3E8EA

Crystal structures of the kinase domain of pka in complex with atp-competitive inhibitors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
344
structure length
341
Chain Sequence
KKGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Aminofurazans as potent inhibitors of AKT kinase
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 110
structure length 341
sequence length 344
chains with identical sequence B, E, I, L, P
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e8eA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e8eA02
3KN5A 2F4JA 2XEZA 5H8EA 5EKNA 3POZA 3FLSA 5IISA 3ZUUA 1SZMA 3LJ1A 5AUZA 5AV3A 4F99A 3UZRA 5KNJA 2BPMA 2RGPA 4UBAA 4IVAA 3RAHA 4U3ZA 4FZ6A 3T3UA 5M4UA 4QMZA 3RPSA 3FXXA 4IE9A 3WF6A 4O0SA 2X2KA 2ZM4A 3AC3A 1URCA 3ZYAA 3FQEA 5AV4A 5LQFA 5BX0A 2O8YA 4FSTA 3R8VA 3CY2A 2EWAA 5K4JA 4L6QA 4BI0A 4XLVA 3GEQA 2YCQA 3G9NA 4D5HA 4FTUA 3PXRA 2X9EA 3BEAA 2ITPA 3BPRA 1DI8A 4PPCA 4ITJA 3TZ7A 4D4VA 3CC6A 3KK8A 3ZBXA 1KV2A 4GG5A 3ZXZA 4O91A 3LFCA 4WOVA 4AN2A 1VYWA 4EOPA 2PVMA 4YPSA 1YOMA 2ITWA 3FKNA 4RVKA 2XS0A 4LM5A 2VO3A 4AT4A 3ZZEA 2F2CB 3R9RA 4K18A 4NKAA 5BMSA 2W9FB 1P14A 3C9WA 3I7CA 5AV2A 4BIBA 3FKOA 3DDQA 3O7LB 3R1NA 1NW1A 2XBAA 2ESMA 5J9YA 4L52A 5FBOA 2EB2A 3EFKA 4ID7A 4ZSJA 5BVKA 5AIKA 1KE5A 4D0WA 2RG5A 4B0GA 3VVHA 4M8TA 4RIOA 4IB5A 2W1CA 3BU3A 4BCHA 2VN9A 1IAHA 4AOJA 4ZLOA 4QP2A 2BRNA 3RI1A 3OBJA 3IW8A 3TIZA 3BGQA 1SM2A 3KXHA 1ZMUA 3LFBA 4PDPA 5BVEA 4XV3A 3DV3A 2ZV9A 2XJ1A 3H4JA 5HG5A 3QGWA 1REJA 2KTYA 4C4FA 4FSMA 5HEZA 4EUUA 1Y6BA 4LYNA 3TKUA 3UZPA 5K5XA 3R63A 3QALE 4RIXA 3R71A 4FEXA 3IS5A 4I41A 2YAKA 2Y8OA 4DLJA 2IWIA 4ZOGA 3P7CA 5DI1A 5EYMA 2XK4A 4O7NA 3DJ6A 4OLIA 2H34A 4O7YA 5DWRA 2E9PA 2C3KA 4KKGA 2JEDA 4YSJA 4HGLA 5CY3A 4GG7A 4HOKA 4F70A 4QMWA 4RWIA 2CGWA 4LGHA 4WRSA 3BKBA 3Q3BA 4QNYA 5HIDA 3OOMA 5KX8A 4A9UA 5LVOA 4C34A 4TXCA 2NRUA 4QTAA 4QO9A 4MNEB 4UZDA 2OLCA 5G1XA 4MD8E 3C4WA 4BCIA 1QPDA 2R3RA 5HO7A 2WD1A 4DE4A 3CS9A 4C2VA 3VBTA 5D7VA 1T45A 5HX8A 5C4KA 2WELA 1PY5A 3C4FA 4RVMA 3OEZA 4ZTRA 3ZO3A 1KE8A 2ITXA 3KRXA 2C4GA 2PK9A 2R3LA 4F4PA 1H4LA 2RIOA 1XBBA 4FI1A 3S00A 4IACA 2WMUA 3OOGA 4KINA 4EBVA 3NSZA 1Z9XA 2BIKB 3DB8A 4Y8DA 4E6CA 3IOPA 2CMWA 3Q4UA 4A4LA 3F3TA 3KULB 3PSCA 2I1MA 3EQRA 4L53A 4XG2A 5E8YA 3OT3A 4H05A 4WHZA 3ZLWA 3EN6A 4YZCA 3RHXA 4A7CA 2WFYA 3FZRA 1Q24A 1OIUA 3D2KA 4PPAA 3HGKA 1XBAA 2XK6A 5IPJA 2CGUA 4XLIA 4ZK5A 4BFMA 3MVHA 3UE4A 3DXNA 2DYLA 4WD5A 2VO7A 1YWVA 4JQ7A 5E91A 2JITA 2PTKA 4FKTA 4Y46A 3VS2A 4D4YA 2CKPA 5B2LA 5GZ8A 1O6LA 3QZGA 5T68A 5IQIA 1JLUE 1HCKA 3S4QA 3OHTA 4YSMA 4OAUC 4ZEGA 2XBJA 5I4NA 4Q9SA 2WMQA 4W4WA 4IH8A 4MXZA 5CI7A 2HZ0A 3ZBFA 4AF3A 4ORKA 4L8MA 3UVRA 3DTCA 3VJOA 4RZVA 4M84A 3OEFX 4DH7A 3GCVA 4FK3A 3KK9A 1FINA 2OKRA 3UC3A 3BQRA 2UVZA 1YHWA 5KUPA 5LMBA 2HW7A 5J1VA 1XR1A 2HXQA 3D0EA 4M12A 4NEUA 2BAJA 4AN9A 1PMEA 4IM0A 4X3FC 4MBJA 4D9TA 5GIPE 3DQWA 4FV1A 3K54A 3FXZA 3BYSA 3A4OX 3CKWA 3UG1A 3Q5ZA 5IZFA 3G90X 5E8WA 3Q2MA 3TUCA 4P5QA 5EH0A 5CEPA 5I9ZA 4E4LA 4M69B 1UNGA 5DGZA 4Q5HA 3UMXA 3IW4A 1R1WA 5JFSA 5DYJA 4EORA 3LMHA 3ZO1A 3FE3A 4O0RA 3FWQA 4ACHA 2QG5A 4UWYA 2VD5A 1UV5A 3RK7A 2C1AA 2YCRA 3UOJA 3MH3A 4FZAB 3O8PA 4EWHA 1M14A 5A6NA 2HCKA 4EJNA 4RA4A 2W9ZB 4NW5A 4X2FA 3H3CA 5IH4A 3IQ7A 3N4TA 4APPA 5AAFA 2XJ0A 3NUPA 4JG7A 4U3YA 3EN4A 2W1ZA 4DAWA 3OVVA 4J8MA 3UBDA 4PNIA 4FNWA 3NW6A 3G33A 4Y5HA 4U45A 3AC8A 1ZOHA 4FTAA 4AW0A 1YOJA 5BQ0A 1ERKA 3F82A 3NWWA 3E8EA 2IW8A 5IQEA 4DEHA 4FE2A 4DT8A 1ZYCA 4APCA 4IX6A 2QO2A 1MUOA 4C2WA 5AUTA 4U0IA 4BDFA 1HCLA 1Q41A 3GNIB 1A48A 3F2AA 4WNMA 2GNIA 4UZHA 3R1SA 2WMRA 3PXZA 1CKJA 4WT6A 5AEPA 5IMXA 3OCSA 5CYIA 3VS5A 2YWVA 2YN8A 2Z60A 3TZ8A 1F5QA 3K3IA 3NZ0A 3QLGA 5DMZA 5CLPA 4LUEA 3P4KA 2IJMA 5H8GA 4F63A 3MPTA 2B4SB 4AZEA 3DZOA 2ZV7A 4OAVB 3GCPA 4USDA 4MWIA 3T8OA 3WI6A 5GINE 1ZWSA 4HYIA 5HORA 1L3RE 5AUXA 3QD0A 4BBFA 3OY1A 5AA9A 4JBOA 4CVAA 2JKKA 3LVPA 3LM5A 4QP3A 2PE2A 3ODYX 1XH8A 4ZTQA 4GKIA 2W1HA 3SRVB 3EOCA 3MFTA 3ATTA 4L3LA 3DJ7A 1ZLTA 3HDMA 4OTGA 4RGJA 4XYFA 3R7EA 3PXKA 3BELA 1R39A 4HGTA 5CEOA 2C69A 2UZOA 4QMQA 3FMHA 5IEXA 3FJQE 4YHTA 4I4EA 3WZDA 2QQ7A 5L2QA 4FTKA 1BL6A 3ZFXA 4BY9E 3G0EA 1OKWA 1PMVA 3D15A 4I6BA 4P4CA 2BMCA 3FLWA 5IQDA 1G5SA 5IQGA 1Q8WA 1R78A 3FXWA 4XG6A 4JNWA 4V04A 3RM6A 3FC1X 3MH2A 4AGDA 1Y6AA 3PE1A 1Q3WA 3VS4A 2C47A 1NVRA 3PVBA 3IW6A 3ZC6A 4ZY5A 2HK5A 5EKOA 1Q8TA 3D83A 3KA0A 5KMNA 3AT4A 2CCIA 3UOKA 4E8AA 3KN6A 4RX7A 2VX1A 1CM8A 3E92A 3PRFA 4J97A 3FYKX 4H1JA 5CAQA 2PVRA 3WYYA 5CSXA 4MNEA 2X7FA 4ANBA 4FGRA 4GKHA 1SNXA 4R3CA 3HP5A 4O22A 4OBQA 4YZNA 3KU2A 3FMJA 4M7IA 4ZTHA 2C6DA 4FYOA 1PMNA 2XNNA 4JX3A 5AP2A 4CNHA 5HLWA 1ZYDA 3RNIA 4EHVA 3H9OA 5E4HA 4CZTA 2UUEA 3GU8A 4JX7A 4LV5A 3FQSA 3P86A 3UNZA 4O7SA 4J7BA 4O83A 3BHYA 4MF0A 2IN6A 2RSVA 2A27A 3UYSA 2NPQA 1WFCA 4M66A 5FLFA 3KULA 3ZRKA 2Z8CA 3DY7A 3MESA 2R3KA 3OS3A 2UVXA 3E3BX 1LR4A 2JBPA 3QD2B 2X39A 3Q6WA 2ITOA 3TTIA 1GZNA 2YM3A 2XUUA 3MS9A 1YI6A 4HYSA 5B7VA 5L2WA 4AZWA 3SGCA 1JOWB 5HZNA 2RG6A 4BC6A 2R3NA 2ZDTA 3QTIA 2I0VA 3F69A 1XKKA 5F94A 4EQUA 3EQDA 3ZMMA 