 4WNKA 4UYNA 4ZMEA 1MUOA 3E8CA 4XX9A 2PE0A 4NJDA 4KSPA 4DH7A 5AUUA 2VU3A 5E92A 2C0OA 3BYOA 1H24A 4RX7A 5KKRB 1EH4A 3ANRA 4MNFA 1OI9A 3E64A 5CTPA 4U5JA 3RPYA 3R71A 2P2IA 5KKRC 3MESA 4H05A 4CG8A 2WNTA 4FSYA 3HDNA 3VS4A 2XM8A 4EK5A 2WFYA 3A60A 3QBNA 5KBQA 5LCKA 3I7CA 3RK5A 3F7WA 3G51A 1ATPE 4ZIMA 5M07A 4PP9A 3TNWA 2QCSA 2WU7A 2GNFA 3A7FA 4KBAA 5J95A 3UQGA 2ZM3A 2XNGA 4IANA 5ANDA 4K0YA 5CVHA 3NUSA 4W4YA 3ERKA 1JVPP 4Q9ZA 4DGNA 1XBAA 2VWYA 2VAGA 2HW7A 3F82A 1PMNA 3FYJX 3PLSA 4HYSA 3R9HA 4AE9A 4AZSA 3C0HA 3Q52A 2HXQA 3O51A 1ZY5A 4P5QA 4IMYA 5AR2A 3K3IA 3VUDA 5FG8A 1W7HA 3QCSA 3B2WA 2P55A 4XP2A 3TL8A 5CWZA 1BX6A 2X6DA 3DBCA 5F1ZA 4L45A 2DS1A 3VQHA 2YABA 3P08A 4LYNA 3ZO1A 4CFFA 5BMMA 1GZOA 2WEIA 2WOUA 4RRVA 4Y5QA 3S95A 4BCPA 4RSSA 4FA2A 3ZUVA 4KBKA 5M53A 4RFYA 4PDPA 5HVKA 3PA3A 4PNIA 3W8LA 1M2QA 2A2AA 5DWRA 4ITIA 3P78A 5HO6A 4JX7A 4EJ7A 3TNPC 2WOTA 3S2PA 3HLLA 1AD5A 4XV1A 3UVQA 4OBQA 3ZRMA 4AX8A 5T6KA 4AT5A 1ZOHA 3UNZA 2YDJA 3FLWA 2PVLA 1IA9A 4RVTA 2OZOA 5JRQA 4PMPA 5A4LA 3PJ1A 1ZYDA 3OT3A 4GG5A 3FZOA 3HRFA 4JDKA 5IA2A 4FSMA 1R39A 4AWIA 3BHTA 3GQIA 4C3PA 4GU6A 5A14A 5JK3A 4AUAA 1E1VA 3WE4A 4QMSA 3WI6A 3G90X 3R21A 4FIGA 4FKQA 3PZEA 3R30A 1YDRE 4BDFA 5HD7A 3MTLA 4MX9A 1UWHA 4TWPA 4GT5A 5FD2A 5L6WL 3DQXA 2PTKA 3W2CA 4BGHA 4IB3A 4MBJA 4FT5A 4QTAA 2VZ6A 3MH0A 4D4RA 5C1QB 4EOQA 4FKVA 2BCJA 3UYTA 1OITA 3R9NA 1VZOA 1XH6A 1YI3A 2ZV8A 3BIZA 4DEBA 4LV8A 1W84A 4E93A 5L2SA 3ORXA 3DBFA 2JDVA 4HVSA 3E8EA 4U3ZA 3LCSA 4D2RA 3WARA 3L9PA 3UOLA 4CRSA 5HE3A 5CAVA 4WNMA 5EOLA 2VTQA 3ALOA 5IUGA 3MDYA 4HCUA 1WVYA 1YDSE 2XKCA 4RLKA 3UC4A 3QKLA 4EKKA 2R3PA 4YZMA 1J7LA 4TWCA 4FV1A 4M97A 2X7OA 2YIQA 3N51A 3UC3A 5HIEA 4UXQA 3TIYA 4U41A 3AT2A 1WBOA 4I6HA 4LRKA 1OMWA 5J8IA 4C57A 4JRVA 5HVYA 5D9HA 3FC2A 3SA0A 1XHAA 2JIIA 2ITYA 3QTWA 4M0ZA 3ZS5A 4A9RA 2CKEA 4GFMA 5CLPA 2ZYBA 4LGGA 1NA7A 3FC1X 3FI3A 3Q9ZA 4R3PA 3LJ1A 3UVRA 3M2WA 1W83A 3V5TA 3ZBFA 3LIJA 4MQ2A 4XG7A 4EZ5A 2WTJA 1KSWA 5DFPA 4AW1A 5CSXA 5AP3A 2C5YA 4BCIA 2QG7A 3PJ8A 5CF5A 4R7BA 3W2OA 5AFVA 3U9CA 3PA4A 3BYVA 4B8LA 4YSJA 5CSPA 3JXWA 3WIKA 4EHZA 3KXGA 4WSQA 3R7YA 5CF4A 4BDJA 3F5PA 3ZCLA 2OH4A 4FTOA 3Q32A 5E8TA 4F9CA 3CIKA 4EBVA 2VRXA 2J0MB 3BLHA 5AIKA 3SXRA 4QQTA 2BHHA 1K9AA 1XH5A 2X6EA 3HVCA 5IQCA 3Q3BA 2IW6A 4IB0A 1Y91A 4KRCA 3DT1A 2PZRA 3VIDA 2UZLA 3UODA 4UEUA 3OT8A 2VWXA 3MPTA 4LMUA 4NUSA 3A99A 4F7NA 3NNXA 4YJTA 1FVRA 1H0WA 3BGQA 5DNRA 5I3RA 3FYKX 2IWIA 4PTEA 3I5ZA 3HEGA 4RZWA 3O71A 5CZIA 3IW4A 3BHVA 1KV1A 5T68A 4F7LA 4KUJA 3NW5A 2ITQA 5IMXA 4O96A 3EQPA 3VUKA 2C0IA 4IM2A 4DBXA 4O7WA 4U7ZA 1RE8A 4G5JA 4DHFA 4ZTMA 5CF6A 2EXEA 3OTUA 5L4QA 3G9NA 4GMYA 1WVWA 4B4LA 4BKYA 2JKMA 5HD4A 2R0IA 4QP6A 3RCJA 1P4FA 1CSNA 4EQUA 2X2LA 3MVLA 4EI4A 2W5BA 1Q8YA 2WMRA 2VTAA 3KGAA 3TDVA 2BUJA 1H1SA 2DQ7X 2J0KA 4M68A 4AS0A 4BDGA 1YWNA 2RSVA 3PFQA 3HAMA 4ID7A 2WU6A 1PKDA 1Q3WA 5AIRA 3CTHA 4G6OA 3BI6A 4NFNA 5JFXA 2X4FA 4CQEA 4XG3A 3UOJA 4YLJA 4EC9A 5J7HA 5ANGA 3C13A 3ZSHA 4PNKA 2ITNA 5D7AA 3HX4A 4F0IA 4B7TA 4FGBA 3EFLA 2HY81 4RJ3A 3WF9A 4FZ7A 3EYGA 3CPBA 3G2FA 2OFVA 4IC8A 3K5UA 5AX9A 1YXVA 2XS0A 3GC9A 4WNOA 4XYFA 3FHRA 3GGFA 3V5LA 4QP9A 2HZIA 1GAGA 1PF8A 5E8VA 3RAKA 4L3PA 5BX0A 3R7OA 4O0YA 4CKJA 3IONA 4IX3A 4NL0A 4BZDA 5HTIA 4L46A 1ZZ2A 4YZDA 2W1CA 4AN9A 4E26A 4EH3A 5DYJA 5AP1A 4JBQA 4E6DA 3VULA 1SNUA 3PE2A 2O2UA 4WBOA 5AAFA 1GIJA 5EDPA 5E9EA 5GIOE 4YNOA 4O0SA 5LMKC 3QWJA 4HPTE 4KKHA 5AP0A 4QMNA 5LJJA 4I6QA 1OUKA 1HCLA 3DJ7A 3EYHA 3TM0A 1Z57A 2BR1A 2AC3A 2BRGA 5C8KA 1KE9A 3UO4A 3WOWA 2E2BA 2VO0A 4LUDA 5EFQA 3RM6A 4JG6A 4XJ0A 2IZTA 4HYUA 4BHNA 3VS1A 3DB8A 3RPVA 5L8KA 4I0SA 4DLJA 2DYLA 1H0VA 3PY3A 3GFWA 3FE3A 3MV5A 1OB3A 4CNHA 4D5HA 4EH7A 4FTAA 4IFCA 2C6EA 5EKOA 3LCOA 5CXZA 4YZBA 3ORTA 4BIDA 4I6BA 4ZY6A 3OC1A 2BZIB 4ACCA 2PSQA 3FY0A 2Y0AA 4TKSA 4ZTLA 4W4WA 3RWPA 3TKUA 2VO3A 1B38A 3LZBA 5M51A 5G1XA 3DNEA 5CVFA 2VGOA 1PXMA 1FVTA 3BGZA 4EOIA 3EMGA 4DH3A 5LCJA 3OHTA 2BIYA 3OTVA 4EH9A 3I6WA 1WBVA 3FXXA 2ETMA 3GU7A 3TACA 3R8VA 3RM7A 2OWBA 3F9NA 4FEXA 3UO6A 1PHKA 4HZRA 4PDOA 4HVDA 4BDIA 2VN9A 3C4CA 4OTRA 2ZDUA 4FZAB 4F63A 3Q4TA 4ANMA 5FGKA 1O6YA 5CAOA 3PSDA 4FKJA 2IZUA 3P5KA 4IWQA 3UIXA 3U8WA 5GINE 1H26A 2EWAA 3U55A 4O6LA 2YACA 3TNQB 1M2PA 2W1EA 4I4EA 1H4LA 1M2RA 2RL5A 3CP9A 3I5NA 5HG9A 3UO5A 3WZEA 4FSRA 1RDQE 3RINA 3R04A 1JPAA 3N4UA 4NYEA 2CMWA 1OIRA 4Y95A 5H8GA 5EW3A 1SNXA 2GS7A 