3E8EA

Crystal structures of the kinase domain of pka in complex with atp-competitive inhibitors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
344
structure length
341
Chain Sequence
KKGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Aminofurazans as potent inhibitors of AKT kinase
pubmed doi rcsb
source organism Bos taurus
total genus 110
structure length 341
sequence length 344
chains with identical sequence B, E, I, L, P
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e8eA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e8eA02
5J1VA 5J7HA 2BHEA 4AZVA 2VO0A 3ZRLA 2EUFB 3MJ2A 3OTVA 3R9DA 3P5KA 2HAKA 2R7IA 3DB6A 3QYZA 2QG5A 1U4DA 3KULA 4ITHA 4YP8A 3ITZA 3KREA 5DA3A 3ROYA 1XHAA 2R3RA 5GJFA 4I6FA 2XBJA 2YITA 4BTJA 1FINA 5KBRA 2C6MA 4B8LA 4WBOA 5IU2A 5G1XA 3SXSA 4Y5QA 2XA4A 4U45A 3MVJA 4FV0A 5BMMA 3L8VA 3VS2A 1QMZA 4ZTMA 4RIXB 4ANSA 1AGWA 4F0GA 3ETAA 4I0SA 2C6KA 4I1ZA 2PMLX 1F5QA 1MRYA 3LFCA 2ITOA 4FBXA 5ANOA 4ALWA 4BCOA 4O7LA 3PIZA 5B7VA 4U41A 5LJJA 3GU6A 3NUSA 3VRZA 3KMUA 2B4SB 3TJCA 4NYEA 1GAGA 3QLFA 5FXRA 4QMYA 3JPVA 3Q2MA 5FBNC 5KMIA 5AX3A 1VZOA 3WE4A 5AAEA 1PJKA 5AIKA 5M4IA 1YQJA 3MFSA 4FI1A 2R3HA 4IX6A 3VUHA 1PXMA 4DEHA 3VUIA 5B2MA 4ONAA 3KEXA 5HO6A 3RINA 4C4EA 3VQHA 3U6JA 3KRJA 3G90X 3ZEWA 4ZSJA 2XNMA 3N4TA 3F3UA 3KK9A 3IK3A 4V0GA 1DI9A 1P4FA 1YDTE 5HCZA 1GNGA 2CCHA 4NKSA 1YOJA 3Q96A 4D2RA 3RALA 3UVQA 4M14A 3OEFX 2BKZA 5GINE 4XG7A 3EIDA 2E9PA 2WTVA 4FOBA 5EDQA 4C02A 4O0TA 3TZ9A 3VULA 2YJRA 3PLSA 3PE2A 3IW5A 5M07A 4LUEA 5DLSA 3HNGA 5AP6A 4BBMA 4FYNA 3SLSA 5AADA 3R22A 5CU2A 3VN9A 2JKKA 3NCGA 1F3MC 4GRBA 5CSHA 1KE9A 4KABA 2YM8A 3QQLA 4KBCA 4YC8A 5HCXA 4FKQA 3RK7A 5BVDA 3HLLA 5I5ZA 4C62A 5H9BA 3PP1A 5I9YA 2IZSA 4LI5A 4IAAA 1R1WA 4YTHA 3WE8A 5BMSA 4MBJA 2GNGA 2CHLA 2PSQA 3TKHA 4BF2A 1Y57A 4FOCA 2KULA 4ARKA 2R3JA 2DWBA 3IONA 1RDQE 4YHFA 1LR4A 4EOMA 4PWNA 2DUVA 4AG8A 5K5NA 2ZB1A 3VS5A 2OJGA 1RQQA 3ZBFA 4NU1A 5DG5A 3R7IA 3CKXA 2UW6A 3D5VA 5FBOA 1H08A 4K2RA 4WA9A 4ZTSA 5J5TA 1J7IA 4FIJA 1UNLA 1JKTA 2C3JA 2WMVA 4EYMA 5JSMA 3P7CA 5KHWA 3A7JA 3QC9A 3RBWA 5E8TA 3E8DA 3RAIA 1H00A 3FMLA 4FEQA 3ACJA 3IGGA 4G3CA 3TJDA 2J7TA 1J1BA 3KGAA 2Y4IC 4IDTA 4ITIA 4U5JA 5M55A 2JKMA 4II5A 4XG2A 2YZAA 3QX2A 3VW8A 2WMSA 4GS6A 4QTEA 4EK4A 4G2FA 4IZAA 3PY0A 2UW9A 2F7ZE 3QUPA 4DH7A 2J0LA 4NWMA 4JRVA 2FSTX 4E5WA 5M06A 3UYSA 4OAVB 4XLVA 2HW6A 3L9LA 3PVGA 3ORIA 5FXSA 5A4TA 4PP7A 2UVYA 4IDVA 3PXKA 3BLRA 4LYNA 3TNWA 3UOLA 3GI3A 5D7VA 3W18A 4BKZA 1ZOEA 2XNOA 3AGLA 4QP9A 3PG1A 1TQMA 2OXXA 3TV4A 4EH6A 2QLQA 3Q32A 4FF8A 2JKOA 2C68A 4P7EA 4F6UA 5A4CA 4LRMA 2B9JA 1OITA 3NNVA 3QKKA 4U8ZA 3ROCA 4EK5A 1OVEA 3LM0A 5JFWA 4EK6A 3C1XA 3BHYA 1M7NA 3D0EA 5JK3A 5GJGA 4UN0C 3R02A 3VUTA 2WTWA 4ZS0A 4WUAA 2HZNA 1KOBA 2WELA 3UE4A 3HX4A 5C8MA 3GCVA 4EOJA 5C4KA 2GMXA 3GU7A 3R2BA 5BPYA 3ZXTA 3NW7A 2X1NA 2PVLA 5GJDA 2XMYA 4ASEA 4XG4A 3MV5A 3VHKA 2V22A 4J1RA 3WILA 2XM8A 1GY3A 4GT5A 3AC4A 1PMEA 4QT1A 3RMFA 3UIUA 5LMBA 2OJJA 2C3KA 3UG2A 1KSWA 3R6XA 4KSQA 4FV5A 4KIPA 4NTSA 3QALE 3ULIA 2JEDA 5A9UA 3G0FA 2C1BA 2XEYA 2F7XE 2YM6A 4J71A 3IDBA 4NIFB 3G51A 4QP4A 5JQ8A 3A4OX 1JAMA 5AP2A 4HZSA 3GENA 5C9CA 4ZLZA 4QRCA 4PNKA 2YDKA 2GFSA 3A7FA 3IW8A 3KF4A 4YUQA 4BBFA 2ESMA 4FG9A 5AX9A 4JS8A 4L45A 3JYAA 5EM5A 2UZLA 3HDMA 2BMCA 2YDJA 3AT4A 2A27A 3O71A 4XG6A 4I22A 2P2HA 4DT9A 5ANJA 4CQEA 2CLXA 3B2TA 5HLNA 4HVDA 3C51A 4MAOA 3F3TA 2ZMDA 3FMMA 4YSJA 4ALUA 3ORNA 4TN6A 4I41A 3KQ7A 5BVFA 4TYHA 1VEBA 1QPDA 3DLZA 3S2PA 4KD1A 2XNNA 4MD7E 4BCKA 1YWRA 4GFGA 4BDEA 4XRJA 3UP2A 4U6RA 2QNJA 4A4OA 4U7ZA 2B9IA 2BALA 4RPVA 4BDAA 4FTNA 5IA5A 3FMNA 5EM7A 1L3RE 4RIWA 4D2WA 1FBNA 3L1SA 4DT8A 4CKJA 3TZMA 2ITVA 1BLXA 3VJNA 3V8SA 4EH3A 3SC1A 1WZYA 4YJQA 4I21A 4R3PA 3EMGA 3V5WA 4KBAA 5HOAA 4FEWA 4C33A 3U55A 1KUTA 3MN3A 3QAME 2XJ0A 1H4LA 4LG4A 4N70A 2RGPA 2W7XA 2GNLA 3COIA 2W1ZA 3NUYA 4LRKA 4QPSA 2VO7A 4F7LA 4UX9A 3MIYA 3KXZA 4TY1A 5TO8A 4ZTHA 1H07A 3UBDA 5FD2A 3ZDUA 4D1ZA 3QA0A 4KS8A 3QZIA 4O0VA 5HTBA 1Q8TA 3PZEA 3FXZA 5KMJA 5KNJA 3SW7A 4W9WA 3BE2A 3DXNA 4MD8E 4DINA 1RJBA 3HV5A 2UZTA 3ZU7A 4M84A 5FQDC 2ZV8A 1WBPA 1ZARA 3FQEA 4XX9A 3U87A 2I6LA 4HYIA 1HOWA 3VHEA 4ASDA 5IISA 3BHVA 5FTGA 5ANIA 3R1QA 3WZJA 3QTUA 2HZ0A 4GFOA 2BRHA 2UW4A 4PMPA 2IW6A 2X8IA 4YZMA 3WYYA 1YW2A 4HGLA 1K3AA 4ENYA 4DBXA 3U4WA 2GU8A 3QTIA 2VTOA 4KIKB 4P2KA 4IB1A 5AR8A 4FV2A 2B9HA 2V5QA 3G6HA 4AZTA 3KRXA 3IOKA 1BYGA 3V3VA 3DOGA 4C3RA 3PZHA 4WG4A 3DFAA 5FTQA 2IWIA 4PTCA 2YM7A 2WQNA 3I7CA 4USFA 1WMKA 3R8PA 1WVWA 4FKRA 2JIVA 3DAJA 1WBSA 4RQVA 4YC6A 3W2OA 3EFJA 3M11A 3NUAA 3P08A 4HCVA 3D15A 5CSVA 5E8ZA 4BWKA 2ZB0A 4QP7A 2XK7A 3ZFXA 4NH1A 4DC2A 5E90A 3F3WA 3PFQA 4U81A 2J0IA 2VTQA 3D14A 3Q9WA 4G3DA 3QZFA 4Y8DA 2O63A 3LCTA 4FTKA 4AOTA 2R3FA 1H26A 5EH0A 2ZM1A 2XBAA 1IRKA 4RIOA 3ZEPA 4AFEA 5CASA 4NJDA 3NRMA 3NUPA 4RMZA 4O7TA 5EM6A 4IFCA 1XWSA 4QQ5A 5BYZA 4UMRA 2J50A 2PVHA 5L4QA 5C26A 3H9OA 5LVMA 3BU6A 5HICA 4Q5HA 3AD5A 2Y4IB 4QTAA 1GOLA 3CSVA 4DH3A 4B0GA 5M57A 4O82A 3BELA 2BZHB 1ZXEA 3ORTA 1OPLA 2FSMX 5J9ZA 2UZNA 1H1RA 1UWHA 3EL7A 4IM0A 3UZPA 5J9LA 