1NXKA 4C61A 3A7HA 3AG9A 3PXYA 4FUXA 4DINA 2I0EA 3CQUA 4JDJA 3U8WA 4AE6A 4PL3A 3TNWA 3ENMA 4G9RA 3AC4A 4BB4A 3V04A 5L6PA 3PZHA 3O71A 4G6NA 4RBLA 2ITYA 3QKKA 2QOFA 4YP8A 4HW7A 5M08A 1TQMA 1PXIA 2C3IB 2NO3A 2EVAA 5E90A 4FIFA 5J9LA 5F9EA 1UKIA 3R1YA 4AGUA 5LVLA 5I0BA 3MPMA 4UN0C 3QCXA 4G17A 4IWDA 2X4FA 1CSNA 5J87A 2CLXA 2WTDA 3R8UA 2WQNA 2G01A 3E93A 3WF8A 3D4QA 1H1WA 1OPLA 3CSVA 3VULA 1ATPE 4KS7A 4W4VA 4O27B 4XCUA 5M44A 4ZIMA 4R7IA 4LMNA 4BF2A 4F6WA 3BLHA 4IFGA 1H00A 3RPVA 4AA5A 1UVRA 4M69A 3EWHA 3TWJA 2OFVA 5BUEA 2OJIA 3F61A 3H9FA 5FBNC 5EQPA 4U5JA 3QRIA 2PZ5A 3I5NA 4I6QA 2UW7A 4FVPA 3CJFA 2FO0A 5I9VA 4F7LA 3E8DA 3V8SA 4D4RA 3IKAA 3PYYA 2BDFA 4AW5A 3LMIA 2EB3A 3TTJA 4FX3A 4FKSA 5A4QA 3FMKA 4JOAA 5AMNA 5IA0A 3R0TA 4TTHB 4XV1A 4PDOA 2XK7A 4AN3A 3DBCA 4D1XA 1W82A 3G6GA 3ZH8A 4EK6A 4JJRA 4DG2E 2C0TA 3Q2JA 3WZKA 3ZEWA 3BGZA 3H0ZA 2ZMCA 4GFOA 3GGFA 3QZIA 4IZ7A 4L43A 4RFZA 4I24A 5CU3A 5D12A 4EH7A 4QMLA 4PTEA 3LIJA 2VTHA 4XJ0A 2A0CX 3VS1A 3Q9YA 4PTGA 2GS2A 3R9NA 3TUDA 4RSSA 2OH4A 4F6SA 3QCSA 2YM5A 4CG8A 1ZYJA 2GNHA 3QRJA 3SDJA 4EOKA 1ZY5A 3UNJA 4IZYA 4AZTA 2X2LA 2UZVA 2C0OA 2W1GA 3QD3A 4QD6A 3AC2A 4B7TA 3II5A 3O23A 4UY9A 4ALUA 4FVRA 3TDWA 2GCDA 1UWJA 4HVSA 5GJDA 3ZCLA 5FG8A 4RIWB 4D55A 4IX5A 4R5YA 4U40A 3ZRMA 2RL5A 2VTLA 3O17A 2J2IB 3OTUA 2X1NA 4L44A 2R5TA 3S2PA 5EW3A 4FT7A 4OTHA 4PDSA 4U81A 4FV2A 4NYEA 4QT1A 3UODA 1Q5KA 4KBKA 3QTXA 4HJOA 2WTIA 4P5ZA 5FUTA 1PW2A 5D9HA 3DAEA 2IW9A 4NM3A 1KSWA 4GYIA 4YHFA 2XM9A 5T6KA 3EQBA 1GIJA 3A7JA 4F0IA 4Y95A 3DGKA 4K11A 4II5A 4LOPA 5T3QA 5EI8A 3S95A 4Z7HA 3LFAA 5HE3A 4QMUA 3CLYA 3GU4A 3R28A 3A7GA 5AUWA 4D5KA 3UP7A 5LVMA 4QPMA 4PL5A 5AR8A 3CGOA 3O0GA 3COKA 4RC2A 3NUXA 2P2IA 3QZFA 4RIYB 5AX9A 4AT5A 2XK9A 3W1FA 3R83A 4YZ9A 1OKYA 4XRJA 1AD5A 3OWLA 3IGGA 4BDCA 4UMPA 2XF0A 3LHJA 5J5TA 5E8UA 3TL8A 4G5JA 3F5PA 2VTAA 4HCVA 4R1VA 1BI8A 1VR2A 4HVIA 3EQGA 2NRYA 3R73A 4BHNA 3M2WA 5HTIA 2EUFB 4MHAA 1YOLA 3AQVA 5C4LA 3CBLA 4IC8A 4IB3A 1PXLA 4QPAA 2A4LA 3CEKA 3D9VA 3MFUA 5AUUA 4HYHA 1WBWA 4RJ8A 4DFUA 4RVTA 3DAJA 3AMYA 1E1VA 4CEGA 3NUSA 4BI2A 3U4WA 4GJ2A 4K8AA 4O6LA 2Q0BA 2BTRA 2BALA 2VUWA 4GIIA 4Y72A 5ANJA 4F1TA 3Q4TA 2R4BA 4CQGA 4ZJIA 4PMPA 3EIDA 4AFEA 3U6IA 2VWBA 3R7OA 3MFRA 2HXLA 4IAFA 1ZZLA 4FKVA 2WAJA 5IH5A 3F3ZA 3A4PA 4NJ3A 2CNVA 4FMQA 2E9NA 4IM2A 3THBA 4FEQA 4TNBA 2BFXA 3F9NA 3VRYA 5E92A 4BBEA 3HA6A 3C4ZA 5AJQA 4ARKA 3LXNA 3VW8A 4RJ5A 4C4GA 1SMHA 4FL3A 2BR1A 4NH1A 2R3PA 1I44A 4QYFA 3M11A 4RWKA 4GU9A 4FTJA 3R7VA 3H10A 3OXTA 3DCVA 4MXOA 3QQHA 4BTJA 3DLZA 2UZTA 1W98A 3BRBA 3HVCA 4UXLA 5HQ0A 5J5SA 5K3YA 4CMUA 4A4OA 4ZS4A 3G15A 3QTZA 4J98A 5L2TA 4JIAA 5L8KA 5CF5A 3Q53A 3UYTA 2QO7A 4NL0A 4FGBA 2PE1A 1SYKA 4AW1A 3UC4A 2R3IA 3EH9A 4DH3A 3MN3A 4F1OA 2ZV8A 4DGGA 4BYJA 5L2IA 4TT7A 4HNIA 3VS3A 3AD5A 4CZUA 4RIXB 3BX5A 3CY3A 4LI5A 5HCZA 2RFSA 5FP6A 3L8XA 4QQCA 3MPAA 3I60A 5FEDA 3WBLA 3VQHA 3L9NA 3EZVA 4BCGA 1OUKA 2Y0AA 4MAOA 5TT7A 1VJYA 4KIKA 4FEVA 3BEGA 1XQZA 4HVGA 1OL2A 5AX3A 2OZOA 2CKOA 3VBYA 4DFXE 3Q04A 5KMMA 2HY81 4OBOA 3GQLA 4RA5A 4J1RA 3ZO4A 2H6DA 4DTBA 2JDSA 3GC9A 3KRLA 3QQJA 2Y6MA 3MTFA 4C3FA 1YDRE 3P5KA 2XNPA 3RWQA 3ZLYA 3VN9A 3QXOA 3NCZA 3V51A 1XHAA 4I3ZA 1GIHA 4C59A 2RFNA 1RE8A 3MH0A 4FIGA 1IEPA 3DK7A 3VWAA 2RFDA 4BDEA 4BKJA 2E9OA 4HZRA 2WTVA 3ZONA 3FMLA 4Q5EA 2OBJA 4E73A 4O1PA 5F1ZA 4QYYA 3SHEA 3TNHA 2GNLA 5HBHA 3U6JA 4MXCA 4CFWA 5CXHA 2EXCX 5CQUA 1XH6A 1FOTA 2B7AA 4RLKA 5FP5A 3FPQA 2GQRA 4EKLA 3FBVA 4O82A 3NNWA 4EK4A 5AR4A 4YR8A 3KXZA 2V62A 5M4IA 4NJDA 4CXAA 2NNWB 4DITA 1WBTA 4AFJA 4EYMA 4HGEA 1W83A 2C6TA 3JS2A 4DT9A 4IB0A 3FZ1A 2VTNA 1H1QA 2X2MA 2XVDA 3BCEA 4NT4A 5IDPA 2BZKB 2EXEA 3AC5A 2W05A 3PSBA 5HKMA 4ZSAA 5EK7A 3QQLA 4TL0A 2AYPA 4X21A 3R04A 2QURA 2W5AA 3F3VA 4JG8A 1J1CA 2YA9A 3PTGA 3OWPA 3R9DA 3V5TA 2YCFA 3G0FA 2ITNA 3QUDA 2XIZA 3E64A 3Q9WA 5E9EA 5M57A 4FG8A 1YHVA 4L7SA 4N4SA 4FEWA 3P1AA 2ZJWA 3V5LA 4F9AA 2QODA 5M51A 1ZOEA 4CKIA 4J8NA 1VZOA 3QYZA 3U55A 4W4XA 2GFCA 2W4OA 3NYOA 4MXYA 4NSTA 4RIYA 3PWDA 4GS6A 4Z16A 3PIXA 2VTPA 2ZB1A 4FZFB 3ET7A 5EDQA 5JEBA 2JIVA 1OIQA 2YABA 4DCEA 4NM0A 1KUTA 4A9SA 3IONA 5TE0A 2ZDUA 3NVMB 3PIZA 1U54A 4USFA 4L67A 5A46A 3SV0A 5HO6A 2XK3A 3VBVA 4QMTA 2F49A 3DNDA 4KKEA 4CT2A 2WPAA 3IK3A 4BGQA 3F3UA 3HX4A 4Y73A 4I0TA 5EG3A 2W7XA 3MWUA 2YIQA 2BAQA 4QTEA 3UQCA 2UZEA 3R8MA 3LJ2A 1WBOA 3RNYA 3P9JA 4FIJA 1W8CA 1H8FA 2YZAA 2IO6A 3HRFA 2QOQA 4XP0A 5HE2A 2XJ2A 4FL1A 5HIEA 1U46A 5FTQA 4YPDA 5FTOA 3FL5A 3OT8A 4ALVA 1S9JA 4I0RA 4BGGA 5EM7A 4HPUE 3IECA 4EHGA 3I4BA 2ERZE 3HAMA 1WBNA 1GJOA 3FLNC 4FTIA 4KABA 1YHSA 3A7IA 4I22A 4YZMA 3C13A 4H1MA 1O6YA 2BUJA 1FMKA 2C6LA 1OPJA 3BYMA 4LV8A 1J1BA 4MH7A 4MYGA 4QYGA 3BLRA 4GK3A 2GDOA 1M52A 2BIYA 5HD7A 3TI1A 4EOQA 4BIDA 3FI3A 4DF3A 1BKXA 4V05A 3GUBA 4ANQA 4YLJA 2QOCA 5H8BA 4NZWB 2B55A 4BDJA 4F7SA 2F7ZE 3NW7A 3SG8A 3C4CA 5CVGA 5J79A 4DFBA 3QL8A 3MVJA 3CPBA 1S9IA 3DOGA 4YJQA 3C4XA 5D41A 1Q4LA 3COMA 2F7EE 3HMMA 3QA0A 1OB3A 3W2PA 4AZVA 2DQ7X 3SOAA 2QD9A 4EOLA 2PUUA 5AV1A 4IEBA 4NTTA 3ORTA 3QTRA 2VGOA 2VO0A 1K2PA 4B4LA 3I6WA 2OF4A 4GU6A 3VIDA 3TXOA 3VS0A 