4RC4A 4XS2A 4YLLA 3NYNA 2YWVA 4QP1A 4CVAA 2C69A 1I44A 5EM8A 4C7TA 1RW8A 2C3LA 4IXPA 2BDWA 3SW4A 4HNIA 4L3JA 4ZP5A 4K9YA 4O2PA 4D4SA 3QUEA 3KEXA 5LVMA 2GQGA 5KBRA 3C9WA 2XNNA 3IW7A 4AQCA 2YEXA 3KK9A 4EYMA 1R0EA 5LWNA 3ZEWA 2XKFA 1MP8A 2VTTA 3KRRA 4DGMA 4DAWA 5IU2A 1IASA 1BYGA 3R01A 4YZCA 1K2PA 4DINA 4YP8A 3T8OA 4J96A 4X0MA 3RBWA 5AAEA 5IQHA 2QG5A 4MNEB 1T45A 2HZ0A 2PZPA 3A8WA 3AC8A 1JKSA 3HMIA 4RIXA 5L2IA 4LM5A 1UA2A 3DQWA 1ZZLA 5HIBA 4RZVA 3TTJA 2CCIA 3R7IA 2WQMA 4ZTHA 5M09A 3VBQA 5HCZA 4YJVA 4FIJA 3EN7A 3GU8A 4BCOA 1UVRA 3EJ1A 3GBZA 4LL0A 4UXLA 4FV3A 3AT4A 4WHZA 3QTQA 4JR3A 2R3FA 2ZVAA 3FKLA 2UW0A 4QP7A 2XRWA 4O7LA 5FEQA 2JKOA 2BZKB 3UBDA 4FIEA 2RGPA 5HLPA 4ZSLA 3MY5A 5BUEA 5CI6A 3F5UA 3OOMA 3MA6A 4JQ7A 2NO3A 4QMLA 1H1PA 4BBFA 4M67A 4C62A 5BVNA 2XNPA 3LMGA 1ZYSA 1ZXEA 4LOPA 3ZRKA 4I5MA 3ZEPA 1IAHA 1BI8A 3AC5A 3A7JA 2CN5A 1OIUA 2PVRA 5KNJA 2BALA 1OKZA 4LL5A 3IG7A 2I7QA 2WMUA 2YM7A 1Q4LA 4MKCA 2WIHA 3R1YA 2CKOA 3OF0A 5M56A 2YIRA 4Z3VA 4JAJA 2C5NA 1A48A 3A7HA 2X8DA 3VNTA 2I40A 3D7TB 4TZRA 2IN6A 2PE2A 5IUHA 4WOVA 3W33A 2VV9A 4YPDA 3IO7A 3TG1A 4PMSA 2HZNA 5EDQA 4JOAA 4BVUA 2Y4IB 3PTGA 4U79A 4BYJA 2OSCA 4WA9A 3GC8A 3F88A 5CEIA 2Y4IC 4EKLA 3MIAA 3FLZA 3ZOSA 1LR4A 2RFNA 5LARA 5BUIA 2CGVA 3GVUA 4NSTA 4P2KA 2ITVA 4FV5A 3FAAA 3PXRA 3QKMA 4FICA 4BCFA 4D4VA 5IMEA 2IVVA 4EK6A 4FVPA 4LMNA 2UZEA 4IX6A 1E1XA 3IDBA 4TWNA 5BYLA 4OLIA 3WF7A 2OBJA 3ZUTA 2ITUA 4TN6A 5AMNA 5HCYA 2XKEA 4C38A 2WQOA 3Q4UA 3FL4A 1PW2A 3EQHA 5FP6A 3K54A 4OUCA 3ID6C 3UZRA 2WEVA 3O2MA 5DT4A 5ANOA 3UG2A 3UG1A 1KOAA 5AR8A 3C7QA 4FX3A 3P7BA 3FKOA 3VF9A 4E5WA 4CT1A 3FPQA 4QMTA 3QQFA 5HG5A 4IAIA 4QRCA 3EH9A 2PK9A 2XK7A 1GZKA 2ZM4A 2A19B 3H10A 4FG9A 3DY7A 3GI3A 4X3FB 3VVHA 3LMHA 2WMQA 3QFVA 5KHWA 2PVHA 5KMLA 4J7BA 3BBTB 3H0YA 4X3FC 4S31A 3VHKA 4ENYA 2ZB1A 4TYHA 3M42A 5BQ0A 1PMVA 2XIZA 4MEDA 4BCNA 4KINA 4JBOA 4KS7A 1QCFA 3QA0A 4YTIA 2FUMA 3FZ1A 5BVWA 4ZEGA 2GFSA 4L44A 3DJ6A 2YIWA 2WMTA 1S9JA 3EN5A 3W8QA 4GKIA 4F6WA 4PDYA 3QX2A 5L2QA 5CI7A 3R1SA 3UMXA 3HMMA 3P86A 4IVDA 3TXOA 1VYZA 5AUZA 5C8MA 3TUCA 1FINA 5E1SA 2WELA 1Y6BA 3IW8A 3UZPA 5EI8A 3R1QA 5HQ0A 5LVPA 4DTKA 3DA6A 4Y83A 3TV6A 2WKMA 4YLKA 2HWPA 4DGOA 3TN8A 4BDAA 3PJCA 4BWKA 4G6LA 2JGZA 4GL9A 4I93A 3ORNA 4J95A 4M12A 5HHWA 3CS9A 4BN1A 2Z7LA 4MVFA 4XOZA 5EH0A 3IDCA 5DHJA 2X9EA 3V5JA 3ZRLA 4BTKA 2X8IA 4ZLOA 3DTWA 4MF1A 3LFSA 4P7EA 4I0TA 3NGAA 4KKEA 5CNOA 5HG8A 3Q9WA 5DMZA 4YJSA 3DKGA 3ATTA 2I0VA 4QTEA 1IR3A 4JT3A 1H28A 1YXXA 3ULZA 4A9SA 4M8TA 1YOMA 4I23A 5AA8A 5A46A 1PYXA 4ASZA 3ANQA 4FG8A 3I7BA 2J90A 5A6NA 1WBPA 3KF7A 3G0FA 4WO5A 3VRYA 4ARKA 2BZJA 3R9RA 5DH3A 4FTTA 3SD0A 4U6RA 3LCDA 4EK8A 1Q99A 2E9OA 3ZMMA 3VJOA 3ATSA 5FQDC 4FEUA 4FV0A 1UNGA 4BY9E 3PPZA 4JDJA 2GU8A 2QD9A 4XHKB 3MH2A 1H1QA 2G1TA 2OJIA 2P0CA 2VX1A 4XG6A 5ANEA 3WBLA 4CTBA 1YQJA 3VUHA 5I9VA 3DDQA 3ZBXA 5CEOA 2R0UA 3S1HA 3SVVA 3DBDA 3IDPA 3WZJA 4AG8A 5HLNA 3VW8A 2IPXA 5I3OA 4QT1A 2UV2A 3GQLA 4ZS0A 2X39A 2ONLC 3BGPA 4EH5A 4GJ2A 3UP7A 5J1WA 4I21A 4W8DA 5M06A 3HMPA 3WYYA 4I5HA 3FZTA 4I22A 4O7RA 4GYGA 3II5A 4QYEA 3I0OA 3KU2A 4FZFB 4S33A 1FVVA 4YC8A 3VJNA 3LCKA 2YAKA 5DT0A 2F49A 3NIZA 1STCE 4QTBA 3Q4CA 3B8RA 3A7IA 3ZHPC 3NWWA 4WUNA 4E4XA 4CMTA 3R63A 4X2JA 4D0XA 4JIAA 3OW4A 4LQMA 2VWBA 3HMNA 4AOIA 4GFGA 2E9NA 2ZOQA 3CKXA 4RQKA 4IQ6A 3R9OA 4USDA 3T9TA 3KFAA 3TEIA 2QLUA 4JR7A 4FNWA 2XYNA 3IOPA 3CTQA 5AV1A 4A4XA 2RIOA 3E8NA 2G01A 5G6VA 3U4WA 2C6MA 5JFWA 1YDTE 3ZO2A 3LXPA 5HE2A 1NVQA 3FL5A 2CNUA 4O22A 3EQCA 3O0GA 2B1PA 1OECA 5HVJA 2BMCA 4KNBA 5IUIA 3PY0A 2Y6OA 3D5UA 4K77A 2ZMCA 2WB8A 3VHEA 5EOBA 4CCBA 5L2TA 2Q0NA 2ZB0A 1H27A 2V7AA 3KULB 3KK8A 4KIPA 5FTOA 3DXQA 3U9NA 1CDKA 1SZMA 5HBEA 5CU3A 2HELA 4GRBA 3CGOA 2YM3A 2XEYA 4MHAA 4E4NA 5A54A 4JL9A 2BKKA 2REIA 3R7GA 4QOXA 2UZNA 1XH7A 4FSNA 1XH4A 5JGDA 3QTZA 5GZ9A 4NCTC 4M69A 3QZHA 3QRIA 4ANOA 4BI2A 2G15A 3UE4A 2WMSA 3WIGA 3U51A 4UV0A 3Q5IA 3DLSA 2Y8OA 2PMOX 4G3GA 1WVXA 3OUNB 2WMVA 4FV7A 4FNZA 2QR7A 3DK7A 3U4UA 3NUPA 5FTGA 2WO6A 3FQEA 2A27A 3PYYA 4PL4A 3KXNA 3QUPA 4V0GB 4K33A 2JFLA 5FTQA 1UV5A 4N57A 3UP2A 5DPVA 3S3IA 2QOCA 2W1GA 4D4YA 3NUUA 5BYZA 1CKPA 2VO7A 2RF9A 3OMVA 5EHLA 4K11A 3QWKA 4P4CA 4S2ZA 1H01A 1Q61A 4GU9A 3UYSA 4IDVA 3DDPA 1GIIA 2GCDA 3U54A 3MPMA 4GEOA 4I94A 4UWBA 4FVRA 3OVVA 1JKLA 4KIOA 2Z7QA 5E7RA 5AR3A 4IAZA 4AFEA 4EOPA 4AT4A 1M14A 4D2WA 3O7LB 2JLDA 4F99A 1A9UA 