4F99A 4CLIA 5LCJA 2R3OA 1B39A 2V7OA 5HE1A 4EJNA 3TUBA 5EDRA 5L3AA 3A7HA 2R4BA 3OT8A 2CKPA 4RQKA 2REIA 5FP5A 5I3OA 5JZJA 4GJ2A 4QMQA 5EQYA 3E3BX 1YRPA 4ANNA 4AA5A 2JDRA 2OJIA 3R63A 1CDKA 3UO6A 3GP0A 4F09A 1W7HA 1SM2A 3NLBA 2RFDA 2JFMA 4U97A 3JXWA 2ITNA 1HCKA 5AV2A 3VS1A 5HX6A 4O83A 1KV2A 4PDYA 2W4OA 2EB2A 1SVHA 2ERZE 3GFEA 3OP5A 4L00A 3E62A 5CNNA 1QPJA 2VO3A 5E8XA 3DPKA 5C27A 3TNHA 4AGUA 5CXZA 4GKHA 2NRUA 5CAQA 4OTPA 2CJMA 5IQGA 4I0TA 5AA9A 3SHEA 2C3LA 4BDHA 3O0GA 4F1TA 2JDVA 2BDWA 3II5A 4FKOA 4BKJA 4BYJA 5LVOA 3TDVA 5E8VA 5CLPA 5DH3A 4DCEA 4QYEA 4ZSLA 4YTFA 3KXHA 2C5VA 3NDMA 4DH5A 3E88A 5EQPA 4ORKA 3FC1X 3V51A 5CS6A 5L8KA 5DHJA 4ENXA 3IW7A 3F82A 4FTMA 4WRSA 4X6RA 5HE3A 5I0BA 5DFPA 1ZLTA 4IWOA 1OZ1A 4MX9A 4C61A 3RNYA 3G6GA 2BILB 5ANKA 1SNXA 2VWBA 3KCKA 4ZZOA 5IMXA 2RIOA 5CTPA 2QC6A 2HZIA 3QHWA 1UU3A 2WOUA 3P23A 4H1JA 5FEEA 1U46A 5DT0A 4JDHA 5GHVA 4ASXA 2JBPA 5DRBA 4EKKA 5DEWA 5HIDA 1I44A 2PVNA 5KZ0A 3EKKA 2P33A 2PE2A 2XF0A 3F5XA 3POOA 4G6OA 3CTHA 1UNHA 3KVXA 3KXXA 4CMUA 4FV3A 4HYUA 3HL7A 2UW5A 4LGGA 1NW1A 2Z7LA 2WGJA 4EHGA 1H27A 4UXLA 2X8DA 3VVHA 3QQFA 4IADA 4PDSA 1QL6A 4CT2A 4RGJA 4AZSA 3QTRA 3CKWA 4DF3A 2XNPA 4MXYA 3UIMA 3FI8A 4UYAA 5KBQA 1FVTA 1KOAA 3SDJA 2QQ7A 5FTOA 2V62A 4GG7A 3NYNA 3JS2A 3REPA 3QQJA 4O96A 3KMMA 3AOXA 3ZH8A 2W5AA 4I93A 5EHLA 4J7BA 3ET7A 1ZYLA 2Z60A 3QTQA 4BFMA 1VYWA 3VS4A 5HBJA 1GZ8A 4E93A 3KRLA 2WMWA 5BUEA 1RW8A 1WBWA 4YZBA 5CAVA 1J91A 3OXIA 4Y5HA 3FLSA 4CG9A 4EOLA 3NAXA 3QZHA 4D0XA 5CEMA 2I0HA 3UO5A 4GW8A 4EHVA 3MH2A 3EJ1A 4AT3A 1OPKA 4C4IA 4Y95A 2EXCX 3UOHA 2WNTA 5ANGA 2CNVA 3PY1A 2QODA 3F2RA 2XZSA 4FYOA 1YOLA 3NYXA 1M2PA 4AE9A 2PY3A 4BCJA 5AV4A 5JT2A 3HZTA 4X3FC 4F7JA 3F9NA 1JNKA 5JFXA 4A9UA 4RX5A 1Z5MA 3DAEA 3E92A 3BEGA 3KC3A 3ULZA 3OZ6A 4MF0A 1NY3A 2WB8A 3KMWA 3OWKA 5EKNA 4IC7A 5CAOA 2XK9A 4AWIA 4R7BA 2ZM3A 4RX8A 4GK3A 5TKDA 3FMJA 2VGOA 5C8KA 3RZFA 2BVAA 4U43A 4BDBA 4BTMA 3I81A 2G2IA 3R9HA 2QR8A 1O9UA 3ZSIA 2PVFA 2YWVA 2OZAB 3NAYA 4FIIA 2HK5A 4F7SA 5IQEA 5LMKA 4USEA 2VRXA 4LGHA 4L6QA 4IBMA 4ZSGA 4CKIA 2XVDA 3QXOA 5LXMA 3ZC5A 5E8YA 3PSCA 3EN7A 4A7CA 3UNJA 3QRUA 3MTFA 4ZY4A 4XS2A 4IHPA 3R04A 3SV0A 3TNPC 4E20A 5IA2A 3TV6A 3ODZX 2J51A 2O5KA 3UGCA 3NUNA 4IEBA 4S33A 3UJGA 3Q4ZA 4U3ZA 3HP5A 1I09A 4D2SA 4BCHA 2X2MA 1RE8A 5DRDA 5BVEA 4GIHA 4KWPA 4YJSA 3O23A 2GFCA 4M69A 3MVMA 4GK4A 4ZZNA 4ZTLA 3R8UA 4XOYA 1UKIA 1YVJA 4G34A 3KRWA 3TIYA 4TWNA 3PA3A 2BRNA 1KWPA 1YWNA 2ZDTA 3HECA 3F3VA 2IVTA 4JBVA 3LE6A 4QMPA 4AU8A 4F6SA 4EORA 1NA7A 1FVVA 1R3CA 3E87A 4XP2A 4KIQA 4FEXA 2YCFA 3LW0A 4FV1A 4NK9A 3E93A 4C8BA 5AIRA 4UMPA 4O81A 2V0DA 1LUFA 2PK9A 2Q0NA 4MNFA 4TZRA 1OIRA 4L3LA 5A14A 1PMNA 4X3JA 3F88A 4W4XA 3PP0A 4CCBA 2RG5A 5HQ0A 4MNEB 4YJNA 2JAMA 2WTDA 3OXTA 4MBLA 1E1VA 2PUUA 2YISA 4Z7HA 4A9YA 2JKQA 1M2QA 3HMOA 4G3GA 4HCTA 4AW2A 3SVVA 1E1XA 4OR5A 3V8WA 2PMOX 3LXLA 4K8AA 4WNOA 4YZCA 5JQ5A 1A48A 4TRLA 4A4XA 5KUPA 5LQFA 2BFYA 4JIAA 3IKAA 3D5UA 4WHZA 2OKRA 4PTEA 4QPAA 4L7SA 5CEIA 5CEQA 4UMUA 2W9ZB 1FQ1B 4DFLA 4F64A 1XH8A 4BCQA 3I79A 4CV8A 3MA6A 4EUTA 2SRCA 3W33A 4OTGA 3CBLA 1AQ1A 1GZOA 3E5AA 4HOKA 4FL1A 3VRYA 3GCQA 3VS7A 2BRBA 5HIBA 2JDOA 3MH3A 4ERKA 5HIEA 5AJQA 4RA5A 2VTHA 2CNUA 2XKEA 2OSCA 3RZBA 3ACKA 3IECA 3A7IA 2IO6A 4V05A 4B99A 1H1WA 3Q4TA 4C35A 4X7QA 4C2VA 1Y8GA 4FZDB 5LVLA 2PU8A 3MTLA 2VTIA 4ZSAA 2GS6A 4E4LA 5ANDA 1OUYA 3C4EA 3QHRA 1PXKA 3ELJA 1JSTA 1SMHA 3FZ1A 3O96A 1MUOA 3PVUA 4S31A 5KMLA 3CR0A 1NVQA 5DBXA 2GNHA 4EI4A 5DYJA 3GXLA 3T3VA 3PVBA 4D2TA 4FK3A 4FKJA 4QMVA 4R8QA 5CT7A 4KSPA 2O8YA 4F0FA 3KCFA 3AMAA 4YC3A 3FI2A 4G6NA 4QMNA 5EQEA 4FIFA 3HUBA 4QMZA 4UMTA 4HGEA 2XIXA 3CGFA 2C69A 2C5YA 3WOWA 3ZYAA 3T9IA 4BDCA 2B54A 4P90A 4D2VA 4AZFA 2JBOA 4D4SA 3QGWA 3QBNA 3O17A 4MYGA 2IZRA 4NM7A 4GUEA 1Q3WA 3OCBA 4QYYA 1YI6A 4FNWA 2OZAA 5JFVA 4E26A 5ACKA 3VAPA 3ORLA 3FQHA 2W1EA 4D1XA 2OXDA 3ZMMA 4M68A 5CALA 3DBEA 1JOWB 5DR6A 3W2RA 5TF9A 4IWQA 5AAFA 3TIZA 3UDBA 4WOVA 3VF8A 3ZLWA 4YO4A 3EZVA 3RAHA 3TTIA 3S1HA 5ITAA 3CQWA 4JX3A 4UWCA 2BAKA 2I0VA 5L2IA 3N9XA 3CGOA 5A4QA 1CKIA 5CXHA 4DEIA 3PXRA 2PVMA 3SAYA 4FUYA 4WG5A 3ANRA 4CZUA 4PPAA 4E8AA 4JRNA 4NM0A 2H6DA 3MVHA 4PX6A 3QTWA 5KO1A 2QKRA 4YLLA 2VTJA 4MQ1A 4ACHA 4X3FB 2P3GX 4DLIA 3LZBA 1T46A 4XG3A 3TWJA 5TE0A 1TKIA 1ZWSA 5M09A 3OY3A 5DMZA 3HYHA 2FA2A 3MSSA 3TZ8A 4MEDA 2G9XA 1IASA 1V0PA 2BDFA 2C5NA 3TEIA 4C36A 3F7ZA 4D5KA 4AQCA 3ZHPC 3JVRA 3UODA 5HEZA 3GU5A 4O0SA 4DG0E 3T9TA 3PYYA 4I0RA 4NFNA 3HVCA 3P79A 2RFNA 4K18A 4RSSA 2BPMA 2CGXA 3Q3BA 3PDTA 2RG6A 2OI4X 3K2LA 3R01A 4YPDA 3RPSA 4RJ4A 4FA2A 4EEVA 4BL1A 4ZTRA 3R7OA 1OIUA 5EG3A 3FEGA 4WBBB 2P0CA 3EN6A 3MPTA 4O0WA 4BCIA 5DEYA 4EH9A 4TPTA 5AP3A 3ZZEA 2PE1A 4Y72A 4FGRA 3D2KA 4BDDA 2IZTA 4QQTA 4YHJA 3HMMA 3HAMA 4S30A 3O50A 1WBOA 3DT1A 4C0TA 4I6QA 5JEBA 4QYGA 4FKSA 4WT6A 3CJFA 3ZO4A 2PZYA 3EQCA 4FIEA 3TTJA 3SOAA 5K4IA 3HMIA 1ZYSA 3OCGA 1YOMA 3PVWA 4YBJA 2BDJA 1JWHA 4NM3A 5CSXA 5C03A 3ZCLA 1OBGA 3G9LX 1PMVA 2PE0A 3ZSHA 3OWLA 3HV6A 4G1WA 3NUUA 5EI8A 3ZSGA 3DB8A 4JDJA 4AW1A 1JKSA 3EQDA 2C6TA 1V0OA 3A60A 3QA8A 5H8BA 4KRDA 4M7IA 3V8TA 2I0YA 