3E8EA

Crystal structures of the kinase domain of pka in complex with atp-competitive inhibitors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
344
structure length
341
Chain Sequence
b'KKGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Aminofurazans as potent inhibitors of AKT kinase
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 110
structure length 341
sequence length 344
chains with identical sequence B, E, I, L, P
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e8eA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e8eA02
4BI1A 4R5YA 1QPDA 5EI6A 1Q62A 5D11A 4AOIA 4BDJA 4RC2A 5CNNA 4TYGA 3QYZA 2Q0NA 4AA0A 4Q9ZA 2VGOA 2WOTA 4YZ9A 2YFXA 5B2KA 4Y46A 2G15A 4A07A 4FEVA 3NIEA 1XH4A 5CF6A 4NM0A 4EOLA 5IQAA 2YDJA 5HNIX 2I40A 3MVJA 4JG6A 5HBJA 4JJRA 1O9UA 4YO6A 3KXGA 4WA9A 4OTGA 3OTVA 5A6OA 3ZDIA 4KBAA 3BGQA 2QOFA 1W82A 3FI3A 2QG5A 4A06A 3MW1A 5AR3A 4HGSA 4JAJA 4L7SA 4DFZE 2BFXA 2R7BA 4IANA 3JVRA 3V5PA 4ACGA 4E4MA 2J0IA 2X1NA 3EQDA 4ITHA 5IMEA 3N51A 3PJCA 3Q9WA 3L9PA 4AQCA 2YCRA 2GTMA 2IO6A 3C4ZA 3OOGA 1O6LA 5JRSA 2BHEA 4QYYA 4ORKA 3TNQB 2QG7A 4B99A 2ITNA 2VTMA 3BU6A 2XM8A 3G2FA 3PVBA 5BMMA 3D7TB 4FUXA 3TZ7A 4W9XA 3LKMA 4F08A 3U87A 1A48A 4PX6A 3VUIA 4ZTLA 4E6AA 1A06A 4YLLA 1J7IA 2CKPA 3COKA 5IISA 3ZBXA 1YOJA 4FVPA 4HYSA 2R4BA 3ANRA 4QRCA 1WBPA 4I23A 5DEYA 4YMJA 2WIPA 3SOCA 4AZFA 4JOAA 4IWPA 1TQMA 4H39A 4BN1A 5IDNA 4QP6A 1W7HA 2ZM1A 4G3FA 3TDWA 3D2IA 1PKGA 3U4UA 4ZTMA 2YEXA 4K0YA 2IVVA 4DEDA 4HZRA 3JVSA 1OI9A 3GU5A 2IZSA 4I6HA 5EFQA 4AS0A 1H8FA 3F5PA 5L8LA 3ENMA 3UNKA 3R04A 1OGUA 4EC8A 2UZEA 3CGFA 4FV8A 3CPCA 5ETCA 4DA5A 1V0OA 4V01A 3I5NA 3RCJA 2UZOA 1G8AA 5T3QA 3TNPC 5AR4A 1Q24A 4GV1A 3HMOA 2VWXA 4K11A 4XRJA 2ZM3A 3NNUA 2WPAA 5M07A 1ZZ2A 2OZAB 2XYNA 3K3JA 2C6KA 3VS1A 4V0GA 4YBKA 4XS2A 4BGQA 4CFVA 4FKWA 3RK5A 1STCE 2OXDA 3FLSA 4U40A 3D2KA 3DDPA 4WNPA 5B0XA 1UWHA 4WNKA 3HL7A 4XV1A 3W2OA 2GNJA 3PXKA 4UBAA 2F57A 5HBHA 5HO7A 5E8XA 2QOKA 1SM2A 3KN6A 3AMAA 5AUZA 4AN9A 5AEPA 4PF4A 3A7GA 3VBVA 4E73A 2B9HA 2A27A 2WEVA 2W1HA 2XEYA 3OY3A 4RQVA 5IQGA 4XV9A 1UU8A 3PLAE 2Y4IB 3PYYA 3ORMA 1SVHA 3EZRA 5CX9A 4PDSA 3BLQA 3WYYA 1ZZLA 5HU9A 4XRLA 4HGEA 3CTHA 2ERZE 3MH2A 1PXLA 5L3AA 3HV6A 4ANMA 3V6RA 2IJMA 2VAGA 3LXPA 4QP1A 3VWAA 4Q9SA 5HG8A 1OIQA 2W1ZA 2G2IA 4IHPA 4J7BA 3EFKA 2C68A 4ZP5A 5JFXA 4O6LA 3CXWA 5AUYA 5L6OA 3EIDA 2J0MB 4F6SA 3BU3A 3D0EA 4FIFA 3MY1A 5CY3A 1WAKA 5FXQA 3IOKA 5M06A 4IMYA 4IX3A 4M69B 2H9VA 2O64A 3ZO4A 5M4CA 2OIBA 3DAKA 4G2FA 2W17A 4EYMA 3O50A 1OITA 5IA1A 2W06A 4NFMA 3EFLA 3JY9A 2ZV2A 4M0YA 3D5WA 4KBCA 4EUTA 3BYVA 3D7TA 4AW5A 2HW6A 3EMGA 4DGMA 3BEGA 2VTHA 2HXLA 1TKIA 1FBNA 2C5OA 4E20A 3RWPA 1LUFA 5I9UA 3VUKA 2GQRA 2RIOA 4FGRA 3E64A 2Z60A 5JZNA 3F3VA 3KA0A 2VTPA 2OGVA 3F5UA 5IUHA 1GZOA 3MI9A 4DTKA 2VWWA 3VVHA 4TYJA 5LVLA 4FTRA 2CNUA 3QQUA 4I5PA 5GZ9A 4YU2A 3R02A 4FSTA 3UPXA 2CPKE 4GMYA 5KCVA 4WUAA 5AIRA 4DT9A 4USEA 3DFAA 3SD0A 1Q3WA 3OWJA 4BDFA 5BVNA 5GINE 3BHUA 4ZAUA 4OTIA 1YDRE 5TO8A 3UO5A 3QC4A 1FVVA 4K77A 4O0YA 2C6OA 2RKUA 3DA6A 3MPAA 3ODYX 5EH0A 3ETAA 4PPCA 3W16A 1OKWA 5CT7A 2R3LA 3ZO2A 3PE2A 3PXRA 4J53A 4JR7A 4X7QA 4F9AA 4YSJA 3I7BA 2OZAA 1NA7A 3IECA 2BZHB 3P79A 4EQCA 2R3KA 3D15A 4GEOA 4OBOA 1ZMUA 5GJGA 1R39A 4AT4A 2EVAA 1JWHA 2PVFA 4QMPA 2HYYA 4U45A 1NXKA 3D5XA 2RGPA 2X2MA 2J90A 2W1FA 3QD4A 1YI3A 1FMOE 4GT4A 5HCXA 2YJSA 4DFXE 2YA9A 5KKRB 4Z16A 2LAVA 2E9UA 2J0LA 4PNIA 1JAMA 3F5GA 3HUBA 2XM9A 1PXMA 3FL5A 4BCKA 2ZV8A 4M84A 3T9TA 2ITWA 3R2BA 4FF8A 3Q4CA 2XKCA 4PP7A 3ACKA 5CAPA 4MF1A 5EM6A 3HP5A 2IW6A 1Z5MA 3G33A 5FXSA 4BDIA 4OUCA 3TJCA 1M2PA 4BCHA 3BPRA 3NGAA 3NUPA 4JG8A 3SX9A 3R1NA 3OOMA 4KBKA 3TWJA 4QMOA 4GKHA 4DITA 4BL1A 2OJ9A 2VO6A 4EBWA 4D4VA 5GZ8A 4YGAA 4BHNA 1G5SA 4CVAA 4ALVA 2PUPA 3L8SA 4RFZA 3G15A 4GS6A 2UW6A 3WYXA 2PU8A 3V01A 4Y5QA 4ALWA 3FQSA 4IWQA 3EFJA 1H4LA 3TUCA 2R3QA 3GC0A 4M69A 2WD1A 4DT8A 3PTGA 3GXLA 3H9RA 3DZOA 1DAWA 3OCBA 4CCBA 3CJGA 4IC8A 4F7NA 4YO4A 2GSFA 2C3JA 4BI0A 3MH0A 4WRSA 4YTCA 3ODZX 1ZY4A 4XLVA 4RJ4A 2WB8A 2VX3A 3FWQA 4LOPA 1ZYDA 2GMXA 1GIIA 2WU6A 4FT3A 4XCUA 4CV8A 3GUBA 4J96A 1ZYJA 2BRBA 2UVZA 3ZBFA 4A4LA 5L6PA 3QLFA 2R3IA 5FLFA 3EN7A 1OIUA 2Z02A 4UWCA 4FMQA 4AUAA 1KSWA 2DQ7X 4GL9A 5IA2A 2PYWA 4L46A 5DR9A 1UVRA 3UC3A 4A9YA 3KRRA 4FG7A 4CKIA 3SVVA 3KXZA 3ULIA 3GC8A 2W5HA 2YERA 2BRGA 2QC6A 4JT3A 4AGCA 3GCVA 5FG8A 4ANSA 1W0XC 3TNIA 4E6CA 2XB7A 2BDFA 2JIIA 5KZIA 3ZM9A 1GAGA 4OW8A 2UW0A 1KE8A 3RAWA 5CF8A 4FTOA 2YDIA 3DKGA 4UZDA 2WMTA 2HAKA 3OCGA 3QTUA 4QTBA 3LLAA 3I7CA 3PIZA 3PJ1A 4E4LA 3O7LB 4GJ2A 4RX5A 4WBBB 2JC6A 4AT5A 2ONLC 4PL4A 4PPBA 4RX9A 1WZYA 4XBUA 4O1OA 2VD5A 3LCDA 3MTFA 4IVCA 4XV2A 4QPMA 3HMPA 5DOSA 3GCPA 4TW9A 5A4CA 1ZOEA 4G3GA 3CSVA 4DE4A 3C13A 3IG7A 3PIXA 4F99A 4PQNA 4BIBA 2OBJA 3R8ZA 2WMSA 1PMEA 3PJ2A 4WIHA 3HV5A 1JSUA 3Q3BA 4XG3A 5HE3A 2J7TA 5FTOA 5AP3A 3SLSA 3QQHA 2JAMA 3ZUVA 5L2TA 4G9RA 3DAJA 4WNMA 4G31A 5L6WL 3E3PA 2P33A 3H0ZA 3HGKA 3JYAA 4FZ6A 3HDNA 4IXPA 4B8LA 4F9CA 4QMXA 5CVGA 3LZBA 2J0KA 1H28A 3R7EA 2JDVA 1JKLA 4MD9E 4AN2A 4H1JA 3KXNA 2XJ0A 2NP8A 3UC4A 