1GNGA

Glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
349
structure length
348
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title The Structure of Phosphorylated Gsk-3Beta Complexed with a Peptide, Frattide, that Inhibits Beta-Catenin Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 348
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gngA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gngA01
4ZZOA 5AP7A 3E63A 3ZRLA 4F9BA 3P7AA 1ZYSA 1UNGA 2BCJA 4H3BA 3FKOA 3QLGA 3MFSA 3SRVA 3RBWA 3QD2B 3G33A 4M66A 3DZOA 4EJNA 2CGWA 3Q9XA 5M56A 3FYJX 3FPQA 4I21A 1YDSE 4MXCA 4L43A 3GCSA 4FTQA 1A9UA 4OLIA 1TQPA 2VAGA 1F3MC 4RSSA 5EM5A 2IZUA 4ITIA 3FC2A 5AA8A 4QP2A 5I9ZA 4IVBA 1IA8A 4QMSA 3UG2A 4JNWA 3JS2A 4AZTA 2VWWA 4USDA 2CDZA 1CKJA 5AUZA 1GIJA 1RQQA 1TKIA 3CD3A 4LG4A 3GC7A 3LQ5A 1PXLA 1XKKA 3BEGA 4FSMA 4JBPA 4YNEA 4KUJA 3RHXA 5JSMA 4CLIA 4IX3A 3FEGA 3WZKA 4C7TA 3THBA 5IA2A 5FEDA 1R1WA 5IQDA 5H8EA 4NIFA 4M68A 5BVWA 3EWHA 3WZDA 2C6MA 5FG8A 3TJCA 4DEBA 2WAJA 4EHGA 4Z16A 3U51A 2F4JA 3FDNA 3OC1A 2VTTA 3BE9A 4O96A 3BPRA 4M7IA 2XIZA 5A4QA 4GEOA 4ORKA 4D5KA 4I23A 2G2IA 1SYKA 5J8IA 4C61A 4F99A 5KMKA 2J0KA 4AGDA 2JKKA 3OXZA 4UZDA 2GHLA 2G15A 4I5PA 4MQ1A 5IG1A 3AQVA 4OAVB 4PMMA 5DRBA 4GJ2A 4K2RA 5AUVA 3V3VA 4XG6A 4JDKA 4IW0A 5L4QA 2HZ0A 3HA6A 5B7VA 3F66A 2C5YA 4NEUA 4XP2A 4JLCA 4CZTA 4JBVA 5AX3A 4J8MA 5GJDA 4JRVA 5EM7A 1QMZA 3QRUA 2C4GA 3P0MA 5K0KA 3UZTA 3VULA 3L8SA 2RGPA 3MIYA 4NM0A 5HX8A 3KRJA 4EC8A 4ANLA 4OW8A 3BGQA 4PPBA 3T8OA 3HV6A 4II5A 4H39A 5AAEA 4TRLA 1UU9A 4KRDA 4RQVA 2OXDA 3OTVA 5M09A 2CN8A 4ZTNA 2GS2A 2R7BA 4B4LA 1FINA 3V6RA 2ITOA 3TACA 1UKHA 3T9TA 3QXPA 5A46A 4IHPA 2C30A 1NA7A 3EN4A 5EKNA 4I6QA 3D94A 4JDIA 2JGZA 2V5QA 3ORNA 4MEDA 3PG1A 3QC4A 4ASXA 5E4HA 4JT3A 4Q9ZA 3MY0A 3OCTA 2QG5A 3R7EA 2Q0NA 2B53A 3HMNA 4YZBA 4EZ5A 4DCAA 3RK7A 3ZLSA 2WMXA 3LXPA 