2OG8A 2WPAA 3G5DA 3FQSA 3ORZA 4ID7A 5BVKA 4AAAA 2CKEA 5M51A 4AP7A 1PMUA 2IPXA 2WU7A 4IJ9A 4JBPA 3RM7A 4WNKA 5E1EA 4BVUA 3MY5A 4TT7A 4UY9A 3VS0A 3MB6A 3HV7A 4O1OA 4PDPA 2X81A 1CKJA 4BWXA 4JJRA 3BX5A 2WMBA 3U4UA 4BHZA 1PKGA 3R28A 3PXFA 5AM7A 4O0XA 3AQVA 4FV8A 2OIDA 4U80A 1DAYA 4DH1A 3NWWA 2NRYA 3UMXA 4D4VA 2CN5A 3DKCA 1Y91A 3EQHA 3MY0A 5HG8A 5FUTA 2R9SA 3DQXA 4IAZA 4AN3A 3DKGA 5AUVA 2VAGA 3B2WA 3E63A 4QQCA 4BCMA 4TTHB 4YJUA 4A9SA 4FT0A 2ZMCA 4QTCA 5F94A 4BCGA 5LOHA 4E6AA 3FUPA 4J95A 4QP1A 3ZUTA 4BC6A 1JSVA 2PHKA 4NL0A 3I6UA 2P2IA 3EH9A 1Q8YA 2BUJA 3V6SA 4TWPA 4KIOA 4Z7GA 4FKWA 4W4YA 3MFTA 4EHEA 1WVYA 3A8XA 3E3PA 2YAKA 3O7LB 3R2YA 5CQUA 3L9MA 3UIBA 5GZAA 3DQWA 2W4KA 3BKBA 4FV7A 3V5PA 4I6HA 4ZMEA 4MVFA 3R7EA 4PNIA 2VTAA 3EL8A 2BAQA 4FMQA 1FGKA 3NIZA 4KKGA 5EFQA 3HAVA 1ZZ2A 4Q5EA 4RFZA 4FSMA 2Z2WA 4RWKA 1ZMWA 3LLTA 4M15A 3HP2A 2OH0E 2X6DA 5J9YA 2IZUA 4FTAA 1REJA 2IVUA 4GU9A 4AN9A 2CGWA 2HWOA 4XEYA 3UVPA 2WO6A 3HDNA 3K3IA 3EFKA 3OWJA 1WBTA 1YXTA 2J0JA 1E9HA 4O38A 3MVLA 3JUHA 3PSDA 4HYSA 2GNIA 3BE9A 4YPSA 3Q6WA 4HVIA 3HMNA 4O27B 3QD0A 4OTHA 2GHMA 4AE6A 5HNIX 1G8SA 4FX3A 4OTRA 4Q9SA 1W8CA 5EHYA 4Y85A 1OB3A 3R30A 4X21A 4DFZE 3D7TB 4NCTA 2OU7A 3P4KA 5T6KA 4IC8A 4O0RA 3ZTXA 1B6CB 4ZSEA 3VS6A 1FGIA 5CT0A 3AC5A 4B7TA 4JL9A 1NVSA 2F4JA 3IW4A 1FMKA 3KN5A 2ZM4A 3Q5ZA 2JITA 3H10A 2YIQA 3DDQA 3EN4A 3E64A 3BWJA 5M53A 3OUKA 4AZEA 4NTTA 2JDSA 3GEQA 4AF3A 3ENMA 3EHAA 2R3KA 3P0MA 4QMOA 4PMSA 4RFYA 1BL6A 4RIXA 5CU3A 4ZOGA 5G6VA 2XS0A 4AA0A 4YNEA 3EB0A 4OTIA 5EOLA 2GS2A 4QP8A 2OF2A 3LFQA 3W2QA 3WYXA 4FEUA 3LVPA 5HX8A 2LGCA 4DEAA 5J7BA 4G3FA 4QNYA 4YLKA 3TACA 1GIJA 4C4JA 4DTKA 3BBTB 2C3IB 4FT9A 4RJ8A 5E7RA 5CEKA 3ODYX 2IW9A 1WFCA 3A99A 4MQ2A 5ETCA 3QRKA 2XIRA 3L8XA 4BR3A 3OMVA 4CRLA 4ERWA 4QMMA 1YHVA 4BB4A 1O6KA 2PZ5A 3LXNA 5IUIA 3COHA 2QU5A 2YABA 3C5UA 3MS9A 2QONA 5EHOA 3BWFA 2W05A 3ORKA 3RK5A 4R1YA 2I40A 3E7VA 4FL3A 3UVRA 2WU6A 4CZTA 3K54A 1ZYJA 4X2FA 4O1PA 4XJ0A 5CX9A 4RLLA 2R0UA 5HESA 3VQUA 2X0GA 3DS6A 4QOXA 4QYHA 4BIEA 4B4LA 3UZTA 1UU7A 4E6CA 2GNJA 3FLZA 3DKOA 4RJ5A 4BDGA 2HZ4A 3CTQA 2YM4A 1LPUA 4YZDA 3UNZA 2PUNA 3IPHA 4FIHA 3FXWA 3GU8A 4CFUA 2C4GA 4NM5A 5M4UA 4JQ7A 1CTPE 5B0XA 3Q52A 3R71A 4F70A 3VBYA 4BTFA 2EVAA 3QQGA 1CMKE 3PPZA 2W17A 4AGWA 3PLAE 2V7AA 4Y46A 4OW8A 3DTWA 4JI9A 3PXZA 4G5JA 1K2PA 1GIIA 5C8NA 4DFXE 3DZOA 1H28A 4EZ7A 4GT4A 2W9FB 2YM5A 2X4FA 4IVAA 3EQPA 3TCPA 3WF7A 5L6OA 3BGPA 3JY0A 4IB5A 1XBCA 2QU6A 2WMTA 3R21A 4RG0A 4NUSA 3NR9A 3Q6UA 3BGQA 4M66A 2QO2A 3PRFA 2BR1A 4JNWA 4EWHA 1P14A 4FTTA 2UW0A 5DWRA 4O7RA 5AMNA 4Q2AA 3FZSA 4Y73A 1OECA 3KA0A 2CNQA 3OVVA 4FTCA 2YHVA 4AGCA 5BUIA 5IQDA 2HW7A 2QOHA 3Q60A 4BBEA 1HCLA 3RPVA 3MWUA 3OCSA 5L8LA 4EK3A 4DG2E 4I4EA 2BROA 4IVCA 2HYYA 2GQGA 1Q41A 4H3PA 4K11A 4RJ3A 4IJPA 2C30A 1FPUA 3LJ2A 2RSVA 4TXCA 4XG9A 3UMWA 5IH5A 3BLHA 4L53A 3ID6C 3W1FA 2CPKE 4OTWA 5EI2A 2OJFE 3NW6A 3BHTA 3VO3A 5BVWA 3D9VA 3CLYA 5DT3A 5BUJA 4YMJA 4I23A 4ZJIA 1BUHA 4OBOA 4RBLA 5FXQA 1H0VA 3EQIA 2UZVA 4L3PA 1UU9A 4RVLA 2NPQA 3CY2A 3KXMA 4ANLA 3BV3A 2Z02A 2ZV7A 2X9FA 2XKCA 5KX8A 4GEOA 4G17A 4EH8A 4KB8A 4JIKA 3MB7A 4BTKA 2I7QA 3IS5A 1M52A 4FT7A 4X6QC 4I24A 4QMLA 5CNOA 3HA8A 5GZ9A 4TKSA 1OKWA 2HY0A 5HU9A 3FSKA 4OAUC 2QHNA 3DLSA 5JH6A 2BCJA 2UW3A 4FZ7A 1ZMVA 2QOIA 1ATPE 2HENA 4TNBA 3QCQA 4M0YA 3EYGA 4FKTA 1L8TA 5JRQA 2BZIB 4YU2A 4JX7A 2PTKA 1PXNA 1ZAOA 3RPOA 1W82A 4FT3A 4U42A 3MFUA 4CFFA 5IA1A 4DFYA 4CMOA 4EBVA 4ZK5A 4TWCA 1NVRA 3T8OA 3MPAA 3QUEA 3DDPA 5M44A 3CEKA 4FV6A 3DA6A 2VWXA 4IACA 2FVDA 4DTAA 4O84A 1LEZA 5HBHA 4ZJVA 1TQPA 5E91A 1Y8YA 5B2LA 2CCIA 2W1FA 4IVBA 4NIFA 4RZWA 5AM6A 3R1SA 3EQFA 1OKYA 5CVFA 2VNWA 4OBQA 3R9OA 4LQMA 4LOQA 5LMAA 4O0YA 4AA4A 3U6IA 4FKIA 4LOPA 4EQCA 5HORA 4NEUA 4NW6A 4N0SA 4W8DA 2VX1A 5HG9A 1PYEA 3RHKA 2CSNA 3QTSA 5HI2A 5K0XA 4GH2A 3V01A 2BTSA 5AUXA 5HO8A 4BRXA 3LOKA 3WF5A 3QF9A 4HJOA 2ZDUA 2YJSA 5FM2A 3OXZA 5IA0A 4EOSA 4GK2A 3ZUVA 4CLJA 1KV1A 3DFCB 3UG1A 2BIKB 3DTCA 2VTRA 3LFBA 3Q04A 4ANBA 2Y9QA 4D28A 2E9OA 3O51A 1WCCA 3GC7A 1DAWA 3S3IA 4K77A 1J7LA 4ZMFA 2ONLC 3PJ8A 4L9IA 4RIYB 2CMWA 4XP3A 4DHFA 4EKLA 4PPBA 2QVSE 3F2AA 4IWPA 3KXNA 4J8MA 3U9CA 4HGTA 2VTPA 4YO6A 3CD3A 1G3NA 2B7AA 3FZOA 4OTQA 4RC2A 4K1BA 2W06A 3L8SA 1MRUA 1PY5A 3RCJA 4AUAA 4CTCA 5FDXA 4UEUA 5IQFA 1WAKA 2WQBA 2XJ2A 4H3BA 4WO5A 4DGNA 2UV2A 4C4GA 1IEPA 2ITUA 4X2GA 3KXGA 1M17A 2R3MA 4FKLA 3CIKA 3RGFA 3QLGA 5B2KA 3LXPA 4KINA 4M67A 2WQMA 4UWYA 3CQUA 5M4FA 4U40A 5H8EA 3E8CA 1URCA 2H96A 4ZZMA 4EQMA 3AC8A 2IW8A 2GNFA 4GVAA 4DTBA 3BCEA 2OH4A 2Z8CA 5L2QA 4OLIA 4N6ZA 5DR2A 3C7QA 4Q9ZA 3U9NA 3QWJA 5DN3A 1IA8A 3FV8A 4XHKB 2CLQA 4CGAA 3ATTA 3RWPA 4RJ7A 5FEQA 4KAOA 2A2AA 4NT4A 5K4JA 4DYMA 5EW3A 4OUCA 5ACBC 4RX7A 4F1OA 1ZOGA 2C6LA 4XP0A 4P5QA 3OCTA 2A19B 4NFMA 3OUNB 4OBPA 1XBAA 1XJDA 5TOZA 4DITA 4KIKA 1WBVA 5IQHA 3OS3A 4O91A 2VX3A 1J3HA 3B8RA 3PSBA 1VYZA 4M8TA 5AUWA 4AW0A 4C2WA 5GNKA 5ETFA 3MBLA 3LHJA 4ZY5A 2XCKA 5JMSA 3TUCA 1NT2A 4MHAA 3OC1A 4YGAA 4LV8A 3F66A 3AC2A 2Y6MA 2Z7SA 3MI9A 4IH8A 4ZEGA 5CAUA 2BTRA 1YI4A 4GL9A 1JVPP 3LFDA 4R7IA 3DZQA 2W5HA 5HG5A 