4BZNA 5EM5A 1PXOA 4FEUA 4UB7A 4L3JA 2SRCA 1M7NA 4HGSA 5KBRA 2WQOA 4YJNA 4S34A 2FSLX 2O0UA 3DKGA 1Q3DA 3MGYA 4XS2A 3U51A 2R7BA 5ETCA 4S2ZA 2PMOX 2E9UA 2BZIB 3CKXA 4UALA 4FTRA 4FUYA 2O3PA 4I0SA 1Z57A 1U5QA 2YERA 3NYNA 4I23A 3PJCA 4BWPA 3CQEA 3LXLA 4BRXA 5C8KA 4CCBA 3VUTA 4L9IA 3QYWA 4QP1A 4TKSA 2UW6A 4FA2A 1K3AA 2ZB0A 1H01A 4UYNA 3VUGA 4B8LA 3DXQA 3WE4A 3R7YA 4GV1A 3A62A 3FL4A 3FKLA 4HVDA 4NU1A 2BAKA 3UOLA 4UMTA 2VWIA 3QU0A 4AACA 3SQQA 2OWBA 1YWRA 5AUYA 2WTCA 2XNGA 4I92A 3P79A 3DNEA 4LGDA 1V0PA 5BNJA 2GFSA 2XCHA 2BRGA 2DUVA 3I79A 5GZAA 2VWVA 4O21A 5HCXA 4KA3A 5J7BA 5E8ZA 5ACBC 1UU8A 3NIEA 1H26A 3DJ5A 1Q99A 2F9GA 3F5UA 3OWKA 3IW5A 3L9LA 4AUAA 1PYXA 3LQ8A 4M13A 2W99B 2ZVAA 4L68A 3C0GA 1RW8A 1J3HA 1PXMA 5EYDA 4FT5A 4J99A 3PP1A 5GIOE 4EOMA 5A4TA 3MFSA 4DGOA 2BHEA 4QP9A 2DS1A 5KMJA 4MEDA 4O38A 3QC4A 4AW2A 4D1SA 4UWBA 2XRWA 3ZLSA 4G3GA 4CLJA 4FSYA 4N70A 2C3LA 2H8HA 1XO2B 2IW6A 3FHRA 5EOLA 5IQBA 3PZEA 4RZWA 5AP5A 3QGYA 2B0QA 2GSFA 4FVQA 5DEWA 3COIA 1OKVA 4IDVA 3U6HA 2XM8A 3O2MA 4DLIA 4JAJA 4AA0A 4B8MA 5HG8A 3CIKA 4I5HA 5DEYA 4S33A 4KNBA 2OK1A 4YJOA 5DN3A 3VC4A 2HENA 1OKZA 1BL7A 4QOXA 3P0MA 2WU7A 4QTCA 4HCUA 2UZUE 5DIAA 3FI2A 5DRBA 5AUVA 4BVUA 1H08A 5C03A 5AP7A 2PZRA 4H3QA 2B9IA 4ASZA 4U9AA 3EQIA 1CKPA 4BDAA 2IVUA 4BCJA 4C33A 1GAGA 1WBSA 2W1DA 4QMSA 3TCPA 3F7ZA 2IVTA 1JSTA 5EQYA 5IQFA 1Q8ZA 3RAIA 1NVQA 2OJGA 3EYHA 3FSFA 5ANKA 3OMVA 3IOKA 4C8BA 4F6UA 5A14A 5CU6A 2CKQA 4D58A 2C6EA 1JKTA 2X8EA 5CQWA 5K0KA 3L8SA 2Y6OA 4IFCA 4IWQA 3P78A 2W5HA 1U59A 4O7VA 4O0XA 4XEYA 2VNYA 4FKJA 2VWUA 4I6FA 4J71A 5I3RA 3RPRA 3BU6A 5HIBA 2ZAZA 3WZUA 1G8AA 3U54A 1RJBA 2OF2A 4FV8A 3TJDA 3HZTA 4LRJA 3QZHA 4I5PA 4P2KA 2VTTA 3MW1A 5KMIA 4I21A 4N57A 5E8XA 1M7QA 3ZDIA 1WVWA 1H28A 3ALOA 2PZPA 1PYEA 2ITTA 4RJ6A 4AS0A 4CRLA 4BTFA 4QP4A 4X0MA 5HOAA 2PSQA 5BVDA 3ZUVA 1PHKA 5ANOA 4O81A 3PA3A 3CTQA 4FIEA 2XYUA 3QTSA 5AR7A 3AOXA 3R1QA 5L2SA 3OROA 3QHWA 3KXMA 2YLFA 1MRYA 4E5AX 3LLAA 3KKVA 4X6RA 3Q9XA 2PVKA 4V0GB 2BZJA 1OPKA 1GNGA 4CMOA 3D5XA 1YQJA 4FV6A 3SAYA 4WNOA 5L6OA 2QNJA 3D7ZA 4OTRA 2PVYA 5JGAA 4EOSA 5JMSA 2B9HA 1DI9A 2WTKB 3EQHA 3E63A 4YJVA 4XP2A 1TQPA 3LCKA 5DT4A 5CF4A 3GBZA 1OBGA 2OFUA 4DC2A 3HV7A 4ENXA 5I9UA 4E4NA 2V22A 3NR9A 4P90A 1OL5A 2WMBA 3HEGA 2YFXA 1JAMA 2OZAB 3FSKA 3FY0A 2HW6A 4R3RA 2YIRA 2W0JA 3Q52A 3Q4CA 3MY1A 2OIQA 4GL9A 4FOCA 5D11A 2H9VA 5KMOA 2I0YA 5FXRA 1WBVA 1VEBA 3SD0A 3SVVA 1MQ4A 1OITA 3QQFA 5C01A 4EI4A 1WCCA 5K0XA 3JY9A 1CMKE 2PVHA 5BYZA 3F5XA 4IVDA 4ZJVA 1Y8GA 2PMIA 3ENHA 1W7HA 3LCSA 3RP9A 3SXRA 4BR3A 3Q60A 3RCDA 4YTIA 4GFMA 4MTAA 5JKGA 1OGUA 2J0KA 2GPHA 4EJ7A 4FSNA 3NDMA 4MX9A 3LFDA 1M17A 4FKOA 4H3PA 3VUIA 1FQ1B 2UW9A 3TZMA 1ZYLA 1DS5A 3PG1A 2I40A 4EC8A 3DBQA 4JDKA 2P33A 3DLSA 2VTIA 5LXMA 5FM2A 3PP0A 3SA0A 5DPVA 5ETAA 3ACKA 4J53A 5EHOA 1ZZ2A 4JR3A 4WUAA 3ZU7A 1ZOGA 2E9VA 4C36A 1AGWA 1IG1A 2QONA 4IW0A 1H1PA 4FSZA 4YBJA 4NW6A 3R9OA 1JQHA 3AGMA 2JKQA 2C6IA 1Y57A 4K6ZA 1WBPA 5K5NA 2XKFA 5E8SA 1J7LA 1NT2A 4IQ6A 2JKMA 4KIQA 5AR5A 2F57A 2YM6A 3KB7A 4ZS0A 3HV5A 3ID6C 4UXQA 5KMKA 4YO6A 1PXPA 4LRKA 4MBIA 4DFYA 3RPYA 3QA8A 1FGKA 3LXKA 3Q6UA 3LFNA 4GMYA 3A61A 3VS6A 1PF8A 4D0XA 3ORPA 4XHKB 2FSOX 3BZ3A 2BKZA 1OIRA 2I7QA 4IAZA 3TG1A 2B9JA 4PNKA 4TY1A 2HWPA 2UV2A 2XRUA 5DR2A 4JAIA 2Y7JA 3MVLA 3LCOA 2XKEA 5HLPA 5CVFA 4QYEA 4A9YA 4QMXA 4O1OA 4WBBB 3T9TA 3AXWA 5BYLA 2UW3A 1YXXA 4FV7A 5CNOA 5HTBA 4K1BA 4G9CA 3EN9A 2ETKA 3PVWA 5HG9A 5HO8A 2OI4X 4ZSGA 1UA2A 1H0WA 3O8UA 5M56A 1JKSA 4C58A 3BIZA 4A9TA 4IM3A 3N4VA 4LRMA 4RMZA 1O9UA 3RVGA 3QX2A 4ANSA 5EFQA 1B38A 3LFFA 3MH1A 1APME 4MK0A 3FEGA 3QQUA 4YJSA 3UGCA 1XH4A 2YITA 3VBQA 3NVKI 3P23A 4G5PA 3G51A 2YHVA 3EJ1A 2CPKE 2QR8A 3PIYA 4FT0A 2I6LA 2YDIA 4GVAA 4FTTA 5AM6A 4JQEA 4YZBA 2FSTX 3H0YA 1FBNA 1IASA 3OP5A 3E3PA 4FV4A 3TNQB 4X2GA 1P2AA 5HNIX 5J9ZA 4HYUA 1NA7A 2IZSA 4W8DA 2BRBA 4ANMA 4DEDA 5DR9A 5FD2A 1B39A 3EQCA 4TNDA 5FDPA 4L3PA 4QMMA 1DM2A 2WOUA 2X6DA 1H27A 1FVTA 3PJ8A 4BCOA 4CYIA 3LJ0A 3OFMA 4FTLA 4FIIA 5ICPA 2PULA 3R7IA 4JBVA 4ALWA 2FA2A 3GT8A 2PL0A 3E7OA 3GOPA 3OXZA 4XG3A 3QQGA 3ODZX 1XWSA 2WQBA 4CZYB 2PMNX 2C5NA 2C5VA 2WOTA 3D14A 4DEEA 3F88A 4XG7A 3BYOA 4O6EA 5JQ5A 5EW9A 4E4MA 4YUQA 5LWMA 4IXPA 3GP0A 5A54A 2ONLA 5AR3A 3KRWA 4BBMA 4EH8A 5FXQA 2C0IA 3CTHA 4GVJA 2WU6A 3EKKA 4KIKB 3MBLA 5AV0A 4WUNA 3WZEA 3ZTXA 1YW2A 4IAYA 3KCFA 1EH4A 1PKGA 1T46A 4Y5QA 2QHMA 2C6MA 1G8SA 3D5VA 3KRRA 4TYHB 3EHAA 4DFZE 4IX3A 3DDPA 4E6QA 5C9CA 5A4LA 3RGFA 2VWXA 4CSVA 5TO8A 1W84A 4S31A 4F9BA 3FI8A 4V0GA 3EZRA 2WTWA 4EL9A 4G2FA 4DEIA 3UPXA 5CAPA 3UTOA 3ZFYA 4CYJA 3F6XA 1SVHA 3A2CA 3HUCA 3MJ1A 4BDGA 3NEWA 4S30A 4EQMA 2V55A 3FQHA 2GHMA 3ZUTA 1YXUA 1ZMVA 3NS9A 1P4FA 4CLIA 3R9HA 3S1HA 3VAPA 4D4SA 1MRUA 5EYKA 1GOLA 2BDWA 1KOAA 3BV3A 3TV7A 4ANOA 4C3PA 2JDTA 3KQ7A 2ZYBA 3B8RA 4RRVA 2OZAA 4O2PA 5CT7A 1Q8UA 2A19B 4GSBA 4BIEA 4CKJA 1REKA 2JIIA 3CQWA 2ITVA 3HRBA 5CU2A 2OXXA 4DBXA 5JT2A 4EUTA 5K4IA 2B52A 3HECA 5CSWA 5IF1A 3I7BA 4I20A 2G2IA 4ZSEA 2CGXA 4BDBA 5I3OA 4FTNA 4FNYA 3AMBA 4LG4A 3ZSHA 3KMWA 1OMWA 5JFVA 1HOWA 4DG3E 4X2NA 2J0IA 4RLLA 2V7AA 2AUHA 