3FLZA 2VUWA 3KC3A 4M3QA 2GNJA 1JSTA 1TQIA 1QL6A 1WBPA 2QVSE 4AU8A 1H27A 4A4XA 5JGAA 3NGAA 2NRUA 4WO5A 3MBLA 2C1AA 5IPJA 3CTQA 2CNUA 1YRPA 4G9CA 2QURA 3DFAA 4M0ZA 3KXNA 3PJ2A 3WOWA 3EQBA 3FKNA 5A6NA 2PVFA 4K8AA 3GC0A 4G5PA 2W99B 4TT7A 3DKGA 3NRMA 3CY2A 3DZQA 4FSQA 4ZS4A 2VNWA 4WNOA 4APCA 1PMNA 4DLJA 1ATPE 3HRFA 1W84A 4I5CA 3G90X 4I92A 3I0OA 4FKOA 4R3CA 3UVRA 5L2TA 5LVMA 1IASA 3Q60A 3PVBA 2JAVA 4C02A 3GOPA 4BDBA 5HE1A 4YTHA 4Y83A 4E3CA 1GJOA 4N6YA 4O0VA 2VO0A 2B9HA 3F7ZA 3WI6A 3NUXA 4BWPA 1ZARA 4G16A 3ROCA 4AGUA 3QCSA 3KULB 3RMFA 2B9FA 2VWYA 1T45A 2A19B 3R1QA 3I7CA 4DGOA 2OSCA 4Z55A 2WTKC 4RT7A 3I4BA 4C62A 1B38A 4FKJA 2XUUA 4PTCA 4CKJA 2X2MA 5DR9A 4R5YA 3ZEWA 2XK4A 4G6OA 5L2QA 4FL1A 3EKKA 3GU6A 4FT7A 4BN1A 3FMLA 3R6XA 1WCCA 4MNEB 4YJTA 1KUTA 1W0XC 2C6TA 3NNUA 2EB2A 5CSXA 2ZAZA 3JY9A 5A14A 1GOLA 3GC8A 4BTMA 2BDFA 2VTAA 3MH3A 1BYGA 1RJBA 2GNLA 3EQCA 4L3PA 4MNEA 4BCQA 4CKIA 3CQEA 5IA1A 4FZDB 4CQEA 2EVAA 4N70A 2OLCA 2XCHA 1ZYJA 3S2PA 3VBXA 3I60A 2E9NA 3ZCLA 3DBDA 2JIUA 5LARA 4BZDA 3EIDA 1PYXA 3VBVA 3F5XA 1P4FA 3KXGA 2Z7RA 4W8DA 4ALVA 4ANOA 5ANGA 5CEOA 3LFCA 3M2WA 4EZ3A 3QRKA 5L2IA 4YJSA 2AC3A 3DY7A 1ZOHA 2ITQA 4O7TA 4OTGA 2B0QA 3QZGA 4C8BA 2YISA 2VWIA 4PTGA 4BBFA 3TZ9A 4ANMA 2ERZE 3DOGA 4KWPA 4MXYA 5IUHA 3BLQA 3CC6A 2LAVA 2BKZA 3PY3A 2XBAA 3T3UA 2UUEA 3QTWA 2YM3A 1JNKA 1ZMVA 2QG7A 1ZRZA 5FD2A 5GINE 3BIZA 2BTSA 4EORA 4RRVA 4PNKA 3UGCA 3EQPA 2CGUA 3V04A 3KREA 2XJ1A 4O7VA 3TNIA 4E5AX 2IJMA 4FYNA 3QTIA 3QZIA 4IACA 2YLFA 2VWBA 2BZJA 2XK8A 2C0OA 3RPSA 3RWQA 3SXRA 4XG9A 2W7XA 3F2AA 3NAXA 3PE1A 5CSPA 3QCYA 3QQKA 4CYIA 2UVXA 1TQMA 1O6YA 2P4IA 3BE2A 3DU8A 3JPVA 3VUIA 5M55A 3C13A 4UEUA 3P1AA 4F7SA 1JKSA 3O0GA 3H9OA 4JS8A 5CNOA 1NVQA 2PMIA 1K2PA 4NZWB 4ZSLA 4G3CA 5F95A 3D2IA 2CSNA 2W1ZA 2X2KA 3Q9YA 4DGGA 4WOVA 3TZMA 4JQ8A 3PY0A 4J95A 2GTMA 3HP2A 3REPA 4DF3A 3QZFA 5FLFA 2XK9A 2XNGA 