3GC7A 3OWKA 5FBNC 4YJNA 2C6LA 5CAUA 3PE1A 4FSTA 3C4ZA 4HOKA 4RMZA 4R78A 3OCSA 1CTPE 3WZDA 4GS6A 4NIFA 4D2TA 3MY0A 1FGKA 1XH8A 2PVYA 3BU6A 4ACGA 3I6UA 4CYJA 1F0QA 4PPBA 2XJ1A 3TV4A 4AW0A 5EI2A 5EKNA 4DE4A 4WIHA 3AC1A 4E4LA 3O96A 1Y57A 3I4BA 5AX3A 2PL0A 2YCFA 3D2KA 1CMKE 4V04A 4DFLA 5IA3A 3P7CA 2JAVA 3R7UA 3CLYA 4EJNA 5K0KA 2IW8A 4ZAUA 3ZTXA 4E73A 1PXKA 2VTLA 2FA2A 3H3CA 2XIYA 4L7FA 5L8LA 3CXWA 5TKDA 3DGKA 4FKUA 2BTRA 3DKFA 3QQHA 3NS9A 5KZ0A 5CQUA 4R7HA 4DF3A 2FVDA 2OF4A 2X81A 1DI9A 2C30A 3CR0A 3G33A 3OFMA 4ZZMA 3DAEA 3KF4A 2QKWB 3LLTA 3KXMA 3P23A 3AD4A 3Q9XA 4YTCA 5K4JA 4FV8A 3R00A 2R3MA 5ANIA 4FKGA 2IG7A 1H00A 4M13A 3GCPA 3QRTA 4F70A 4H3PA 3JY9A 4IZAA 2XCHA 5M4CA 2VTNA 5EYKA 2YLFA 3P4KA 3F66A 5CSHA 3TKHA 5CAQA 2YIYA 1PMUA 2VTPA 2FO0A 4FIIA 2JIVA 4ANNA 1O9UA 3HMOA 3HECA 5L8JA 4J8NA 5CT0A 4II5A 3W2PA 4E3CA 3KN6A 2OG8A 2J51A 4FBXA 4R5SA 5AP4A 3RCDA 3T9IA 3VAPA 2XBAA 5FBOA 4F0FA 5IPJA 2HY0A 1PXOA 4BKJA 2JBOA 2RFDA 2OXXA 1BMKA 3BWFA 2GTNA 3AMYA 3E92A 2CLQA 2PUIA 2P2HA 2PZYA 3TKIA 1GZNA 4AN2A 1WAKA 3UQFA 4MXAA 4J53A 2PMNX 2QOBA 1P14A 1NY3A 2A0CX 2KULA 4O86A 2EB3A 3UVPA 4C02A 2QO7A 3QQUA 1QPDA 4DEDA 1A06A 4U42A 3RPSA 4UYAA 2HK5A 2QOOA 2UW5A 3EWHA 4AP7A 5B0XA 4ORKA 3QAME 5J9LA 2BHEA 2OZAB 4FKLA 3FPMA 3IGOA 4C33A 4BGQA 5A4TA 5KMOA 3MH3A 3DKOA 4XRLA 2YJSA 5I9ZA 3FXWA 3M1SA 3OCBA 4L00A 3UQCA 2R9SA 4D55A 4F1OA 2VNWA 3F3ZA 3QX4A 4RIWA 4BCKA 1ND4A 5HTBA 4FV2A 2BROA 2ESMA 5DGZA 1ZYCA 4NM7A 4AXAA 2YCQA 3SRVB 4HJOA 4XOYA 3GCVA 2J0IA 2QO2A 3CJGA 3PSCA 4FTUA 4DEHA 2ITOA 3ZYAA 4F64A 4QMXA 3V6RA 1Q5KA 3WYXA 2GPHA 5IQFA 2OFUA 2CHLA 2XMYA 3G0EA 5HG7A 2F4JA 3M11A 5LXMA 1FPUA 3RVGA 3ZC5A 5IDPA 4F9YA 3MWUA 3BYSA 3PWYA 1FMOE 5AJQA 3I79A 4CMOA 4ZTQA 4JLCA 4EWQA 4UMQA 3W1FA 4RT7A 3HUCA 4X2GA 3P0MA 2C5OA 2LAVA 2QURA 4DFYA 2QLQA 4XP3A 2C5XA 4D28A 3PA5A 4G9CA 4YPSA 1KUTA 4Y8DA 3NUXA 1KWPA 4KIKB 3VC4A 2F57A 3ZO4A 4HVHA 3TUBA 5FP5A 5JEBA 2UVXA 4IAAA 4R1YA 4FTQA 3D83A 4PTCA 5CEQA 3G9LX 4BDBA 4WRGA 5LVNA 1BL6A 1OKWA 4CMUA 2JAMA 4CEGA 5D12A 1ZY4A 4N0SA 4U43A 4RJ4A 3DCVA 4N6YA 2HENA 4QP8A 2XBJA 5JMSA 1WBSA 1JSVA 5IEYA 3KRXA 3CEKA 3RKBA 2QOKA 4FKTA 4CLJA 3D5WA 4FL3A 3JVRA 4K8AA 4PWNA 4Y5HA 4UMTA 4E1ZA 3VBVA 3NX8A 4FR4A 5D41A 4CV9A 2R3HA 3MS9A 1Q41A 4XLVA 4ZZOA 5CF8A 4MBIA 2XZSA 4FT3A 5DI1A 5IQBA 3COHA 4QMYA 5FLFA 4ASDA 3G6HA 3TNHA 3SLSA 2R3LA 2GNIA 3EOCA 4OTPA 3I1AA 4FKOA 5EQEA 4MD9E 4RFMA 3K5VA 4FYOA 3QZGA 2QOHA 2ITTA 1SVEA 5F20A 4RPVA 4A07A 4UZHA 3JVSA 5DR9A 3WILA 4AFJA 4GT3A 4UN0C 4IVBA 2OLCA 4AF3A 1PY5A 4C4EA 5KMIA 5H2UA 4BGGA 2R4BA 2R5TA 3O8UA 3AG9A 4OBPA 3VS6A 4KWPA 3BRBA 5DT3A 2FYSA 3LM5A 4RVLA 3RP9A 4L42A 2O3PA 5A6OA 2X0GA 3E63A 4GW8A 3GOPA 3CQWA 4GK3A 5GJFA 3QALE 5FDPA 2Y9QA 4Y72A 4GUEA 4IWOA 4L7SA 4F09A 4XBUA 2R3OA 4Q2AA 2ZM1A 4RGJA 5CSVA 2CLXA 3LFAA 2BDJA 4ERKA 1AGWA 4E5AX 4A7CA 2W1IA 2YM5A 3NMUF 1V0BA 3CJFA 5L6OA 4YJUA 2XP2A 1MQ4A 3PVGA 4LGHA 3ACKA 3BLRA 1WFCA 4PF4A 4TRLA 3KXZA 5BUJA 3KVWA 3FKNA 2OO8X 4GG7A 4C3FA 4OT5A 4GYIA 3H9RA 5CSWA 3TCPA 4QYGA 3ZSGA 5B2LA 2BZHB 3V01A 4O84A 4GT4A 5HX6A 1U5QA 3LQ3A 2NRUA 2GQSA 4EOKA 4O1PA 3FHIA 3QC4A 3AD5A 3NNWA 5A4CA 4RIYA 4BC6A 3LJ0A 4BDCA 3A8XA 3D5XA 4HYHA 4D9TA 1H1RA 2X8EA 3CCNA 4YTFA 5B2KA 4I20A 4F7JA 4DEEA 2PUUA 2UW9A 2NPQA 2R3GA 2C3JA 3C5UA 2BAJA 4M84A 4A4LA 3EIDA 4DG0E 1JKTA 1SM2A 2IO6A 4ANSA 1M52A 3PRFA 5DR2A 3TZ9A 4EK4A 3D0EA 2ZDTA 3ACJA 4BTFA 4GKHA 3QRUA 3L1SA 2I0YA 4WRSA 4HGEA 5E8UA 4UX9A 1NT2A 2UZDA 3DAJA 5M57A 3ODZX 2UZOA 4XMOA 2BPMA 4RX5A 4DH8A 1NW1A 2QU5A 2QOQA 4EOLA 4QD6A 3SG9A 4QMMA 2OGVA 4F65A 2ETRA 4FYNA 1J91A 1OL7A 5FEDA 4ZLYA 2R64A 3ZXZA 3LMIA 3CBLA 3ITZA 5EM7A 5AUXA 2O8YA 4S32A 4IWPA 5GZ8A 2C4GA 3GP0A 1Q8UA 5GIPE 4QTDA 4G31A 1Y8GA 4XCUA 5AUWA 4BI1A 3NUYA 4FZDB 3KXXA 4FOCA 2W9ZB 3BE9A 5ETCA 1OBGA 4WKQA 4QYYA 4O21A 5E8SA 4BCJA 2W4OA 3PRIA 5CVGA 5KMJA 3NVKI 1P5EA 2CGXA 3QYWA 5LWMA 4TY1A 2W5AA 3H0ZA 4C4FA 1RJBA 4XBRA 1YI6A 1DAYA 3MIYA 1U54B 5AUVA 2YM4A 1XKKA 3DU8A 2ERKA 3RI1A 1VEBA 5HORA 4AW2A 3BWJA 2UZTA 3P79A 2EU9A 3R0TA 5KX8A 2PYWA 4NW5A 3TI1A 2O5KA 2VTJA 3D5VA 3HL7A 1U4DA 3KB7A 1MRYA 3BYMA 5DBXA 5M08A 2J7TA 3EQIA 5HOAA 4HGTA 4EHEA 2AYPA 3DZOA 3JUHA 2JDOA 4EZ3A 2JBPA 1Q3DA 3IW5A 3GFEA 3A2CA 3JS2A 3BQRA 3QQGA 4HVGA 5GNKA 3AD6A 5HI2A 4ALVA 4RQVA 4QYHA 2CCHA 4WD5A 4HZSA 4EC8A 3DFAA 5K5NA 3NYOA 1NXKA 4EHVA 5F4NA 4QMZA 4YJOA 1DAWA 3NYXA 3FDNA 3GCSA 