5IH6A 2UZBA 3NNWA 1OMWA 1S9JA 3BHHA 3I0OA 3AC3A 4J96A 4XV2A 5EOBA 4PDOA 3UOKA 4KA3A 2YLEA 4R3CA 3OW3A 2WMQA 3PJ2A 4QMUA 1EH4A 4FZ6A 1OIQA 4PQNA 3AD4A 1M14A 5AP1A 5EI6A 5GZ8A 2GTNA 2V55A 3NNUA 2X7OA 2UZUE 3MESA 4O7VA 2QOBA 2XRWA 1UWJA 3TXOA 3Q5IA 4DGLC 2YAAA 5DI1A 1K9AA 1H25A 1KE5A 5HTCA 3QGYA 4IM2A 1H24A 4MXOA 3LCOA 3ZBXA 5M4CA 3DKFA 3F69A 3U8WA 3OWPA 2VV9A 3F61A 4GVJA 4BI1A 3QRTA 3BU3A 4FTRA 3BLQA 1PW2A 4EZ3A 3PPJA 3PTGA 1GZNA 4E3CA 2OIBA 1GIHA 3VBVA 5CU0A 4BWPA 1GJOA 3ZONA 3CY3A 4G5PA 3LLAA 4R3RA 4U0IA 2H9VA 3R9RA 4F9BA 1YWVA 5IF1A 5GIPE 2PPQA 4FE2A 1OKZA 2XK4A 5CI7A 5A6OA 2X2KA 2Y8OA 4PMMA 4FR4A 4IW0A 3P7BA 1Q24A 3ERKA 4EJ7A 3U54A 4WSYA 3B8QA 2XKFA 3FLWA 1WVXA 4OT5A 4MH7A 3FMDA 3D94A 3NSZA 4DGGA 4CSVA 1UNGA 3RAKA 1T45A 3BBWA 2QI8A 2WMXA 2IN6A 4DA5A 3RHXA 2CDZA 1Y6BA 2FSLX 2C5XA 2VTTA 4QNAA 4TWOA 1AD5A 3C4XA 5HNGA 4XG8A 5JRSA 2OICA 5T68A 4BIDA 5D9HA 4EOQA 5HLWA 1PXIA 4BIBA 4IZYA 2HY81 5LWNA 1QPEA 3TNQB 3AXWA 1P5EA 2QHMA 3F5PA 4IAFA 1OGUA 3DBCA 5HLPA 3UQGA 4E4MA 3POZA 3A61A 3R73A 4LL5A 3C0GA 5AV1A 4XOZA 4APCA 5A6NA 1XKKA 2E9VA 4FEVA 2P4IA 4EK8A 3DU8A 2UZWE 4BGHA 3KY2A 2W0JA 5DNRA 3ZO2A 3W55A 5CF8A 2XK3A 3W8QA 1XQZA 2JAVA 3QD3A 1KE6A 2UVXA 5IEXA 4USDA 3SQQA 4CKRA 3SX9A 2R5TA 2HWPA 2XUUA 5EKOA 3CJGA 3IO7A 5IMEA 4CG8A 4OTDA 3FKOA 3V6RA 1R39A 3BV2A 1OKVA 4K0YA 4KKEA 4CD0A 3GGFA 1OUKA 5HKMA 3S4QA 4O22A 3GVUA 5F1ZA 3VC4A 2OFVA 2R3PA 1ZY5A 2XCHA 3HRFA 4HGSA 2C5OA 2O2UA 2W1CA 4O2ZA 5IA4A 4HPTE 2XKDA 3LPBA 3OROA 5LARA 4DEGA 3KULB 4O7SA 3ZDIA 1A06A 4M0ZA 4D55A 2WAJA 3BYOA 3FHIA 3PE1A 4PL3A 4DFBA 5FLFA 5JFSA 5GIOE 5K9IA 3WF6A 3V5TA 1J7UA 3F2NA 5H3QA 4MXAA 1BMKA 4EHZA 5CF6A 4OTFA 3PY3A 4E7WA 3NVKI 3LJ1A 1W83A 2OWBA 4CFWA 3TKUA 3R1NA 1A9UA 3F5UA 1U59A 5TT7A 3VUKA 4AT4A 2HXQA 2C6EA 3DBFA 4B9DA 4I4FA 4HW7A 3ATSA 4J99A 4H3QA 4L01A 2ZVAA 2R64A 2YWPA 4I5CA 5FEDA 5M56A 4E5BA 5LVNA 2ZJWA 4I94A 2VNYA 5ETIA 4CFNA 5HTIA 1R0PA 2QKWB 3GC9A 4BKYA 1P4OA 2F7EE 2IVSA 3IDCA 4M3QA 5H2UA 5HE2A 4EOKA 5CAPA 2GTMA 2FB8A 5EYKA 4LV5A 4E6DA 5AP0A 4GMYA 4BHNA 5I9WA 4PUZA 1DM2A 1Q61A 4RWJA 1V1KA 3FI3A 4IVDA 4S32A 3WIKA 1JKLA 1BKXA 3WI6A 1W0XC 5CF4A 3E7OA 2X39A 2ZYBA 1F0QA 3VUGA 1B38A 4V0GB 3Q9XA 3DBDA 2G2HA 3LQ5A 3UC3A 2QOFA 3CP9A 5A4LA 2XNGA 5JZNA 3OT3A 4O21A 1UA2A 3NGAA 3FDNA 3FL5A 4FTIA 4FKUA 4XV1A 3QYWA 4HVHA 5KHXA 3OHTA 2ERKA 1XH9A 1ZYCA 2YERA 2RKUA 1OPJA 2UZEA 4XBUA 3ENHA 3EFLA 3OF0A 3JR1A 2W1HA 1UKHA 3MIAA 3KB7A 3Q4CA 4DLJA 4L52A 4ZXTA 4RVTA 4U44A 4DE4A 3SOCA 4WKQA 3FSFA 2OIQA 2AC5A 3D2IA 2XK6A 1JSUA 5F9EA 4BGQA 4JG7A 3MJ1A 3QTZA 5AUTA 4W9XA 5KMMA 2IG7A 1ZYDA 4IXPA 5CQWA 2X9EA 5IKWA 5I3RA 2YZLA 2J5EA 4ZTQA 3RPRA 4GIIA 5CVHA 3BYUA 3OY1A 3UTOA 4C57A 1YDSE 5IUGA 4QTDA 2PULA 3G2FA 2J9MA 2BHHA 2OF4A 2X6EA 3AT3A 3LFSA 4DEDA 1U5RA 4F63A 4EH2A 1Q99A 4EL9A 3M2WA 1H0WA 5HNBA 4AN2A 1JBPE 2Y6OA 3HRCA 3NNXA 4BCNA 3DXPA 3DBQA 2XIZA 4L8MA 4CV9A 3ZRKA 3BRBA 1Z57A 3GOKA 4ZP5A 1MRVA 4JVGA 4D2PA 4K9YA 3ZLXA 4PP9A 4KRCA 4OT6A 4FNYA 5IA3A 4YJOA 5IPJA 5C4LA 4P4CA 4MNEA 4QO9A 5AP5A 3R1YA 3SXRA 3C5IA 1YDRE 4NW5A 4PTGA 1PKDA 4A9TA 3CPCA 5J79A 4Y83A 5L2WA 2B52A 2WTCA 2VWVA 4G6LA 5L2SA 4RVMA 3FLNC 4L46A 2XRUA 4DGOA 4JAJA 3PA4A 2ZV9A 5DT4A 4C58A 2B53A 1OL6A 4XV9A 4CYJA 3FBVA 4D1SA 2PVRA 3WF9A 5AR4A 3QZGA 5HG7A 1ND4A 2XYUA 4L3JA 3FJQE 3MYGA 5IQBA 4IAKA 1O6LA 3I0QA 3I5NA 3NZ0A 4GU6A 4WG3A 5DGZA 5AUYA 4C3FA 2FYSA 2GS7A 4LMUA 3IGOA 2PYWA 4XYFA 5HZNA 2WTJA 3SKCA 4JDIA 4N57A 5J8IA 2B55A 4CFXA 3N51A 3NYOA 5BNJA 1STCE 4HVSA 2J90A 1Y6AA 4MXZA 2VN9A 4KNBA 4UZHA 3ORXA 2WZJA 3DAKA 3EKNA 3D4QA 3VBXA 2ONLA 2WOTA 5E8SA 1PRYA 1PF8A 4MWHA 3ZUUA 4IB0A 4TW9A 3OBJA 3HGKA 3FXXA 3HV3A 1UU8A 4A06A 2PMNX 4O6LA 3RCDA 3SGCA 2JD5A 5CY3A 3RJCA 3AD6A 3TM0A 3GNIB 1Q8UA 5AR2A 3M42A 3UZRA 2VTNA 4IIRA 3RPYA 4L44A 3RP9A 3ZO3A 2XNEA 3FMEA 5A3XA 3UYTA 5CU4A 4W4WA 2W99B 3CCNA 2R3NA 4IMYA 5D10A 2VTMA 2VX0A 4EOOA 2VUWA 3ZZWA 4JR3A 4FNZA 4NJ3A 2YDIA 5BVOA 1UVRA 5CSWA 1SYKA 3VW6A 4F4PA 3F7WA 3FLYA 1IR3A 4HCUA 4HZRA 2C47A 2XYNA 4FSQA 4APPA 3NUXA 4JXFA 4N4SA 5D7AA 5BX0A 2QG7A 3LCDA 3QTXA 3R83A 4DEBA 3LM5A 5CSPA 3U6HA 5CZIA 5HU3A 2VO6A 4ZAUA 1OIYA 2WFYA 4LMNA 1ZMUA 3LIJA 3EQGA 2J6MA 3G9NA 3SRVB 3ZM9A 3K5VA 5L8JA 1OI9A 2IVVA 4CFMA 4TYGA 4BICA 1DS5A 2YACA 2OO8X 1S9IA 3FZPA 3TUDA 4XMOA 4AFJA 3C4WA 2HIWA 3H4JA 4TYHB 1BL7A 4BDIA 4F9YA 1TQIA 2EXMA 2GPHA 5CANA 1ZY4A 2Y0AA 3QD2B 4XNEA 3LFAA 3QCXA 3UPXA 3R0TA 4GYIA 2UZOA 4L43A 2H8HA 4FVPA 5E1SA 4LM5A 4RLKA 3EQRA 4TYIA 4FTUA 4RIWB 2VWIA 4FTJA 3JY9A 2Q83A 3RTPA 4JQ8A 3SG8A 3WZDA 3TNIA 3DJ5A 1XH5A 3KF7A 3Q53A 4QMWA 3ZXZA 4M97A 3P78A 2HOGA 4YJRA 4JR7A 3P7AA 3W10A 5KKRB 4FC0A 2E9UA 4FKVA 3FKLA 4ACDA 4TL0A 3A4PA 3CS9A 4MKCA 4G31A 4YJTA 2GQSA 4X2JA 5KE0A 4IQ6A 4NZWB 3O8TA 5CU6A 5BVNA 3FKNA 4X2KA 5BYYA 5F95A 4X3FA 2AUHA 5K0KA 4BZNA 5EDPA 1IAJA 4RC4A 2FUMA 1H8FA 2EU9A 4LOOA 1YXVA 5D1JA 3ZS5A 3LMIA 3QC4A 2ETRA 5DPVA 3TDWA 5FWKK 4A07A 2PZIA 2EWAA 3AG9A 4AT5A 3BYVA 2C6DA 2WEVA 3D5WA 4R5YA 3TI1A 4CQGA 3D7ZA 1WBNA 3GOPA 4LL0A 1H01A 3OW4A 3C4ZA 2WTKC 3E8NA 3BHUA 3LQ3A 2PUPA 2UUEA 3G0EA 3W2CA 4RC3A 4O6EA 