4GG7A 4QPSA 1L3RE 1XWSA 1PHKA 2X4ZA 4FK6A 4YBKA 5AIRA 1KE8A 3WZEA 4CFMA 4BIEA 4P7EA 4DEIA 1JKKA 1KWPA 1Q62A 3ZZEA 4EK3A 4UXQA 1Q8YA 3BBWA 5A54A 1Z9XA 5E1SA 2UVZA 4V0GB 5TKDA 4AN9A 1R39A 4FKIA 3ZO4A 4CKRA 2H8HA 3D4QA 2WHBA 1IEPA 4K9YA 2GS7A 2W5HA 4PRJA 1M2QA 2YM5A 4PTEA 3P9JA 2DYLA 1DAYA 4JIAA 3K3JA 3A4OX 5T3QA 4O7RA 5EG3A 3VQUA 3C4EA 4AOIA 3LCTA 4Z9LA 3GU7A 2HW7A 2XIXA 3FL4A 2G2HA 3R04A 4K6ZA 4F63A 2WTVA 5JZNA 3F3VA 3LMIA 3D5UA 3LMGA 4IQ6A 5CNNA 4R7BA 4AOJA 4BBMA 4BIBA 4YSJA 3RPOA 3V5JA 2PZYA 3PTGA 4AOTA 4L9IA 5DT0A 4L67A 4IB0A 3FMNA 2UZOA 2YM7A 5BVNA 3DGKA 4K0YA 3OXTA 5BNJA 3TNHA 2R5TA 3VWAA 3QGYA 4AF3A 3IOKA 3TZ8A 4HNFA 2HZIA 2WMRA 3R1NA 4KIOA 3UPXA 3IS5A 4RBLA 5CVHA 4PV0A 5E8YA 5GZ8A 3UIMA 3K3IA 4EOOA 3PPJA 3EMGA 2FH9A 4ZSJA 2XJ2A 2QR7A 5KMOA 3QXOA 3DBFA 4JBQA 2I1MA 1YDTE 2ZVAA 3CXWA 4BDKA 3FLSA 2RL5A 3HMOA 4QP6A 4UWCA 2WMVA 4FUYA 5H2UA 3W2QA 4JAIA 3RINA 4FEUA 3FZPA 2ITWA 1Q8ZA 4O7WA 5IQGA 1O6LA 1RDQE 4N4SA 2CKPA 4XOZA 5D41A 3ROYA 1PXJA 2AC5A 2BIKB 4FTTA 1U5QA 4IDTA 2VNYA 3RAHA 2XIRA 3ACJA 4G1WA 3HV4A 4I6BA 4FODA 4AACA 1SMHA 3V01A 3PXFA 3VN9A 3UBDA 3UJGA 4YPDA 4D28A 4FNYA 4RIOA 2PVLA 3B2TA 3DNEA 3QGWA 3RAIA 4BVUA 2G9XA 4M97A 1OUKA 2PMNX 5CEPA 4KKGA 4HVDA 1JOWB 1WBNA 4ZLOA 2BFYA 3OP5A 4IDVA 4Y46A 4IZ7A 5BVFA 4EK5A 3N9XA 3QKMA 5E8XA 5HIBA 4U43A 3LFEA 5AAGA 2FSOX 2OXXA 3W33A 5EI2A 4F1TA 2QU5A 3LFBA 3HECA 2O3PA 3GFWA 3HX4A 4IVAA 4QTAA 1DI8A 2WTIA 4OT6A 4DHFA 3V8SA 4OBPA 4M84A 1YOLA 4U97A 2OJJA 3KVWA 1W8CA 4K11A 2WZJA 4MXOA 3RKBA 1IRKA 3IONA 4KD1A 3UNJA 1Q3DA 2C5OA 3QKKA 3E3BX 4HGLA 4O0UA 2IPXA 1QPEA 4FV6A 4AN2A 2WQBA 2XNEA 4AP7A 1BI8A 3H10A 1JWHA 3H0ZA 2YEXA 3FY0A 5DN3A 5KZ0A 5HLWA 2KULA 4L3LA 2UW3A 3TV7A 3QWJA 1CTPE 3L8XA 4IJPA 2GFCA 5EDQA 2PE0A 1VEBA 3NW7A 4JBOA 1OKWA 2YCQA 4GMYA 4MWIA 2CKQA 4YBJA 4E4LA 2FGIA 2WNTA 3NCZA 5LWNA 4F6WA 1YDRE 4WRSA 4QD6A 4NJ3A 4YPSA 