4BCNA 3PJ2A 3SW7A 4YO4A 3D2IA 4MBLA 5LOHA 1KOBA 1KE7A 3NIZA 4WKQA 3MY5A 1ZYSA 4O0YA 5FGKA 2Z7QA 4CV9A 3IGOA 5CS6A 5F4NA 5G6VA 2PVFA 3WIKA 2WIHA 4JBQA 3OWJA 4YNOA 4S32A 3ORXA 4ZZMA 3RPOA 1UNHA 5KKRC 4JR7A 5L8JA 4DGLC 1CTPE 3NNXA 2JKOA 4DGMA 3I1AA 2G15A 2QOIA 4TYJA 2UZNA 3UVQA 1BLXA 5AAGA 1XJDA 3R8PA 1QPJA 4RQKA 3ORNA 4O7LA 1U54B 3K5VA 4R1YA 4U97A 5CSVA 3B8QA 3QUEA 3VW6A 2WQEA 4PMMA 4YNEA 3PE2A 2VTQA 4RC4A 2DWBA 4YJPA 2FH9A 5JZNA 5B2MA 3GCQA 5DNRA 3FMEA 5KHWA 1OM1A 3V5WA 3PVUA 5BVWA 2GU8A 1M2RA 2VX3A 3F2RA 3SX9A 4L7FA 2FVDA 3OZ6A 4BCQA 4RX9A 4LUDA 4RX5A 4IHPA 4UMQA 2XIXA 2HYYA 1PMUA 3ZO2A 4O0TA 2CJMA 3A7FA 3AMAA 5BMMA 2Z2WA 3VBXA 3R02A 3E87A 1NVSA 2FB8A 3K5UA 4QQJA 4A06A 3MV5A 4EZ7A 2YIWA 4LQMA 1YDSE 3DFCB 3FMMA 5M53A 3SG9A 2AC5A 5FM3A 4IANA 2W1EA 2BTSA 1B6CB 2HZNA 2XZSA 3ORMA 4ERWA 5ANIA 4MD7E 4DFNA 4D28A 5IQAA 2JC6A 5JRSA 3F5GA 4C37A 5LJJA 3Q32A 2VGPA 4BZOA 4O0UA 4RQVA 4ZTNA 3V5PA 3EQPA 5FWKK 4YJUA 4BDDA 4AE9A 4FSUA 3FZSA 2VO6A 3QCQA 3UNKA 3RAKA 4F7JA 4AAAA 3C5UA 3EMGA 3CTJA 4L45A 2PE0A 3HV3A 1QL6A 2XIYA 3FAAA 1XBCA 4U43A 4XX9A 3VF9A 5JH6A 4R6VA 4OTQA 4I6HA 3LFEA 3HMNA 1OIYA 2GMXA 1ZY4A 1J91A 4KB8A 3JUHA 4A9RA 4JRVA 4QMYA 4EK8A 3PRIA 2GNFA 3KEXA 2JDRA 3JPVA 4XNEA 1P4OA 4LMUA 3DA6A 3NCGA 4XH6A 3ORIA 2XNEA 5IQHA 3REPA 3OCBA 4H36A 3PSDA 2J90A 4NM5A 4NIFA 5HI2A 4C4IA 3W8QA 2BRHA 1H25A 5KKRB 4EOJA 4IX4A 4O0WA 1OECA 2R0UA 3MIAA 4M68A 1PKDA 1R0PA 4B6LA 3JYAA 1KE6A 2B54A 4TZRA 5HCYA 4XRLA 4FYNA 1Q62A 2WHBA 4M14A 2PMLX 3FLQA 3MTLA 4ZSLA 3NYVA 4RC3A 1OL7A 4IMYA 4G3EA 5D1JA 5B0XA 4YC8A 2LAVA 2R3OA 3BBTB 3LCTA 4EH9A 4QNAA 5LMKA 3SXFA 4U7ZA 4XBUA 3VUKA 4IADA 4QTDA 2C30A 4TYHA 4QYHA 3QBNA 1OVEA 2W06A 3ALNA 2B1PA 4K33A 3KCKA 4FSQA 4PTCA 4EOOA 5AA8A 4M15A 4FG7A 2X8IA 5DR6A 2GHGA 5IUIA 3ZLXA 1G3NA 4E5BA 3FLYA 5JSMA 2XB7A 2OXYA 3WF9A 1LUFA 2OXDA 4F65A 2JGZA 2V0DA 4K77A 3W32A 5HTCA 3RBWA 3GC0A 3FY2A 3WOWA 3NNVA 4O7TA 3FZPA 4BL1A 5CU4A 3LZBA 3TNPC 4K0YA 4ZXTA 5CASA 4WO5A 2X81A 2Q83A 3D7TA 4ENYA 2YM4A 2BDJA 3QXPA 2OH0E 3OTVA 3R2BA 1PXJA 5D10A 5GJGA 4JRNA 4ASDA 4CQEA 4CCUA 3ZEPA 1ZAOA 2W4KA 1FVVA 4QP6A 2C6OA 2Y4PA 4MF1A 4BTKA 1BX6A 4B9DA 2VU3A 3MIYA 4AGCA 2XKDA 3ACJA 4FKPA 5CSHA 2YLEA 5KCVA 2HWOA 2P2HA 2IPXA 2J0LA 3CJGA 3PUPA 3UIUA 2BVAA 1FMOE 2HY0A 5FQDC 4EEVA 3QKMA 4DN5A 4RX8A 5JFWA 4YJRA 1O6KA 4GT5A 4JI9A 4L42A 5HD4A 3TUBA 3GU7A 3KL8A 4DFLA 4TPTA 3D5WA 5LVPA 5BVFA 3TM0A 4G6OA 4AOIA 2PVNA 3AC1A 5JRQA 5HNGA 2WQMA 3IPHA 5EM6A 2CDZA 1A06A 3S0OA 4A07A 2OW3A 4QQTA 4C7TA 3FV8A 5GJFA 3TDVA 4FOBA 3GFWA 2PVJA 3HMIA 3RCJA 4ITIA 3RHKA 3DXPA 3MYGA 3QCYA 3WILA 3F3WA 3BQCA 4X6QC 3T9IA 4EC9A 5A4CA 4NWMA 2EU9A 4ACGA 4BDIA 1ZMWA 4WG3A 5CT0A 3KF7A 1TVOA 1F3MC 5IA5A 5KE0A 4BZDA 3WE8A 4XBRA 4ANLA 4KAOA 2O64A 3EN5A 3RMFA 5HU9A 4ASXA 4U42A 4F7NA 4ZY6A 3L8PA 3POOA 2QCSA 4ZAUA 5HBJA 4L46A 2QKRA 3ITZA 4W4YA 4ZZOA 4JG6A 4HPTE 2B9FA 4L00A 3NUUA 3C0IA 3UG2A 3ZXTA 1OBDA 2PUNA 3BI6A 3TNIA 4OTFA 4AOTA 2GS7A 2QOOA 4P7EA 4BYIA 3ZDUA 2CCHA 4HNFA 3DU8A 2YJSA 3ZM4A 2CN8A 1OUYA 1JWHA 4I93A 4DG0E 5I5ZA 4FKQA 4HVHA 3TACA 4E3CA 5LCJA 3RM7A 2BFYA 4NK9A 4TWPA 4Z55A 3BLQA 5JGDA 4CG9A 2CNUA 4KKHA 1YRPA 5AWMA 1Y91A 3RTPA 3RWPA 2VZ6A 5BVNA 3RJCA 3PG3A 4BGHA 4CFNA 3OCGA 3C51A 5E1SA 1Z5MA 4QTBA 1IA9A 3D5UA 3MB6A 2F7XE 4NCTA 1GZKA 4WBOA 5DT3A 2QOLA 4NUSA 4R8QA 4UYAA 3W33A 1H1SA 4LL0A 3FLZA 4MKCA 2Z7LA 4DGNA 2ZV2A 2IVVA 2YAAA 3NW5A 4G16A 5E1EA 5IA4A 4PQNA 2VTRA 5D7AA 1LEWA 4DA5A 2QLUA 3GQIA 4IZAA 5E8TA 3F2NA 4E20A 4FSRA 4PDYA 2BCJA 3V8WA 5K9IA 1E1XA 1JSUA 1PXNA 3AT3A 3QFVA 1QPCA 3VO3A 2PPQA 2VTMA 2WMSA 3PVGA 5ANEA 4JL9A 4BI1A 3CE3A 5AP4A 4CRSA 4OGRA 3DKCA 3DTWA 3CCNA 1PJKA 5HX6A 2R3JA 2FUMA 2A2AA 1IAJA 4FTMA 3Q5IA 4GRBA 2HZ4A 3MJ2A 4K9YA 5CTPA 2JAVA 1RQQA 3IDCA 3JVRA 5M4CA 2WEVA 3O50A 3DZQA 2GQSA 2JBOA 2CHLA 4OT6A 5EI6A 1GZOA 4FODA 3DKOA 2CLQA 2XH5A 2WMWA 3AD4A 4ZTSA 5J8IA 3DT1A 3W10A 5DBXA 4GCJA 5CU0A 4KS8A 5B2KA 4UMRA 3OUKA 2GTMA 3DPKA 1IRKA 3C0HA 5CSPA 2GTNA 3ULZA 5CF8A 1QMZA 4Y85A 3QC9A 3VRZA 2PU8A 3NMUF 5HBEA 4YURA 5BPYA 5DHJA 2X4ZA 3DBFA 2ZM1A 3KFAA 2ONLC 4X2JA 2BZHB 1U4DA 2HOGA 4X7QA 1WZYA 3HRCA 3Q96A 4RJ7A 4GT4A 4XG4A 5AP3A 2Z02A 4NFMA 4GJ3A 4YJTA 3UMWA 4J96A 4M0ZA 5HE1A 2G2FA 3LW0A 4C4HA 3ZFMA 2CNQA 3PY3A 1MP8A 2G9XA 3GFEA 4ZMFA 4MXXA 4U79A 2XYNA 3EFLA 3ELJA 4IJPA 2CGVA 4AU8A 3V8TA 4GK2A 3ZHPC 4CFUA 3KC3A 5J7HA 3GC7A 3AT2A 2Z7RA 1YKRA 4D2WA 5JK3A 5AP0A 3QQKA 1KE9A 2JFLA 2W5BA 2WTKC 3HV6A 5JGBA 2PUPA 5EQEA 2OSCA 4YC6A 3RINA 3HLLA 3AD6A 4BWXA 5C1QB 2RF9A 4GUEA 3UO5A 3BWJA 3JY0A 4R3PA 4F0GA 1LP4A 4JQ8A 3VBWA 2P0CA 2W17A 4LOQA 4ERKA 3UOHA 5KZ0A 1P5EA 4M0YA 3TKHA 5H2UA 4MCVA 4DYMA 4AA4A 3TKIA 2QLQA 5FEQA 4UMUA 3N51A 4LFIA 4EZ5A 5GZ9A 4FNZA 4PMSA 3C50A 2C6KA 2QOKA 3DKFA 3L9MA 3LE6A 4G3DA 3G6HA 2JLDA 2HZIA 2WMAA 4MNFA 2UZDA 2X6EA 5DFPA 4DH8A 4J52A 1ZXEA 3HAVA 3BYUA 5TR6A 3MA3A 3C7QA 4QMNA 2OGVA 4Z3VA 4BKZA 3UQFA 5CENA 4FKIA 3EN7A 4IWOA 4ASEA 4UX9A 3QD4A 4D2PA 1BMKA 3QWJA 4WIHA 4XMOA 3BHTA 3GCUA 3B2WA 3BYVA 2UW0A 4EONA 3DFAA 1W0XC 2J50A 1R0EA 4D2TA 4C4EA 4CMTA 2UW4A 2R3FA 4FT9A 2XIKA 1DAWA 3SXSA 