3SD0A 4BYIA 5LMKC 3NCZA 5AR3A 3PUPA 4HNIA 2WEIA 4H05A 1OL5A 5KMKA 4YURA 5HD7A 4UXQA 4DFUA 1QCFA 5JGAA 1CKPA 1NXKA 3QQKA 4WNPA 3ALOA 2OBJA 3UP7A 3FPQA 4JLCA 1J1CA 2QLUA 3RVGA 3H0ZA 4GFMA 3LMGA 2F2CB 5AEPA 4F9WA 4GYGA 4R1VA 5CWZA 3UQFA 2QOCA 3KKVA 3LJ0A 4S34A 3V04A 4NSTA 1JLUE 4L68A 2G01A 4EUUA 4RT7A 2BAJA 3KU2A 5D12A 3UOJA 4IZ5A 1H1SA 2A4LA 3QCSA 4D0WA 1CSNA 4JQEA 4FTQA 2CKOA 3A8WA 1SVEA 4L7FA 1Z9XA 4PRJA 1URWA 2WTIA 3IQ7A 4FTLA 5EYCA 3TT0A 4D9UA 2XH5A 1YXUA 1X8BA 3CQEA 3PRIA 2ITTA 5CEOA 3R7YA 3GC8A 3P1AA 5HBEA 3R8MA 2QO9A 4G16A 4WD5A 5L6PA 5I9VA 1TVOA 5HVYA 1BI7A 4AXAA 2GQRA 4EYJA 3R8ZA 3NPCA 2O65A 2RL5A 1YHSA 2BFXA 3BYSA 2CN8A 4AW5A 2ITWA 4ZIMA 4WSQA 3ZFYA 5KMNA 2F49A 5LVPA 4K33A 1JQHA 3MDYA 4QMSA 1XH4A 3IOPA 4AOIA 4C34A 2JDTA 3S0OA 4YR8A 4PF4A 2XNBA 4RA4A 4FSWA 5ANEA 2XIKA 2OZOA 4XLIA 2WIHA 5HVKA 4ACMA 2YIRA 1APME 3PIYA 5A46A 5HE0A 3A2CA 4WUNA 4EC9A 4Z16A 4MCVA 3QD4A 3SRVA 4B8MA 5I9XA 4F1MA 3VNTA 2ITXA 3QU0A 3K3JA 4YHTA 3RI1A 1XO2B 3PA5A 3MFRA 3UO4A 3FY2A 2AC3A 2C1AA 2VWWA 3A62A 4C37A 2OK1A 2VZ6A 5IEYA 4ANMA 2J4ZA 2QOOA 4FSUA 2ZV2A 3NVMB 4XH6A 3HUCA 4FTOA 4H58A 3V5LA 3ZO1A 1Q97A 3NIEA 3SW4A 5C01A 5L6WL 4CEGA 2NNWB 2QOLA 5EYDA 1SVGA 3UPZA 4YNOA 2GHGA 3VWAA 1PXLA 3OFMA 3I4BA 4QP3A 1YXXA 3AMBA 5CEPA 1IA9A 3FI4A 3GQLA 3GUBA 4MXCA 5AP7A 3AGMA 3N4VA 3UQCA 3PG3A 1OM1A 2GCDA 4DG3E 3ZLSA 4ACCA 4FV9A 4QMTA 2F9GA 4XCUA 5E8UA 1SZMA 4O2PA 4S2ZA 3RKBA 5J1WA 3LAUA 2JIUA 4F6WA 2GSFA 4FSRA 1KE7A 3R7UA 2X7GA 5AWMA 4X2NA 5E92A 4ASZA 4FKPA 5IDNA 4J8NA 2YN8A 3D7TA 4FSYA 4IX4A 4P5ZA 2BIYA 4U79A 5F4NA 3RM6A 5IQCA 4GUBA 3FMHA 3RNIA 4XUFA 5K5XA 4FNXA 3THBA 1IAHA 2FO0A 2VWYA 3I6WA 4C3PA 3OTUA 3PXQA 2G1TA 4XV3A 4UV0A 3VBTA 3EYHA 5CI6A 2I0EA 3GBZA 1PHKA 4J53A 4BI2A 2VGPA 5F20A 3W8LA 2KTYA 4M12A 3PWYA 2XB7A 2YCQA 4QD6A 2NP8A 3LCKA 3BZ3A 4AGDA 1R0EA 3KN6A 5FRIA 3MPMA 2R3GA 2C0TA 4YTIA 4FZFB 3BQCA 3QXPA 3KFAA 3DY7A 3GT8A 2ETKA 4J97A 3NMUF 1OL7A 4FL2A 5EK7A 1PYXA 4WIHA 4RVKA 3R7GA 3I60A 4WRGA 5D41A 4DN5A 2Y7JA 4D4RA 5IEVA 3H9FA 2BRGA 5AUZA 2PUIA 4JBOA 3FMKA 4RWLA 4C7TA 3CXWA 3MW1A 2W1IA 4L42A 4DAWA 4HYHA 5CVGA 4L67A 5IH4A 4O0UA 4TNDA 4EH4A 1YKRA 4F9AA 1PXOA 2X4ZA 5KCVA 2DYLA 3BGZA 3O2MA 5LCKA 1CM8A 2WXVA 2ZOQA 1G5SA 4FVRA 4PV0A 2JIIA 3S00A 4MK0A 3COKA 4A9RA 2A1AB 3PWDA 4FGBA 3TV7A 1QPCA 5DE2A 4GG5A 1H1PA 2CGVA 1PXPA 3OOMA 4CXAA 3WBLA 3W32A 2WTKB 2ETMA 4C38A 4O7NA 4O7WA 1FVRA 2XM9A 3H30A 3MY1A 3DK6A 2J0MB 4Z55A 4MXXA 2OJ9A 5IDPA 4ZY6A 2XK8A 4I20A 3ORMA 4V04A 4TYJA 4ACGA 4EC8A 2FSOX 5IG1A 4D9TA 4W4VA 2UZDA 2QOQA 2FGIA 3WZKA 3MA3A 3C0IA 4C59A 2ITYA 4MBIA 2F2UA 4CVAA 4DGMA 4J98A 4FUXA 3Q2JA 3LFEA 3SG9A 3BIZA 3D5XA 4BDFA 5KMOA 4EZ5A 4GT3A 4EBWA 4AX8A 5TR6A 1XR1A 3I5ZA 3LFNA 2RFEA 2B0QA 2BZKB 3DV3A 4M69B 5FGKA 2W1DA 3KL8A 3UC4A 4UWBA 1JKKA 3VUDA 4QPMA 2J2IB 4Z3VA 4FV4A 1XH7A 4CRSA 4D5HA 2HELA 2DQ7X 1GZKA 2FH9A 3CTJA 5AV3A 1LP4A 3COMA 1SNUA 1M2RA 3NX8A 2WMRA 2BRMA 2E9NA 4GJ3A 4RFMA 4E4XA 5FM3A 1DI8A 4B6LA 4O7YA 4IE9A 3IDPA 5I9UA 1Q8WA 4PMTA 3GB2A 3MH0A 4FZAB 4YJVA 4E4NA 1U54B 2HCKA 5FG8A 3EQBA 3OEZA 2QURA 4BGGA 4BI0A 4MD9E 3AMYA 1W98A 4UALA 3RAWA 4KUJA 2I1MA 2YIXA 4FKGA 4IAYA 3ZOSA 3HV4A 4HPUE 3W16A 3R7VA 4CTBA 4ZJJA 5M08A 3R8LA 5CF5A 2GDOA 4V01A 2XEZA 3O8UA 3QQUA 4QMXA 3ZM4A 3O7LD 4YZ9A 2IJMA 4ALVA 2HXLA 4FODA 2ZAZA 3EFWA 5AR7A 2YCRA 3ANQA 4G3EA 4ZTNA 2G2FA 5D11A 4F0IA 3ZRMA 1KE8A 2B9FA 4JOAA 4W8EA 5CYIA 1FMOE 3VJOA 4I92A 4I5PA 3WZEA 1VR2A 2W96B 4G9CA 2QOKA 3WIGA 3QRJA 4UMQA 4RWIA 4UB7A 2VD5A 3H0YA 5T3QA 4EOPA 3R9NA 3JVSA 1ZOHA 4IANA 3RK9A 4M13A 2QD9A 3DJ6A 2Y4PA 3P9JA 2RF9A 4CNHA 1H1QA 5CENA 2GHLA 4FSTA 4QQJA 4I6BA 2Z7QA 3Q4UA 3M1SA 3DNEA 3WARA 5AFVA 5A54A 3L9PA 3R8VA 4IAIA 1VJYA 3C4CA 4D4YA 1PXJA 3GU4A 2PVYA 3CD8A 4FSZA 4TYEA 5EYMA 4DFNA 4HVGA 4RJ6A 3K5UA 4DCAA 2R3LA 3QRIA 5KZIA 5J5SA 1P2AA 5HO7A 3HMPA 2OW3A 3A7GA 2R0IA 4WNMA 3ORPA 4BDKA 4ZLYA 3PPKA 4EH7A 5JN2A 2C6IA 4EWQA 5DOSA 1ZRZA 4AOJA 4MTAA 4BZOA 3LCSA 4IM3A 1ZZLA 1MQBA 2R7BA 2NO3A 2W5BA 4IX5A 1ERKA 2WD1A 4JG8A 4NCTC 4FVQA 4JG6A 4LFIA 2J0KA 3QUDA 4KKHA 3FC2A 5IZFA 3Q9YA 3BU5A 3KK8A 1BX6A 3CE3A 2JLDA 3GQIA 2F57A 3C0HA 3NEWA 4QTBA 3EZRA 2XJ1A 3NW5A 1FOTA 4IWDA 5EW8A 3BPRA 2YCSA 4RIYA 4C4HA 3C13A 1V0BA 4LUDA 3KRRA 4BZDA 3G33A 3H9RA 5JKGA 4FK6A 4ZS4A 3EN9A 4MF1A 1U5QA 2PVKA 3QWKA 2R2PA 2VWUA 5DVRA 4E5AX 2UVZA 4CFVA 2JGZA 3HEGA 3NYVA 2H34A 3BI6A 4YJPA 5JGBA 1YXSA 3HA6A 3DXQA 3V5JA 4G9RA 3FYJX 4K6ZA 4R77A 3LQ8A 2DS1A 4N6YA 4H36A 5H8GA 3VUMA 4KS7A 1O6YA 2BZJA 1MP8A 3L8PA 3F3ZA 4U3YA 3DGKA 4HNFA 4F7NA 4YZNA 2PVJA 3VBQA 2C0OA 2VWZA 4RX9A 3QL8A 3TKIA 4UYNA 5DR9A 5LWMA 2WQEA 3FL4A 2UW8A 3HKOA 3TZ7A 5DIAA 5HCYA 4R78A 1U54A 3GFWA 4CCUA 3AT2A 3LMHA 5C1QB 2WQOA 4F65A 3R00A 2ITQA 2PWLA 2QR7A 5J87A 5AUUA 3GCUA 2ITZA 3ALNA 3WF8A 2J5FA 4DEEA 5I9ZA 4QP6A 4YLJA 2CKQA 2RFSA 3MGYA 4CYIA 3SA0A 4QYFA 4AACA 4E6QA 3GC0A 4BY9E 5AA8A 4R5SA 4FICA 4FT5A 2YA9A 2C0IA 4RZVA 5I4NA 3GCPA 2X2LA 2XP2A 4PPCA 3C9WA 4EQUA 5BQ0A 3I7BA 3TG1A 3VIDA 5EW9A 5CZHA 1Q5KA 4I3ZA 2BKKA 3DK3A 4GSBA 5K3YA 5E4HA 3QQHA 5JGDA 1REKA 1IG1A 3P86A 4PL4A 5FDPA 