3PWYA 5GJFA 4L68A 4BYJA 3FI2A 1YHWA 3G6HA 4RX9A 4L3JA 4YP8A 5IQAA 4BY9E 4ACMA 3D15A 2V0DA 5EOLA 3PFQA 4DGMA 4EH8A 2VTQA 3PYYA 4F0IA 4QMMA 2NO3A 2RFNA 3QD3A 4FIFA 4D5HA 2GS6A 3FL5A 1U59A 3PLAE 2OIBA 4IZ5A 3KK8A 2H96A 2WIPA 4KB8A 2X9FA 4U9AA 1OKYA 5BUIA 5FP5A 4GUEA 4EEVA 5KBQA 3DBQA 1NW1A 3PLSA 2F7XE 5IQFA 3W16A 1SNXA 2DS1A 5HG8A 1XH5A 5KMJA 1UU3A 4TYGA 3U4UA 3QUPA 4YGAA 4PDOA 5CF6A 1XH8A 4C35A 5EI6A 2F49A 4RJ3A 3RP9A 4FG9A 5L6PA 3FHRA 4JX7A 2BAKA 3HYHA 2ZYBA 4HCVA 2ZV2A 4JG8A 5M53A 4A9UA 4RVKA 2B9IA 4FTIA 3F2NA 3KCKA 3TTIA 3R21A 4C3FA 1UU8A 4WNPA 3D14A 3NYVA 4N6ZA 4DA5A 3A7JA 4OR5A 2C3JA 3U6IA 2WTCA 4O0SA 2E2BA 2JBOA 2OJIA 2E9UA 3R7OA 5IQHA 1Q3WA 2H6DA 1R0EA 2Y4PA 3GFEA 2BHHA 4X3FA 3K5VA 2FA2A 4XP3A 4EJ7A 4I5HA 4WG5A 2J90A 2PMLX 4OTDA 1GZOA 4F70A 3EFKA 3QRIA 1IAHA 3EZRA 5LVLA 2VWZA 2XNNA 4CXAA 2OF2A 5JFWA 3EYGA 4AA0A 5LOHA 1H8FA 2X4FA 3OWPA 5EFQA 4RQKA 1R3CA 2C3KA 2F9GA 2R0IA 3CTJA 4TW9A 2WQNA 2CKOA 4EOKA 4JJRA 3UDBA 4DINA 2FVDA 2XNPA 3FUPA 2J0LA 4RVMA 3F82A 3LCSA 3WE4A 4AZFA 3LLAA 1XH9A 2BTRA 3AC8A 2H34A 4E1ZA 3K2LA 4EH9A 3PXYA 4J53A 3VS6A 4TL0A 2R3NA 2BFXA 4FTLA 3NX8A 4M14A 1H0WA 5C27A 1E1VA 3FMMA 4FT3A 3UTOA 3NCGA 3WF8A 3HL7A 3SDJA 5GZAA 2YERA 4RC3A 1PRYA 5IH4A 5F20A 2PUPA 2IVTA 2OU7A 4U42A 4FSRA 3QZHA 2W06A 4CVAA 1IAJA 4U7ZA 5BQ0A 4D1XA 4BYIA 2EWAA 2XA4A 3GVUA 5AP4A 2C0TA 2ITXA 4RIXA 3OHTA 1FMKA 5K3YA 4QMUA 3EL8A 3DJ7A 5H8GA 5C03A 5EW3A 2QKWB 3ZLXA 4HPTE 4NW5A 1EH4A 3PA3A 2YAAA 4E5BA 5JK3A 5CF4A 1G5SA 3FBVA 2X9EA 3I6WA 5ETAA 4E6AA 1Z57A 1WAKA 3QQJA 2GHMA 3POOA 4CMUA 4CLJA 3Q9WA 1W82A 3PJ1A 4BR3A 4C58A 2XKEA 3IDBA 3Q4TA 2F57A 2FSTX 5FTQA 5HTBA 1J7IA 3E7OA 5IUIA 5HCXA 4GU9A 1P2AA 1U54A 2YCFA 4F7LA 4V01A 3FWQA 2XRWA 3O51A 1LPUA 4DEGA 3HNGA 3MTFA 4E6DA 3DV3A 2R7IA 3COKA 3VBTA 1MQ4A 4EUTA 5LMKA 4S33A 1J7LA 3DAJA 2HELA 4HCTA 2UW7A 4RZVA 4RX5A 4KIKB 4TPTA 3TUBA 5GJGA 