4FTCA 4C38A 1MQBA 4WSYA 4JT3A 5GHVA 5J1WA 4WNPA 3C1XA 4EK3A 5IA2A 4I1ZA 3OW3A 1FPUA 3RK5A 4GFGA 4BCMA 3AGLA 3MDYA 2J51A 2QOBA 3KVXA 3NUNA 3OBGA 4FV3A 4FV0A 3MSSA 4FZ7A 3VS7A 5CZHA 4JVGA 2VAGA 4FC0A 2Y4IC 4FF8A 5F95A 3OW4A 3V5JA 3BV2A 4ACMA 3ZZWA 3VHKA 4FZDB 4OTWA 5HICA 4AZSA 4PV0A 1UU7A 5BVOA 3UQGA 4XV2A 4D2RA 4CTBA 4FTOA 4PUZA 4BWKA 3CPCA 4C0TA 1Q61A 3GC8A 5ANGA 4ACCA 2BROA 4C35A 2XEYA 4F9CA 5M4FA 4FV9A 1H1RA 3JXWA 4WNKA 3CGFA 3NPCA 2WNTA 1OL1A 3GI3A 3ANQA 2XNMA 4MQ1A 3FPMA 4O2ZA 5DVRA 4D1ZA 1E9HA 4RT7A 5EDPA 4F9YA 2PWLA 3QHRA 4I94A 5C27A 3QRUA 1XH5A 5CF6A 3FC2A 3SOCA 3VHEA 4KRCA 3PXQA 3TEIA 4OT5A 3G5DA 5F20A 2PHKA 4DEBA 4Y83A 5IDNA 3BBWA 3LPBA 2KULA 3UZTA 2J6MA 4XOYA 2X7GA 3LLTA 4FKWA 2C3JA 4GEOA 3W16A 5L4QA 2IZUA 1X8BA 2J0MB 2V5QA 2IZTA 3QTUA 3ZS5A 4EOIA 5KZIA 1CKIA 1GY3A 1BYGA 3B2TA 3E62A 4IBMA 4X3JA 5C8MA 2ERKA 4AGWA 3HMOA 2BRMA 4MD9E 3VQUA 2IZRA 3UIMA 3EL7A 4M97A 2UVYA 1UU9A 2R0IA 3ANRA 4H39A 4XV9A 2ETRA 3I0QA 3LQ5A 4CFVA 3GU6A 4E6DA 4WG4A 4AZFA 2YWPA 5HLNA 2XNOA 5IUHA 4KIPA 1PRYA 3NUAA 5EHLA 3R8ZA 3BU5A 3F66A 1QCFA 4AXAA 3PLSA 4G3FA 4QMPA 1WVXA 3FHIA 3ZM9A 2AC3A 3QWKA 4FG9A 4CFXA 4OW8A 2VWYA 3PJ1A 4L01A 3R8LA 3ROYA 1M2PA 2UZLA 3PPKA 3UIXA 4DCAA 5I9WA 2J4ZA 4YGAA 2GS6A 1YI4A 4BCFA 2IG7A 2JIUA 4I5CA 5A3XA 3KXXA 4EH4A 4YU2A 4E4XA 4FK6A 5E8VA 4KD1A 3K3JA 4KBCA 3O96A 1ZRZA 4Z9LA 4DH5A 4X3FB 2XCKA 1JVPP 4YLLA 3NGAA 4G1WA 4W8EA 5CI6A 2Y4IB 2J5EA 1MRVA 3E5AA 3OCTA 3HKOA 5LMKC 1JKLA 3HMPA 3ORZA 2VWZA 4JXFA 2A1AB 4CFMA 3R6XA 2YISA 5HGIA 4EZ3A 4QMOA 3U9CA 5C26A 3LQ3A 3EL8A 3G9LX 3OC1A 2PZYA 4PMTA 3KF4A 3NAXA 3R30A 5EM8A 5LMAA 3BWFA 2GQGA 3OD6X 2J5FA 4I5MA 4WA9A 5DH3A 5HVKA 1XH7A 2XA4A 5DLSA 4FNXA 2ACXA 2PZIA 2GNGA 2YDKA 3DAKA 4NM7A 1TQIA 1AQ1A 4JLCA 5LCKA 3UIBA 2YEXA 4YTHA 4F64A 3LKMA 4BN1A 3O51A 4U41A 2YACA 4G31A 3NLBA 1XH9A 2XKCA 3GENA 2C5YA 3P7AA 4WG5A 1LPUA 5HESA 3UO4A 2JAMA 4ANNA 4BDHA 1UKHA 1Y8YA 5FRIA 2ZM3A 5HVYA 3C5IA 3ORLA 1YVJA 3PY1A 3BE9A 3W8LA 3QTWA 4ZLZA 3LFSA 2WMTA 5FEEA 2X9FA 3MA6A 1H0VA 3TV4A 2OJFE 4DBNA 3KXNA 2WO6A 2BHHA 5EYCA 3N4UA 3KVWA 2OU7A 4IVCA 3IO7A 5JN2A 4GUBA 4LGGA 1SVEA 1JNKA 5M09A 2R2PA 5CVHA 4GW8A 4IAAA 4RWJA 1YXSA 4N6YA 3R22A 3VUHA 4OBPA 2VX0A 3K2LA 3BGPA 4R7BA 2RKUA 4RG0A 2R3QA 5CAUA 3H9RA 3L8VA 4K2RA 4R77A 1V1KA 1WAKA 2CKEA 3NAYA 4AWIA 4O86A 2P55A 2J9MA 3PJ3A 3HUBA 2JDOA 4FKGA 3M1SA 4IIRA 3W18A 5EOBA 3GXLA 4EBWA 4PP7A 2GNJA 4CFFA 4EH3A 4EHZA 1F0QA 5J95A 3FI4A 2YJRA 4KRDA 3GU5A 4FKUA 4IB1A 3VF8A 4H3BA 2YZLA 5TKDA 3ZRLA 5IU2A 3QX4A 3SLSA 3FMNA 4MXAA 2VTJA 4NIFB 5M07A 1V0BA 5HG7A 5JFXA 4R78A 3HYHA 4PX6A 4CGAA 4EYJA 3QKLA 4Q9ZA 5AADA 1DAYA 2QU5A 5CEKA 3GCSA 4U6RA 2P4IA 4N6ZA 3E8CA 2PY3A 5DRDA 3UDBA 2OIDA 3PLAE 5AIRA 4RPVA 5DA3A 5M55A 4BHZA 2W1IA 3QF9A 4AX8A 5IQCA 4R7HA 1H07A 1IA8A 4FT3A 3R2YA 4XG9A 5M06A 2YM7A 4LOOA 4PPBA 5L3AA 3TIYA 5C8NA 2WMXA 3IDPA 2W1FA 3PFQA 3PDTA 3A8XA 3P08A 3SC1A 3CD8A 4UEUA 4W9WA 4IVBA 3R21A 3U9NA 4BKYA 4E5WA 4FIHA 3W2QA 4YZDA 2CN5A 2ITZA 4A4XA 3DQXA 3H30A 4ZP5A 3VUDA 4JS8A 2RFEA 3UJGA 1UNLA 4LL5A 3WF5A 5HU3A 4FICA 3ATSA 5AP1A 3COHA 2BILB 4YLKA 3E88A 4OTPA 3U4UA 3W2OA 4JBPA 1I09A 4NKSA 2Q0NA 3PPJA 2QO9A 4N0SA 3D94A 3KRJA 4I4FA 5CAVA 3ERKA 5TOZA 2XP2A 3JVSA 4DHFA 4IDTA 3M42A 1YXVA 3ZC5A 3BHUA 2OICA 1VYZA 3I6UA 1BI7A 1UWHA 3PWYA 2OJ9A 4ZTLA 2Y9QA 3D7TB 3I81A 3FZTA 3MVMA 4IAIA 4NCTC 5ACKA 4AQCA 2LGCA 2B53A 3NUYA 4FSWA 3N9XA 4IC7A 4E26A 5AFVA 3R01A 4EH2A 4IJ9A 4AT3A 3ZSIA 3KMUA 4RFMA 1A9UA 4XP3A 5IUGA 2O2UA 4TWOA 3FMDA 4MVFA 3DK3A 3ORKA 3OXIA 3V3VA 3CP9A 3PXFA 4UWCA 2I0HA 3LAUA 3QAME 4M3QA 4DH1A 2ZOQA 3V01A 2X0GA 3BE2A 5AP6A 4JDHA 2VRXA 4G34A 2IVSA 5HE0A 1Q8YA 4RFYA 5LWNA 5CANA 4GK4A 2F2UA 3OY3A 3QLFA 1YI3A 4Q2AA 4O84A 4MWHA 4FKLA 4F08A 4CV8A 1JKKA 4HCTA 2QC6A 4YHJA 4E1ZA 4OTDA 1YDTE 4FTQA 4C4JA 4U80A 3SRVA 3BHVA 2XIRA 4O0VA 2V7OA 3QUPA 4M67A 3FDNA 5IEVA 4UV0A 3UP2A 3UVPA 4F1MA 3RZBA 5AAEA 3ETAA 4YBKA 5E7RA 4G3CA 4ZTMA 3I0OA 2XNBA 2YDJA 4X3FA 4C02A 2VWWA 2VTSA 2YM8A 4E6AA 4PRJA 1IR3A 3CD3A 3ZSGA 3A60A 4GIHA 5IA3A 2O65A 3EKNA 2XMYA 1SNUA 3Q4ZA 3DS6A 1H24A 4RVLA 1KWPA 3CR0A 4OTIA 4WSQA 5DE2A 5L6WL 5CALA 3EQFA 5IEYA 2ZMDA 3IDBA 2WIPA 3PY0A 2WGJA 3OUNB 4CKRA 4FR4A 1BUHA 2R64A 5ANDA 4ZMEA 4QP8A 5IH6A 3CXWA 2EXMA 5CX9A 3FZOA 3WARA 4R5SA 2PUIA 4U44A 3O7LD 2PYWA 4XG8A 3EFJA 2UZWE 1OL6A 3QRTA 4RJ3A 2WXVA 2CSNA 4O96A 3DB6A 2C68A 3OG7A 4NTSA 3RK9A 1RDQE 4TW9A 2ETMA 3DBDA 3ROCA 5IA1A 4KIOA 4DEAA 2C5XA 4IWPA 3W2CA 3S3IA 2QI8A 2QVSE 2UW5A 2OIBA 2WMVA 4ITHA 3I5ZA 4F09A 4GYGA 5CAOA 5ITAA 5DT0A 4KBAA 2YCSA 2R3HA 1OI9A 4BDKA 2R3MA 2HELA 2NP8A 3BHHA 4XUFA 2J0JA 4AP7A 4EWQA 1OZ1A 4CTCA 1Q97A 5EHYA 4BCPA 3RKBA 5FXSA 1YWNA 3LOKA 2QU6A 4MQ2A 3KREA 4TRLA 3HNGA 3VJNA 1FGIA 2FGIA 1UU3A 3W2SA 1ZARA 5L8LA 2WEIA 3VUMA 2QHNA 4EK5A 4Z7GA 2QR7A 1M2QA 4V01A 4F0FA 3PA4A 4KSQA 4C62A 2OJJA 3NRMA 5HVJA 3RALA 3TZ9A 4EQCA 2PVLA 3R00A 4H58A 1JBPE 1WMKA 5IKWA 4D9UA 3NX8A 3WZJA 4RJ4A 4C57A 5CEMA 3IG7A 5KHXA 2W96B 3W55A 4ZY4A 3E8NA 4PF4A 2QOHA 3MI9A 2R7IA 3QRKA 1PXKA 1V0OA 4TYGA 3HV4A 2C1BA 2YIYA 3DBEA 3PA5A 5CEQA 4ONAA 