2XF0A 4K2RA 1UNLA 4IAYA 1IAJA 5TT7A 3HA8A 4ZY4A 2YN8A 2QOIA 4L3LA 3PJ2A 3ZZEA 5CANA 4NKSA 3R8PA 1S9IA 3DFCB 3VBYA 3G15A 3CGFA 3MSSA 3PXQA 4I5PA 3GOKA 5IH6A 2C6TA 5M4UA 3ZM9A 4CLIA 5JZNA 3UNKA 3ZLSA 3E88A 4FKPA 3TZ8A 5E8ZA 4EORA 5C9CA 3NUNA 3QTIA 3MY1A 3HV3A 3F6XA 5B7VA 1XQZA 2Z7RA 1NVSA 4OTQA 2RFSA 4MQ1A 4J52A 2Y6MA 1Y8YA 4MAOA 4H1MA 4RWJA 3UOKA 2WHBA 2YCSA 3QD2B 3AT3A 3RHKA 5CEMA 4HCTA 2V22A 3UNJA 2V62A 4AA0A 5I9UA 4FUXA 3FSFA 4X2FA 2G2IA 2GNLA 4NWMA 5JGAA 3GENA 3GEQA 3BCEA 4EHGA 3DXNA 3POZA 3ZZWA 4GFOA 2VTHA 5A4QA 5HO7A 4D1ZA 3VUIA 5CNNA 2XEZA 4C35A 1G8SA 2B53A 3GC0A 2H8HA 3VBXA 3W18A 3AOXA 4EL9A 3OBJA 4E8AA 4NFMA 2YAAA 4QNAA 2VWZA 5IISA 2PY3A 4U9AA 5CAPA 4H36A 5LMBA 4TPTA 4JNWA 3R9DA 4UMUA 3UPXA 4L6QA 2X2MA 4FK6A 3NNVA 4AN3A 2PUNA 2QI8A 2I1MA 1LEZA 4E4MA 3FY2A 4FG7A 2C3KA 4PMMA 4OTWA 3F5GA 3OWJA 5CALA 2UW4A 4ITHA 3HDMA 4YZNA 3PVUA 3MFSA 2VGPA 1ZMVA 3MJ1A 2XRUA 5EDRA 1PXJA 1YRPA 4NT4A 3RPRA 3ZDUA 3V04A 4E7WA 2HCKA 2XK4A 3KCFA 4LV5A 3ZC6A 4USEA 3PXYA 4WNPA 5LMAA 4EQMA 4AU8A 2RKUA 4AGDA 1YHWA 1MRUA 3OS3A 4EBWA 4DBNA 4OTIA 4ACMA 2Z8CA 5EQYA 3QQJA 3PWDA 4IBMA 4O0VA 4ASEA 5JFVA 3C0GA 3VWAA 4G34A 4BDDA 1RQQA 5CYIA 3UMWA 1PXPA 4CT2A 3R02A 4YJRA 5AM7A 2GNGA 2HAKA 1KE8A 2GSFA 4JVGA 4MWHA 4ZMFA 5KCVA 3NEWA 2ITZA 3POOA 3FI8A 5HU9A 2GS6A 5IG1A 3L8SA 2PHKA 2VUWA 4FKWA 4FSWA 4BCHA 4BIBA 5AP6A 5HEZA 3MH1A 2QR8A 5JRSA 1YOLA 3W2QA 5HE1A 3WE8A 1WCCA 5KE0A 3ZONA 1TQIA 5IA4A 1TVOA 3CQUA 1F3MC 5DA3A 5LVOA 5AV2A 3WF5A 3NRMA 3FV8A 3UIBA 3BHYA 3IKAA 1LP4A 5HICA 4OBOA 4ZK5A 3TUDA 4JX3A 3QZIA 1HOWA 2GHMA 1ZARA 2I0EA 3BLQA 2QO9A 3EFKA 1V1KA 2PVKA 5FUTA 2PE1A 3C4WA 4GJ3A 1IEPA 4ZJJA 4U80A 3E93A 1KE6A 3ZFMA 4QMOA 4EQCA 1JBPE 2FGIA 2R3JA 1H25A 3Q96A 4OT6A 5KZIA 4BWXA 3F3TA 5IEVA 1B6CB 3FZRA 4M7IA 5DG5A 3DK6A 3PPJA 4BTJA 3MW1A 1FBNA 4RA4A 4DT9A 4IVAA 3LAUA 3RK9A 4FT0A 4B99A 1XJDA 3DAKA 4JQ8A 4EEVA 5H8EA 1B39A 1WBNA 2F2UA 3HRBA 4Q5HA 3RAIA 2HOGA 4EZ7A 3EQFA 3PSBA 5HKMA 3FMDA 3PIXA 5E4HA 4XG2A 2IVTA 2WTCA 3FMNA 4IFGA 4OTFA 2GDOA 2OIDA 1ZMUA 5TF9A 4F6UA 3ZFXA 4DGLC 1OL5A 5M4FA 1UKHA 3VS0A 4I0RA 4QMVA 5FXSA 3GU6A 3LQ5A 4RC3A 2XNEA 2BKZA 4JXFA 3EN9A 4FIFA 1VJYA 3FLSA 1F5QA 3HA6A 3FLYA 3HRCA 3Q2MA 4MYGA 4XNEA 3RALA 4XV2A 1G3NA 1OKYA 4EK3A 5LMKA 3GUBA 4YZ9A 1QPCA 3VO3A 2GTMA 2OXDA 2XK3A 3BELA 2AC5A 4Z7GA 4ZZNA 3D4QA 3F2NA 5AR5A 5LQFA 1GZ8A 3W32A 4YUQA 3S0OA 2CNQA 5IQAA 4KBCA 3VN9A 4F08A 3TJDA 5E8YA 2BFYA 2C1AA 2XJ2A 2YLEA 4ZSGA 5AV3A 1CKJA 2VWUA 3TNIA 4WUAA 3CD3A 4DFNA 3PVWA 2YDIA 4KA3A 1BLXA 4KABA 4NTSA 5CQWA 4BTMA 4RJ6A 5J79A 3PVBA 4I3ZA 3MPAA 1JLUE 4YJPA 2UW8A 4JBVA 5L3AA 3AQVA 4ONAA 2C6DA 4AZTA 3KC3A 2QVSE 4G1WA 2JC6A 1YOJA 2WMAA 4EH2A 4F0GA 3JPVA 3LXKA 4FE2A 3BV2A 2YJRA 4AZFA 5J5SA 2H9VA 3RZFA 1P4OA 3E7OA 1JAMA 4MD8E 4YNEA 3VS5A 3LQ8A 4L52A 3KREA 3OP5A 5JN2A 4WSYA 1OM1A 4CFUA 5DE2A 2QHNA 2OIQA 3FEGA 3ORMA 2Z02A 3ORIA 4N4SA 3OWLA 4OAVB 3L9LA 3MVHA 5KO1A 4MXYA 3WZKA 3OXTA 5BNJA 3LHJA 4D9UA 4K6ZA 4KSQA 4RFZA 1MRVA 1WBWA 3PG3A 4XV9A 3OD6X 2B0QA 4K18A 3FUPA 4JDIA 3NDMA 1KOBA 4KS8A 4ZS4A 2R3NA 4MH7A 3FZSA 5HNGA 2YWPA 4A9YA 2ZAZA 4FT9A 2W1FA 3EQBA 4APPA 3B8QA 5IQGA 5C4LA 1XO2B 3O8PA 5C03A 5I5ZA 2VTIA 2IVUA 4BIEA 4NM0A 3D9VA 5HZNA 2CNVA 4GVJA 2O63A 5IA5A 5CASA 4PL5A 4CKRA 4DA5A 2X2KA 2B7AA 4NU1A 1OPLA 1ZOEA 3NSZA 3CD8A 3ET7A 1LPUA 2BFXA 2C3IB 4DLIA 4ANQA 3F69A 4FKIA 4FK3A 4S30A 4CZTA 4F9BA 2FH9A 4KIQA 4LOQA 2GS2A 3E62A 4FSUA 1IG1A 4GCJA 4RJ8A 2FSLX 3BEGA 3LW0A 5ETAA 3NW6A 4UBAA 4XLIA 5FEEA 5BPYA 4E5BA 2H34A 2Q0BA 5HESA 2XK6A 3L9NA 4HW7A 3OZ6A 2OU7A 2XK8A 3MI9A 3KY2A 3QD3A 2YHVA 4YC3A 1ZMWA 5K5XA 3EQRA 3MA3A 4B9DA 2VTOA 4FNXA 4M0YA 4BHZA 2JKQA 2Y7JA 5K9IA 5GHVA 4OTDA 1JNKA 3QRKA 1BL7A 4MNEA 1IRKA 2R2PA 3H30A 2WQEA 4L68A 2GHGA 4QPAA 4FTKA 4L67A 1E9HA 4JJRA 4KRDA 2H6DA 2Q83A 4X7QA 4TXCA 1K3AA 4EH4A 3C4EA 1OZ1A 4U44A 4F1TA 4FOBA 5I9WA 2BRBA 1X8BA 2JDTA 4HGSA 4IJ9A 1FQ1B 3SXFA 3CQEA 5HGIA 3TZ7A 5F95A 4PPAA 4DT8A 3OY3A 4C4IA 2Y4PA 4O0WA 4DCEA 5CENA 2QOLA 5GJGA 2PVFA 4DGGA 5E8XA 5IDNA 2CGUA 4LRJA 1AQ1A 1Q97A 1YXSA 2FSMX 4YO4A 3UGCA 4AA5A 2CPKE 4DH5A 3PG1A 2B9HA 4C0TA 4L9IA 2CN8A 2XH5A 3V5PA 2C1BA 1H07A 3PIZA 5DOSA 2F7EE 2J0JA 2C6IA 4R5YA 5IQDA 4C2WA 1JSUA 3BU5A 2IVSA 3EQGA 4MCVA 3NR9A 5LVLA 4QMUA 3D7TA 1GNGA 3LFDA 2WTDA 2YITA 3KMUA 1R0PA 3LM0A 4G3CA 4J97A 3KQ7A 2B9JA 1Q8WA 4MK0A 4YURA 4D0WA 4FEQA 4O2ZA 3T3UA 4NEUA 