4DYMA 3ELJA 5CEQA 4BGGA 5L6WL 4HYHA 2OIQA 1YXXA 4MNFA 5CLPA 3WF6A 4D2PA 1R78A 3JUHA 3WF5A 3RPVA 2XB7A 3MFRA 3UP7A 3A2CA 4FKWA 3A7HA 4KIKA 5TO8A 4EK4A 4FZ7A 2O5KA 2X8DA 5FM3A 3SW4A 1Q41A 3B8QA 2BAJA 2ZB0A 3E64A 3VC4A 3VW6A 3W2SA 1QPCA 1R0PA 4MTAA 2X7OA 3DTCA 1PMUA 3FZTA 1MRYA 1OI9A 4QRCA 3R8UA 4DTAA 3UIBA 3VVHA 3FXZA 4XV2A 4O38A 5CASA 4I20A 2QQ7A 4IC7A 5JGBA 3A8WA 2X8EA 3AGMA 3TNWA 4D2TA 2Z7LA 4XEYA 3SLSA 4D9TA 4X3FC 5A4LA 3ANRA 4QMZA 2CN5A 4RJ7A 4D1SA 4E20A 3R30A 4X6RA 2VTNA 4BHZA 4EL9A 4YC8A 2JLDA 3SD0A 1OIUA 5A4TA 3VS4A 3U54A 3MVMA 4LOPA 1KOAA 2QO9A 5IH5A 2OF4A 3P78A 3QKLA 4RIWB 5EQEA 4OGRA 3C0GA 2HAKA 2R2PA 1YXTA 4O0RA 1M52A 4PL5A 2PZ5A 2ITPA 4YJVA 5C9CA 3HV3A 4J71A 2OZAA 3LIJA 3ZBFA 1LR4A 2RF9A 4BTJA 3GCQA 4UWBA 2XH5A 1BMKA 4GT5A 3GU4A 4E6CA 2ETRA 4TYEA 4XHKB 2QOQA 4ITHA 4X0MA 4I3ZA 3S1HA 4LV8A 3U8WA 2OZOA 3W32A 4EYJA 2PVRA 3M42A 4FUXA 5I5ZA 3TDVA 5K9IA 3F6XA 5FXQA 4GKIA 4D55A 4EOPA 4J97A 2XNMA 3TNPC 3PUPA 3QUDA 3LQ3A 2OFVA 1ZMWA 3QU0A 2QONA 4XNEA 3PP1A 3VUHA 3LHJA 4FEQA 2UW4A 1XR1A 4EH3A 3FC1X 4CMOA 2HENA 3NUUA 1V0BA 1XQZA 2R3KA 5E8SA 5C26A 1M14A 5HIEA 3VUKA 4CGAA 1YI4A 3OY1A 3ZFMA 3W55A 1GZKA 1H28A 4PDSA 5CTPA 4BDEA 2IZRA 5AV2A 2W1DA 1A48A 5DLSA 4KS7A 3RGFA 4APPA 4A9RA 4FTNA 3C4ZA 4YJPA 3QYWA 5LXMA 2JAMA 2C0IA 4TYJA 1Q5KA 3WF7A 2G2FA 3CY3A 3JVRA 1PXMA 4GK3A 3ZC5A 1UKIA 3GU5A 3IW7A 4QP9A 4JX3A 5BYYA 4MBIA 4C3PA 5DI1A 4D58A 2YCSA 5HGIA 4ZJIA 5AMNA 3QHWA 4LGGA 5J5TA 3SRVB 2F2CB 4FA2A 4FNXA 3E8EA 5CAVA 5LMKC 3N51A 5JFSA 3F7WA 5ANOA 5EOBA 3R8MA 3W2CA 2YHVA 5BMMA 1KE9A 4UMQA 3UYSA 4I24A 5CANA 2SRCA 5HBHA 3TL8A 3ZM4A 2FSMX 3MTLA 1FVVA 2BAQA 2JFMA 2AYPA 2P55A 2A2AA 5BVDA 2PU8A 1BLXA 3ORMA 4IX6A 3VBWA 4EYMA 4I0SA 2GNGA 2PZPA 4KAOA 2R0UA 3R9DA 4HZRA 3ENMA 5A4EA 3ULIA 1GNGA 1YHSA 3Q53A 4ZSEA 4AW1A 1F0QA 5EM8A 5KHXA 4GK4A 5KUPA 1GY3A 3PZHA 3TV4A 2XVDA 4PL3A 3HV5A 