4YTFA 2G1TA 4YTCA 4IZ5A 1FVRA 2OO8X 4OUCA 1CDKA 4QPSA 5AM7A 4CT1A 1L8TA 5I9XA 4QQ5A 2ITQA 5BUIA 4FV5A 4ACDA 2JDVA 1LEZA 2W4JA 3GVUA 4EH6A 2QKWB 4FL2A 4EH5A 5JQ8A 2FYSA 5KMLA 4TWNA 3E7VA 2FSMX 3LFQA 3NNUA 3TN8A 4OR5A 1QPEA 3L9PA 3MY0A 3PPZA 4HZSA 5EDRA 4BTMA 4KUJA 2R9SA 4F9WA 2JD5A 3A8WA 3SW4A 2E2BA 3GB2A 3LM0A 5A6OA 4ZJJA 4U8ZA 4DEGA 5DOSA 3OF0A 5KO1A 1J7IA 2ITUA 4E93A 5CXZA 3UO6A 4C3RA 3R7GA 3HL7A 3KMMA 5IG1A 3EYGA 3HP2A 1YXTA 4FKRA 4NFNA 3RZFA 4YC3A 5FTGA 4FBXA 3C4EA 5CNNA 2VTOA 4O7WA 4EHEA 4XOZA 5KBQA 3F7WA 1KV1A 1NY3A 2YIXA 5EI2A 5JZJA 3G2FA 4IAKA 3IW7A 3Q9ZA 4JDIA 3TT0A 2Z7SA 3T3VA 4X2KA 4QRCA 5DG5A 5H9BA 3WIGA 4O7ZA 4TWCA 5A4EA 5CEIA 4AG8A 1J7UA 3A99A 3FYJX 1STCE 5HHWA 4GT3A 3U87A 2O63A 3V6SA 2XK8A 3NYXA 3P7BA 4TYIA 4B99A 3WF7A 2H96A 4ZLYA 3LXPA 1U5RA 4W9XA 3VNTA 3EB0A 1URWA 4TN6A 3KXGA 4KSPA 2BKKA 1K9AA 2REIA 4KWPA 3O8TA 5AR2A 5EW8A 3MB7A 5CWZA 3RAWA 4O7RA 1JPAA 4RIWA 4QP7A 4G6LA 3ZOSA 4BCKA 1SVGA 2P3GX 5BUJA 2X8DA 4DTKA 3SKCA 3TJCA 4USEA 2VNWA 5TF9A 2WTJA 2C5OA 4GH2A 5FDXA 5A9UA 3R7UA 2VV9A 3L1SA 2HAKA 3LCDA 3ULIA 4WRGA 4E7WA 2OG8A 1WVYA 5LVNA 2JFMA 2UW8A 4PWNA 4TYEA 5ETIA 5BYYA 1TKIA 3TV6A 4CD0A 3WYXA 3DK6A 3FUPA 2R3GA 2WZJA 2QG7A 4BICA 4ZZNA 3HA8A 3LMGA 3W2RA 3UPZA 4RWLA 3QTQA 4PL4A 5HNBA 3V6RA 1GIIA 4D2VA 3KGAA 2J7TA 3KY2A 3HDNA 5I9YA 4JIKA 5CZIA 4EKKA 5ETFA 2UZBA 4PY1A 5GNKA 5LARA 4D2SA 3EFWA 5H3QA 1JSVA 2WB8A 4DTAA 4YMJA 3GOKA 2GHLA 1ND4A 4J95A 2X7OA 4QMVA 2G2HA 5IMEA 1GZ8A 2HIWA 2O5KA 3V5QA 4PP9A 2WKMA 3JR1A 1R3CA
chains in the Genus database with same CATH superfamily
3KN5A 2F4JA 2XEZA 5H8EA 5EKNA 3POZA 3FLSA 5IISA 3ZUUA 1SZMA 3LJ1A 5AUZA 5AV3A 4F99A 3UZRA 5KNJA 2BPMA 2RGPA 4UBAA 4IVAA 3RAHA 4U3ZA 4FZ6A 3T3UA 5M4UA 4QMZA 3RPSA 3FXXA 4IE9A 3WF6A 4O0SA 2X2KA 2ZM4A 3AC3A 1URCA 3ZYAA 3FQEA 5AV4A 5LQFA 5BX0A 2O8YA 4FSTA 3R8VA 3CY2A 2EWAA 5K4JA 4L6QA 4BI0A 4XLVA 3GEQA 2YCQA 3G9NA 4D5HA 4FTUA 3PXRA 2X9EA 3BEAA 2ITPA 3BPRA 4AXCA 1DI8A 4PPCA 4ITJA 3TZ7A 4D4VA 3CC6A 3KK8A 3ZBXA 1KV2A 4GG5A 3ZXZA 4O91A 3LFCA 4WOVA 4AN2A 1VYWA 4EOPA 2PVMA 4YPSA 4LV7A 1YOMA 2ITWA 3FKNA 4RVKA 2XS0A 4LM5A 2VO3A 4AT4A 3ZZEA 2F2CB 3R9RA 4K18A 4NKAA 5BMSA 2W9FB 1P14A 3C9WA 3I7CA 5AV2A 4BIBA 3FKOA 3DDQA 3O7LB 3R1NA 1NW1A 2XBAA 2ESMA 5J9YA 4L52A 5FBOA 2EB2A 3EFKA 4ID7A 4ZSJA 5BVKA 5AIKA 1KE5A 4D0WA 2RG5A 4B0GA 3VVHA 4M8TA 4RIOA 4IB5A 2W1CA 3BU3A 4BCHA 2VN9A 1IAHA 4AOJA 4ZLOA 4QP2A 2BRNA 3RI1A 3OBJA 3IW8A 3TIZA 3BGQA 1SM2A 3KXHA 1ZMUA 3LFBA 4PDPA 5BVEA 4XV3A 3DV3A 2ZV9A 2XJ1A 3H4JA 5HG5A 3QGWA 1REJA 2KTYA 4C4FA 4FSMA 5HEZA 4EUUA 1Y6BA 4LYNA 3TKUA 3UZPA 5K5XA 1G8KA 3R63A 3QALE 4RIXA 3R71A 4FEXA 3IS5A 4I41A 2YAKA 2Y8OA 4DLJA 2IWIA 4ZOGA 3P7CA 5DI1A 5EYMA 2XK4A 4O7NA 3DJ6A 4OLIA 2H34A 4O7YA 5DWRA 2E9PA 2C3KA 4KKGA 2JEDA 4YSJA 4HGLA 5CY3A 4GG7A 4HOKA 4F70A 4QMWA 4RWIA 2CGWA 4LGHA 4WRSA 3BKBA 3Q3BA 4QNYA 5HIDA 3OOMA 5KX8A 4A9UA 5LVOA 4C34A 4TXCA 2NRUA 4QTAA 2AQXA 4MNEB 4QO9A 4UZDA 2OLCA 5G1XA 4MD8E 3C4WA 4BCIA 1QPDA 2R3RA 5HO7A 2WD1A 4DE4A 3CS9A 4C2VA 3VBTA 5D7VA 1T45A 5HX8A 5C4KA 2WELA 1PY5A 3C4FA 4RVMA 3OEZA 4ZTRA 3ZO3A 1KE8A 2ITXA 3KRXA 2C4GA 2PK9A 2R3LA 4F4PA 1H4LA 2RIOA 1XBBA 4FI1A 3S00A 4IACA 2WMUA 3OOGA 4KINA 4EBVA 3NSZA 1Z9XA 2BIKB 3DB8A 4Y8DA 4E6CA 3IOPA 2CMWA 3Q4UA 4A4LA 3F3TA 3KULB 3PSCA 2I1MA 3EQRA 4L53A 4XG2A 5E8YA 3OT3A 4H05A 4WHZA 3ZLWA 3EN6A 4YZCA 3RHXA 4A7CA 2WFYA 3FZRA 1Q24A 1OIUA 3D2KA 4PPAA 3HGKA 1XBAA 2XK6A 5IPJA 2CGUA 4XLIA 4ZK5A 4BFMA 3MVHA 3UE4A 3DXNA 2DYLA 4WD5A 2VO7A 1YWVA 4JQ7A 5E91A 2JITA 2PTKA 4FKTA 4Y46A 3VS2A 4D4YA 2CKPA 5B2LA 5GZ8A 1O6LA 3QZGA 5T68A 5IQIA 1JLUE 1HCKA 3S4QA 3OHTA 4YSMA 4OAUC 4ZEGA 2XBJA 5I4NA 4Q9SA 2WMQA 4AAYA 4W4WA 4IH8A 4MXZA 5CI7A 2HZ0A 3ZBFA 4AF3A 4ORKA 4L8MA 3UVRA 3DTCA 3VJOA 4RZVA 4M84A 3OEFX 4DH7A 3GCVA 4FK3A 3KK9A 1FINA 2OKRA 3UC3A 3BQRA 2UVZA 1YHWA 5KUPA 5LMBA 2HW7A 5J1VA 1XR1A 2HXQA 3D0EA 4M12A 4NEUA 2BAJA 4AN9A 1PMEA 4IM0A 4X3FC 4MBJA 4D9TA 5GIPE 3DQWA 4FV1A 3K54A 3FXZA 3BYSA 3A4OX 3CKWA 3UG1A 3Q5ZA 5IZFA 3G90X 5E8WA 3Q2MA 3TUCA 4P5QA 5EH0A 4DHIB 5CEPA 5I9ZA 4E4LA 4M69B 1UNGA 5DGZA 4Q5HA 3UMXA 3IW4A 1R1WA 5JFSA 5DYJA 4EORA 3LMHA 3ZO1A 3FE3A 4O0RA 3FWQA 4ACHA 2QG5A 4UWYA 2VD5A 1UV5A 3RK7A 2C1AA 2YCRA 3UOJA 3MH3A 4FZAB 3O8PA 4EWHA 1M14A 5A6NA 2HCKA 4EJNA 4RA4A 2W9ZB 4NW5A 4X2FA 3H3CA 5IH4A 3IQ7A 3N4TA 4APPA 5AAFA 2XJ0A 3NUPA 4JG7A 4U3YA 3EN4A 2W1ZA 4DAWA 3OVVA 4J8MA 3UBDA 4PNIA 4FNWA 3NW6A 3G33A 4Y5HA 4U45A 3AC8A 1ZOHA 4FTAA 4AW0A 1YOJA 5BQ0A 1ERKA 3F82A 3NWWA 3E8EA 2IW8A 5IQEA 4DEHA 4FE2A 4DT8A 1ZYCA 4APCA 4IX6A 2QO2A 1MUOA 4C2WA 5AUTA 4U0IA 4BDFA 1HCLA 1Q41A 3GNIB 1A48A 3F2AA 4WNMA 2GNIA 4UZHA 3R1SA 2WMRA 3PXZA 1CKJA 4WT6A 5AEPA 5IMXA 3OCSA 5CYIA 3NFFB 3VS5A 2YWVA 2YN8A 2Z60A 3TZ8A 1F5QA 3K3IA 3NZ0A 3QLGA 5DMZA 5CLPA 4LUEA 3P4KA 2IJMA 5H8GA 4F63A 3MPTA 2B4SB 4AZEA 3DZOA 2ZV7A 4OAVB 3GCPA 4USDA 4MWIA 3T8OA 3WI6A 5GINE 1ZWSA 4HYIA 5HORA 1L3RE 5AUXA 3QD0A 4BBFA 3OY1A 5AA9A 4JBOA 4CVAA 2JKKA 3LVPA 3LM5A 4O4FA 4QP3A 2PE2A 3ODYX 1XH8A 4ZTQA 4GKIA 2W1HA 3SRVB 3EOCA 3MFTA 3ATTA 4L3LA 3DJ7A 1ZLTA 3HDMA 