4CQEA 3D5VA 4E26A 3IQ7A 4ZJJA 3LCOA 5KMIA 4FKRA 2WQBA 4P5ZA 5FEQA 3LFSA 3CTJA 3IK3A 5DRDA 4GKIA 1MQBA 5JEBA 1H00A 4YURA 3ZSHA 5L8KA 2VNWA 4U8ZA 5EYKA 1P4FA 5ANGA 4QQ5A 1Y57A 3VBWA 4F6WA 2YITA 1CM8A 3OG7A 2ITVA 4QT1A 4PDYA 5H8BA 4YTIA 3LJ2A 4MWIA 3GU4A 3OBJA 1DI8A 1SMHA 2ITQA 2XKEA 3JXWA 3U9CA 3O2MA 2UZDA 3K2LA 3QWKA 4FSZA 4WNOA 3VUDA 3UJGA 4PMPA 4N70A 3DBCA 4FG9A 5GNKA 3CY3A 5CXZA 2WMXA 2QI8A 5GIPE 5AX3A 1WBOA 3DY7A 4AOTA 2Z2WA 4D55A 5JGAA 5IU2A 1A9UA 4RZVA 4UY9A 1Y6AA 4OTRA 4YZNA 4AP7A 5HTCA 3Q96A 1YHVA 5DFPA 4C4HA 2B7AA 1J91A 2F2CB 3Q2JA 3HMMA 4PTGA 3K5VA 4WHZA 3DBFA 2XMYA 4H3BA 5HESA 2W05A 3RWQA 2QOHA 2VWBA 3QGWA 4IB1A 4ITIA 5J87A 1L8TA 4HCUA 3HVCA 3GC9A 3NRMA 3FPQA 2G01A 3ET7A 4ZOGA 4IEBA 4MQ1A 5A46A 2JBOA 1GIHA 2RFSA 3K5UA 4ZTHA 2HZ4A 1XQZA 4LRKA 4BCJA 4BCMA 4RMZA 2ETRA 4N6YA 4KIPA 2YLFA 3TZ9A 1KV1A 5EM7A 2JITA 3S95A 4RFYA 4LUEA 2H34A 3ZLSA 4ZMEA 4FKJA 4WG4A 5AR7A 3SKCA 4CYJA 4HVDA 2OJFE 3IDCA 1RE8A 4FEXA 4I24A 5EDPA 1OECA 3Q4UA 4JAIA 4QQCA 2PUNA 2C4GA 3TXOA 4C8BA 5JH6A 2HELA 5JRQA 3LFNA 3UOHA 2PUIA 2QHNA 4XG9A 4TXCA 2OXXA 1WFCA 5LARA 2GHMA 2PVMA 4I94A 1ZYLA 3UO4A 4QMMA 4TWNA 3BCEA 1E9HA 2OZOA 3QALE 3LFCA 4NIFB 4FC0A 2C1BA 3OEZA 3W18A 5LVPA 3LE6A 5BVFA 2IZRA 3U55A 3FSFA 3EB0A 3HEGA 3E8EA 5L2IA 3G51A 4ZZMA 2IZUA 5K0KA 2YZLA 3D83A 4HPUE 5FEEA 5KO1A 3RKBA 3HP2A 4JRVA 4KKHA 4EH8A 4EEVA 5EW8A 4GT5A 4I0SA 5J8IA 4EKKA 2XRUA 2BAJA 4BF2A 4FSNA 4AA5A 2OJJA 4EHEA 2NRUA 5KE0A 3FLNC 2UZTA 3C4XA 4Y73A 2R3OA 1OM1A 4DFLA 1JSVA 5M57A 4S32A 1NVRA 2GNGA 2R3FA 2XNGA 2VN9A 1URWA 2OW3A 1SNUA 3K54A 5K4IA 5M51A 1GOLA 3VS6A 3HV7A 4IZAA 5EM8A 3ALNA 3BHVA 3FE3A 4J1RA 4P7EA 3FC2A 3KK8A 3PE1A 1OB3A 3E3BX 4AGDA 3E8NA 3LQ5A 3LW0A 5IUIA 5I9XA 2FSLX 3C5IA 5EQEA 4M14A 5AP5A 3W1FA 1K2PA 4D58A 3DNEA 4IDTA 5AWMA 3FLZA 2XP2A 4X3FB 3I1AA 4ZS4A 2XK8A 3P0MA 4K8AA 5CXHA 4O84A 3PVWA 1YHSA 4XOYA 5IEYA 3ID6C 3ZC6A 3WF7A 3PXZA 3ROYA 5E8UA 3R8MA 3ZEWA 4UN0C 3TTJA 1PMNA 2ZMDA 3Q53A 4QQJA 3FMLA 3DFCB 2V5QA 4NUSA 2OWBA 3QQLA 2C6TA 5HKMA 3T3VA 3HMIA 3SOAA 3I5ZA 4QMLA 2V22A 4PUZA 4EOJA 4M97A 3D9VA 4KWPA 4C3PA 3QRTA 1YDTE 4GK4A 3RPVA 3ZO1A 4E93A 5B2MA 1YXUA 3EH9A 4MBLA 1Q8ZA 1IASA 1Q8TA 4FL3A 3BYSA 3ZUUA 1LP4A 4KSPA 2R3GA 2GNHA 3RMFA 1FOTA 2HZNA 3CJFA 3FL4A 4BYIA 3F2RA 3GFWA 1W8CA 1XR1A 2QKRA 3BIZA 4BY9E 5A14A 4GFOA 3TTIA 3W55A 3QTWA 3AC4A 2XKFA 3DBDA 5EYDA 4FTQA 5EHLA 4QMQA 2XNPA 4NSTA 1O6KA 5AFVA 1LPUA 4W8DA 4RRVA 3QTQA 3S4QA 5CAVA 4ZSGA 1E1VA 1H07A 2CN8A 4G6LA 4EHGA 3ZTXA 4EQUA 2YIRA 5EOLA 3ZC5A 4EK8A 2C5XA 4WT6A 4ANBA 2I0VA 4D5KA 3UP2A 4LMNA 3WZEA 3IOPA 3G6GA 3SV0A 4AAAA 4FT5A 4NIFA 5HTBA 4D2TA 1U54B 5KBQA 3M42A 2QCSA 3FMEA 4FSMA 4S34A 1KV2A 4DG3E 3S3IA 3OP5A 2OO8X 4FKQA 1F5QA 2XCKA 5J9ZA 1BKXA 5JFVA 3CQEA 5E9EA 2YM3A 4O0SA 3RNYA 2WFYA 3FV8A 3VUMA 4AZSA 2X7GA 5H3QA 2WGJA 3BHYA 1ZLTA 4C2WA 4MBIA 3ZU7A 3O51A 4GW8A 3WZJA 3HA6A 2JIVA 4WSQA 3NSZA 5DRBA 4RJ8A 4R78A 1U46A 3AMBA 3DCVA 2OU7A 3BBTB 2J4ZA 4YNOA 3H30A 3L9NA 3PY3A 4LOQA 4X0MA 5CAUA 3DTCA 3COIA 4X2NA 4I0TA 3HECA 4IX6A 1U4DA 3UOJA 4CD0A 3D5UA 3FZTA 2YCSA 4XNEA 5CYIA 2PWLA 3TACA 4JIAA 2ITPA 3ZCLA 3KRWA 3VS3A 1PRYA 3MESA 2YM7A 4F1TA 3RK9A 5HD7A 1KWPA 2QOIA 4HNFA 2PMIA 2Y6MA 4X3FA 4DH5A 1MRVA 2ACXA 3GENA 3GI3A 1PF8A 2YIYA 1BUHA 3LJ1A 2O63A 5E1SA 3LFFA 4JBVA 4G9CA 3UIXA 5J5TA 5A4TA 4TY1A 5D12A 4DEEA 2JGZA 5JQ8A 3VUHA 5KUPA 3DJ5A 4RT7A 5J5SA 1H1WA 2VTJA 3KF4A 3QYWA 4WOVA 2YM8A 4IQ6A 4PV0A 4YPDA 5I9YA 2BKZA 4MWHA 4KIOA 4LL0A 2YCFA 2R3PA 4OTDA 4X6QC 3V8WA 2YIQA 3BRBA 4ANLA 4ASZA 2J9MA 4G1WA 4DEAA 1YQJA 3NVKI 5IH4A 2W99B 4PTCA 2VWIA 5T68A 4QMVA 2H96A 3G9LX 5L2QA 5AA9A 2IPXA 3HZTA 2WEIA 3NAYA 5HIEA 1ZARA 3M11A 4MHAA 1R78A 2BDJA 4KS7A 5GJDA 4LYNA 4RBLA 1JVPP 4DH3A 4MVFA 4HJOA 2BROA 5AUUA 2X8DA 1UV5A 3OWPA 2CHLA 4RVMA 4CMUA 5A9UA 3AD6A 3GU8A 4M8TA 3QA8A 4AFJA 1IAHA 4BC6A 3OW3A 2O5KA 2GNFA 5HNBA 5CAOA 4ERWA 2WQEA 3BGZA 5ETIA 3DGKA 3AC5A 4O0UA 3FXWA 4RVKA 3ZRMA 4AW0A 2HZ0A 2HZIA 3HAVA 2UZLA 2RFDA 5I3RA 4XG2A 1CSNA 4KAOA 4ACCA 4YJVA 4F7LA 3PVGA 3OWKA 5F94A 1PHKA 2WTCA 3BYMA 4FVRA 3COHA 4FV4A 3LHJA 4I1ZA 1U54A 5AP6A 5JK3A 3FI8A 3QUDA 3QKKA 4FODA 4G3DA 1Q5KA 3GFEA 4BR3A 3S2PA 1UKIA 4XH6A 3FC1X 3MGYA 4BBEA 4W4WA 2A4LA 1YXTA 5FBOA 1Q41A 3U51A 3WZDA 3PY1A 5CU0A 5D10A 1PYEA 4RVTA 4BTFA 4O7ZA 2QHMA 3UP7A 2PZIA 2QNJA 4NL0A 2CJMA 3RALA 4EL9A 3O23A 4GVAA 4GFMA 4BZOA 3BYOA 2FUMA 4ZTRA 3TV4A 4EONA 1OIRA 2Y6OA 4JQ7A 1OL2A 5LQFA 4WRGA 1XH6A 4XHKB 2J50A 4BRXA 4U3YA 3RJCA 4EWQA 2FSTX 2WQNA 3KVWA 4U3ZA 4UWYA 4D2RA 5AV4A 3NVMB 4CZTA 3R01A 2W1DA 3FMNA 3BLHA 3FJQE 4IVDA 3R8LA 1VR2A 4YJUA 2WTDA 2QLUA 4GH2A 3V04A 1OPLA 3TEIA 3LLTA 4F63A 3QX2A 2YM4A 3HRCA 4S2ZA 4XG8A 4C7TA 3L9MA 4YC8A 4EZ5A 3SA0A 4II5A 4LRJA 3V5JA 2GDOA 4EK5A 5C4KA 2R3MA 4EH7A 3OT8A 1Y91A 3EJ1A 4FGBA 3R63A 4OTHA 5JKGA 3EN5A 4L42A 5E8SA 3TL8A 5IMXA 1FVTA 2X8IA 1P4OA 3OW4A 4L44A 4QP8A 4X3JA 1ERKA 1FVRA 2JKQA 4KIQA 2VWVA 4HZSA 4OBQA 4XLIA 3QD2B 5DGZA 5FRIA 2ONLA 4NCTC 3HAMA 2BR1A 4FKVA 3CKWA 4BDGA 3NUXA 5EW9A 1OL1A 3FMHA 3FHIA 4XX9A 5A54A 4F7SA 4O86A 3HMNA 3RPSA 4PY1A 3WOWA 2PVLA 4FA2A 2JEDA 