4P5ZA 5FUTA 5AP2A 4NIFB 4EKLA 4LRJA 2NNWB 4GT3A 3OTUA 4RVTA 4A4OA 4BZOA 3CQWA 4BHNA 3TCPA 5K4JA 4QTBA 4NTTA 2I6LA 3WILA 4YUQA 3TKHA 4XCUA 1LUFA 4IE9A 3R7VA 2A27A 3EQHA 5IISA 4FR4A 4IANA 2Y4IC 3ODZX 4GU6A 1OGUA 2WTKB 4EOMA 2X8IA 1Y91A 3F5UA 3MWUA 3PE2A 1VYWA 4L7FA 2ITVA 3UE4A 3NMUF 5K5NA 5B2MA 2JEDA 4GYIA 4OT5A 4Y73A 4A07A 3UVQA 5J9ZA 3O7LB 1H08A 5I3OA 3R1SA 5EYDA 2GSFA 2UW0A 3O7LD 4DFYA 4R3PA 2ZB1A 2JDVA 2VO3A 4LGHA 3C9WA 4OBOA 3NUSA 4FTJA 4MAOA 4BICA 2BUJA 4E6QA 3R00A 4OTFA 3R7IA 5IDNA 3V8TA 4PDYA 5DHJA 4K18A 4LUDA 4AXAA 3GU8A 2FUMA 5HD7A 3TV6A 5LJJA 3Q5IA 3GENA 4G17A 1V0PA 1LP4A 1ZY4A 2AUHA 4TWCA 2W1IA 3DTWA 2ESMA 4Q9SA 2I7QA 3RCJA 3E8CA 1PW2A 5M08A 4NM5A 3BYVA 3GB2A 4MH7A 2HYYA 1DAWA 3HLLA 1RE8A 3O8TA 3L8PA 5IA5A 4IZAA 5HLPA 5CQWA 3S4QA 3OMVA 2Z7SA 3OWJA 2QLQA 4RG0A 3QTXA 4MKCA 4ID7A 3EZVA 4MQ2A 5CU2A 5FWKK 1BUHA 2QNJA 4NKAA 3RVGA 4QMPA 4M15A 3TXOA 3KA0A 3ZYAA 3TDWA 1B39A 1MQBA 4DTBA 2O0UA 3P5KA 4C0TA 4IAFA 5CVFA 2J0JA 2OW3A 3QF9A 4BTFA 2ZDTA 2PL0A 2VX1A 2R3GA 4GKHA 4O7NA 2R9SA 4WUNA 2C5XA 3CD8A 2HOGA 2WOUA 5ETCA 4YLJA 3UQGA 5JFXA 5JQ5A 1Y6BA 1M2PA 4FV8A 4TN6A 4MXXA 4HVHA 4DH8A 4R7IA 3C1XA 2J9MA 2GTNA 4FE2A 5CU0A 3SV0A 1YQJA 4HOKA 3PRIA 4R3RA 5EHLA 3A4PA 3FHIA 3SA0A 3VS2A 4QQTA 4UBAA 1PYEA 2OWBA 2DUVA 4CSVA 4S32A 2R3PA 3UOHA 3KXHA 3ZXZA 3SAYA 4AZEA 4EWQA 3VS0A 1XHAA 3V6SA 2PSQA 3NYXA 2CPKE 4GS6A 2Y6MA 1E1XA 1PF8A 1OM1A 4OTHA 2H9VA 3MH2A 2YWPA 4YZ9A 3TKUA 5LVNA 4G2FA 5DNRA 3R2BA 3V51A 3IG7A 4ANNA 1FPUA 4ASDA 3N4VA 2C6IA 4HYUA 4XMOA 4W4YA 4NUSA 5FEEA 3AGLA 4AGCA 3VIDA 3QQUA 5CENA 2WTJA 5D11A 2OICA 3EN6A 5DIAA 5IKWA 3HA8A 4XX9A 3D0EA 3UNZA 3HRBA 2UZUE 4UMUA 2OJ9A 3ALOA 3I6UA 2UW5A 3KMUA 5JQ8A 1PKGA 3GC9A 4FV5A 3G0EA 4NW6A 5CEKA 3QTRA 4FG8A 4HCUA 3HP5A 2YJRA 4CNHA 4MHAA 2YABA 3ENHA 4DH7A 3CR0A 3EQIA 4BRXA 2HZNA 3R7UA 4BDJA 3DQXA 3ORIA 1URCA 2YIWA 4BDCA 2I0HA 4A4LA 