4OTGA 4RGJA 4XYFA 3R7EA 3PXKA 3BELA 1R39A 4HGTA 5CEOA 2C69A 2UZOA 4QMQA 3FMHA 5IEXA 3FJQE 4YHTA 4I4EA 3WZDA 2QQ7A 5L2QA 4FTKA 1BL6A 3ZFXA 4BY9E 3G0EA 1OKWA 1PMVA 3D15A 4I6BA 4P4CA 2BMCA 3FLWA 5IQDA 1G5SA 5IQGA 1Q8WA 1R78A 3FXWA 4XG6A 3UDSA 4JNWA 4V04A 3RM6A 3FC1X 3MH2A 4AGDA 1Y6AA 3PE1A 1Q3WA 3VS4A 2C47A 1NVRA 3PVBA 3IW6A 3ZC6A 4ZY5A 2HK5A 5EKOA 1Q8TA 3D83A 3KA0A 5KMNA 3AT4A 2CCIA 3UOKA 4E8AA 3KN6A 4RX7A 2VX1A 1CM8A 3E92A 3PRFA 4J97A 3FYKX 4H1JA 5CAQA 3NFGB 2PVRA 3WYYA 5CSXA 4MNEA 2X7FA 4ANBA 4FGRA 4GKHA 1SNXA 4R3CA 3HP5A 4O22A 4OBQA 4YZNA 3KU2A 3FMJA 4M7IA 4ZTHA 2C6DA 4FYOA 1PMNA 2XNNA 4JX3A 5AP2A 4CNHA 5HLWA 1ZYDA 3RNIA 4EHVA 3H9OA 5E4HA 4CZTA 2UUEA 3GU8A 4JX7A 4LV5A 3FQSA 3P86A 3UNZA 4O7SA 4J7BA 4O83A 3BHYA 4MF0A 2IN6A 2RSVA 2A27A 3UYSA 2NPQA 1WFCA 4M66A 5FLFA 3KULA 3ZRKA 2Z8CA 3DY7A 3MESA 2R3KA 3OS3A 2UVXA 3E3BX 1LR4A 2JBPA 3QD2B 2X39A 3Q6WA 2ITOA 3TTIA 1GZNA 2YM3A 2XUUA 3MS9A 1YI6A 4HYSA 5B7VA 5L2WA 4AZWA 3SGCA 1JOWB 5HZNA 2RG6A 4BC6A 2R3NA 2ZDTA 3QTIA 2I0VA 3F69A 1XKKA 5F94A 4EQUA 3EQDA 3ZMMA 1NXKA 4C61A 3A7HA 3AG9A 3PXYA 4FUXA 4DINA 3TMOA 2I0EA 3CQUA 4JDJA 3U8WA 4AE6A 4PL3A 3TNWA 3ENMA 4G9RA 3AC4A 4BB4A 3V04A 5L6PA 3PZHA 3O71A 4G6NA 4RBLA 2ITYA 3QKKA 2QOFA 4YP8A 4HW7A 5M08A 1TQMA 1PXIA 2C3IB 2NO3A 2EVAA 5E90A 4FIFA 5J9LA 2IF8A 5F9EA 1UKIA 3R1YA 4AGUA 5LVLA 5I0BA 3MPMA 4UN0C 3QCXA 4G17A 4IWDA 2X4FA 1CSNA 5J87A 2CLXA 2WTDA 3R8UA 2WQNA 2G01A 3E93A 3WF8A 3D4QA 1H1WA 1OPLA 3CSVA 1ST4A 4BJJB 3VULA 1ATPE 4KS7A 4W4VA 4O27B 4XCUA 5M44A 4ZIMA 4R7IA 4LMNA 4BF2A 4F6WA 3BLHA 4IFGA 1H00A 3RPVA 4AA5A 1UVRA 4M69A 3EWHA 3TWJA 2OFVA 5BUEA 2OJIA 3F61A 3H9FA 5FBNC 5EQPA 4U5JA 3QRIA 2PZ5A 3I5NA 4I6QA 2UW7A 4FVPA 3CJFA 2FO0A 5I9VA 4F7LA 3E8DA 3V8SA 4D4RA 3IKAA 3PYYA 2BDFA 4AW5A 3LMIA 2EB3A 3TTJA 4FX3A 4FKSA 5A4QA 3FMKA 4JOAA 5AMNA 5IA0A 3R0TA 4TTHB 4XV1A 4PDOA 2XK7A 4AN3A 3DBCA 4D1XA 1W82A 3G6GA 5BV3A 3ZH8A 4EK6A 4JJRA 4DG2E 2C0TA 3Q2JA 3WZKA 3ZEWA 3BGZA 3H0ZA 2ZMCA 4GFOA 3GGFA 3QZIA 4IZ7A 4L43A 4RFZA 4I24A 5CU3A 5D12A 4EH7A 4QMLA 4PTEA 3LIJA 2VTHA 4XJ0A 2A0CX 3VS1A 3Q9YA 4PTGA 2GS2A 3R9NA 3TUDA 4RSSA 2OH4A 4F6SA 3QCSA 2YM5A 4CG8A 1ZYJA 2GNHA 3QRJA 3SDJA 4EOKA 1ZY5A 3UNJA 4IZYA 4AZTA 2X2LA 2UZVA 2C0OA 2W1GA 3QD3A 4QD6A 3AC2A 4B7TA 3II5A 3O23A 4UY9A 4ALUA 4FVRA 3TDWA 2GCDA 1UWJA 4HVSA 5GJDA 3ZCLA 5FG8A 4RIWB 4D55A 4IX5A 4R5YA 4U40A 3ZRMA 2RL5A 2VTLA 3O17A 2J2IB 3OTUA 2X1NA 4L44A 3O5AA 2R5TA 3S2PA 5EW3A 4FT7A 2X0PA 4OTHA 4PDSA 4FV2A 4U81A 4QT1A 3UODA 1Q5KA 4KBKA 3QTXA 4HJOA 2WTIA 4P5ZA 5FUTA 1PW2A 5D9HA 3DAEA 2IW9A 4NM3A 1KSWA 4GYIA 4YHFA 2XM9A 5T6KA 3EQBA 1GIJA 3A7JA 4F0IA 3UDTA 4Y95A 3DGKA 4K11A 4II5A 4LOPA 5T3QA 5EI8A 3S95A 4Z7HA 3LFAA 5HE3A 4QMUA 3VONA 3CLYA 3GU4A 3R28A 3A7GA 5AUWA 4D5KA 3UP7A 5LVMA 4QPMA 4PL5A 5AR8A 3CGOA 3O0GA 3COKA 4RC2A 3NUXA 2P2IA 3QZFA 4RIYB 4QDVA 5AX9A 4AT5A 2XK9A 3W1FA 3R83A 4YZ9A 1OKYA 4XRJA 1AD5A 3OWLA 3IGGA 4BDCA 4UMPA 2XF0A 3LHJA 5J5TA 5E8UA 3TL8A 4G5JA 3F5PA 2VTAA 4HCVA 4R1VA 1BI8A 1VR2A 4HVIA 3EQGA 2NRYA 3R73A 4BHNA 3M2WA 5HTIA 2EUFB 4FJVA 4MHAA 1YOLA 3AQVA 5C4LA 3CBLA 4IC8A 4IB3A 1PXLA 4QPAA 2A4LA 3CEKA 3D9VA 3MFUA 5AUUA 4HYHA 1WBWA 4RJ8A 4DFUA 4RVTA 3DAJA 3AMYA 1E1VA 4CEGA 3NUSA 4BI2A 3U4WA 4GJ2A 4K8AA 4O6LA 2Q0BA 2BTRA 2BALA 2VUWA 4GIIA 4Y72A 5ANJA 4F1TA 3Q4TA 2R4BA 4CQGA 4ZJIA 4PMPA 3EIDA 4AFEA 3U6IA 2VWBA 3R7OA 3MFRA 2HXLA 4IAFA 1ZZLA 4FKVA 2WAJA 5IH5A 3F3ZA 3A4PA 4NJ3A 2CNVA 4FMQA 2E9NA 4IM2A 3THBA 4FEQA 4TNBA 2BFXA 3F9NA 3VRYA 5E92A 4BBEA 3HA6A 3C4ZA 5AJQA 4ARKA 3LXNA 3VW8A 4RJ5A 4C4GA 1SMHA 4FL3A 2BR1A 4NH1A 2R3PA 1I44A 4QYFA 3M11A 4RWKA 4GU9A 4FTJA 3R7VA 3H10A 3OXTA 3DCVA 4MXOA 3QQHA 4BTJA 3DLZA 2UZTA 1W98A 3BRBA 3HVCA 4UXLA 5HQ0A 5J5SA 5K3YA 4CMUA 4A4OA 4ZS4A 3G15A 3QTZA 4J98A 5L2TA 4JIAA 5L8KA 5CF5A 3Q53A 3UYTA 2QO7A 4BJJA 4NL0A 4FGBA 2PE1A 1SYKA 4AW1A 3UC4A 2R3IA 4O4DA 3EH9A 4DH3A 3MN3A 4F1OA 2ZV8A 4DGGA 4BYJA 5L2IA 4TT7A 4HNIA 3W0OA 3VS3A 3AD5A 4CZUA 4RIXB 3BX5A 3CY3A 4LI5A 5HCZA 2RFSA 5FP6A 3L8XA 4QQCA 3MPAA 3I60A 5FEDA 3WBLA 3VQHA 3L9NA 3EZVA 4BCGA 1OUKA 2Y0AA 4MAOA 5TT7A 1VJYA 4KIKA 4FEVA 3BEGA 1XQZA 4HVGA 1OL2A 5AX3A 2OZOA 2CKOA 3VBYA 4DFXE 3Q04A 5KMMA 2HY81 4OBOA 3GQLA 4RA5A 1W2CA 4J1RA 1TZDA 3ZO4A 2H6DA 4DTBA 2JDSA 3GC9A 3KRLA 3QQJA 2Y6MA 3MTFA 4C3FA 1YDRE 3P5KA 2XNPA 3RWQA 3ZLYA 3VN9A 3QXOA 3NCZA 3V51A 1XHAA 4I3ZA 1GIHA 4C59A 2RFNA 1RE8A 3MH0A 4FIGA 1IEPA 3DK7A 3VWAA 2RFDA 4BDEA 4BKJA 2E9OA 4HZRA 2WTVA 3ZONA 3FMLA 4Q5EA 2OBJA 4E73A 4O1PA 5F1ZA 4QYYA 3SHEA 3TNHA 2GNLA 5HBHA 3U6JA 4MXCA 4CFWA 5CXHA 2EXCX 5CQUA 1XH6A 1FOTA 2B7AA 4RLKA 5FP5A 3FPQA 2GQRA 4EKLA 3FBVA 4O82A 3NNWA 4EK4A 5AR4A 4YR8A 3KXZA 2V62A 5M4IA 4NJDA 4CXAA 2NNWB 4DITA 1WBTA 4AFJA 4EYMA 4HGEA 1W83A 2C6TA 3JS2A 4DT9A 4IB0A 3FZ1A 2VTNA 1H1QA 2X2MA 2XVDA 3BCEA 4NT4A 5IDPA 2BZKB 4DHJA 2EXEA 3AC5A 2W05A 3PSBA 5HKMA 4ZSAA 5EK7A 3QQLA 4TL0A 2AYPA 4X21A 3R04A 2QURA 2W5AA 3F3VA 4JG8A 1J1CA 2YA9A 3PTGA 3OWPA 3R9DA 3V5TA 2YCFA 3G0FA 2ITNA 3QUDA 2XIZA 3E64A 3Q9WA 5E9EA 5M57A 4FG8A 1YHVA 4L7SA 4N4SA 4FEWA 3P1AA 2ZJWA 3V5LA 4F9AA 2QODA 