2YEXA 4JDKA 2AYPA 3QX4A 2X7FA 3OD6X 4F08A 4EH5A 4IZ7A 1OL1A 4LRJA 2A0CX 5KKRC 2OLCA 4UZDA 2QO7A 4I5HA 3FPMA 3W2SA 3DNDA 4KBKA 2X8EA 5AP4A 3EN5A 3QKMA 4IB3A 4D58A 4H39A 1LEWA 4PY1A 4YBKA 2Q0BA 4I5MA 5E9EA 3SXFA 2PL0A 2PMIA 3FYKX 5E8WA 2VU3A 5IQIA 2WIPA 4O7ZA 3OG7A 5HVJA 2R3QA 2LAVA 3AC1A 1XBBA 3C50A 1Q8ZA 3LFFA 4IX3A 4BN1A 4CMTA 5HD4A 3Q9ZA 1R78A 2ITPA 3VBWA 1XH6A 4E73A 2VTLA 3FZRA 3QCYA 4YTCA 3N4UA 2WHBA 3FAAA 3U51A 1OL2A 2O0UA 4ZLOA 4QP2A 2EB3A 3CPBA 3FZTA 2EXEA 3GCSA 1Q4LA 3BQRA 4ANOA 4UBAA 3CC6A 5ETAA 4FG7A 3H3CA 1G8AA 4JAIA 3W2PA 4GKIA 3OBGA 5L2TA 2WMUA 2O64A 4XBRA 4XRLA 3QKLA 3VS3A 4BDJA 5ICPA 4IFGA 3IG7A 2YLFA 3O8PA 4MWIA 3DCVA 4F9CA 2Z7RA 4BCFA 5J95A 3FWQA 4O86A 3D83A 2XIYA 3I1AA 1Q3DA 2ACXA 5AAGA 3HRBA 3NS9A 3PJ1A 2B1PA 3PIXA 3BEAA 1Q62A 3WZUA 3ZFMA 4ANQA 2W4JA 4CT1A 2O3PA 2OGVA 4AZWA 2R3IA 2WMAA 3EWHA 5AR5A 3KVWA 3DJ7A 1YI3A 1MQ4A 2CGUA 3TL8A 4EONA 5BYLA 4A4LA 3MH1A 4GV1A 2PZPA 3DK7A 1M7QA 1YHWA 3UNKA 3QFVA 3G15A 3PJ3A 4J52A 4C4FA 2PZRA 5IQAA 3FY0A 3EOCA 2E2BA 3BYMA 3ZC6A 4R6VA 3UIXA 2YFXA 4JT3A 3V5QA 4JBQA 3OOGA 1BI8A 3E8EA 4BCPA 4DBNA 1UV5A 4U9AA 4EOIA 1W84A 4ITJA 5EM8A 4E1ZA 4RRVA 2G15A 3F5GA 2OFUA 2W1GA 3F6XA 3VF9A 5HGIA 2JC6A 2UW7A 4CZYB 3FHRA 5FP6A 4FSNA 2JFLA 4FIGA 4H1MA 3LXKA 5AV0A 2P55A 3PXYA 2QCSA 3IW6A 3L9NA 4OGRA 4Z9LA 2WKMA 4PL5A 2VTSA 2YIYA 4NKAA 3LKMA 5A4EA 1OBDA 2YM3A 4YSMA 4AS0A 4DH8A 4GCJA 4LGDA 3T3UA 3ZLYA 2C6OA 2OXYA 4R7HA 1JPAA 3FLQA 3FE3A 3TN8A 4X0MA 2YIWA 3S95A 5HHWA 3C4FA 4FG8A 3PJCA 3RWQA 5IUHA
chains in the Genus database with same CATH superfamily
5J1VA 5J7HA 2BHEA 4AZVA 2VO0A 1XMMA 3ZRLA 2EUFB 3MJ2A 3OTVA 3R9DA 3P5KA 2HAKA 2R7IA 3DB6A 3QYZA 2QG5A 1U4DA 3KULA 4ITHA 4YP8A 3ITZA 3KREA 5DA3A 3ROYA 1XHAA 2R3RA 5GJFA 4I6FA 2XBJA 2YITA 4BTJA 1FINA 5KBRA 2C6MA 4B8LA 4WBOA 5IU2A 5G1XA 3SXSA 4Y5QA 2XA4A 4U45A 3MVJA 4FV0A 5BMMA 2A98A 3L8VA 3VS2A 1QMZA 4ZTMA 4RIXB 4ANSA 1AGWA 4F0GA 3ETAA 4I0SA 2C6KA 4I1ZA 2PMLX 1F5QA 1MRYA 3LFCA 2ITOA 4FBXA 5ANOA 4ALWA 4BCOA 4O7LA 3PIZA 5B7VA 4U41A 5LJJA 3GU6A 3NUSA 3VRZA 3KMUA 2B4SB 3TJCA 4NYEA 1GAGA 3QLFA 5FXRA 4QMYA 3JPVA 3Q2MA 5FBNC 5KMIA 1ST0A 5AX3A 1VZOA 3WE4A 5AAEA 1PJKA 5AIKA 5M4IA 1YQJA 3MFSA 4FI1A 2R3HA 4IX6A 3VUHA 1PXMA 4DEHA 3VUIA 5B2MA 4ONAA 3KEXA 5HO6A 3RINA 4C4EA 3VQHA 3U6JA 3KRJA 3G90X 3ZEWA 4ZSJA 2XNMA 3N4TA 3F3UA 3KK9A 3IK3A 4V0GA 1DI9A 1P4FA 1YDTE 5HCZA 5BV3A 1GNGA 2CCHA 4NKSA 1YOJA 3Q96A 4D2RA 3RALA 3UVQA 4M14A 3OEFX 2BKZA 5GINE 4XG7A 3EIDA 2E9PA 2WTVA 4FOBA 5EDQA 4C02A 4O0TA 3TZ9A 3VULA 2YJRA 3PLSA 3PE2A 3IW5A 5M07A 4LUEA 5DLSA 3HNGA 5AP6A 4BBMA 4FYNA 3SLSA 5AADA 3R22A 5CU2A 3VN9A 2JKKA 3NCGA 1F3MC 4GRBA 5CSHA 1KE9A 4KABA 2YM8A 3QQLA 4KBCA 4YC8A 5HCXA 4FKQA 3RK7A 5BVDA 3HLLA 5I5ZA 4C62A 5H9BA 3PP1A 5I9YA 2IZSA 4LI5A 4IAAA 1R1WA 4YTHA 3WE8A 5BMSA 4MBJA 2GNGA 2CHLA 2PSQA 3TKHA 4BF2A 1Y57A 4FOCA 2KULA 4ARKA 2R3JA 2DWBA 3IONA 1RDQE 4YHFA 1LR4A 4EOMA 4PWNA 2DUVA 4AG8A 5K5NA 2ZB1A 3VS5A 2OJGA 1RQQA 3ZBFA 4NU1A 5DG5A 3R7IA 3CKXA 2UW6A 3D5VA 5FBOA 1H08A 4K2RA 4WA9A 4ZTSA 5J5TA 1J7IA 4FIJA 1UNLA 1JKTA 2C3JA 2WMVA 4EYMA 5JSMA 3P7CA 5KHWA 3A7JA 3QC9A 3RBWA 5E8TA 3E8DA 3RAIA 1H00A 3FMLA 4FEQA 3ACJA 3IGGA 4G3CA 3TJDA 2J7TA 1J1BA 3KGAA 2Y4IC 4IDTA 4ITIA 4U5JA 5M55A 2JKMA 4II5A 4XG2A 2YZAA 3QX2A 3VW8A 2WMSA 4GS6A 4QTEA 4EK4A 4G2FA 4IZAA 3PY0A 2UW9A 2F7ZE 3QUPA 4DH7A 2J0LA 4NWMA 4JRVA 2FSTX 4E5WA 5M06A 3UYSA 4OAVB 4XLVA 2HW6A 3L9LA 3PVGA 3ORIA 5FXSA 5A4TA 4PP7A 2UVYA 4IDVA 3PXKA 3BLRA 4LYNA 3TNWA 3UOLA 3GI3A 5D7VA 3W18A 4BKZA 1ZOEA 2XNOA 3AGLA 4QP9A 3PG1A 1TQMA 2OXXA 3TV4A 4EH6A 2QLQA 3Q32A 4FF8A 2JKOA 2C68A 4P7EA 4F6UA 5A4CA 4LRMA 2B9JA 1OITA 3NNVA 3QKKA 4U8ZA 3ROCA 4EK5A 1OVEA 3LM0A 5JFWA 4EK6A 3C1XA 3BHYA 1M7NA 3D0EA 5JK3A 5GJGA 4UN0C 3R02A 3VUTA 2WTWA 4ZS0A 4WUAA 2HZNA 1KOBA 2WELA 3UE4A 3HX4A 5C8MA 3GCVA 4EOJA 5C4KA 2GMXA 3GU7A 3R2BA 5BPYA 3ZXTA 3NW7A 2X1NA 2PVLA 5GJDA 2XMYA 4ASEA 4XG4A 3MV5A 3VHKA 2V22A 4J1RA 2IF8A 3WILA 2XM8A 1GY3A 4GT5A 3AC4A 1PMEA 4QT1A 3RMFA 3UIUA 5LMBA 2OJJA 2C3KA 3UG2A 1KSWA 3R6XA 4KSQA 4FV5A 4KIPA 4NTSA 3QALE 3ULIA 2JEDA 5A9UA 3G0FA 2C1BA 2XEYA 2F7XE 2YM6A 4J71A 3IDBA 4NIFB 3G51A 4QP4A 5JQ8A 3A4OX 1JAMA 5AP2A 4HZSA 3GENA 5C9CA 4ZLZA 4QRCA 4PNKA 2YDKA 2GFSA 3A7FA 3IW8A 3KF4A 4YUQA 4BBFA 2ESMA 4FG9A 5AX9A 4AQKA 4JS8A 4L45A 3JYAA 5EM5A 2UZLA 3HDMA 2BMCA 2YDJA 3AT4A 2A27A 3O71A 4XG6A 4I22A 2P2HA 4DT9A 5ANJA 4CQEA 2CLXA 3B2TA 5HLNA 4HVDA 3C51A 4MAOA 3F3TA 2ZMDA 3FMMA 4YSJA 4ALUA 3ORNA 4TN6A 4I41A 3KQ7A 5BVFA 4TYHA 1VEBA 1QPDA 3DLZA 3S2PA 4KD1A 2XNNA 4MD7E 4BCKA 1YWRA 4GFGA 4BDEA 4XRJA 3UP2A 4U6RA 2QNJA 4A4OA 4U7ZA 2B9IA 2BALA 4RPVA 4BDAA 4FTNA 5IA5A 3FMNA 5EM7A 1L3RE 4RIWA 4D2WA 1FBNA 3L1SA 4DT8A 4CKJA 3TZMA 2ITVA 1BLXA 3VJNA 3V8SA 4EH3A 3SC1A 1WZYA 4YJQA 4I21A 4R3PA 3EMGA 3V5WA 4KBAA 5HOAA 4FEWA 4C33A 3U55A 1KUTA 3MN3A 3QAME 2XJ0A 1H4LA 4LG4A 4N70A 2RGPA 2W7XA 2GNLA 3COIA 2W1ZA 3NUYA 4LRKA 4QPSA 2VO7A 4F7LA 4UX9A 3MIYA 3KXZA 4TY1A 5TO8A 4ZTHA 1H07A 3UBDA 5FD2A 3ZDUA 4D1ZA 3QA0A 4KS8A 3QZIA 4O0VA 5HTBA 1Q8TA 3PZEA 3FXZA 5KMJA 5KNJA 3SW7A 