5ANEA 5DR6A 1AD5A 1OECA 1JPAA 3P79A 5J79A 3ZM9A 3LXLA 5EQPA 1ZZ2A 4KNBA 4O81A 3RZFA 4ZK5A 3IPHA 2I0VA 5IU2A 4AW5A 4BZNA 3II5A 4C4FA 2ZDUA 4CTBA 4PF4A 4USFA 2XZSA 4F9WA 4ASEA 4LL0A 3HUCA 4ZP5A 3FMJA 3RK9A 5IA4A 4O83A 2VU3A 4MCVA 4XJ0A 4U5JA 2Z8CA 2RSVA 4S30A 2VTHA 3F88A 3R0TA 3C5IA 5ANKA 5A9UA 3Q9ZA 3F9NA 2B1PA 4HGEA 2ERKA 3AD5A 5FGKA 1REJA 3BHVA 3E92A 1OUYA 4O84A 1NT2A 4PMSA 2JDTA 4RC4A 3FI8A 2RKUA 5E8WA 2CGXA 2V62A 4JOAA 3GCPA 4KIPA 4OTQA 3QFVA 5DMZA 4DN5A 3FKLA 4EOIA 3BGPA 4F09A 5HNGA 1GIHA 4UYAA 3B2WA 4NSTA 4XLIA 5HIDA 2YDKA 2WTWA 4PY1A 4FZAB 4EK8A 4NL0A 3QTQA 4EH6A 4YO4A 5FDXA 3PSCA 1GZ8A 5AX9A 4IWDA 4RJ6A 4ONAA 3QC9A 4AG8A 1XH7A 5JEBA 3DKOA 2C5NA 5EK7A 2CNVA 2Y0AA 1CKPA 2ITTA 5HE3A 4F7NA 4KS8A 4BDIA 4AZSA 3QA8A 1UWJA 3UQFA 2B54A 3DXQA 5IQCA 4QP1A 4JXFA 4USEA 3Q6UA 3G0FA 3DB8A 1J91A 2BDJA 3A7IA 3BZ3A 4OTPA 5EI8A 3ZRMA 4F9YA 5HO7A 3QD0A 4W9WA 3SOCA 1YOJA 4GT4A 4YSMA 2VV9A 5AEPA 4YJOA 3MVJA 2IO6A 4QYGA 1ZOGA 2NPQA 1J1BA 4ZOGA 1SVEA 3BYSA 3PSBA 5HE2A 1OL6A 4TNBA 2XYNA 5IQEA 4ANSA 4RWKA 4GW8A 3E7VA 3WIGA 3PDTA 1ZLTA 4PQNA 3ZU7A 3UIUA 1YW2A 3COMA 3VRYA 5AWMA 1MUOA 2UZBA 2V7OA 1Q61A 2WXVA 4BCFA 3TTJA 1NY3A 1H00A 1PY5A 4IXPA 4FSTA 4QNAA 3RAKA 2QOIA 3D83A 3V8WA 5CI7A 4YZMA 4O1OA 3CKWA 4D2WA 4V04A 4X2NA 4ZTSA 2WMBA 2YM8A 4E7WA 3Q3BA 4ZTRA 1KOBA 3LCKA 4EHZA 5DRDA 3I81A 4GRBA 4IAZA 4L45A 4U81A 3V5LA 3W8LA 3CEKA 4E8AA 2E9VA 5J5SA 4KA3A 4GIHA 4F08A 3LKMA 5CI6A 4I6HA 4I1ZA 4RZWA 4ZMFA 4R78A 4ANBA 5E8VA 5M44A 2VO7A 3F3WA 4X7QA 2EUFB 3OVVA 5GIPE 3IECA 2WQEA 5CZIA 2WO6A 4TYHA 3P7CA 4O7YA 2GNIA 4QTCA 4X2FA 3JXWA 1JSUA 2JFLA 1UA2A 3ZONA 5IDPA 5LMBA 2VTLA 3HAMA 5EQYA 4U45A 4G3EA 2B55A 3MVHA 4FV4A 3ZEPA 5HNIX 5CSHA 3VUTA 2BPMA 4N0SA 1H1PA 4HJOA 3UQCA 4XG2A 3MH0A 3LFSA 3MV5A 2BRHA 1WBWA 2FYSA 2YITA 2WTDA 3P7BA 3CGOA 4QTDA 4RFMA 5H9BA 3QTSA 3TM0A 3KRLA 4GVAA 1FGIA 4PNIA 4CV8A 3CIKA 