4I6BA 4R7BA 2E9NA 4ZZOA 2P4IA 4JBQA 3MY0A 4H1MA 4D1SA 5ICPA 1BI7A 1YW2A 2BDWA 2IW9A 1H08A 5IA0A 4I5MA 2V0DA 3R7OA 1F0QA 3PPJA 2UZWE 1Q8YA 4HVIA 4FEWA 3CD8A 3GOKA 5LVOA 3F66A 3HX4A 1WBNA 1PXJA 3FY0A 5AV0A 3PJ8A 4CKJA 5H8GA 2GNLA 4J95A 2OJIA 3CKXA 3ERKA 4A9TA 4BIDA 2E9OA 3O0GA 4EOPA 4IAZA 4JL9A 3V5QA 3PWYA 5TR6A 5DE2A 3A8WA 4B8MA 5BVDA 2BALA 2X4FA 2PZPA 4YPSA 2C6LA 1YI6A 3BV3A 3ENHA 4LG4A 4L45A 2Z7QA 3EOCA 5FTGA 4I6QA 3R7IA 4JS8A 5AP7A 1VYWA 4FZ7A 4G3EA 3OCTA 5FXRA 4BDCA 3NUAA 4OTFA 1JKTA 5CF4A 4RPVA 2YWVA 3DKOA 3UIBA 3QFVA 5BYLA 4QYEA 2CNVA 3A2CA 3R0TA 3LAUA 3C4EA 3PFQA 4R5SA 4F4PA 1YOLA 3V5TA 3BQCA 3FMJA 4CGAA 3NNXA 3KF7A 4GJ3A 4A7CA 3LXKA 2GS2A 5LOHA 3GP0A 2YLEA 3THBA 1OKVA 3VS5A 4BWXA 2PVRA 5KHXA 4W4XA 3Q32A 3TUDA 2XVDA 2P3GX 2OF4A 3EL7A 3T8OA 4C38A 3HV3A 1H27A 3G5DA 5BPYA 4IWDA 4J52A 3ZYAA 3VF8A 1OKYA 3AQVA 2B9JA 3F2AA 3OXIA 4AW2A 3F6XA 2PUUA 4L7FA 5EM5A 4G6NA 3PJ3A 4C37A 2GFCA 5E90A 3REPA 3L1SA 3H0YA 3NYOA 3R71A 4P90A 4Y95A 1WBTA 4RX7A 3QZFA 4JQ8A 4FKUA 4FV3A 5ACBC 5L2SA 3NAXA 2QD9A 1K3AA 2BVAA 4ZSJA 1DM2A 3KREA 5JZJA 4NM3A 2QKWB 2F4JA 4PMTA 5CSXA 2WMQA 1Z57A 2P2HA 4FSRA 3OROA 5M08A 2G9XA 3I79A 2OG8A 1BL7A 5JMSA 1Q4LA 1XH5A 2ETKA 3HNGA 2XK4A 4ZLZA 3DQXA 3F3WA 5LMKC 2WTIA 4TWCA 3VAPA 3PXQA 4BHZA 3IW5A 5DR6A 3QF9A 4U97A 4KSQA 4AZEA 4F65A 4C3RA 2CCHA 3TZMA 3R9OA 3BELA 4MEDA 2VGPA 4D4YA 2QR7A 2BKKA 2XJ2A 3NEWA 4JBPA 1M14A 2A1AB 4LRMA 4HNIA 4OAUC 1OBDA 1GJOA 3MV5A 5ANKA 4M12A 2GFSA 2X7OA 4X6RA 3KCFA 2RFNA 3CQWA 3DJ6A 4NKAA 5HU3A 2C3IB 3KXMA 4MH7A 4TNDA 3B8RA 1T46A 1OL5A 4FIEA 4UMRA 3S0OA 3CC6A 2UV2A 1J7LA 2R0UA 4FX3A 3VIDA 3W2RA 4LV8A 2ETMA 2PMNX 3DOGA 2B9FA 2XKDA 2ZM4A 2ZV9A 4FSYA 5GJFA 4A4OA 4J8NA 3KEXA 5AR8A 4TYEA 3UTOA 2NPQA 4IH8A 4E5WA 5LVNA 4CQGA 2AC3A 2R5TA 5FDXA 4CFMA 3A61A 3GNIB 3M1SA 5JT2A 1JSTA 4MXAA 2PE1A 3ORNA 4P2KA 3SC1A 3R7GA 4TTHB 2CKQA 2C6EA 1PMUA 4S33A 2P2IA 3RZFA 4CMOA 3KMMA 2O65A 4LMUA 5HE2A 3RHKA 4PRJA 4E7WA 4R1VA 2XBAA 2CNQA 3E87A 4C35A 5IA4A 2VU3A 4IBMA 3I4BA 1BI8A 2B0QA 2WKMA 5FQDC 2X81A 5JQ5A 5E92A 3E88A 3EN6A 3ORKA 3A7JA 4AN3A 4C02A 2ITOA 3KCKA 3NUNA 5EQYA 1B6CB 3AG9A 4FTTA 4Y83A 2W4OA 3KQ7A 4UV0A 5E4HA 5FD2A 4DFYA 5EYCA 3RBWA 2PSQA 3V5LA 1H24A 2UUEA 4FUYA 2ITYA 3VF9A 2A0CX 3DLZA 3VUGA 4Z7HA 2B53A 2BTRA 5HI2A 4I22A 4YJTA 5M4IA 3RHXA 3SXSA 4GU9A 4FKTA 5H8EA 4R1YA 1E1XA 1UA2A 4IIRA 3VHEA 4C34A 4TKSA 3MJ1A 4MBJA 2ZB1A 4EZ7A 1RQQA 5IKWA 4FK6A 3EKNA 2CGVA 4BKYA 2XNMA 3VS4A 3ZZWA 2JKKA 3Q9YA 4YJRA 4DEHA 5BUJA 4C61A 2XF0A 2PMOX 5IA3A 4Z55A 3TI1A 2WMAA 2C6IA 3SG8A 4U79A 3OUKA 2JLDA 5CU4A 3VRZA 3DBEA 4AOJA 3W2SA 2B9IA 3PRIA 1PYXA 2EUFB 2W9FB 2C30A 4BTKA 3NUSA 3T3UA 3TUBA 5AUTA 1UNHA 3R1SA 4E3CA 3TZ8A 3G9NA 3Q60A 5DT4A 5ETFA 2XH5A 3NCZA 2W5BA 4EH6A 4FV0A 4B7TA 3TM0A 2YABA 4ASEA 5HLWA 2ITXA 1I09A 4BCOA 1PMVA 3I60A 4IAFA 2XK7A 4B0GA 3TDVA 3K3IA 2QU6A 1HCLA 4FBXA 2OIQA 4IADA 5EK7A 3FMMA 3OEFX 3PIYA 1SYKA 2XCHA 3FPMA 5DEWA 2B55A 4BWKA 4QTCA 2I0EA 3P7AA 1RW8A 3FHRA 3NNWA 2VV9A 3HYHA 4EUUA 3JS2A 4L01A 2QOBA 4EH3A 3DBQA 2X9EA 4CSVA 1J7UA 3QCYA 3QC9A 2GHLA 4UB7A 2W1CA 1H0VA 4FT9A 4H3QA 3GT8A 4C4FA 4FTCA 2XA4A 2WTJA 1GNGA 5FDPA 3POOA 2C1AA 2E9PA 2VTLA 4C4EA 4UYNA 4BCNA 4K2RA 5L4QA 4F0IA 5I4NA 2C0TA 3P9JA 3QKLA 5T6KA 3Q9XA 2PMLX 4MCVA 3CCNA 3AT4A 4HVSA 4CRSA 5DN3A 1WCCA 3EL8A 2BZIB 4BZDA 2YISA 2H6DA 4YJPA 4GCJA 3NW6A 3CLYA 4FTJA 4M7IA 5IH5A 4UX9A 4QMNA 2BAQA 2BRNA 3DXNA 4X2KA 3TIYA 4C2VA 5L2WA 3LCSA 4BDEA 5K3YA 4NH1A 3SW7A 1J1BA 5ETAA 4DLIA 1OPKA 2CSNA 3P86A 3BE9A 4FKSA 3QD0A 3WARA 2NNWB 5AX9A 3MFRA 4I93A 3II5A 4FKLA 3GCSA 2QQ7A 3HDMA 5BUIA 4YLKA 5FP6A 4EQMA 4IB5A 4U81A 3HLLA 3CD3A 3ZLYA 2JFLA 4CYIA 3HUCA 2F7XE 2F49A 2VRXA 3E62A 3LQ8A 4NEUA 2C6DA 5HICA 5CI7A 4FE2A 1QMZA 4FL2A 5AV1A 3RM6A 4YZMA 3DPKA 3C50A 3AT3A 2VTOA 1ZXEA 3ORTA 1M2RA 4MXXA 2GNIA 4JG7A 5F95A 5FM2A 3DKCA 3EWHA 2W9ZB 4YNEA 3FMDA 4DEBA 4OTPA 2HWPA 2IW8A 3ZDUA 3KL8A 1WVXA 4FOBA 3DT1A 4Y8DA 2XBJA 4IJ9A 2GPHA 5J7BA 3O96A 3C4CA 3IONA 4EJNA 4UXQA 3DKFA 4FVQA 3BLRA 3CBLA 3OC1A 4R3RA 4DEGA 5AUVA 4WKQA 4X2FA 1YXVA 5EKNA 2BILB 3Q9ZA 1H25A 1IRKA 3FAAA 2C5YA 3QLGA 3TCPA 3C9WA 4F9BA 1RDQE 4NJ3A 5AV3A 2A2AA 2CLQA 2GHGA 4FTNA 3FKOA 3GQLA 3ORIA 1XJDA 4N4SA 4YC6A 4UMTA 1U5RA 4L3PA 5IZFA 4FKIA 3LCKA 2VWYA 2VTQA 4R7IA 1JOWB 3WF6A 5KX8A 4ZSEA 3BU5A 2E2BA 3G0EA 4GG7A 2BFYA 4IM2A 3KXHA 4CZUA 3UIUA 5IUGA 2WZJA 2BUJA 4RJ6A 4TT7A 5BVOA 4FZAB 5CENA 4ACDA 4IE9A 4HYHA 4FNZA 3IW6A 3GU6A 3ORZA 4ZK5A 3R8UA 4DTBA 4HW7A 4IVBA 3HA8A 3A60A 3BBWA 4R8QA 1EH4A 2REIA 3L8VA 4RWIA 3GU7A 5BYZA 5IQIA 5DT3A 4Y72A 3DK7A 2KULA 5KZ0A 2I7QA 3OBGA 3KK9A 5J1WA 1OL6A 3KGAA 5HVKA 4RIYB 4QP7A 3UQGA 4A4XA 4AFEA 4FV9A 4L9IA 5TKDA 5C9CA 3VO3A 2Q0BA 3LVPA 2HENA 3DQWA 4EK4A 3EKKA 3SQQA 5CEQA 4BWPA 5EOBA 2VUWA 5AUXA 2V55A 5HHWA 4O7TA 4BVUA 2YM6A 4GUBA 4PWNA 2X2LA 3V51A 4EKLA 4RJ7A 3QAME 2DUVA 4ENXA 4TL0A 4ID7A 5M44A 3LCTA 3HV4A 2X2KA 2YDKA 1TVOA 3EYHA 3POZA 3ZOSA 5J1VA 2CMWA 3HKOA 2W1GA 3FI4A 1HOWA 4C0TA 4KIKB 3LM5A 4MF0A 4LI5A 5I9WA 4S31A 4F9WA 4QMUA 4M0ZA 1YXXA 3R28A 3UOLA 3ORLA 2WMBA 4TYIA 4IM0A 5EDQA 4ZSLA 