2C0TA 1XWSA 2B4SB 4GSBA 4IZ5A 4W4XA 1DI8A 2XUUA 4EH6A 3N9XA 1H08A 1UWJA 4FV4A 5H3QA 4AOJA 2B9IA 3NLBA 2J5EA 3HAVA 1JWHA 1U5RA 1XBCA 4HPUE 5LOHA 3ZM4A 3LFNA 3PP1A 3QHRA 4GUBA 5H9BA 4UMRA 3REPA 4YSMA 4W9XA 3BHUA 5GJDA 2XNMA 1KE7A 3FBVA 3LXLA 2HWOA 4O0XA 2X9FA 2B54A 5CU4A 1REKA 2P33A 5AP7A 5TR6A 3F2RA 1XBBA 3PZHA 1REJA 4R3RA 4IE9A 4EUTA 4ENXA 4JS8A 5C8NA 3C4FA 1O6KA 2BRMA 3H4JA 3TT0A 3MTFA 4DG3E 4V05A 1TQMA 3QXOA 2XCKA 4BCGA 3UPZA 2XNOA 4QPMA 4KD1A 3UIMA 4JQEA 2V55A 4AT3A 1JQHA 4CSVA 3SHEA 5D7VA 5I9XA 3WF8A 5HE0A 3Q6WA 5EW8A 2W05A 4ZXTA 3ZFYA 4BF2A 3EFWA 3O50A 4A4OA 3DJ5A 3LFQA 4OW8A 3DV3A 3R7EA 4BDEA 5BYYA 2W1ZA 4DN5A 4CTCA 2NRYA 3TJCA 5KMNA 3SOAA 2HIWA 3RAWA 4Q5EA 4X3FA 5F94A 4O7YA 3FSKA 5C26A 1ZYLA 4DFBA 1P2AA 3NAYA 3HV5A 3GCQA 4IM3A 4C8BA 2B9FA 1WBTA 3QCXA 3NPCA 4NH1A 5IH4A 4IDTA 2OK1A 5HCXA 2EXCX 3EQDA 2QOFA 1GIHA 5B2MA 1YKRA 3QU0A 4A9UA 4BFMA 1W8CA 3RK7A 3AMAA 5AR7A 4QP3A 2BAQA 5EI6A 4CFXA 4N70A 4BICA 4G3DA 3FZPA 4O7SA 4FV9A 2E9VA 4D2VA 5JQ8A 4IHPA 1XR1A 2VWVA 2QC6A 4OR5A 3N4VA 3VRZA 2HXLA 5JZJA 5HBHA 2V7OA 3Q2JA 1CM8A 4FMQA 4AAAA 3A7GA 4EOSA 4GIHA 4F1MA 4YTHA 3PXFA 1URCA 1TKIA 2G2FA 4FF8A 2OKRA 4NM3A 4YHJA 1J1CA 3BKBA 3PPKA 1XH9A 1ZAOA 3A4OX 4U45A 3PDTA 4H1JA 3MBLA 2BRHA 3OG7A 5ACKA 4EUUA 4PX6A 3C51A 3V8SA 3MJ2A 5DIAA 4FKSA 4AZEA 3HZTA 2UZBA 2WMXA 3Q5ZA 3HYHA 3E87A 3ZUUA 4LUEA 3H9OA 3IPHA 4R77A 4A9TA 4YO6A 3UIUA 2GFCA 4EOOA 3JR1A 4W8EA 4CGAA 5TO8A 3SG8A 2GNJA 4C37A 3QZFA 5AP5A 1URWA 3H9FA 3QTRA 4Y73A 5ETFA 3BX5A 2YCRA 4AW5A 2IZRA 3LFCA 3IECA 3SKCA 4RJ5A 5C4KA 2RG6A 1GJOA 3OUKA 4XH6A 1U46A 4RIXB 4CZUA 2UVZA 3L8VA 1IA8A 4IX4A 3LFEA 5AUYA 2VWWA 1Q62A 1YXTA 4FUYA 2YDKA 2ONLA 4IB5A 1MQBA 5BVKA 5AM6A 4R7IA 4MBLA 3NW7A 4QO9A 2R7BA 4W4VA 4ALWA 3Q9YA 5M55A 5AAGA 1R1WA 3ROCA 3RNIA 3D2IA 3QKKA 2J0LA 2W1DA 1GOLA 3KN5A 5J5TA 4IM0A 4LG4A 3ZSIA 4X3JA 4U3YA 5JFSA 3V8TA 1VR2A 4KKGA 3RGFA 1TQPA 3KA0A 4H3QA 3ETAA 2JITA 4J1RA 4TWOA 4NZWB 4U97A 5HU3A 4XG9A 3NNUA 3OY1A 4OAUC 5C01A 4WG4A 5JSMA 3KXHA 4TNDA 3DBQA 4PTGA 5CT7A 4C4GA 3SAYA 2OI4X 2XA4A 4ACDA 1W82A 4C3RA 2LGCA 2WGJA 2R3IA 2VTSA 4AACA 4B8MA 3VBWA 2PUPA 1PXIA 3CTJA 4C4HA 5J7BA 3A61A 5HX8A 3QRJA 5AR4A 5ITAA 5KMKA 3C5IA 1UU3A 3T3VA 4BI0A 4TYIA 2ITPA 2BVAA 3SOCA 3IW6A 5IA1A 3KRLA 4UY9A 4O7VA 2X7GA 4BCQA 4KAOA 3QGYA 3PIYA 3ZH8A 2F7XE 5E1EA 3DNDA 4OTHA 4ZTRA 2XM9A 5CZHA 1UU7A 3R22A 4E20A 2C6OA 3RWQA 2JDSA 1JKKA 4RX9A 4OGRA 1M7NA 3OCTA 5IZFA 3BPRA 3KULA 1SMHA 2PVMA 4DFZE 4U81A 2PVNA 4C34A 4IZ7A 4MXCA 4QMWA 3RTPA 5EM6A 4FTMA 5A9UA 3MFUA 1WMKA 4NCTA 1KE5A 1BUHA 4UALA 2XB7A 2W9FB 2VX0A 1Z9XA 2JFMA 5FWKK 2C47A 4RJ7A 2X7FA 4ZJIA 4WG3A 3EKNA 3QLGA 5EHYA 5CX9A 1T46A 3NVMB 4CFMA 5IQIA 1J1BA 1QMZA 1OIQA 5IF1A 4XG8A 2R3RA 4B0GA 2YA9A 4BCMA 4FEWA 1NVRA 4V0GA 5TE0A 4AZWA 2DUVA 3IGGA 2NNWB 4BL1A 1Q8TA 2W7XA 2GNHA 2J9MA 1VYWA 3KMMA 3LFFA 3LVPA 2W17A 3P9JA 5A4EA 2P4IA 4UWYA 3HV7A 5EYCA 4I6FA 5CS6A 3W55A 1PYEA 4C4JA 4WT6A 3CY2A 3VQUA 4H58A 3NAXA 2H96A 2PWLA 3HP5A 2XYUA 4FTNA 4O81A 5T3QA 5EYDA 5AADA 4AGWA 5GZAA 1Q24A 2JKKA 5CU0A 3OEFX 4TYHB 3R28A 2XK9A 3LCTA 3RNYA 1YW2A 5KUPA 3KRWA 5JT2A 2R3KA 3MFRA 3CE3A 4O6EA 4AA4A 2QQ7A 4I1ZA 4X6RA 2VD5A 3D94A 3BYUA 3R8UA 4CV8A 4GH2A 4TNBA 3LOKA 1R3CA 3QTUA 4AZVA 4Z9LA 4BRXA 1J3HA 3OWPA 4FEVA 4DITA 3W2SA 2WZJA 1O6LA 4FTCA 3C1XA 2WPAA 2A1AB 5AV4A 3DB6A 2ZV7A 4DCAA 3R1NA 5HO8A 3EZRA 4EONA 3QTXA 3VBTA 4E6AA 2VTRA 2PULA 1Y6AA 4M66A 2Z7SA 2GQRA 3U6HA 3CY3A 3VS2A 5JQ5A 3VW6A 2QHMA 2UZWE 2ZJWA 4PV0A 5IKWA 3V8WA 3VUTA 1FMKA 5HTCA 4BWPA 2DWBA 5HLWA 3K3JA 1YHSA 3O23A 4K1BA 4L8MA 4QQ5A 4QYFA 4RG0A 5E91A 3ULIA 3WZUA 1KV2A 4EH8A 3BU3A 3Q04A 5BVFA 5M44A 4IACA 5DLSA 3VF8A 2QODA 4G3EA 4CZYB 3KMWA 4FSZA 1APME 3MGYA 5AEPA 3VS3A 5BVOA 4DTBA 2FSTX 1M7QA 2UW6A 3E7VA 3EKKA 3KL8A 4IWDA
chains in the Genus database with same CATH superfamily