4W9WA 3BE2A 3DXNA 4MD8E 4DINA 4DDIA 1RJBA 3HV5A 2UZTA 4QDEA 3ZU7A 4M84A 5FQDC 2ZV8A 1WBPA 1ZARA 3FQEA 4XX9A 3U87A 2I6LA 4HYIA 1HOWA 3VHEA 4ASDA 5IISA 3BHVA 5FTGA 5ANIA 3R1QA 3WZJA 3QTUA 2HZ0A 4GFOA 2BRHA 2UW4A 4PMPA 2IW6A 2X8IA 4YZMA 3WYYA 1YW2A 4HGLA 1K3AA 4ENYA 4DBXA 3U4WA 2GU8A 3QTIA 2VTOA 4KIKB 4P2KA 4IB1A 5AR8A 4FV2A 2B9HA 2V5QA 3G6HA 4AZTA 3KRXA 3IOKA 1BYGA 3V3VA 3DOGA 4C3RA 3PZHA 4WG4A 3DFAA 5FTQA 2IWIA 4PTCA 2YM7A 2WQNA 3I7CA 4USFA 1WMKA 3R8PA 1WVWA 4FKRA 2JIVA 3DAJA 1WBSA 4RQVA 4YC6A 3W2OA 4DHJA 3EFJA 3M11A 3NUAA 3P08A 4HCVA 3D15A 5CSVA 5E8ZA 4BWKA 2ZB0A 4QP7A 2XK7A 3ZFXA 4NH1A 4DC2A 5E90A 3F3WA 3PFQA 4U81A 2J0IA 2VTQA 3D14A 3Q9WA 4G3DA 3QZFA 4Y8DA 2O63A 3LCTA 4FTKA 4AOTA 2R3FA 1H26A 5EH0A 2ZM1A 2XBAA 1IRKA 4RIOA 3ZEPA 4AFEA 4AXDA 3W0MA 5CASA 4NJDA 3NRMA 3NUPA 4RMZA 4O7TA 5EM6A 4IFCA 1XWSA 4QQ5A 5BYZA 4UMRA 2J50A 2PVHA 5L4QA 5C26A 3H9OA 5LVMA 3BU6A 5HICA 4Q5HA 3AD5A 2Y4IB 4QTAA 1GOLA 3CSVA 4DH3A 4B0GA 5M57A 4O82A 3BELA 2BZHB 1ZXEA 3ORTA 1OPLA 2FSMX 5J9ZA 2UZNA 1H1RA 1UWHA 3EL7A 4IM0A 3UZPA 5J9LA 4F99A 4CLIA 5LCJA 2R3OA 1B39A 2V7OA 5HE1A 4EJNA 3TUBA 5EDRA 5L3AA 3A7HA 2R4BA 3OT8A 2CKPA 4RQKA 2REIA 5FP5A 5I3OA 5JZJA 4GJ2A 4QMQA 5EQYA 3E3BX 1YRPA 4ANNA 4AA5A 2JDRA 2OJIA 3R63A 1CDKA 3UO6A 3GP0A 4F09A 1W7HA 2ZFYA 1SM2A 3NLBA 2RFDA 2JFMA 4U97A 3JXWA 2ITNA 1HCKA 5AV2A 3VS1A 5HX6A 4O83A 1KV2A 4PDYA 2W4OA 2EB2A 1SVHA 2ERZE 3GFEA 3OP5A 4L00A 3E62A 5CNNA 1QPJA 2VO3A 5E8XA 3DPKA 5C27A 3TNHA 4AGUA 5CXZA 4GKHA 2NRUA 5CAQA 4OTPA 2CJMA 3BL9A 5IQGA 4I0TA 5AA9A 3SHEA 2C3LA 4BDHA 3O0GA 4F1TA 2JDVA 2BDWA 3II5A 4FKOA 4BKJA 4BYJA 5LVOA 3TDVA 5E8VA 5CLPA 5DH3A 4DCEA 4QYEA 4ZSLA 4YTFA 3KXHA 2C5VA 3NDMA 4DH5A 3E88A 5EQPA 4ORKA 3FC1X 3V51A 5CS6A 5L8KA 5DHJA 4ENXA 3IW7A 3F82A 4FTMA 4WRSA 4X6RA 5HE3A 5I0BA 3PFYA 5DFPA 1ZLTA 4IWOA 1OZ1A 4MX9A 4C61A 3RNYA 3G6GA 2BILB 5ANKA 1SNXA 2VWBA 3KCKA 4ZZOA 5IMXA 2RIOA 5CTPA 2QC6A 2HZIA 3QHWA 1UU3A 2WOUA 3P23A 4H1JA 5FEEA 1U46A 5DT0A 4JDHA 5GHVA 4ASXA 2JBPA 5DRBA 4EKKA 5DEWA 5HIDA 1I44A 2PVNA 5KZ0A 3EKKA 2P33A 2PE2A 2XF0A 3F5XA 3POOA 4G6OA 3CTHA 1UNHA 3KVXA 3KXXA 4CMUA 4FV3A 4HYUA 3HL7A 2UW5A 4LGGA 1NW1A 2Z7LA 2WGJA 4EHGA 1H27A 4UXLA 2X8DA 3VVHA 3QQFA 4IADA 4PDSA 1QL6A 4CT2A 4RGJA 4AZSA 3QTRA 3CKWA 2X0PA 4DF3A 2XNPA 4MXYA 3UIMA 3FI8A 4UYAA 5KBQA 1FVTA 1KOAA 3SDJA 2QQ7A 5FTOA 2V62A 4GG7A 3NYNA 3JS2A 3REPA 3QQJA 4O96A 3KMMA 3AOXA 3ZH8A 2W5AA 3NFFB 4I93A 5EHLA 4J7BA 3ET7A 1ZYLA 2Z60A 3QTQA 4BFMA 1VYWA 3VS4A 5HBJA 1GZ8A 4E93A 3KRLA 2WMWA 5BUEA 1RW8A 1WBWA 4YZBA 5CAVA 1J91A 3OXIA 4Y5HA 3FLSA 4CG9A 4EOLA 3NAXA 3QZHA 4D0XA 5CEMA 2I0HA 3UO5A 4GW8A 4EHVA 3MH2A 3EJ1A 4AT3A 1OPKA 4C4IA 4Y95A 2EXCX 3UOHA 2WNTA 5ANGA 2CNVA 3PY1A 2QODA 3F2RA 2XZSA 4FYOA 1YOLA 3NYXA 1M2PA 4AE9A 2PY3A 4BCJA 5AV4A 5JT2A 3HZTA 4X3FC 4F7JA 3F9NA 1JNKA 5JFXA 4A9UA 4RX5A 1Z5MA 3DAEA 3E92A 3BEGA 3KC3A 3ULZA 3OZ6A 4MF0A 1NY3A 2WB8A 3KMWA 3OWKA 5EKNA 4IC7A 1TZDA 5CAOA 2XK9A 4AWIA 4R7BA 2ZM3A 4RX8A 4GK3A 5TKDA 3FMJA 2VGOA 5C8KA 3RZFA 2BVAA 4U43A 4BDBA 4BTMA 3I81A 2G2IA 3R9HA 2QR8A 1O9UA 3ZSIA 2PVFA 2YWVA 2OZAB 3NAYA 4FIIA 2HK5A 4F7SA 5IQEA 5LMKA 4USEA 2VRXA 4LGHA 4L6QA 4IBMA 4ZSGA 4CKIA 2XVDA 3QXOA 5LXMA 3ZC5A 5E8YA 3PSCA 3EN7A 4A7CA 3UNJA 3QRUA 3MTFA 4ZY4A 4XS2A 4IHPA 3R04A 3SV0A 3TNPC 4E20A 5IA2A 3TV6A 3ODZX 2J51A 2O5KA 3UGCA 3NUNA 4IEBA 4S33A 3UJGA 3Q4ZA 4U3ZA 3HP5A 1I09A 1W2DA 4D2SA 4BCHA 2X2MA 1RE8A 5DRDA 5BVEA 4GIHA 4KWPA 3W0RA 4YJSA 3O23A 2GFCA 4M69A 3MVMA 4GK4A 4ZZNA 4ZTLA 3R8UA 4XOYA 1UKIA 1YVJA 4G34A 3KRWA 3TIYA 4TWNA 3PA3A 2BRNA 1KWPA 1YWNA 2ZDTA 3HECA 3F3VA 2IVTA 4JBVA 3LE6A 4QMPA 4AU8A 4F6SA 4EORA 1NA7A 1FVVA 1R3CA 3E87A 4XP2A 4KIQA 4FEXA 2YCFA 3LW0A 4FV1A 4NK9A 3E93A 4C8BA 5AIRA 4UMPA 4O81A 2V0DA 1LUFA 2PK9A 2Q0NA 4MNFA 4TZRA 1OIRA 4L3LA 5A14A 1PMNA 4X3JA 3F88A 4W4XA 3PP0A 4CCBA 2RG5A 5HQ0A 4MNEB 4YJNA 2JAMA 2WTDA 3OXTA 4MBLA 1E1VA 2PUUA 4DDGA 2YISA 4Z7HA 4A9YA 2JKQA 1M2QA 3HMOA 4G3GA 4HCTA 4AW2A 3SVVA 1E1XA 4OR5A 3V8WA 2PMOX 3LXLA 4K8AA 4WNOA 4YZCA 5JQ5A 1A48A 4TRLA 4A4XA 5KUPA 5LQFA 4LV7A 2BFYA 4JIAA 3IKAA 3D5UA 4WHZA 2OKRA 4PTEA 4QPAA 4L7SA 5CEIA 5CEQA 4UMUA 2W9ZB 1FQ1B 4DFLA 3UDSA 4F64A 1XH8A 4BCQA 3I79A 4CV8A 3MA6A 4EUTA 2SRCA 3W33A 4OTGA 3CBLA 1AQ1A 1GZOA 3E5AA 4HOKA 4FL1A 3VRYA 3GCQA 3VS7A 2BRBA 5HIBA 2JDOA 3MH3A 4ERKA 5HIEA 5AJQA 4RA5A 2VTHA 2CNUA 2XKEA 2OSCA 3RZBA 3ACKA 3IECA 3A7IA 2IO6A 4V05A 4B99A 1H1WA 3Q4TA 4C35A 4X7QA 2XAOA 4C2VA 1Y8GA 4FZDB 5LVLA 2PU8A 3MTLA 2VTIA 4ZSAA 2GS6A 4E4LA 5ANDA 1OUYA 3C4EA 3QHRA 1PXKA 3ELJA 1JSTA 1SMHA 3FZ1A 3O96A 1MUOA 3PVUA 4S31A 5KMLA 3CR0A 1NVQA 5DBXA 2GNHA 4EI4A 5DYJA 3GXLA 3T3VA 3PVBA 4D2TA 4FK3A 4FKJA 4QMVA 4R8QA 5CT7A 4KSPA 2O8YA 4F0FA 3KCFA 3AMAA 4YC3A 3FI2A 4G6NA 4QMNA 5EQEA 4FIFA 3HUBA 4QMZA 4UMTA 4HGEA 2XIXA 3CGFA 2C69A 2C5YA 3WOWA 3ZYAA 3T9IA 4BDCA 2B54A 4P90A 4D2VA 4AZFA 2JBOA 4D4SA 3QGWA 3QBNA 3O17A 4MYGA 2IZRA 4NM7A 4GUEA 1Q3WA 3OCBA 4QYYA 1YI6A 4FNWA 2OZAA 5JFVA 4E26A 5ACKA 3VAPA 3ORLA 3FQHA 2W1EA 4D1XA 2OXDA 3ZMMA 4M68A 5CALA 3DBEA 1JOWB 5DR6A 3W2RA 5TF9A 4IWQA 2NYAA 5AAFA 