4AXAA 2FA2A 4L52A 3UNJA 2PPQA 2XYUA 5HQ0A 2Y0AA 4KKEA 4LM5A 4WBOA 3QTIA 4IAYA 3BKBA 3TNWA 2WO6A 4QMZA 2HWOA 1YXSA 3FZOA 4P4CA 3OZ6A 5GZAA 3SW4A 3H3CA 4BICA 5J7HA 2P0CA 5FEDA 3MB7A 2XIXA 4Z9LA 3IDPA 3UDBA 3E7VA 1IEPA 5IA5A 3WE8A 2O2UA 4NCTA 4AE9A 4QQTA 3OD6X 4IWOA 4TWPA 2GQSA 5CU6A 1YWVA 3OUNB 5J9YA 3PXYA 3LFQA 4G34A 3QQFA 2W7XA 4KUJA 4AZVA 4MXCA 4EC9A 3F9NA 4ONAA 5K5XA 3C0HA 3MTLA 5AADA 1M7QA 2FO0A 3LMHA 4O81A 1DI9A 2XNNA 4FIIA 4EK6A 3DB8A 4FOCA 4ZY4A 2RG5A 3C0GA 2CKOA 1XH8A 4QP4A 1X8BA 4XBRA 2BMCA 3RK7A 2QO9A 3E8CA 4U43A 1M52A 4ASXA 2W1EA 3P78A 3IO7A 4IJPA 3ZXZA 4W4VA 3OXTA 4BBFA 3IKAA 2YAKA 4QYHA 4YJNA 4I6FA 4TZRA 4ZTSA 5LMBA 5KMOA 1KUTA 5E1EA 2WXVA 4EORA 4ALUA 5B7VA 3R7UA 4Z7GA 2WQMA 4FSUA 4CFWA 2J6MA 4UMPA 5CSPA 2C47A 3CIKA 4Q2AA 4O2PA 3GCQA 2YN8A 4MK0A 1Y8YA 5C8KA 4E6DA 3R6XA 2WELA 4JX7A 4TPTA 3UVPA 3MIAA 2CDZA 4QOXA 5BQ0A 4CRLA 5JFSA 3AXWA 1KOBA 4C4JA 2BRMA 3P7BA 3EN4A 5AP4A 5DI1A 5M4UA 4O7SA 2QODA 2ZV7A 1FPUA 4AX8A 2J0JA 3Q4ZA 3ZLWA 2XNEA 4XV3A 4RIYA 5I0BA 4X21A 1JLUE 3LM0A 3OVVA 5TT7A 3UG2A 3UE4A 3MA3A 3NZ0A 3MN3A 1XBCA 3BI6A 4NFNA 4C62A 1P2AA 3GQIA 4ZSAA 3O7LD 3SHEA 4EH9A 4O0VA 4OAVB 3MWUA 2HK5A 3QTZA 4I4FA 2BZKB 1ND4A 3WZKA 1MQ4A 4O7LA 3KKVA 5ANEA 1SNXA 3QXPA 4HGTA 4KIKA 3N4VA 5E91A 4DG0E 5AAGA 4L43A 4MYGA 4PDOA 2QURA 4JIKA 5IQFA 2XEZA 4XUFA 3CS9A 2J2IB 3DAEA 4LUDA 4QYFA 3FY2A 5ANJA 4RZWA 4EH4A 2WU7A 4IW0A 3MVMA 3NS9A 3EHAA 1BX6A 4R3PA 5FP5A 1H1PA 3P23A 5LMKA 2UW7A 4JDIA 4BTJA 2C0IA 1OUKA 2R3JA 4RFMA 3U6HA 3QCSA 2HCKA 3BYUA 4RWJA 4OBPA 3U6IA 5M09A 5FTQA 3DLSA 5KKRC 4WD5A 5GIOE 2VZ6A 3R8PA 3MH3A 3HRBA 4O7RA 2XIYA 2YAAA 5E7RA 2JAVA 5HX8A 3GC7A 2B4SB 2SRCA 2ZYBA 3GOPA 4CG9A 4O27B 4BIEA 2G2FA 2QONA 4KNBA 4BDDA 3FYJX 4Z3VA 4HOKA 3O8UA 3PG3A 1IA8A 1YOMA 3C5UA 4XJ0A 5CALA 5LWNA 4RJ3A 4DFBA 4NK9A 3DXQA 4MXOA 2HXQA 3CGOA 4USFA 5CSWA 3R7YA 1CKJA 3BWFA 4I5HA 4WO5A 3TIZA 3VS7A 4OT5A 3QL8A 1YWNA 5F4NA 3ROCA 2WTKC 2JKMA 4A9SA 4O1PA 4YP8A 4ZEGA 1H01A 2BZJA 2RSVA 4HYUA 4CT2A 4KS8A 4ZZNA 5I9ZA 3LJ0A 1I44A 3IS5A 2X39A 1Q8WA 2ZMCA 5H2UA 1L3RE 4U6RA 4BCFA 2VTRA 3O8PA 3DXPA 4F1MA 2F7EE 1OVEA 2IZTA 2OSCA 4PDPA 4IC7A 4X2GA 5HLNA 1QCFA 3C7QA 2Z7LA 3QRUA 3PLSA 3PZEA 3SGCA 3PA5A 4H36A 2OFVA 4I41A 3TKUA 3H4JA 4V04A 4DN5A 3BWJA 4TNBA 3AC1A 4F70A 3ANQA 1XWSA 5EYMA 4AACA 4YUQA 4NW5A 1KE5A 2JD5A 3KULB 4M68A 1ZYSA 4ANNA 2ZVAA 1BYGA 1G3NA 2O3PA 2VX0A 3W2QA 3TN8A 1HCKA 3PZHA 1Y8GA 1YWRA 3EN9A 5F1ZA 1MRUA 3FZ1A 2PHKA 4ZTNA 4RA4A 3F69A 3L9LA 3BV2A 1JBPE 3AC2A 2OLCA 5CEOA 3WZUA 3CY2A 3FYKX 3DB6A 3NIZA 5D7VA 1UWJA 5LCJA 3VBQA 4FT7A 3E93A 2C3KA 2WMUA 3AT2A 5TE0A 3QCXA 1R0EA 4KD1A 1SVEA 2IVTA 4BDKA 4JBOA 3W33A 2PULA 2ZAZA 3ZM4A 3TG1A 2R7IA 3MH1A 3RCDA 3ZEPA 4BZNA 3OS3A 2DYLA 4QPSA 5HVYA 4MTAA 1H1SA 3PVUA 4EHZA 5HCZA 3QZGA 3RI1A 4ZXTA 3AD4A 4RC4A 3ITZA 2G1TA 4L68A 1P5EA 3BE2A 4U0IA 3ZRLA 3SG9A 3MS9A 4QYGA 2I1MA 2GU8A 2JDTA 4I92A 5DT0A 4KKGA 3FKLA 4ZMFA 4O7WA 4W4YA 4RJ5A 2ESMA 5FUTA 4FV7A 3NLBA 2E9VA 3RP9A 4FNWA 4D0WA 2PZ5A 1OL7A 2YHVA 5CTPA 3ZFXA 4FYOA 1OPJA 4YJSA 5BYYA 4NWMA 4BGGA 5C4LA 1PW2A 4U9AA 3C1XA 1PXIA 4UEUA 3DV3A 2UW3A 4U5JA 5J9LA 4UMUA 5J79A 4LL5A 1NW1A 3W10A 2QOOA 3I0QA 4G5PA 5IF1A 1ZYCA 3EQHA 3DZQA 4IDVA 4JI9A 3R9HA 4JDHA 3FLYA 4TYHB 5HG5A 5DPVA 3NUUA 3O17A 5CWZA 3VRYA 1O6YA 5KMJA 4U44A 5AP2A 3E92A 5HO8A 4S30A 5L8JA 4PP9A 5CEIA 2CLXA 1Q97A 3R73A 4ANOA 4FL1A 3R9RA 4IX5A 4IVAA 5ANOA 4AW1A 2WTWA 2PE2A 3LXNA 3QRKA 1IR3A 4RLLA 4D9UA 3MPTA 4BFMA 1GY3A 2OI4X 4UXLA 5DMZA 3UVQA 4MXZA 3WF9A 2Z7SA 3V5WA 5FGKA 5HLPA 2FVDA 3MPMA 1AD5A 4FSQA 4JDJA 4JQEA 2OK1A 5AJQA 3O8TA 4TN6A 5IQBA 1H1RA 2WNTA 5CAQA 5K5NA 2Z7RA 4N6ZA 4U42A 1UU3A 4Y5HA 4FYNA 5D7AA 4ITJA 5IQDA 3QD3A 3NR9A 1B39A 4RWLA 3DTWA 4GU6A 5HOAA 3RAHA 3V8TA 5F9EA 1R1WA 5HCYA 2OICA 5E8YA 4OTWA 5HTIA 4FEQA 2BCJA 2ZDUA 3FZSA 3R9DA 4CFXA 5JN2A 3VQUA 2HW7A 4NZWB 5AP0A 4YR8A 3PSBA 2W1IA 3KY2A 3I6UA 1WMKA 4O91A 3KULA 2C3LA 4CFFA 5AM7A 3EQGA 4EI4A 5E8ZA 4F0GA 1H0WA 5IDPA 1KE6A 5AUWA 4ZIMA 5BUEA 5HX6A 1XKKA 3ZMMA 3NYXA 2UW9A 3PPZA 3C4WA 4EHVA 4FTAA 4LQMA 3MIYA 1VEBA 4I20A 5J95A 4ZTQA 3A4OX 4K18A 4BDHA 4EK3A 4WUNA 3BEAA 3OTUA 4EOMA 3QXOA 5CASA 3ORXA 4FTMA 4K9YA 1UKHA 4HCVA 3OY1A 4M13A 3ELJA 4XOZA 5CLPA 3MSSA 3R7VA 4FIJA 3PSDA 4ZY6A 4D2PA 3FMKA 5HE1A 4AGWA 5DBXA 4C4GA 4MAOA 4PMSA 3R1YA 5HD4A 3FLQA 5DYJA 2Y9QA 3UPZA 2J51A 2FH9A 4W8EA 5EG3A 3ZFMA 3TT0A 2WOUA 3VJNA 2IWIA 3OF0A 3VS0A 2WMVA 1KOAA 3LQ3A 5C1QB 2XNBA 2VTIA 3Q5ZA 2IVUA 4P5QA 2J5FA 2W4KA 3RPOA 3MB6A 5FM3A 1FQ1B 2CN5A 4DH1A 1M7NA 1W98A 2BPMA 4R6VA 4YC3A 4AWIA 2W5AA 4DAWA 1XH9A 4O2ZA 4G6OA 3EQRA 4CEGA 3PP1A 3BQRA 4G5JA 5AR5A 3KN5A 4DFUA 4GVJA 3WBLA 2WMWA 1PXOA 5CT0A 2B1PA 3EFWA 4NTTA 2WHBA 3R2YA 3TV7A 2CGXA 1M17A 4H05A 5DLSA 3HRFA 3IW7A 4YLJA 4FG8A 4TYHA 4WG5A 3QTRA 4AA4A 4D0XA 5ANDA 1TQPA 2OXYA 4DGNA 5CSHA 1V0BA 3AMYA 3MDYA 4MNFA 3NW5A 4XP0A 3KMUA 1S9IA 5HBEA 4QPAA 3VQHA 1RJBA 4O7NA 2W4JA 2PL0A 3UIMA 3SXFA 5CVHA 1GIJA 3UMWA 3RPRA 4GRBA 5ITAA 1J3HA 3W2PA 3V8SA 3OMVA 4D28A 3MYGA 4R77A 3VULA 2GTNA 4KA3A 4GIIA 4MXYA 4W9WA 3F3UA 2A19B 4JXFA 4DF3A 1WVWA 1QL6A 4KB8A 