5M51A 1ZOEA 4CKIA 4J8NA 1VZOA 3QYZA 3U55A 4W4XA 2GFCA 2W4OA 3NYOA 4MXYA 4NSTA 4RIYA 3PWDA 4GS6A 4Z16A 3PIXA 2VTPA 2ZB1A 4FZFB 3ET7A 5EDQA 5JEBA 2JIVA 1OIQA 2YABA 4DCEA 4NM0A 3ML1A 1KUTA 4A9SA 3IONA 5TE0A 2ZDUA 3NVMB 3PIZA 1U54A 4USFA 4L67A 5A46A 3SV0A 5HO6A 2XK3A 3VBVA 4QMTA 2F49A 3DNDA 4KKEA 4O4EA 2WPAA 3IK3A 4BGQA 3F3UA 3HX4A 4Y73A 4I0TA 5EG3A 4CT2A 2W7XA 3MWUA 2YIQA 2BAQA 4QTEA 3UQCA 2UZEA 3R8MA 3LJ2A 1WBOA 3RNYA 3TYKA 3P9JA 4FIJA 1W8CA 1H8FA 2YZAA 2IO6A 3HRFA 2QOQA 4XP0A 5HE2A 2XJ2A 4FL1A 5HIEA 1U46A 5FTQA 4YPDA 5FTOA 3FL5A 3OT8A 4ALVA 1S9JA 4I0RA 4BGGA 5EM7A 4HPUE 3IECA 4EHGA 2A98A 3I4BA 2ERZE 3HAMA 1WBNA 1GJOA 3FLNC 4FTIA 4KABA 1YHSA 3A7IA 4I22A 4YZMA 3C13A 4H1MA 1O6YA 2BUJA 1FMKA 2C6LA 1OPJA 3BYMA 4LV8A 1J1BA 4MH7A 4MYGA 4QYGA 3BLRA 4GK3A 2GDOA 1M52A 2BIYA 5HD7A 3TI1A 4EOQA 4BIDA 3FI3A 4DF3A 1BKXA 4V05A 3GUBA 4ANQA 4YLJA 2QOCA 5H8BA 3W0PA 4NZWB 2B55A 4BDJA 4F7SA 2F7ZE 3NW7A 3SG8A 3C4CA 5CVGA 5J79A 4DFBA 3W0QA 3QL8A 3MVJA 3CPBA 1S9IA 3DOGA 4YJQA 3C4XA 5D41A 1Q4LA 3COMA 2F7EE 3HMMA 3QA0A 1OB3A 3W2PA 4AZVA 2DQ7X 3SOAA 2QD9A 4EOLA 2X0OA 2PUUA 5AV1A 4IEBA 4NTTA 3ORTA 3QTRA 2VGOA 2VO0A 1K2PA 4B4LA 3I6WA 2OF4A 4GU6A 3VIDA 3TXOA 3VS0A 4BZNA 5EM5A 1PXOA 4FEUA 4UB7A 4L3JA 2SRCA 1M7NA 4HGSA 5KBRA 2WQOA 4YJNA 4S34A 2FSLX 2O0UA 3DKGA 1Q3DA 3MGYA 4XS2A 4MUQA 3U51A 2R7BA 5ETCA 4S2ZA 2PMOX 2E9UA 2BZIB 3CKXA 4UALA 4FTRA 4FUYA 2O3PA 4I0SA 1Z57A 1U5QA 2YERA 3NYNA 4I23A 3PJCA 4BWPA 3CQEA 3LXLA 4BRXA 5C8KA 4CCBA 3VUTA 4L9IA 3QYWA 4QP1A 4TKSA 2UW6A 4FA2A 1K3AA 2ZB0A 1H01A 4UYNA 3VUGA 4B8LA 3DXQA 3WE4A 3R7YA 4GV1A 3A62A 3FL4A 3FKLA 4HVDA 4NU1A 2BAKA 3UOLA 4UMTA 2VWIA 3QU0A 4AACA 3SQQA 2OWBA 1YWRA 5AUYA 2WTCA 2XNGA 4I92A 3P79A 3DNEA 4LGDA 1V0PA 5BNJA 2GFSA 2XCHA 2BRGA 2DUVA 3I79A 5GZAA 2VWVA 4O21A 5HCXA 4KA3A 5J7BA 5E8ZA 5ACBC 1UU8A 3NIEA 1H26A 3DJ5A 1Q99A 2F9GA 3F5UA 3OWKA 3IW5A 3L9LA 4AUAA 1PYXA 3LQ8A 4M13A 2W99B 2ZVAA 4L68A 3C0GA 1RW8A 1J3HA 1PXMA 5EYDA 4FT5A 4J99A 3PP1A 5GIOE 4EOMA 5A4TA 3MFSA 4DGOA 2BHEA 4QP9A 2DS1A 5KMJA 4MEDA 4O38A 3QC4A 4AW2A 4D1SA 4UWBA 2XRWA 3ZLSA 4G3GA 4CLJA 4FSYA 4N70A 2C3LA 2H8HA 1XO2B 2IW6A 3FHRA 5EOLA 1XMLA 5IQBA 3PZEA 4RZWA 5AP5A 3QGYA 2B0QA 2GSFA 4FVQA 5DEWA 3COIA 1OKVA 4IDVA 3U6HA 2XM8A 3O2MA 4DLIA 4JAJA 4AA0A 4B8MA 5HG8A 3CIKA 4I5HA 5DEYA 4S33A 4KNBA 2OK1A 4YJOA 5DN3A 3VC4A 2HENA 1OKZA 1BL7A 4QOXA 3P0MA 2WU7A 4QTCA 4HCUA 2UZUE 5DIAA 3FI2A 5DRBA 5AUVA 4BVUA 1H08A 5C03A 5AP7A 2PZRA 4LDTA 4H3QA 2B9IA 4ASZA 4U9AA 3EQIA 1CKPA 4BDAA 2IVUA 4BCJA 4C33A 1GAGA 1WBSA 2W1DA 4QMSA 3TCPA 3F7ZA 2IVTA 1JSTA 3KIOC 5IQFA 1Q8ZA 3RAIA 1NVQA 2OJGA 3EYHA 3FSFA 5ANKA 3OMVA 3IOKA 4C8BA 4F6UA 5A14A 5CU6A 2CKQA 4D58A 2C6EA 1JKTA 2X8EA 5CQWA 5K0KA 3L8SA 2Y6OA 4IFCA 4IWQA 3P78A 2W5HA 1U59A 4O7VA 4O0XA 2X0QA 4XEYA 2VNYA 4FKJA 2VWUA 4I6FA 4J71A 5I3RA 3RPRA 3BU6A 5HIBA 2ZAZA 3WZUA 1G8AA 3U54A 1RJBA 2OF2A 4FV8A 3TJDA 3HZTA 4LRJA 3QZHA 4I5PA 4P2KA 2VTTA 3MW1A 5KMIA 4I21A 4N57A 5E8XA 1M7QA 3ZDIA 1WVWA 1H28A 3ALOA 2PZPA 1PYEA 2ITTA 4RJ6A 4AS0A 4CRLA 4BTFA 4QP4A 4X0MA 5HOAA 2PSQA 5BVDA 3ZUVA 1PHKA 5ANOA 4O81A 3PA3A 3CTQA 4FIEA 2XYUA 3QTSA 5AR7A 3PUFC 3AOXA 3R1QA 5L2SA 3OROA 3QHWA 3KXMA 1OGYA 2YLFA 1MRYA 4E5AX 3LLAA 3KKVA 4X6RA 3Q9XA 2PVKA 4V0GB 2BZJA 1OPKA 1GNGA 4CMOA 3D5XA 1YQJA 4FV6A 3SAYA 4WNOA 5L6OA 2QNJA 3D7ZA 4OTRA 2PVYA 5JGAA 4EOSA 5JMSA 2B9HA 1DI9A 2WTKB 3EQHA 3E63A 4YJVA 4XP2A 1TQPA 3LCKA 5DT4A 5CF4A 3GBZA 1OBGA 2OFUA 4DC2A 3HV7A 4ENXA 5I9UA 4E4NA 2V22A 3NR9A 4P90A 1OL5A 2WMBA 3HEGA 2YFXA 1JAMA 2OZAB 3FSKA 3FY0A 2HW6A 4R3RA 2YIRA 2W0JA 3Q52A 3Q4CA 3MY1A 2OIQA 4GL9A 4FOCA 5D11A 2H9VA 5KMOA 2I0YA 5FXRA 1WBVA 1VEBA 3SD0A 3SVVA 1MQ4A 1OITA 4QEBA 3QQFA 5C01A 4EI4A 1WCCA 5K0XA 3JY9A 1CMKE 2PVHA 5BYZA 3F5XA 4IVDA 4ZJVA 3AKKA 1Y8GA 2PMIA 3ENHA 1W7HA 3LCSA 3RP9A 3SXRA 4BR3A 3Q60A 3RCDA 4YTIA 4GFMA 4MTAA 5JKGA 1OGUA 2J0KA 2GPHA 4EJ7A 4FSNA 3NDMA 4MX9A 3LFDA 1M17A 4FKOA 4H3PA 3VUIA 1FQ1B 2UW9A 3TZMA 1ZYLA 1DS5A 3PG1A 2I40A 4EC8A 3DBQA 4JDKA 2P33A 3DLSA 2VTIA 5LXMA 5FM2A 3PP0A 3SA0A 5DPVA 5ETAA 3ACKA 4J53A 5EHOA 1ZZ2A 4JR3A 4WUAA 3ZU7A 1ZOGA 2E9VA 4C36A 1AGWA 1IG1A 2QONA 4IW0A 1H1PA 4FSZA 4YBJA 4NW6A 3R9OA 1JQHA 3AGMA 2JKQA 2C6IA 1Y57A 4K6ZA 1WBPA 5K5NA 2XKFA 5E8SA 1J7LA 1NT2A 4IQ6A 2JKMA 4KIQA 5AR5A 2F57A 2YM6A 3KB7A 4ZS0A 3HV5A 3ID6C 4UXQA 5KMKA 4YO6A 1PXPA 4LRKA 4MBIA 4DFYA 3RPYA 3QA8A 1FGKA 3LXKA 3Q6UA 3LFNA 4GMYA 3A61A 3VS6A 1PF8A 4D0XA 3ORPA 4XHKB 2FSOX 3BZ3A 2BKZA 1OIRA 2I7QA 4IAZA 3TG1A 2B9JA 4PNKA 4TY1A 2HWPA 2UV2A 2XRUA 5DR2A 4JAIA 2Y7JA 3MVLA 3LCOA 2XKEA 5HLPA 5CVFA 4QYEA 4A9YA 4QMXA 4O1OA 4WBBB 3T9TA 3AXWA 5BYLA 2UW3A 1YXXA 4FV7A 5CNOA 5HTBA 4K1BA 4G9CA 3EN9A 2ETKA 3PVWA 5HG9A 5HO8A 2OI4X 4ZSGA 1UA2A 1H0WA 3O8UA 5M56A 1JKSA 4C58A 3BIZA 4A9TA 4IM3A 3N4VA 4LRMA 4RMZA 1O9UA 3RVGA 3QX2A 4ANSA 5EFQA 1B38A 3LFFA 3MH1A 1APME 4MK0A 3FEGA 3QQUA 4YJSA 3UGCA 1XH4A 2YITA 3VBQA 3NVKI 1G8JA 3P23A 4G5PA 3G51A 2YHVA 3EJ1A 2CPKE 2QR8A 3PIYA 4FT0A 2I6LA 2YDIA 4I6LA 4GVAA 4FTTA 5AM6A 4JQEA 4YZBA 2FSTX 3H0YA 1FBNA 1IASA 3OP5A 3E3PA 4FV4A 3TNQB 4X2GA 1P2AA