3TIZA 3UDBA 4WOVA 3VF8A 3ZLWA 4YO4A 3EZVA 3RAHA 3TTIA 3S1HA 5ITAA 3CQWA 4JX3A 4UWCA 2BAKA 2I0VA 5L2IA 3N9XA 3CGOA 5A4QA 1CKIA 5CXHA 4DEIA 3PXRA 2PVMA 3SAYA 4FUYA 4WG5A 3ANRA 4CZUA 4PPAA 4E8AA 4JRNA 4NM0A 2H6DA 4LDTA 3MVHA 4PX6A 3QTWA 5KO1A 2QKRA 4YLLA 2VTJA 4MQ1A 4ACHA 4X3FB 2P3GX 4DLIA 3LZBA 1T46A 4XG3A 3TWJA 5TE0A 1TKIA 1ZWSA 5M09A 3OY3A 5DMZA 3HYHA 2FA2A 3MSSA 3TZ8A 4MEDA 2G9XA 1IASA 1V0PA 2BDFA 2C5NA 3TEIA 4C36A 3F7ZA 4D5KA 4AQCA 3ZHPC 3JVRA 3UODA 5HEZA 3GU5A 4O0SA 4DG0E 3T9TA 3PYYA 4I0RA 4NFNA 3HVCA 3P79A 2RFNA 4K18A 4RSSA 2BPMA 2CGXA 3Q3BA 1VLRA 2RG6A 2OI4X 3K2LA 3R01A 4YPDA 3RPSA 4RJ4A 4FA2A 4EEVA 4BL1A 4ZTRA 3R7OA 1OIUA 5EG3A 3FEGA 4WBBB 2P0CA 3EN6A 3MPTA 4O0WA 4BCIA 5DEYA 4EH9A 4TPTA 5AP3A 3ZZEA 2PE1A 4Y72A 4F78A 4FGRA 3D2KA 4BDDA 2IZTA 4QQTA 2XANA 4YHJA 3HMMA 3HAMA 4S30A 3O50A 1WBOA 3DT1A 4C0TA 4I6QA 5JEBA 4QYGA 4FKSA 4WT6A 3CJFA 3ZO4A 2PZYA 3EQCA 4FIEA 3TTJA 3SOAA 5K4IA 3HMIA 1ZYSA 3OCGA 1YOMA 3PVWA 4YBJA 2BDJA 1JWHA 4NM3A 5CSXA 5C03A 3ZCLA 1OBGA 3G9LX 1PMVA 2PE0A 3ZSHA 3OWLA 3HV6A 4G1WA 3NUUA 5EI8A 3ZSGA 3DB8A 4JDJA 4AW1A 1JKSA 3EQDA 2C6TA 1V0OA 3A60A 3QA8A 5H8BA 4KRDA 4M7IA 3V8TA 2I0YA 2OG8A 2WPAA 3G5DA 2AQXA 3FQSA 3ORZA 4ID7A 5BVKA 2CKEA 4AAAA 5M51A 4AP7A 1PMUA 2IPXA 2WU7A 4IJ9A 4JBPA 3RM7A 4WNKA 5E1EA 4BVUA 3MY5A 4TT7A 4UY9A 3VS0A 3MB6A 3HV7A 4O1OA 4PDPA 2X81A 1CKJA 4BWXA 4JJRA 3BX5A 2WMBA 3U4UA 4BHZA 1PKGA 3R28A 3PXFA 5AM7A 4O0XA 3AQVA 4FV8A 2OIDA 4U80A 1DAYA 4DH1A 3NWWA 2NRYA 3UMXA 4D4VA 2CN5A 3DKCA 1Y91A 3EQHA 3MY0A 5HG8A 5FUTA 4AXFA 2R9SA 3DQXA 4IAZA 4AN3A 3DKGA 5AUVA 2VAGA 3B2WA 3E63A 4QQCA 4BCMA 4TTHB 4YJUA 4A9SA 4FT0A 2ZMCA 4QTCA 5F94A 4BCGA 5LOHA 4E6AA 3FUPA 4J95A 4QP1A 3ZUTA 4BC6A 1JSVA 2PHKA 4NL0A 3I6UA 2P2IA 3EH9A 1Q8YA 2BUJA 3V6SA 4TWPA 4KIOA 4Z7GA 4FKWA 4W4YA 3MFTA 4EHEA 1WVYA 3A8XA 3E3PA 2YAKA 3O7LB 3R2YA 5CQUA 3L9MA 3UIBA 5GZAA 3DQWA 2W4KA 3BKBA 4FV7A 3V5PA 4I6HA 4ZMEA 4MVFA 3R7EA 2X0QA 2VTAA 3EL8A 4PNIA 2BAQA 4FMQA 1FGKA 3NIZA 4KKGA 5EFQA 3HAVA 1ZZ2A 4Q5EA 4RFZA 4FSMA 2Z2WA 4RWKA 1ZMWA 3LLTA 4M15A 3HP2A 2OH0E 2X6DA 5J9YA 2IZUA 4FTAA 1REJA 2IVUA 4GU9A 4AN9A 2CGWA 2HWOA 4XEYA 3UVPA 2WO6A 3HDNA 3K3IA 3EFKA 3OWJA 1WBTA 1YXTA 2J0JA 1E9HA 4O38A 3MVLA 3JUHA 3PSDA 4HYSA 2GNIA 3BE9A 4YPSA 3Q6WA 4HVIA 3HMNA 4O27B 3QD0A 4OTHA 2GHMA 4AE6A 5HNIX 1G8SA 4FX3A 4OTRA 4Q9SA 1W8CA 5EHYA 4Y85A 1OB3A 3R30A 4X21A 4DFZE 4AXEA 3D7TB 4NCTA 2OU7A 3P4KA 5T6KA 4IC8A 4O0RA 4QEBA 3ZTXA 1B6CB 4ZSEA 3VS6A 1FGIA 5CT0A 3AC5A 4B7TA 4JL9A 1NVSA 2F4JA 3IW4A 1FMKA 3KN5A 2ZM4A 3Q5ZA 2JITA 3H10A 2YIQA 3DDQA 3EN4A 3E64A 3BWJA 5M53A 3OUKA 4AZEA 4NTTA 2JDSA 3GEQA 4AF3A 3ENMA 2AEGA 3EHAA 2R3KA 3P0MA 4QMOA 4PMSA 4RFYA 1BL6A 4RIXA 5CU3A 4ZOGA 5G6VA 2XS0A 4AA0A 4YNEA 3EB0A 4OTIA 5EOLA 2GS2A 4QP8A 2OF2A 3LFQA 3W2QA 3WYXA 4FEUA 3LVPA 5HX8A 2LGCA 4DEAA 5J7BA 4G3FA 4QNYA 4YLKA 3TACA 1GIJA 4C4JA 4DTKA 3BBTB 2C3IB 4FT9A 4RJ8A 5E7RA 5CEKA 3ODYX 2IW9A 1WFCA 3A99A 4MQ2A 5ETCA 3QRKA 2XIRA 3L8XA 4BR3A 3OMVA 4CRLA 4ERWA 4QMMA 1YHVA 4BB4A 1O6KA 2PZ5A 3LXNA 5IUIA 3COHA 2QU5A 2YABA 3C5UA 3MS9A 2QONA 5EHOA 3BWFA 2W05A 3ORKA 3RK5A 4R1YA 2I40A 3E7VA 4FL3A 3UVRA 2WU6A 4CZTA 3K54A 1ZYJA 4X2FA 4O1PA 4XJ0A 5CX9A 4RLLA 2R0UA 5HESA 3VQUA 2X0GA 3DS6A 4QOXA 4QYHA 4BIEA 4B4LA 3UZTA 1UU7A 4E6CA 3VONA 2GNJA 3FLZA 3DKOA 4RJ5A 4BDGA 2HZ4A 3CTQA 2YM4A 1LPUA 4YZDA 3UNZA 2PUNA 3IPHA 4FIHA 3FXWA 3GU8A 4CFUA 2C4GA 4NM5A 5M4UA 4JQ7A 1CTPE 5B0XA 3Q52A 3R71A 4F70A 3VBYA 4BTFA 2EVAA 3QQGA 1CMKE 3PPZA 2W17A 4AGWA 3PLAE 2V7AA 4Y46A 4OW8A 3DTWA 4JI9A 3PXZA 4G5JA 1K2PA 1GIIA 5C8NA 4DFXE 3DZOA 1H28A 4EZ7A 4GT4A 2W9FB 2YM5A 2X4FA 4IVAA 3EQPA 3TCPA 3WF7A 5L6OA 3BGPA 3JY0A 4IB5A 1XBCA 2QU6A 2WMTA 3R21A 4RG0A 4NUSA 3NR9A 3Q6UA 3BGQA 4M66A 2QO2A 3PRFA 2BR1A 4JNWA 4EWHA 1P14A 4FTTA 2UW0A 5DWRA 4O7RA 5AMNA 4Q2AA 3FZSA 4Y73A 1OECA 3KA0A 2CNQA 3OVVA 4FTCA 2YHVA 4AGCA 5BUIA 5IQDA 2HW7A 2QOHA 3Q60A 4BBEA 1HCLA 3RPVA 3MWUA 3OCSA 5L8LA 4EK3A 4DG2E 4I4EA 2BROA 4IVCA 2HYYA 2GQGA 1Q41A 4H3PA 4K11A 4RJ3A 4IJPA 2C30A 1FPUA 3LJ2A 2RSVA 4TXCA 4XG9A 3UMWA 5IH5A 3BLHA 4L53A 3ID6C 3W1FA 3W0QA 2CPKE 4OTWA 5EI2A 2OJFE 3NW6A 3BHTA 3VO3A 5BVWA 3D9VA 3CLYA 5DT3A 5BUJA 4YMJA 4I23A 4ZJIA 1BUHA 4OBOA 4RBLA 5FXQA 1H0VA 3EQIA 2UZVA 4L3PA 1UU9A 4RVLA 2NPQA 3CY2A 3KXMA 4ANLA 3BV3A 2Z02A 2ZV7A 3TYKA 2X9FA 3W0NA 2XKCA 5KX8A 4GEOA 4G17A 4EH8A 4KB8A 4JIKA 3MB7A 4BTKA 2I7QA 3IS5A 1M52A 4FT7A 4X6QC 4I24A 4QMLA 5CNOA 3HA8A 5GZ9A 4TKSA 1OKWA 2HY0A 5HU9A 3FSKA 4OAUC 2QHNA 3DLSA 5JH6A 3KIOC 2BCJA 2UW3A 4FZ7A 1ZMVA 2QOIA 1ATPE 2HENA 4TNBA 3QCQA 4M0YA 3EYGA 4FKTA 1L8TA 5JRQA 2BZIB 4YU2A 4JX7A 2PTKA 1PXNA 1ZAOA 3RPOA 1W82A 4FT3A 4U42A 3MFUA 4CFFA 3NFGB 5IA1A 4DFYA 4CMOA 4EBVA 4ZK5A 4TWCA 1NVRA 3T8OA 3MPAA 3QUEA 3DDPA 5M44A 3CEKA 4FV6A 3DA6A 2VWXA 4IACA 2FVDA 4DTAA 4O84A 1LEZA 5HBHA 4ZJVA 1TQPA 5E91A 1Y8YA 5B2LA 2CCIA 2W1FA 4IVBA 4NIFA 4RZWA 2XALA 5AM6A 3R1SA 3EQFA 1OKYA 5CVFA 2VNWA 4OBQA 3R9OA 4LQMA 4LOQA 5LMAA 4O0YA 4AA4A 3U6IA 4FKIA 4LOPA 4EQCA 5HORA 4NEUA 4NW6A 4N0SA 4W8DA 2VX1A 5HG9A 1PYEA 3RHKA 2CSNA 3QTSA 5HI2A 5K0XA 4GH2A 3V01A