4RWLA 5K3YA 4FTJA 1SYKA 3QTSA 5DRDA 1JOWB 3EFJA 3ORPA 4IAFA 4M3QA 5HNBA 2WQNA 4JG8A 2WTWA 4IJPA 2YM8A 2IW9A 3ZU7A 4USFA 3ZLYA 5DEWA 4R1VA 1UKIA 2WD1A 5A3XA 1ZWSA 2G2HA 4QMQA 2W0JA 4ZJVA 2O65A 4NW6A 1OUYA 3PXZA 3VUMA 2G9XA 2QNJA 4PL3A 2E9UA 4FZ6A 5I0BA 4CFVA 2W1HA 1H8FA 4ANBA 3ENMA 3OXIA 1U59A 1OL1A 4FI1A 4JG7A 5I9YA 4IAKA 4C59A 4JRNA 5L2WA 3AMBA 4FC0A 4O0RA 4D2SA 2OIBA 3DTCA 1HCKA 4DH1A 4RA5A 4FSQA 2HW6A 3F3VA 4M15A 2QU6A 5AP2A 2OZAA 4YBJA 4DYMA 4FKRA 3OOGA 3RHXA 3DPKA 4IB1A 3CSVA 1PXLA 2W96B 3WF6A 3NCZA 3PLAE 4O83A 2B52A 1QPEA 2PZ5A 3COKA 5EM5A 3L8XA 2BRNA 5DR6A 4XRJA 4RVKA 3S4QA 4EWHA 1JSTA 2OH0E 3COMA 3GB2A 3FJQE 3FQHA 3SRVA 2W4KA 4ALUA 4LOOA 5FXQA 1OBDA 4ITJA 2CKQA 3C50A 4L01A 1YWVA 2ITWA 3QXPA 4KB8A 5D1JA 2WXVA 3NIEA 4ACHA 3UDZA 3MVJA 3EN4A 2EVAA 3I81A 4MTAA 1PMEA 4DEGA 3F7ZA 2SRCA 2O64A 2OJ9A 2XVDA 3Q4ZA 4ZOGA 4BDKA 3OXZA 4IEBA 3SXSA 1ZOGA 4PRJA 4BKZA 4O91A 4BBEA 1QPJA 4F9WA 2OF2A 3ML1A 4JIKA 3EHAA 4P5ZA 3ORZA 4PY1A 5CU6A 4O27B 3DBEA 4FL1A 1GY3A 1UNHA 4O4CA 5FM2A 4G17A 5CU2A 4BDHA 4R3CA 4KIKA 2CDZA 1Q8ZA 2JDRA 3B2TA 3ZO3A 3KRJA 3HNGA 4O7ZA 2VX3A 4I5CA 4TW9A 4CG9A 4J98A 4F9AA 2BAKA 3GT8A 3MB7A 5FRIA 2WMWA 3IQ7A 4QP4A 4UWCA 3K2LA 4FTLA 4GVAA 2J6MA 2BILB 1OIYA 4MXOA 4E6CA 4PPCA 3KCKA 4B6LA 2WIPA 3FMLA 3LPBA 2YIXA 3LXNA 3SX9A 2R7IA 4IADA 4M69B 1W98A 1FOTA 4TYJA 5EW9A 4MXZA 2FB8A 4D58A 4ZTSA 4BYIA 1DM2A 5EYMA 4IIRA 3ENHA 3RZBA 4X6QC 3BE2A 3BV3A 5JGBA 3S00A 3GU5A 5EQPA 2E9PA 3P7AA 5CEPA 4YR8A 5ANKA 2QKRA 2RFEA 3A4PA 3AGLA 4ZSEA 3FMMA 1OL6A 2V0DA 3AC3A 1L8TA 3G5DA 3OCGA 3W16A 3R73A 4G3FA 3R6XA 5TOZA 3CKWA 4D5KA 2XJ0A 3BHHA 5J87A 3QHWA 3R8LA 3I0QA 1UU9A 3FMHA 4RWKA 3QQLA 5K4IA 1J7UA 4PUZA 4FNYA 3G6GA 4DEIA 3NZ0A 3F3WA 4ZTNA 4O7TA 3DLZA 3JYAA 4AE6A 3TTIA 2W4JA 3PJ3A 4O7NA 4Q9SA 1W2CA 4UZDA 5EHOA 2PU8A 5KHXA 3N4TA 3OEZA 4J8MA 2Z2WA 3HGKA 3L9MA 4P90A 4U40A 5EK7A 3C4XA 5IEXA 3OW3A 3HV4A 3R2BA 3PXKA 4NIFB 4DG2E 1PXNA 2W99B 4NKAA 5KMMA 2NP8A 2RG5A 3KVXA 4RBLA 1PKGA 4NK9A 4QPSA 3MB6A 2GMXA 4XG4A 3V6SA 4ERWA 4GK4A 4I24A 1YHVA 4FL2A 1YXUA 2W5HA 1ZLTA 3D14A 4CFWA 2WAJA 3UZTA 2IJMA 3Q60A 3SV0A 2F7ZE 4O38A 1G8AA 1OL2A 2R3QA 3VUGA 2JD5A 3QCYA 3R2YA 2VWIA 3E3PA 3QA8A 3CPCA 2BDFA 3ZLXA 1BKXA 4CKIA 2WMBA 3FMJA 3PP0A 1PJKA 4EYJA 4QQJA 3IOKA 3ORKA 3AC2A 2WTIA 3LFBA 4PDSA 3I60A 2V5QA 4A06A 1SVHA 1G5SA 3DOGA 4TYEA 1OVEA 4QQCA 3V5WA 3NUAA 4DFUA 2HZ4A 4O1OA 2J50A 3ZLWA 4FTIA 4IC7A 4BZOA 4ASXA 4N6ZA 3DKCA 5CXHA 5C27A 2O0UA 4XUFA 1OPKA 3QF9A 4GK2A 4G2FA 4CQGA 3AC4A 3FI4A 4LFIA 4IVCA 5J9ZA 3FQSA 3UDBA 2YM6A 4H39A 5H8BA 4QP2A 2OICA 2CKPA 3TDWA 3QC9A 3NYVA 5DRBA 2I6LA 5IH5A 2WTKB 3V5QA 5BMSA 1W2FA 5JH6A 3E5AA 1YVJA 4IX5A 4O0UA 4CCUA 5AWMA 1XMMA 2J2IB 2WTKC 4PMTA 4YGAA 3F2AA 3RJCA 2I0HA 4R6VA 1M17A 1PRYA 3GXLA 4Y46A 3UOHA 3FLNC 1BI7A 4C58A 4CXAA 5AUTA 4JI9A 4X2KA 2PMLX 4HYIA 4ZSJA 2OW3A 3EB0A 3EL8A 4NTTA 2OXYA 4RX8A 3BBWA 3C0IA 4CD0A 3BZ3A 3ZXTA 4NJ3A 2KTYA 1YWRA 2EUFB 2XIRA 4FT7A 3R8ZA 3ROYA 2UZVA 2XIKA 4U0IA 4ZSAA 3F5XA 4XV3A 2UUEA 3TIZA 4WBBB 5EG3A 1LUFA 2PVJA 4XEYA 4YHTA 1OPJA 1L3RE 2XIXA 2GHLA 2IZSA 3BQCA 3QQKA 5ACBC 1SVGA 3W2RA 3R7VA 3MFTA 1I09A 4RIWB 4R8QA 3DK3A 2EB2A 3GNIB 2HYYA 2XNBA 5E8WA 3RAHA 3ZDIA 4C36A 5ICPA 1V0PA 4Z16A 5IQEA 3AXWA 4YU2A 3OROA 5M4IA 4DEAA 1OKVA 3DS6A 3GU4A 3IS5A 3DXPA 4XP0A 4LGDA 3MYGA 4EOMA 5J9YA 3QCQA 4MF0A 3SC1A 5AV0A 2UVYA 3COIA 4GV1A 4G9RA 3OBGA 5I4NA 4S34A 5BVDA 1U54A 4HCVA 1W0XC 4Z7HA 2ETKA 3ALNA 2X1NA 3IK3A 3R83A 4BB4A 5D10A 2YZLA 4FIHA 4TYGA 4D1XA 2PPQA 2C68A 4CRLA 2YISA 5ANJA 3UJGA 4LI5A 1YI4A 4OTGA 3ELJA 1WZYA 4C61A 4NM5A 4D2PA 3V51A 5DEYA 4FTRA 3RPOA 2P3GX 3THBA 2YZAA 3FXZA 2YFXA 2XKDA 4IH8A 3F3UA 3AGMA 3QLFA 4QMPA 4L53A 2WQBA 4X21A 3SQQA 4Z55A 4BR3A 5HNIX 2J5FA 2VNYA 2J4ZA 3V3VA 1UU8A 3O8TA 1LEWA 2ZMDA 2X4ZA 3LE6A 4G5PA 4G6NA 4GIIA 4MWIA 4RIOA 3U6JA 4E6QA 4U8ZA 4G16A 4X2NA 2C6KA 5JKGA 3D7ZA 2ERZE 4O82A 3KKVA 3LKMA 3Q53A 3FMKA 3FMEA 3JY0A 3D15A 3GCUA 2BIKB 3U87A 4TT7A 5J1VA 4MXXA 1Z5MA 1G8KA 5DVRA 2WTVA 4AGCA 3SDJA 3QL8A 3Q6UA 4J71A 1OGUA 4FVQA 4HVIA 2OJGA 4HNFA 3VS7A 5F9EA 3HP2A 5L6PA 3PY1A 4F4PA 3A62A 4JBPA 1J7IA 2PMIA 2ZV2A 2VTMA 2EXMA 2CGWA 3TV7A 4LRMA 3U6IA 4O0TA 3FLQA 5ETIA 3L8PA 5DN3A 2OJJA 4DFXE 4UMPA 1ERKA 2UW3A 3ODYX 4I41A 4ANLA 5CEKA 2BTSA 4IZYA 5FXRA 3MN3A 3QUDA 3E8DA 5BVEA 1TZDA 1CKIA 1R78A 2Z60A 1V0OA 2JIUA 3HUBA 5CY3A 4RLLA 2A4LA 2AUHA 4PQNA 3LJ2A 4HGLA 4YHFA 2ACXA 1H1WA 4YBKA 3EN6A 3FWQA 4F7SA 5FM3A 4EOJA 4RWIA 3NCGA 3P1AA 4DTAA 3O7LD 4BZNA 3QD4A 2CJMA 4F6SA 3EZVA 4FODA 4FV6A 2UW7A 4PP7A 1DS5A 1FGIA 3FI2A 5E90A 3QYZA 2OJFE 2UZUE 1QL6A 4RVMA 3RMFA 4ZLZA 5AA9A 4M14A 5HIDA 2B55A 3HV6A 1ZYJA 4JAIA 5IA0A 2F2CB 3QD0A 3R8MA 4C2VA 4FGRA 2QONA 2ZV9A 4I4FA 4TTHB 2JEDA 3E3BX 5FDXA 3SW7A 4AGUA 3TWJA 3W10A 2PZIA 3DZQA 3MVMA 4J99A 2W06A 3BEAA 4JDHA 5D11A 3TZMA 3ORLA 4MD7E 2C5VA 3F61A 4V01A 4H3BA 2VO6A 4APCA 4CYIA 4YMJA 3BL9A 4AOTA 4BBMA 3QGWA 3SGCA 4Y85A 