4CNHA 1IG1A 1KE7A 5AP1A 3W8QA 2CCIA 3DU8A 3WI6A 3FUPA 5HE0A 3NDMA 4CMTA 3QA0A 2X9FA 1ZOGA 4X3FC 3ZH8A 4FEUA 1MRYA 4CZYB 4YBJA 4J99A 1YVJA 3QRJA 4L53A 3N9XA 4G3CA 3ZRKA 4E4NA 4DLJA 4RIWB 3UQCA 3FXZA 5CVFA 3G0FA 4D2VA 3E8DA 2R3RA 4CV9A 3VUTA 3NW7A 4GK2A 1GZNA 4MX9A 2AC5A 4NJDA 1ZAOA 4BKJA 4C59A 4IFGA 1OBGA 1IAJA 4ZJIA 3EQFA 3MFUA 4O96A 5AIKA 5IQCA 3ZO3A 4D2WA 3MJ2A 4O0WA 4LOOA 4FV5A 3NMUF 4L00A 2X8EA 3A7FA 1JKSA 4CCUA 3SDJA 3N4UA 4EZ3A 4IAIA 3KRXA 4J8MA 2EU9A 3EQCA 5CNOA 3ZZEA 1XBAA 2ZDTA 2QU5A 4FNXA 3NCGA 4H3PA 4LGHA 4I4EA 2RL5A 1VZOA 3QQGA 3U8WA 1OIYA 4AZTA 5CEPA 4DBXA 1V1KA 4TRLA 2UZUE 3PPKA 1YKRA 3PUPA 1REJA 3VS2A 3TJDA 3IDBA 4L67A 4JX3A 3RM7A 2YCQA 3R21A 4J71A 5CU2A 2UVXA 4KINA 5HGIA 3QGYA 3BHHA 4V05A 3PWDA 4EOIA 3UZPA 2UZVA 4M66A 1CKPA 3A7IA 4RVLA 2VO3A 4UZHA 4FTKA 5CSVA 5M4FA 3AGLA 3O71A 5I5ZA 4FT0A 4E5AX 4DH8A 2XS0A 3KU2A 3UYTA 5CF5A 3LFEA 1F3MC 3D14A 1PXKA 2BIYA 3F5XA 3IW4A 4FV2A 4GT3A 4HVHA 2WTKB 3FSKA 4PNKA 4K1BA 5BVKA 1YDSE 2QLQA 3JR1A 3BHTA 4NM5A 4C4IA 2WTVA 5C27A 3MVLA 2VTNA 2PZRA 4B6LA 1UNGA 2W96B 4RSSA 1XO2B 3GB2A 3RTPA 5FBNC 5IQEA 1GZKA 3AGMA 5IG1A 2YIXA 1U5QA 4GYIA 3QTXA 3UMXA 4O6EA 4I5CA 3E7OA 4O21A 3F3TA 4HPTE 4C57A 4QP3A 4BB4A 3OCSA 2PTKA 2JIUA 3OWLA 5IQHA 3NYVA 5A4LA 2R64A 1YI4A 4ACMA 2QOLA 2UZBA 5LMAA 1ZY5A 3R30A 3ZSIA 3E5AA 4L3LA 4OGRA 4LGGA 5B2LA 3M2WA 3DK3A 4QNYA 2GS6A 5HG9A 4PMMA 5K0XA 4FIHA 3UOKA 2Z8CA 5GHVA 3WIGA 1NVSA 5CANA 3P7CA 4DGOA 4XP3A 3ATTA 3H9FA 3G6HA 4IACA 2B54A 5C01A 3QU0A 4AE6A 1J1CA 4BBMA 4BI2A 5LJJA 5CQWA 3AC8A 4FKOA 4R3CA 1U59A 5FWKK 4RIWA 3R9NA 2BIKB 3V6SA 5KHWA 4RLKA 5H9BA 2R3HA 4LFIA 2VTTA 4ACHA 3DDQA 4IAAA 3UGCA 3UZTA 1T45A 2PE0A 2JKOA 3QQKA 4AGUA 3LIJA 3RAKA 5M53A 3QUEA 1AGWA 4I3ZA 4O0XA 4Q5HA 3R83A 3P08A 4ARKA 2J5EA 1JKKA 4NM7A 4XYFA 3VHKA 1Q99A 3V3VA 2C5NA 2I0HA 3F7WA 3F82A 2DS1A 2X6DA 3CPBA 5DVRA 3VC4A 5C8NA 4JLCA 4BYJA 4MNEB 2PVNA 2YZAA 4U7ZA 5CU3A 3UNZA 3CEKA 2GQGA 3F88A 5DG5A 3U9NA 1UU9A 4FV6A 3TNHA 2R9SA 3SRVB 3GEQA 4ZY5A 2W0JA 4FI1A 2B52A 4O38A 4PTEA 2PK9A 1QPJA 2RG6A 4DGLC 1K9AA 2HOGA 3L8XA 1YRPA 2IN6A 3NWWA 4PPAA 1H26A 3RNIA 4FIGA 3VJOA 3Q6WA 3W8LA 4XG7A 5IH6A 4FTUA 4JR3A 1LEZA 3R1QA 4FKPA 3VW8A 3VBYA 3R00A 2CKEA 4KRDA 3ZS5A 3Q04A 5AA8A 3Q6UA 4IFCA 3AC3A 5IEXA 3CTQA 1CDKA 1MP8A 3FZRA 3LMGA 4TWOA 5E8WA 3A62A 3TKHA 5BNJA 3F3ZA 5EQPA 3C0IA 3D4QA 5F20A 4AT3A 4RG0A 4KABA 2ZOQA 2QO7A 4IAKA 4IM3A 5KMMA 3VN9A 5BX0A 4Q5EA 4QMYA 3UG1A 3WF5A 3RINA 2NRYA 3IPHA 5CS6A 4EH2A 4USDA 3VBTA 3ZXTA 5DH3A 1B38A 2H8HA 2OH4A 3NUYA 4UALA 5A3XA 3R8VA 4DTAA 4DYMA 2QOQA 4DINA 4CTCA 2VWZA 4LGDA 2IG7A 1ZOHA 3DJ7A 4NT4A 5CQUA 3U6JA 1LR4A 4G16A 4QO9A 2PVYA 2RF9A 2BRHA 4JVGA 5JSMA 2YACA 4O22A 2PVKA 2V7AA 3ZONA 4C33A 4BCQA 3UODA 4ZLYA 1OUYA 1WBWA 3QKMA 3VW6A 4CKRA 3LFAA 3AD5A 2PZYA 2R2PA 3I81A 4NU1A 4RQKA 4UWBA 4DH7A 1OKZA 2VWUA 3CP9A 3LFDA 2BAKA 4L6QA 1W84A 3ALOA 4F0FA 3FXXA 5KMLA 5BVWA 1TQIA 3UBDA 3KC3A 4CFUA 2JDSA 4YTFA 5TOZA 5IEVA 3EZVA 3RAIA 3EQBA 4O7VA 4D1ZA 1QPEA 2BTSA 5DHJA 4FZDB 4NYEA 4J97A 1PY5A 4D2SA 2RFEA 5AAFA 3PSCA 4H58A 2FSMX 3KMWA 4E4XA 3EQIA 4MD8E 3A8XA 3ZFYA 3B2WA 2VO7A 2WMRA 3PA3A 2C69A 2EXEA 4FR4A 4FTLA 5EHOA 4EJ7A 1ZMWA 4EOOA 2PY3A 5EDRA 4B9DA 1OMWA 2XUUA 5AAEA 3SXRA 1JQHA 1WBSA 5D9HA 4GUEA 2YJRA 2XK6A 2XK9A 3JUHA 4QP9A 5HIDA 2P55A 2DWBA 3H10A 4F64A 2G2HA 2WAJA 4UYAA 4ZJVA 5JFWA 4OT6A 4QMTA 3NX8A 3KVXA 1PKDA 5A4EA 2EXCX 3F7ZA 4EWHA 2I0YA 3CE3A 3WIKA 4DG2E 4OLIA 4MNEA 3QBNA 3UZRA 1NVQA 4XMOA 5CEKA 3RPYA 1XBBA 4NKSA 3SRVA 3WF8A 5KMNA 4QD6A 4DBNA 1KE9A 4D4SA 2AYPA 5CI6A 2GCDA 3S1HA 1G8SA 3MY5A 4X2JA 3PRFA 1NT2A 1JPAA 3FZPA 2LGCA 3P4KA 4O7YA 2FSOX 2C6MA 3N4TA 3C51A 3DS6A 4YSMA 4BDBA 3I6WA 4D4RA 4ERKA 4KRCA 3D7ZA 4RWKA 4RX8A 3P1AA 5A6NA 4DFNA 4I0RA 3Q5IA 4BCGA 4YZCA 5G1XA 4AG8A 4CLIA 4QTAA 5LCKA 1APME 4IB3A 4RGJA 4D1XA 4F1OA 4OTQA 2WQOA 4YHTA 1BMKA 3D94A 5HG7A 1REKA 2Q83A 3COMA 2Y4IC 2C5VA 4XG4A 5HNGA 4GSBA 1ZWSA 3RGFA 4A9RA 3LXLA 5DA3A 5TF9A 1Q3DA 3PY0A 4E1ZA 1FGKA 1R3CA 5D41A 3QZIA 3TKIA 4BKZA 4UMQA 2Y7JA 2HY81 3E63A 5I9VA 4F6UA 5E8TA 5BVEA 2AUHA 4C36A 3CR0A 4G17A 4ZLOA 4FNYA 3P5KA 3QTSA 4FICA 4N0SA 2ITZA 2O0UA 2Y4PA 5EI8A 3OXZA 4K33A 1FGIA 1JNKA 5ANIA 4DC2A 4E6QA 4RIOA 1P14A 3SAYA 2YIWA 4FKGA 4IZ5A 3ORPA 2ITUA 5HVJA 3PG1A 4MQ2A 1V0PA 3Q2MA 4C3FA 4JRNA 3A7HA 4GIHA 3W2CA 4RC3A 4MKCA 3NPCA 4M67A 4RIXB 3IW8A 4APPA 3WE4A 3GVUA 3QCQA 1ZMVA 2GS7A 3I0OA 4YTHA 3JY0A 5EI2A 4F09A 1QPCA 2F9GA 4FSWA 4R7HA 4CTBA 4BCIA 4XEYA 2UZNA 4GFGA 3IGOA 4FK3A 4O0RA 4DCAA 2UVYA 3MFSA 4D9TA 4N57A 1SZMA 5C03A 2JDOA 4O82A 3QZHA 3ZLXA 4IX4A 3PP0A 2PVHA 4NW6A 3BX5A 3FQHA 3PXFA 4EBVA 1S9JA 3KRLA 5C8MA 4QTEA 3B2TA 3UO6A 3A99A 1UNLA 4CLJA 4BCPA 3ATSA 2NO3A 3F61A 3FQEA 3NYNA 4CXAA 5BMSA 2ERKA 4K6ZA 5DNRA 3GGFA 5DIAA 5LWMA 3FLWA 1DAYA 4DCEA 3ZSGA 3QUPA 2EXMA 2EB2A 3AOXA 2XIZA 5K9IA 5KNJA 2FYSA 4YHJA 3UYSA 3G90X 1CKIA 4A9UA 4EOQA 4CG8A 2HIWA 4E5BA 5JGDA 2XIRA 1VYZA 4AU8A 4GK3A 3ACJA 3T9IA 5M56A 2O8YA 3KB7A 4ZS0A 4BGHA 1XHAA 2X6EA 3JPVA 1PXNA 4FTIA 2ITTA 2JDRA 3W32A 3LMIA 3CQUA 2R3NA 2XJ1A 3MA6A 5M55A 4WSYA 4BDAA 5HORA 1NY3A 1ATPE 5KBRA 4YJQA 3RVGA 4YZDA 2QVSE 2Y8OA 4HCTA 3ULZA 3MBLA 2JFMA 3EQPA 3H9OA 1YHWA 3QX4A 3DNDA 1XH7A 4PL3A 5HZNA 5CZHA 3B8QA 4OR5A 2HY0A 2QO2A 3UVRA 5LXMA 2PVJA 1GZ8A 4BTMA 3KRJA 3LFBA 4I21A 2VTSA 4APCA 1ZRZA 4YZBA 5EW3A 4DHFA 2V7OA 4IZ7A 5EHYA 4ASDA 1WBVA 3OFMA 1IA9A 4IZYA 3FEGA 3KXXA 1Q61A 2X7FA 3IGGA 3U4WA 3KFAA 4NTSA 4XG6A 4O83A 1DS5A 3F2NA 5D1JA 4CT1A 2CGUA 4JNWA 5DWRA 4EOSA 5C26A 1M2QA 5HEZA 2XRWA 4E8AA 5IPJA 1R0PA 4IB0A 1OZ1A 4HVGA 2XK3A 4LV5A 2OF2A 3QQJA 2I6LA 3NNVA 2FGIA 1UU7A 2IVSA 2F2UA 1Y6BA 4FV1A 2VNYA 2VTAA 4WG3A 5KMKA 3WILA 2X0GA 2R0IA 3L8PA 2YM5A 4XP2A 5HIBA 5I3OA 4M15A 3QHWA 3BZ3A 4PL5A 2EB3A 5K4JA 2KTYA 5CZIA 4QTDA 4L3JA 4ANQA 4DEIA 4F7JA 2UW8A 2VX1A 4QNAA 3U54A 3FDNA 1VJYA 2QOCA 2OIDA 4AF3A 1FINA 2ZB0A 3PA4A 3QWJA 5AV2A 2XNOA 4D5HA 5A4QA 2OJGA 2F7ZE 3ZUTA 4DGGA 1CMKE 3GBZA 4HGLA 1AQ1A 5JGBA 4MD7E 4EOKA 5LVMA 2JBPA 4RIXA 5E8VA 2YWPA 3MFTA 4C58A 1LEWA 5DR2A 2XIKA 4ENYA 2BHHA 2OFUA 2ZJWA 3LPBA 4RA5A 2EWAA 1CTPE 4U41A 3Q52A 3VNTA 3FI2A 5HO6A 3MVHA 3R22A 2UW4A 4EYJA 4EH5A 5CEMA 4J98A 3BGPA 3DK6A 3FBVA 3OHTA 1WVYA 4QMWA 4QMSA 4YJOA 2OKRA 3A4PA 4GYGA 1URCA 5EKOA 1BLXA 5AR2A 2XZSA 4HYIA 4L8MA 3UQFA 2CGWA 4QP2A 4GG5A 4U80A 3FKNA 4JDKA 4Y85A 2OH0E 3C4FA 1PXPA 5G6VA 4B4LA 1W83A 4V0GB 1BL6A 4FZFB 2WIHA 3OT3A 4AZWA 3GCUA 4YHFA 2C0OA 5AM6A 5ACKA 3LOKA 3VBXA 3ZHPC 2UW5A 3S00A 3RZBA 3QRIA 2X4ZA 3EYGA 1SVGA 1PJKA 4M3QA 1MUOA 4CFNA 2QR8A 3QHRA 2V62A 4O0TA 1H1QA 1Z9XA 4F9YA 1FMKA 2FB8A 3Q4TA 1Q8UA 2VO0A 5AMNA 3PDTA 3TV6A
chains in the Genus database with same CATH superfamily
4BI1A 4R5YA 1QPDA 5EI6A 1Q62A 5D11A 4AOIA 4BDJA 4RC2A 5CNNA 4TYGA 3QYZA 2Q0NA 4AA0A 4Q9ZA 2VGOA 2WOTA 4YZ9A 2YFXA 5B2KA 4Y46A 2G15A 4A07A 4FEVA 3NIEA 1XH4A 5CF6A 4NM0A 4EOLA 5IQAA 2YDJA 5HNIX 2I40A 3NFGB 3MVJA 4JG6A 5HBJA 4JJRA 1O9UA 4YO6A 3KXGA 4WA9A 4OTGA 3OTVA 5A6OA 3ZDIA 4KBAA 3BGQA 2QOFA 1W82A 3FI3A 2QG5A 4A06A 3O5AA 3MW1A 5AR3A 4HGSA 4JAJA 4L7SA 4DFZE 2BFXA 2R7BA 4IANA 3JVRA 3V5PA 4ACGA 4E4MA 2J0IA 2X1NA 3EQDA 4ITHA 5IMEA 3N51A 3PJCA 3Q9WA 3L9PA 4AQCA 2YCRA 2GTMA 2IO6A 3C4ZA 3OOGA 1O6LA 5JRSA 2BHEA 4QYYA 4ORKA 3TNQB 2QG7A 4B99A 2ITNA 2VTMA 3BU6A 2XM8A 3G2FA 3PVBA 5BMMA 3D7TB 4FUXA 3TZ7A 4W9XA 3LKMA 4F08A 3U87A 1A48A 4PX6A 3VUIA 4ZTLA 4E6AA 1A06A 4YLLA 1J7IA 2CKPA 3COKA 5IISA 3ZBXA 1YOJA 4FVPA 4HYSA 2R4BA 3ANRA 4QRCA 1WBPA 4I23A 5DEYA 4YMJA 2WIPA 3SOCA 4AZFA 4AXEA 4JOAA 4IWPA 1TQMA 4H39A 4BN1A 5IDNA 4QP6A 1W7HA 2ZM1A 4G3FA 3TDWA 3D2IA 1PKGA 3U4UA 4ZTMA 2YEXA 4K0YA 2IVVA 4DEDA 4HZRA 3JVSA 1OI9A 3GU5A 2IZSA 4I6HA 5EFQA 4AS0A 1H8FA 3F5PA 5L8LA 3ENMA 3UNKA 3R04A 1OGUA 4EC8A 2UZEA 3CGFA 4FV8A 3CPCA 5ETCA 4DA5A 1V0OA 4V01A 3I5NA 3RCJA 2UZOA 1G8AA 5T3QA 3TNPC 5AR4A 1Q24A 4GV1A 3HMOA 2VWXA 4K11A 4XRJA 2ZM3A 3NNUA 2WPAA 5M07A 1ZZ2A 2OZAB 2XYNA 3K3JA 2C6KA 3VS1A 4V0GA 4YBKA 4XS2A 4BGQA 4CFVA 4FKWA 3RK5A 1STCE 2OXDA 3FLSA 4U40A 3D2KA 3DDPA 4WNPA 5B0XA 1UWHA 4WNKA 3HL7A 4XV1A 3W2OA 2GNJA 3PXKA 4UBAA 2F57A 5HBHA 5HO7A 5E8XA 2QOKA 1SM2A 3KN6A 3AMAA 5AUZA 4AN9A 5AEPA 4PF4A 3A7GA 3VBVA 4E73A 2B9HA 2A27A 2WEVA 2W1HA 2XEYA 3OY3A 4RQVA 5IQGA 4XV9A 1UU8A 4AXFA 4O4BB 3PLAE 2Y4IB 3PYYA 3ORMA 1SVHA 3EZRA 5CX9A 4PDSA 3BLQA 3WYYA 1ZZLA 5HU9A 4XRLA 4HGEA 3CTHA 2ERZE 3MH2A 1PXLA 5L3AA 3HV6A 4ANMA 3V6RA 2IJMA 2VAGA 3LXPA 4QP1A 3VWAA 4Q9SA 5HG8A 1OIQA 2W1ZA 2G2IA 4IHPA 4J7BA 3EFKA 2C68A 4ZP5A 5JFXA 4O6LA 3CXWA 5AUYA 5L6OA 3EIDA 2J0MB 4F6SA 3BU3A 3D0EA 4FIFA 3MY1A 5CY3A 1WAKA 5FXQA 3IOKA 5M06A 4IMYA 4IX3A 4M69B 2H9VA 2O64A 3ZO4A 5M4CA 2OIBA 3DAKA 4G2FA 2W17A 4EYMA 3O50A 1OITA 5IA1A 2W06A 4NFMA 3EFLA 3JY9A 2ZV2A 4M0YA 3D5WA 4KBCA 4EUTA 3BYVA 3D7TA 4AW5A 2HW6A 3EMGA 4DGMA 3BEGA 2VTHA 2HXLA 1TKIA 1FBNA 2C5OA 4E20A 3RWPA 1LUFA 5I9UA 3VUKA 2GQRA 2RIOA 4FGRA 3E64A 2Z60A 5JZNA 3F3VA 3KA0A 2VTPA 2OGVA 3F5UA 5IUHA 1GZOA 3MI9A 4DTKA 2VWWA 3VVHA 4TYJA 5LVLA 4FTRA 2CNUA 3QQUA 4I5PA 5GZ9A 4YU2A 3R02A 4FSTA 3UPXA 2CPKE 4GMYA 5KCVA 4WUAA 5AIRA 4DT9A 4USEA 3DFAA 3SD0A 1Q3WA 3OWJA 4BDFA 5BVNA 5GINE 3BHUA 4ZAUA 4OTIA 1YDRE 5TO8A 3UO5A 3QC4A 1FVVA 4K77A 4O0YA 2C6OA 2RKUA 3DA6A 3MPAA 3ODYX 5EH0A 3ETAA 4PPCA 3W16A 1OKWA 5CT7A 2R3LA 3ZO2A 3PE2A 3PXRA 4J53A 4JR7A 4X7QA 4F9AA 4YSJA 3I7BA 2OZAA 1NA7A 3IECA 2BZHB 3P79A 4EQCA 2R3KA 3D15A 4GEOA 4OBOA 1ZMUA 5GJGA 1R39A 4AT4A 2EVAA 1JWHA 2PVFA 4QMPA 2HYYA 4U45A 1NXKA 3D5XA 2RGPA 2X2MA 2J90A 2W1FA 3QD4A 1YI3A 1FMOE 4GT4A 5HCXA 2YJSA 4DFXE 2YA9A 5KKRB 4Z16A 2LAVA 2E9UA 2J0LA 4PNIA 1JAMA 3F5GA 3HUBA 2XM9A 1PXMA 3FL5A 4BCKA 2ZV8A 4M84A 3T9TA 2ITWA 3R2BA 4FF8A 3Q4CA 2XKCA 4PP7A 3ACKA 5CAPA 2NYAA 4MF1A 5EM6A 3HP5A 2IW6A 1Z5MA 3G33A 5FXSA 4BDIA 4FEXA 4OUCA 3TJCA 1M2PA 4BCHA 3BPRA 3NGAA 3NUPA 4JG8A 3SX9A 3R1NA 3OOMA 4KBKA 3TWJA 4QMOA 4GKHA 4DITA 4BL1A 2OJ9A 2VO6A 4O4FA 4D4VA 4EBWA 5GZ8A 4YGAA 4BHNA 1G5SA 4CVAA 4ALVA 2PUPA 3L8SA 4RFZA 3G15A 1ST0A 4GS6A 2UW6A 3WYXA 2PU8A 3V01A 4Y5QA 4ALWA 3FQSA 4IWQA 3EFJA 1H4LA 2IF8A 3TUCA 2R3QA 3GC0A 4M69A 2WD1A 4DT8A 3PTGA 3GXLA 3H9RA 3DZOA 1DAWA 3OCBA 4CCBA 3CJGA 4IC8A 4F7NA 4YO4A 2GSFA 2C3JA 4BI0A 3MH0A 4WRSA 4YTCA 3ODZX 