2ITXA 3CC6A 5K0XA 1ZRZA 4YJQA 4YC6A 4CFNA 5HBJA 2CSNA 3HKOA 3O17A 4D1SA 4I92A 4TL0A 3EL7A 4QTCA 4W9WA 4QNYA 2FSOX 4UB7A 3PUPA 4ZY5A 4WG5A 4IW0A 3LLAA 2YERA 4RIYB 3UTOA 4DC2A 2F9GA 4L43A 4RC2A 4WNKA 4O4BB 4UYNA 1MUOA 3E8CA 4XX9A 4ZMEA 2PE0A 4NJDA 4KSPA 4DH7A 5AUUA 2VU3A 5E92A 2C0OA 3BYOA 1H24A 4RX7A 5KKRB 1EH4A 3ANRA 4MNFA 1OI9A 3E64A 5CTPA 4MUQA 4U5JA 3RPYA 3R71A 2P2IA 5KKRC 3MESA 4H05A 4CG8A 2WNTA 4FSYA 3HDNA 3VS4A 2XM8A 4EK5A 2WFYA 3A60A 3QBNA 5KBQA 5LCKA 2XANA 3I7CA 3RK5A 3F7WA 3G51A 1ATPE 4ZIMA 3PUFC 4PP9A 3TNWA 5M07A 2QCSA 2WU7A 2GNFA 3A7FA 4KBAA 5J95A 3UQGA 2ZM3A 2XNGA 4IANA 5ANDA 4K0YA 5CVHA 3NUSA 4W4YA 3ERKA 1JVPP 4Q9ZA 4DGNA 1XBAA 2VWYA 2VAGA 2HW7A 3F82A 1PMNA 3FYJX 3PLSA 4HYSA 3R9HA 4AE9A 4AZSA 3C0HA 3Q52A 3TMOA 2HXQA 3O51A 1ZY5A 4P5QA 4IMYA 5AR2A 3K3IA 3VUDA 5FG8A 1W7HA 3QCSA 3B2WA 2P55A 4XP2A 3TL8A 5CWZA 1BX6A 2X6DA 3DBCA 5F1ZA 4L45A 2DS1A 3VQHA 2YABA 3W0OA 3P08A 4LYNA 3ZO1A 4CFFA 5BMMA 1GZOA 2WEIA 2WOUA 4RRVA 4Y5QA 3S95A 4BCPA 4RSSA 4FA2A 3ZUVA 4KBKA 5M53A 4RFYA 4PDPA 5HVKA 3PA3A 4PNIA 3W8LA 1M2QA 2A2AA 5DWRA 4ITIA 3P78A 5HO6A 4JX7A 4EJ7A 3TNPC 2WOTA 3S2PA 3HLLA 1AD5A 4XV1A 3UVQA 4OBQA 3ZRMA 4AX8A 5T6KA 4AT5A 1ZOHA 3W0SA 3UNZA 2YDJA 3FLWA 2PVLA 1IA9A 4RVTA 2OZOA 5JRQA 4PMPA 5A4LA 4QDVA 3PJ1A 4AAYA 1ZYDA 3OT3A 4GG5A 3FZOA 3HRFA 4JDKA 5IA2A 4FSMA 1R39A 4AWIA 3BHTA 3GQIA 4C3PA 4GU6A 5A14A 5JK3A 4AUAA 3TYKA 1E1VA 3WE4A 4QMSA 3WI6A 3G90X 3R21A 4FIGA 4FKQA 3PZEA 3R30A 1YDRE 4BDFA 5HD7A 3MTLA 4MX9A 1UWHA 4TWPA 4GT5A 5FD2A 5L6WL 3DQXA 2PTKA 3W2CA 4BGHA 4IB3A 4MBJA 4FT5A 4AXEA 4QTAA 2VZ6A 3MH0A 4D4RA 5C1QB 4EOQA 4FKVA 2BCJA 3UYTA 1OITA 3R9NA 1VZOA 1XH6A 1YI3A 2ZV8A 3BIZA 1ST4A 4DEBA 4LV8A 1W84A 4E93A 5L2SA 3ORXA 3DBFA 2JDVA 4HVSA 3E8EA 4U3ZA 3LCSA 4D2RA 3WARA 3L9PA 3UOLA 4CRSA 5HE3A 5CAVA 4WNMA 5EOLA 2VTQA 3ALOA 5IUGA 3MDYA 4HCUA 1WVYA 1YDSE 2XKCA 4RLKA 3UC4A 3QKLA 4EKKA 3W0NA 2R3PA 4YZMA 1J7LA 4TWCA 4FV1A 4M97A 2X7OA 2YIQA 3N51A 3UC3A 5HIEA 4UXQA 3TIYA 4U41A 3AT2A 1WBOA 4I6HA 4LRKA 1OMWA 5J8IA 4C57A 4JRVA 5HVYA 5D9HA 3FC2A 3SA0A 1XHAA 2JIIA 2ITYA 3QTWA 3W0PA 4M0ZA 3ZS5A 4A9RA 2CKEA 4GFMA 5CLPA 2ZYBA 4LGGA 1NA7A 3FC1X 1OGYA 3FI3A 3Q9ZA 4R3PA 3LJ1A 3UVRA 3M2WA 1W83A 3V5TA 3ZBFA 3LIJA 4MQ2A 4XG7A 2XAMA 4EZ5A 2WTJA 1KSWA 5DFPA 4AW1A 5CSXA 5AP3A 2C5YA 4BCIA 2QG7A 3PJ8A 5CF5A 4R7BA 3W2OA 5AFVA 3U9CA 3PA4A 3BYVA 4B8LA 4YSJA 5CSPA 3JXWA 3WIKA 4EHZA 3KXGA 4WSQA 3R7YA 5CF4A 4BDJA 3F5PA 3ZCLA 2OH4A 4FTOA 3Q32A 5E8TA 4F9CA 3CIKA 4EBVA 2VRXA 2J0MB 3BLHA 5AIKA 3SXRA 4QQTA 2BHHA 1K9AA 1XH5A 2X6EA 3HVCA 5IQCA 3Q3BA 2IW6A 4IB0A 1Y91A 4KRCA 3DT1A 2PZRA 3VIDA 2UZLA 3UODA 4UEUA 3OT8A 2VWXA 3MPTA 4LMUA 4NUSA 3A99A 4F7NA 3NNXA 4YJTA 1FVRA 1H0WA 3BGQA 5DNRA 5I3RA 3FYKX 2IWIA 4PTEA 3I5ZA 3AKJA 3HEGA 4RZWA 3O71A 5CZIA 3IW4A 3BHVA 1KV1A 5T68A 4F7LA 4KUJA 3NW5A 2ITQA 5IMXA 4O96A 3EQPA 3VUKA 2C0IA 4IM2A 4DBXA 4O7WA 4U7ZA 1RE8A 4G5JA 4DHFA 4ZTMA 5CF6A 2EXEA 3OTUA 5L4QA 3G9NA 4GMYA 1WVWA 4B4LA 2IEWA 4BKYA 2JKMA 5HD4A 2R0IA 4QP6A 3RCJA 1P4FA 1CSNA 4EQUA 2X2LA 3MVLA 4EI4A 2W5BA 1Q8YA 2WMRA 2VTAA 3KGAA 3TDVA 2BUJA 1H1SA 2DQ7X 2J0KA 4M68A 4AS0A 4BDGA 1YWNA 2RSVA 3PFQA 3HAMA 4ID7A 2WU6A 1PKDA 1Q3WA 5AIRA 3CTHA 4G6OA 3BI6A 4NFNA 5JFXA 2X4FA 4CQEA 4XG3A 3UOJA 4YLJA 4EC9A 5J7HA 5ANGA 3C13A 3ZSHA 4PNKA 2ITNA 5D7AA 3HX4A 4F0IA 4B7TA 4FGBA 3EFLA 2HY81 4RJ3A 3WF9A 4FZ7A 3O5AA 3EYGA 3CPBA 4AXFA 3G2FA 2OFVA 4IC8A 3K5UA 5AX9A 1YXVA 2XS0A 3GC9A 4WNOA 4XYFA 3FHRA 3GGFA 3V5LA 4QP9A 2HZIA 1GAGA 1PF8A 5E8VA 3RAKA 4L3PA 5BX0A 3R7OA 4O0YA 4CKJA 3IONA 4IX3A 4NL0A 4BZDA 5HTIA 4L46A 1ZZ2A 4YZDA 2W1CA 4AN9A 4E26A 4EH3A 5DYJA 5AP1A 4JBQA 4E6DA 3VULA 1SNUA 3PE2A 2O2UA 4WBOA 5AAFA 1GIJA 5EDPA 5E9EA 5GIOE 4YNOA 4O0SA 5LMKC 3QWJA 4HPTE 4KKHA 5AP0A 4QMNA 5LJJA 4I6QA 1OUKA 1HCLA 3DJ7A 3EYHA 3TM0A 1Z57A 2BR1A 2AC3A 2BRGA 5C8KA 1KE9A 3UO4A 3WOWA 2E2BA 2VO0A 4LUDA 5EFQA 3RM6A 4JG6A 4XJ0A 2IZTA 4HYUA 4BHNA 3VS1A 3DB8A 3RPVA 5L8KA 4I0SA 4DLJA 2DYLA 1H0VA 3PY3A 3GFWA 3FE3A 3MV5A 1OB3A 4CNHA 4D5HA 4EH7A 4FTAA 4IFCA 2C6EA 5EKOA 3LCOA 5CXZA 4YZBA 3ORTA 4BIDA 4I6BA 4ZY6A 3OC1A 2BZIB 4ACCA 2PSQA 3FY0A 2Y0AA 4TKSA 4ZTLA 4W4WA 3RWPA 3TKUA 2VO3A 1B38A 3LZBA 5M51A 5G1XA 3DNEA 5CVFA 2VGOA 3BGZA 1PXMA 1FVTA 4EOIA 3EMGA 4DH3A 5LCJA 3OHTA 2BIYA 3OTVA 4EH9A 3I6WA 1WBVA 3FXXA 2ETMA 3GU7A 3TACA 3R8VA 3RM7A 2OWBA 3F9NA 4FEXA 3UO6A 1PHKA 4HZRA 4PDOA 4HVDA 4BDIA 2VN9A 4BJJA 3C4CA 4OTRA 2ZDUA 4FZAB 4F63A 3Q4TA 4ANMA 5FGKA 1O6YA 5CAOA 3PSDA 4FKJA 2IZUA 3P5KA 4IWQA 3UIXA 3U8WA 5GINE 1H26A 2EWAA 3U55A 4O6LA 2YACA 3TNQB 1M2PA 2W1EA 4I4EA 1H4LA 1M2RA 2RL5A 3CP9A 3I5NA 5HG9A 3UO5A 3WZEA 4FSRA 1RDQE 3RINA 3R04A 1JPAA 3N4UA 4NYEA 2CMWA 1OIRA 4Y95A 5H8GA 5EW3A 1SNXA 2GS7A 4RC4A 4XS2A 4YLLA 3NYNA 2YWVA 4QP1A 4CVAA 2C69A 1I44A 5EM8A 4C7TA 1RW8A 2C3LA 4IXPA 2BDWA 3SW4A 4HNIA 4L3JA 4LDTA 4ZP5A 4K9YA 4O2PA 4D4SA 3QUEA 3KEXA 5LVMA 2GQGA 5KBRA 3C9WA 2XNNA 3IW7A 4AQCA 2YEXA 3KK9A 4EYMA 1R0EA 5LWNA 3ZEWA 2XKFA 1MP8A 2VTTA 3KRRA 4DGMA 4DAWA 5IU2A 1IASA 1BYGA 3R01A 4YZCA 1K2PA 4DINA 4YP8A 3T8OA 4J96A 4X0MA 3RBWA 5AAEA 5IQHA 2QG5A 4MNEB 1T45A 2HZ0A 2PZPA 3A8WA 3AC8A 1JKSA 3HMIA 4RIXA 5L2IA 4LM5A 1UA2A 3DQWA 1ZZLA 5HIBA 4RZVA 3TTJA 2CCIA 3R7IA 2WQMA 4ZTHA 5M09A 3VBQA 5HCZA 4YJVA 4FIJA 3EN7A 3GU8A 4BCOA 1UVRA 3EJ1A 3GBZA 4LL0A 4UXLA 4FV3A 3AT4A 4WHZA 3QTQA 4JR3A 2R3FA 2ZVAA 3FKLA 2UW0A 4QP7A 2XRWA 4O7LA 5FEQA 2JKOA 2BZKB 3UBDA 4FIEA 2RGPA 5HLPA 4ZSLA 3MY5A 5BUEA 5CI6A 3F5UA 3OOMA 3MA6A 4JQ7A 2NO3A 4QMLA 1H1PA 4BBFA 4M67A 4C62A 5BVNA 2XNPA 3LMGA 1ZYSA 1ZXEA 4LOPA 3ZRKA 4I5MA 3ZEPA 1IAHA 1BI8A 3AC5A 3A7JA 2CN5A 1OIUA 2PVRA 5KNJA 2BALA 1OKZA 4LL5A 3IG7A 2I7QA 2WMUA 2YM7A 1Q4LA 4MKCA 2WIHA 3R1YA 2CKOA 3OF0A 5M56A 2YIRA 4Z3VA 4JAJA 2C5NA 1A48A 3A7HA 2X8DA 3VNTA 2I40A 3D7TB 4TZRA 2IN6A 2PE2A 5IUHA 4WOVA 3W33A 2VV9A 4YPDA 3IO7A 3TG1A 4PMSA 2HZNA 5EDQA 4JOAA 4BVUA 2Y4IB 3PTGA 4U79A 4BYJA 2OSCA 4WA9A 3GC8A 3F88A 5CEIA 2Y4IC 4EKLA 3MIAA 3FLZA 3ZOSA 1LR4A 2RFNA 5LARA 5BUIA 2CGVA 3GVUA 4NSTA 4P2KA 2ITVA 4FV5A 3FAAA 3PXRA 3QKMA 4FICA 4BCFA 4D4VA 5IMEA 2IVVA 4EK6A 4FVPA 4LMNA 2UZEA 4IX6A 1E1XA 3IDBA 4TWNA 5BYLA 4OLIA 3WF7A 2OBJA 3ZUTA 2ITUA 4TN6A 5AMNA 5HCYA 2XKEA 4C38A 2XAOA 2WQOA 3Q4UA 3FL4A 1PW2A 3EQHA 5FP6A 3K54A 4OUCA 2AEGA 3ID6C 3UZRA 2IF8A 2WEVA 3O2MA 5DT4A 5ANOA 3UG2A 3UG1A 1KOAA 5AR8A 3AKKA 3C7QA 4FX3A 3P7BA 3FKOA 3VF9A 4E5WA 4CT1A 3FPQA 4QMTA 3QQFA 5HG5A 4IAIA 4QRCA 3EH9A 2PK9A 2XK7A 1GZKA 2ZM4A 2A19B 3H10A 4FG9A 3DY7A 3GI3A 4X3FB 3VVHA 3LMHA 2WMQA 3QFVA 5KHWA 2PVHA 5KMLA 4J7BA 3BBTB 3H0YA 4X3FC 4S31A 3VHKA 4ENYA 2ZB1A 1XMLA 4TYHA 3M42A 5BQ0A 1PMVA 2XIZA 4MEDA 4BCNA 4KINA 4JBOA 4KS7A 1QCFA 3QA0A 4YTIA 2FUMA 4DHJA 3FZ1A 5BVWA 4ZEGA 2GFSA 4L44A 3DJ6A 2YIWA 2WMTA 1S9JA 4DDIA 3EN5A 3W8QA 4GKIA 4F6WA 4PDYA 3QX2A 5L2QA 5CI7A 3R1SA 3UMXA 3HMMA 3P86A 4IVDA 3TXOA 1VYZA 5AUZA 5C8MA 3TUCA 1FINA 5E1SA 2WELA 1Y6BA 3IW8A 3UZPA 5EI8A 3R1QA 5HQ0A 5LVPA 4DTKA 3DA6A 4Y83A 3TV6A 2WKMA 4YLKA 2HWPA 4DGOA 3TN8A 4BDAA 3PJCA 4BWKA 4G6LA 2JGZA 4GL9A 4I93A 3ORNA 4J95A 4M12A 5HHWA 3CS9A 4BN1A 2Z7LA 4MVFA 4XOZA 5EH0A 3IDCA 5DHJA 2X9EA 3V5JA 3ZRLA 4BTKA 2X8IA 4ZLOA 3DTWA 4MF1A 3LFSA 4P7EA 4I0TA 3NGAA 4KKEA 5CNOA 5HG8A 3Q9WA 5DMZA 4YJSA 3DKGA 3ATTA 2I0VA 4QTEA 1IR3A 4JT3A 1H28A 1YXXA 3ULZA 4A9SA 4M8TA 1YOMA 4I23A 5AA8A 5A46A 1PYXA 4ASZA 3ANQA 4FG8A 3I7BA 2J90A 5A6NA 1WBPA 3KF7A 3G0FA 4WO5A 3VRYA 4ARKA 2BZJA 3R9RA 5DH3A 4FTTA 3SD0A 4U6RA 3LCDA 4EK8A 1Q99A 2E9OA 3ZMMA 3VJOA 3ATSA 5FQDC 4FEUA 4FV0A 1UNGA 4BY9E 3PPZA 4JDJA 2GU8A 2QD9A 4XHKB 3MH2A 1H1QA 2G1TA 2OJIA 2P0CA 2VX1A 4XG6A 5ANEA 3WBLA 4CTBA 1YQJA 3VUHA 5I9VA 3DDQA 3ZBXA 5CEOA 5BV3A 2R0UA 3S1HA 3SVVA 3DBDA 3IDPA 3WZJA 4AG8A 5HLNA 3VW8A 2IPXA 5I3OA 4QT1A 2UV2A 3GQLA 4ZS0A 2X39A 2ONLC 3BGPA 4EH5A 4GJ2A 3UP7A 5J1WA 4I21A 4W8DA 4LV7A 5M06A 3HMPA 3WYYA 4I5HA 3FZTA 4I22A 4O7RA 4GYGA 3II5A 4QYEA 3I0OA 3KU2A 4FZFB 4S33A 3W0QA 1FVVA 4YC8A 3VJNA 3LCKA 2YAKA 5DT0A 3NFFB 2F49A 3NIZA 1STCE 4QTBA 3Q4CA 3B8RA 3A7IA 3ZHPC 3NWWA 4WUNA 4E4XA 4CMTA 3R63A 4X2JA 4D0XA 4JIAA 3OW4A 4LQMA 2VWBA 3HMNA 4AOIA 4GFGA 2E9NA 2ZOQA 3CKXA 4RQKA 4IQ6A 3R9OA 4USDA 3T9TA 3KFAA 3TEIA 2QLUA 4JR7A 4FNWA 2XYNA 3IOPA 3CTQA 5AV1A 4A4XA 2RIOA 3E8NA 2G01A 5G6VA 3U4WA 2C6MA 5JFWA 1YDTE 3ZO2A 3LXPA 5HE2A 1NVQA 3FL5A 2CNUA 4O22A 3EQCA 3O0GA 2B1PA 1OECA 5HVJA 2BMCA 4KNBA 5IUIA 3PY0A 2Y6OA 3D5UA 4K77A 2XALA 2ZMCA 2WB8A 3VHEA 5EOBA 4CCBA 5L2TA 2Q0NA 2ZB0A 1H27A 2V7AA 3KULB 3KK8A 4KIPA 5FTOA 3DXQA 3U9NA 1CDKA 1SZMA 5HBEA 5CU3A 2HELA 4GRBA 3CGOA 2YM3A 2XEYA 4MHAA 4E4NA 5A54A 4JL9A 2BKKA 2REIA 3R7GA 4QOXA 2UZNA 1XH7A 4FSNA 1XH4A 5JGDA 3QTZA 5GZ9A 4NCTC 4M69A 3QZHA 3QRIA 4ANOA 4BI2A 2G15A 3UE4A 2WMSA 3WIGA 3U51A 4UV0A 3Q5IA 3DLSA 2Y8OA 2PMOX 4G3GA 1WVXA 3OUNB 2WMVA 4FV7A 4FNZ