1ZY4A 4XLVA 4RJ4A 2WB8A 2VX3A 3FWQA 4LOPA 1ZYDA 2GMXA 1GIIA 2WU6A 4FT3A 4XCUA 4CV8A 3GUBA 4J96A 1ZYJA 2BRBA 2UVZA 3ZBFA 4A4LA 5L6PA 3QLFA 2R3IA 5FLFA 3EN7A 1OIUA 2Z02A 4UWCA 4FMQA 4AUAA 1KSWA 2DQ7X 4GL9A 5IA2A 2PYWA 4L46A 5DR9A 1UVRA 3UC3A 4A9YA 3KRRA 3BLAA 4FG7A 4CKIA 3SVVA 3KXZA 3ULIA 3GC8A 2W5HA 2YERA 2BRGA 2QC6A 4JT3A 4AGCA 3GCVA 5FG8A 4ANSA 1W0XC 3TNIA 4E6CA 2XB7A 2BDFA 2JIIA 5KZIA 3ZM9A 1GAGA 4OW8A 2UW0A 1KE8A 3RAWA 5CF8A 4FTOA 2YDIA 3DKGA 4UZDA 2WMTA 2HAKA 3OCGA 3QTUA 4QTBA 3LLAA 3I7CA 3PIZA 3PJ1A 4E4LA 3O7LB 4GJ2A 4RX5A 4WBBB 2JC6A 4AT5A 2ONLC 4PL4A 4PPBA 4RX9A 1WZYA 4XBUA 4O1OA 2VD5A 3LCDA 3MTFA 4IVCA 4XV2A 4QPMA 3HMPA 5DOSA 3GCPA 4TW9A 5A4CA 1ZOEA 4G3GA 3CSVA 4DE4A 3C13A 3IG7A 3PIXA 4F99A 4PQNA 4BIBA 2OBJA 3R8ZA 2WMSA 1PMEA 3PJ2A 4WIHA 3HV5A 1JSUA 3Q3BA 4XG3A 5HE3A 2J7TA 5FTOA 5AP3A 3SLSA 3QQHA 2JAMA 3ZUVA 5L2TA 4G9RA 3DAJA 4WNMA 4G31A 5L6WL 3E3PA 2P33A 3H0ZA 3HGKA 3JYAA 4FZ6A 3HDNA 4IXPA 4B8LA 4F9CA 4QMXA 5CVGA 3LZBA 2J0KA 1H28A 3R7EA 2JDVA 1JKLA 4MD9E 4AN2A 2XAMA 4H1JA 3KXNA 2XJ0A 2NP8A 3UC4A 4CQEA 3D5VA 4E26A 3IQ7A 4ZJJA 3LCOA 5KMIA 4FKRA 2WQBA 4P5ZA 5FEQA 3LFSA 3CTJA 3IK3A 5DRDA 4GKIA 1MQBA 5JEBA 1H00A 4YURA 3ZSHA 5L8KA 2VNWA 4U8ZA 5EYKA 1P4FA 5ANGA 4QQ5A 1Y57A 3VBWA 4F6WA 2YITA 1CM8A 3OG7A 2ITVA 4QT1A 4PDYA 5H8BA 4YTIA 3LJ2A 4MWIA 3GU4A 3OBJA 1DI8A 1SMHA 2ITQA 2XKEA 3JXWA 3U9CA 3O2MA 2UZDA 3K2LA 3QWKA 4FSZA 4WNOA 3VUDA 3UJGA 4PMPA 4N70A 3DBCA 4FG9A 5GNKA 3CY3A 5CXZA 2WMXA 2QI8A 5GIPE 5AX3A 1WBOA 3DY7A 4AOTA 2Z2WA 4D55A 5JGAA 5IU2A 1A9UA 4RZVA 4UY9A 1Y6AA 4OTRA 4YZNA 4AP7A 5HTCA 3Q96A 1YHVA 5DFPA 4C4HA 2B7AA 1J91A 2F2CB 3Q2JA 3HMMA 4PTGA 3K5VA 4WHZA 3DBFA 2XMYA 4H3BA 5HESA 2W05A 3RWQA 2QOHA 2VWBA 3QGWA 4IB1A 4ITIA 5J87A 1L8TA 4HCUA 3HVCA 3GC9A 3NRMA 3FPQA 2G01A 3ET7A 4ZOGA 4IEBA 4MQ1A 5A46A 2JBOA 1GIHA 2RFSA 2X0QA 3K5UA 4ZTHA 2HZ4A 1XQZA 4LRKA 4BCJA 4BCMA 4LDTA 4RMZA 2ETRA 4N6YA 4KIPA 2YLFA 3TZ9A 1KV1A 5EM7A 2JITA 3S95A 4RFYA 4LUEA 2H34A 3ZLSA 4ZMEA 4FKJA 4WG4A 5AR7A 3SKCA 4CYJA 4HVDA 2OJFE 3IDCA 1RE8A 1G8KA 4I24A 5EDPA 1OECA 3Q4UA 4JAIA 4QQCA 2PUNA 2C4GA 3TXOA 4C8BA 5JH6A 2HELA 5JRQA 3LFNA 3UOHA 2PUIA 2QHNA 4XG9A 4TXCA 2OXXA 1WFCA 5LARA 2GHMA 2PVMA 4I94A 1XMMA 1ZYLA 3UO4A 4QMMA 4TWNA 3BCEA 1E9HA 2OZOA 3QALE 3LFCA 4NIFB 4FC0A 2C1BA 3OEZA 3W18A 5LVPA 3LE6A 5BVFA 2IZRA 3U55A 3FSFA 3EB0A 3HEGA 3E8EA 5L2IA 3G51A 4ZZMA 2IZUA 5K0KA 2YZLA 3D83A 4HPUE 5FEEA 5KO1A 3RKBA 3HP2A 4JRVA 4KKHA 4EH8A 4EEVA 5EW8A 4GT5A 4I0SA 5J8IA 4EKKA 2XRUA 2BAJA 4BF2A 4FSNA 4AA5A 2OJJA 4EHEA 2NRUA 5KE0A 3FLNC 2UZTA 3C4XA 4Y73A 2R3OA 1OM1A 4DFLA 1JSVA 5M57A 2X0OA 4S32A 1NVRA 4BJJB 2GNGA 2R3FA 2XNGA 2VN9A 1URWA 2OW3A 1SNUA 3K54A 5K4IA 5M51A 1GOLA 3VS6A 3HV7A 4IZAA 5EM8A 3ALNA 3BHVA 3FE3A 4J1RA 4P7EA 3FC2A 3KK8A 3PE1A 1OB3A 3E3BX 4AGDA 3E8NA 3LQ5A 3LW0A 5IUIA 5I9XA 2FSLX 3C5IA 5EQEA 4M14A 5AP5A 3W1FA 1K2PA 4D58A 3DNEA 4IDTA 5AWMA 3FLZA 2XP2A 3W0SA 4X3FB 3I1AA 4ZS4A 2XK8A 3P0MA 4K8AA 5CXHA 4O84A 3PVWA 3W0MA 1YHSA 4XOYA 5IEYA 3ID6C 3ZC6A 3WF7A 3PXZA 4DDGA 3ROYA 5E8UA 3R8MA 3ZEWA 4UN0C 3TTJA 1PMNA 2ZMDA 3Q53A 4QQJA 3FMLA 3DFCB 2V5QA 4NUSA 2OWBA 3QQLA 2C6TA 5HKMA 3T3VA 3HMIA 3SOAA 3I5ZA 4QMLA 2V22A 4PUZA 4EOJA 4M97A 3D9VA 4KWPA 4C3PA 3QRTA 1YDTE 4GK4A 3RPVA 3ZO1A 4E93A 5B2MA 1YXUA 3EH9A 4MBLA 4O4CA 1Q8ZA 1IASA 1Q8TA 4FL3A 3BYSA 3ZUUA 1LP4A 4KSPA 2R3GA 2GNHA 3RMFA 1FOTA 2HZNA 3CJFA 3FL4A 4BYIA 3F2RA 3GFWA 1W8CA 1XR1A 2QKRA 3BIZA 4BY9E 5A14A 4GFOA 3TTIA 3W55A 3QTWA 3P5JC 3AC4A 2XKFA 3DBDA 5EYDA 4FTQA 5EHLA 4QMQA 2XNPA 4NSTA 1O6KA 5AFVA 1LPUA 4W8DA 4RRVA 3QTQA 3S4QA 5CAVA 4ZSGA 1E1VA 1H07A 2CN8A 4G6LA 4EHGA 1TZDA 3ZTXA 4EQUA 2YIRA 5EOLA 3ZC5A 4EK8A 2C5XA 4WT6A 4ANBA 2I0VA 4D5KA 3UP2A 4LMNA 3WZEA 3IOPA 3G6GA 1W2DA 3SV0A 4AAAA 4FT5A 4NIFA 5HTBA 4D2TA 1U54B 5KBQA 3M42A 1ST4A 2QCSA 3FMEA 4FSMA 4S34A 1KV2A 4DG3E 3S3IA 3OP5A 2OO8X 4FKQA 1F5QA 2XCKA 5J9ZA 1BKXA 5JFVA 3CQEA 5E9EA 2YM3A 4O0SA 3RNYA 2WFYA 3FV8A 3VUMA 4AZSA 2X7GA 5H3QA 2WGJA 3BHYA 1ZLTA 4C2WA 4MBIA 3ZU7A 3O51A 4GW8A 3WZJA 3HA6A 2JIVA 4WSQA 3NSZA 5DRBA 4RJ8A 4R78A 1U46A 3AMBA 3DCVA 2OU7A 3BBTB 2J4ZA 4YNOA 3H30A 3L9NA 3PY3A 4BJJA 4LOQA 4X0MA 5CAUA 3DTCA 3COIA 4X2NA 4I0TA 3HECA 4IX6A 1U4DA 3UOJA 4CD0A 3D5UA 3FZTA 2YCSA 4XNEA 5CYIA 2PWLA 3TACA 4JIAA 2ITPA 3ZCLA 3W0RA 3KRWA 3VS3A 1PRYA 3MESA 2YM7A 4F1TA 3RK9A 5HD7A 1KWPA 2QOIA 4HNFA 2PMIA 2Y6MA 4X3FA 4DH5A 1MRVA 2XAOA 2ACXA 3GENA 3GI3A 1PF8A 2YIYA 1BUHA 3LJ1A 2O63A 5E1SA 3LFFA 4JBVA 4G9CA 3UIXA 5J5TA 5A4TA 4TY1A 5D12A 4DEEA 2JGZA 5JQ8A 3VUHA 5KUPA 3DJ5A 4RT7A 5J5SA 1H1WA 2VTJA 3KF4A 3QYWA 4WOVA 2YM8A 4IQ6A 4PV0A 4YPDA 5I9YA 2BKZA 4MWHA 4KIOA 4LL0A 2YCFA 2R3PA 4OTDA 4X6QC 3V8WA 2YIQA 3BRBA 4ANLA 4ASZA 2J9MA 4G1WA 4DEAA 1YQJA 4O4EA 3NVKI 5IH4A 2W99B 4PTCA 2VWIA 5T68A 4QMVA 2H96A 3G9LX 5L2QA 5AA9A 2IPXA 3HZTA 2WEIA 3NAYA 5HIEA 1ZARA 3M11A 4MHAA 1R78A 2BDJA 4KS7A 5GJDA 4LYNA 4RBLA 1JVPP 4DH3A 4MVFA 4HJOA 2BROA 5AUUA 2X8DA 1UV5A 3OWPA 2CHLA 4RVMA 4CMUA 5A9UA 3AD6A 3GU8A 4M8TA 3QA8A 4AFJA 1IAHA 4BC6A 3OW3A 2O5KA 2GNFA 5HNBA 5CAOA 4QDEA 4ERWA 2WQEA 3BGZA 5ETIA 3DGKA 3AC5A 4O0UA 3FXWA 4RVKA 3ZRMA 4AW0A 2HZ0A 2HZIA 3HAVA 2UZLA 2RFDA 5I3RA 4XG2A 1CSNA 4I6LA 4KAOA 4ACCA 4YJVA 4F7LA 3PVGA 3OWKA 5F94A 1PHKA 2WTCA 3BYMA 4FVRA 3COHA 4FV4A 3LHJA 4I1ZA 1U54A 5AP6A 5JK3A 3FI8A 3QUDA 3W0PA 3QKKA 4FODA 4G3DA 1Q5KA 3GFEA 4BR3A 3S2PA 1UKIA 4XH6A 3FC1X 3MGYA 4BBEA 4W4WA 2A4LA 1YXTA 5FBOA 1Q41A 3U51A 3WZDA 3PY1A 5CU0A 5D10A 1PYEA 4RVTA 4BTFA 4O7ZA 2QHMA 3UP7A 2PZIA 2QNJA 4NL0A 2CJMA 3RALA 4EL9A 3O23A 4GVAA 4GFMA 4BZOA 3BYOA 2FUMA 4ZTRA 3TV4A 4EONA 3UDSA 1OIRA 2Y6OA 4JQ7A 1OL2A 5LQFA 4WRGA 1XH6A 4XHKB 2J50A 4BRXA 4U3YA 3RJCA 4EWQA 2FSTX 2WQNA 3KVWA 4U3ZA 4UWYA 4D2RA 5AV4A 3NVMB 4CZTA 3R01A 2W1DA 3FMNA 3BLHA 3FJQE 4IVDA 3R8LA 1VR2A 4YJUA 2WTDA 2QLUA 4GH2A 3V04A 1OPLA 3TEIA 3LLTA 4F63A 3QX2A 2YM4A 3HRCA 4S2ZA 4XG8A 4C7TA 3L9MA 4YC8A 4EZ5A 3SA0A 4II5A 4LRJA 3V5JA 2GDOA 4EK5A 5C4KA 2R3MA 4EH7A 3OT8A 1Y91A 3EJ1A 4FGBA 3R63A 4OTHA 5JKGA 3EN5A 4L42A 5E8SA 3TL8A 5IMXA 1FVTA 2X8IA 4FRFA 1P4OA 3OW4A 4L44A 4QP8A 4X3JA 1ERKA 1FVRA 2JKQA 4KIQA 2VWVA 4HZSA 4OBQA 4XLIA 3QD2B 5DGZA 5FRIA 2ONLA 4NCTC 3HAMA 2BR1A 4FKVA 3CKWA 4BDGA 3NUXA 5EW9A 1OL1A 3FMHA 3FHIA 4XX9A 5A54A 4F7SA 4O86A 3HMNA 3RPSA 4PY1A 3WOWA 2PVLA 4FA2A 2JEDA 4I6BA 4R7BA 2E9NA 4ZZOA 2P4IA 4JBQA 3MY0A 4H1MA 4D1SA 5ICPA 1BI7A 1YW2A 2BDWA 2IW9A 1H08A 5IA0A 4I5MA 2V0DA 3R7OA 1F0QA 3PPJA 2UZWE 1Q8YA 4HVIA 4FEWA 3CD8A 3GOKA 5LVOA 3F66A 3HX4A 1WBNA 1PXJA 3FY0A 5AV0A 3PJ8A 4CKJA 5H8GA 2GNLA 4J95A 2OJIA 3CKXA 3ERKA 4A9TA 4BIDA 2E9OA 3O0GA 4EOPA 4IAZA 4JL9A 3V5QA 3PWYA 5TR6A 5DE2A 3A8WA 4B8MA 5BVDA 2BALA 2X4FA 2PZPA 4YPSA 2C6LA 1YI6A 3BV3A 3ENHA 4LG4A 4L45A 2Z7QA 3EOCA 5FTGA 4I6QA 3R7IA 4JS8A 5AP7A 1VYWA 4FZ7A 4G3EA 3OCTA 5FXRA 4BDCA 3NUAA 4OTFA 1JKTA 5CF4A 4RPVA 2YWVA 3DKOA 3UIBA 3QFVA 5BYLA 4QYEA 2CNVA 3A2CA 3R0TA 3LAUA 3C4EA 3PFQA 4R5SA 4F4PA 1YOLA 3V5TA 3BQCA 3FMJA 4CGAA 3NNXA 3KF7A 4GJ3A 4A7CA 3LXKA 2GS2A 5LOHA 3GP0A 2YLEA 3THBA 1OKVA 3VS5A 4BWXA 2PVRA 5KHXA 4W4XA 3Q32A 3TUDA 2XVDA 2P3GX 2OF4A 3EL7A 3T8OA 4C38A 3HV3A 1H27A 3G5DA 5BPYA 4IWDA 4J52A 3ZYAA 3VF8A 3AKKA 1OKYA 3AQVA 2B9JA 3F2AA 3OXIA 4AW2A 3F6XA 2PUUA 4L7FA 5EM5A 4G6NA 3PJ3A 4C37A 4DHIB 2GFCA 5E90A 3REPA 3L1SA 3H0YA 3NYOA 3R71A 4P90A 4Y95A 1WBTA 1OGYA 4RX7A 3QZFA 4JQ8A 4FKUA 4FV3A 5ACBC 5L2SA 3NAXA 2QD9A 1K3AA 2BVAA 4ZSJA 1DM2A 3KREA 5JZJA 4NM3A 2QKWB 2F4JA 4PMTA 5CSXA 2WMQA 1Z57A 2P2HA 4FSRA 3OROA 2AEGA 5M08A 2G9XA 3I79A 2OG8A 1BL7A 5JMSA 1Q4LA 1XH5A 2ETKA 3HNGA 2XK4A 4ZLZA 3DQXA 3F3WA 5LMKC 4DDIA 2WTIA 4TWCA 3VAPA 3PXQA 4BHZA 3IW5A 5DR6A 3QF9A 4U97A 4KSQA 4AZEA 4F65A 4C3RA 2CCHA 3TZMA 3R9OA 3BELA 4MEDA 2VGPA 4D4YA 2QR7A 2BKKA 2XJ2A 3NEWA 4JBPA 1M14A 2A1AB 4LRMA 4HNIA 4OAUC 1OBDA 1GJOA 3MV5A 5ANKA 3TYKA 4M12A 2GFSA 2X7OA 4X6RA 3KCFA 2RFNA 3CQWA 3DJ6A 4NKAA 5HU3A 2C3IB 3KXMA 4MH7A 4TNDA 3B8RA 1T46A 1OL5A 4FIEA 4UMRA 3S0OA 3CC6A 2UV2A 1J7LA 2R0UA 4FX3A 3VIDA 3W2RA 4LV8A 2ETMA 2PMNX 3DOGA 2B9FA 2XKDA 2ZM4A 2ZV9A 4FSYA 5GJFA 4A4OA 4J8NA 3KEXA 5AR8A 4TYEA 3UTOA 2NPQA 4IH8A 4E5WA 5LVNA 4CQGA 2AC3A 2R5TA 5FDXA 4CFMA 3A61A 3UDTA 3GNIB 3M1SA 5JT2A 1JSTA 4MXAA 2PE1A 3ORNA 4P2KA 3SC1A 3R7GA 4TTHB 2CKQA 2C6EA 1PMUA 4S33A 2P2IA 3RZFA 4CMOA 3KMMA 2O65A 4LMUA 5HE2A 3RHKA 4PRJA 4E7WA 4R1VA 2XBAA 2CNQA 3E87A 4C35A 5IA4A 2VU3A 4IBMA 3I4BA 1BI8A 2B0QA 2WKMA 5FQDC 2X81A 5JQ5A 5E92A 3E88A 3EN6A 3ORKA 3A7JA 4AN3A 4C02A 2ITOA 3KCKA 3NUNA 5EQYA 1B6CB 3AG9A 4FTTA 4Y83A 2W4OA 3KQ7A 4UV0A 5E4HA 5FD2A 4DFYA 5EYCA 3RBWA 2PSQA 3V5LA 1H24A 2UUEA 4FUYA 2ITYA 3VF9A 2A0CX 3DLZA 3VUGA 4Z7HA 2B53A 2BTRA 5HI2A 4I22A 4YJTA 5M4IA 3RHXA 3SXSA 4GU9A 4FKTA 5H8EA 4R1YA 1E1XA 1UA2A 4IIRA 3VHEA 4C34A 4TKSA 3MJ1A 4MBJA 2ZB1A 4EZ7A 1RQQA 5IKWA 4FK6A 3EKNA 2CGVA 4BKYA 2XNMA 3VS4A 3ZZWA 2JKKA 3Q9YA 4YJRA 4DEHA 5BUJA 4C61A 2XF0A 2PMOX 5IA3A 4Z55A 3TI1A 2WMAA 2C6IA 3SG8A 4U79A 3OUKA 2JLDA 5CU4A 3VRZA 3DBEA 4AOJA 3W2SA 2B9IA 3PRIA 1PYXA 2EUFB 2W9FB 2C30A 4BTKA 3NUSA 3T3UA 3TUBA 3TMOA 5AUTA 1UNHA 3R1SA 4E3CA 2IEWA 3TZ8A 3G9NA 3Q60A 5DT4A 5ETFA 2XH5A 3NCZA 2W5BA 4EH6A 4FV0A 4B7TA 3TM0A 2YABA 4ASEA 5HLWA 2ITXA 1I09A 4BCOA 1PMVA 3I60A 4IAFA 2XK7A 4B0GA 3TDVA 3K3IA 2QU6A 1HCLA 4FBXA 2OIQA 4IADA 5EK7A 3FMMA 3OEFX 3PIYA 1SYKA 2XCHA 3FPMA 5DEWA 2B55A 4BWKA 4QTCA 2I0EA 3P7AA 1RW8A 3FHRA 3NNWA 2VV9A 3HYHA 4EUUA 3JS2A 4L01A 2QOBA 4EH3A 3DBQA 2X9EA 4CSVA 1J7UA 3QCYA 3QC9A 2GHLA 4UB7A 2W1CA 1H0VA 4FT9A 4H3QA 3GT8A 4C4FA 4FTCA 2XA4A 2WTJA 1GNGA 5FDPA 3POOA 2C1AA 2E9PA 2VTLA 4C4EA 4UYNA 4BCNA 4K2RA 5L4QA 4F0IA 5I4NA 2C0TA 3P9JA 3QKLA 5T6KA 3Q9XA 2PMLX 4MCVA 3CCNA 3AT4A 4HVSA 4CRSA 5DN3A 1WCCA 3EL8A 2BZIB 4BZDA 2YISA 2H6DA 4YJPA 4GCJA 3NW6A 3CLYA 4FTJA 4M7IA 5IH5A 4UX9A 4QMNA 2BAQA 2BRNA 3DXNA 4X2KA 3TIYA 4C2VA 5L2WA 3LCSA 4BDEA 5K3YA 4NH1A 3SW7A 1J1BA 5ETAA 4DLIA 1OPKA 2CSNA 3P86A 3BE9A 4FKSA 3QD0A 3WARA 2NNWB 5AX9A 3MFRA 4I93A 3II5A 4FKLA 2A98A 3GCSA 2QQ7A 3HDMA 5BUIA 4YLKA 5FP6A 4EQMA 4IB5A 4U81A 3HLLA 3CD3A 3ZLYA 2JFLA 4CYIA 3HUCA 2F7XE 2F49A 2VRXA 3E62A 3LQ8A 4NEUA 2C6DA 5HICA 5CI7A 4FE2A 1QMZA 4FL2A 5AV1A 3RM6A 4YZMA 3DPKA 3C50A 3AT3A 2VTOA 1ZXEA 3ORTA