2P3GX 2ITZA 1Y57A 1K3AA 2RFDA 3GEQA 5CYIA 5HD4A 3S00A 3NVMB 3R02A 2B7AA 3ERKA 2ETKA 2QO2A 2Y6OA 5DGZA 5ETFA 3UO6A 4GH2A 2VTPA 4WRGA 4AUAA 2GQRA 1URWA 5KO1A 4HVGA 1P4OA 2C3IB 4QP4A 1CDKA 1K9AA 3F5GA 4O2ZA 3R2YA 3ZHPC 3RNIA 4KKHA 2W05A 5J1VA 4FGRA 4BDAA 4C33A 1M7NA 3MA3A 4PP7A 3RK5A 3C4WA 3LCDA 4CG8A 5C01A 3OFMA 3R83A 3MESA 3KRRA 4YZDA 4WBOA 4XG3A 2ZJWA 3ZUVA 1GAGA 4EOJA 1G3NA 2P2IA 3SQQA 3PXZA 2QI8A 4F9AA 1E9HA 2BALA 2BR1A 3BYMA 2XCKA 3CLYA 4HGSA 4XV1A 3SG8A 1VZOA 3O23A 3CCNA 3VF9A 4IWPA 2RG6A 5AP1A 3DAEA 3NNXA 4RA4A 2CCIA 3OWLA 4MBLA 3PJCA 5CS6A 3R8PA 4J8NA 3W2OA 3AD4A 2YDIA 3D9VA 5BYZA 5LQFA 4GG5A 2Y9QA 3NYNA 4Q5HA 1KE5A 4Y5QA 3BU5A 3HEGA 3KXXA 2XMYA 3A8XA 2UZWE 4PMPA 2GDOA 2RFSA 5DT3A 4BGQA 3KFAA 4GIIA 1Q99A 2WFYA 1MP8A 3O71A 4TY1A 5HOAA 2QO7A 1YKRA 3ZS5A 3U55A 3KXMA 1YXSA 1PKDA 3FXXA 2EU9A 4ZXTA 2JDOA 1UVRA 4EBWA 3E88A 4RLLA 3RJCA 4IVCA 3HRCA 1OITA 5E1EA 5AUXA 1YWRA 4EH2A 4NT4A 1ZXEA 4NKSA 1LEZA 4B7TA 2VO6A 4G5JA 1PMEA 3R01A 4J1RA 3PSDA 4DBNA 4IH8A 4Y95A 5DOSA 3QX2A 3O8PA 4IB5A 3OEFX 3UODA 5BVKA 4EOLA 1MRUA 2QU6A 3BLHA 3H9FA 2X0GA 4NTSA 5ANIA 3TJDA 1W98A 4L6QA 3GOKA 1BI7A 4QYFA 3LFNA 4KIQA 4KRCA 4L7SA 4M69A 5JFVA 1UWHA 3OEZA 2BRBA 3UG1A 1V1KA 2P0CA 1H4LA 3DKFA 4EQMA 5AV4A 5M51A 2W17A 3LZBA 4AT4A 4FKUA 4MX9A 3ACKA 2C6EA 4HYIA 4H1JA 2WQOA 2YJSA 4JQ7A 3EQGA 5D7VA 1OBDA 3BHTA 1WZYA 3OCSA 4YZNA 4CFVA 3AT3A 3BWJA 4YJQA 3KMMA 3OCGA 2VWXA 3O8UA 2QCSA 5CEMA 3C4FA 2UW9A 5I9UA 4WD5A 5HLNA 4DG3E 2OO8X 5F94A 2C68A 4W4WA 4O22A 3VJOA 5DR2A 4YHJA 4LL5A 5C8MA 4OTRA 4CRLA 4ZY5A 2VGPA 3QA0A 2W1GA 4BKJA 2R3RA 4FIJA 3DBCA 3A60A 3COHA 3VQHA 5LCJA 4D4SA 2XKCA 4TZRA 3VS5A 3PVWA 4X3FB 3HMPA 1SVHA 2QHNA 4ACCA 3FI3A 1SM2A 4IAYA 2WD1A 3TG1A 1OBGA 3C50A 3O2MA 4IBMA 3I79A 3UYTA 4BWKA 4C2WA 5M4IA 3ULZA 4EH7A 2BILB 4TTHB 4DH1A 4E73A 4CG9A 3D5WA 3IGOA 2PVNA 3NNWA 3PXRA 3QQGA 4WA9A 5TF9A 5AIKA 2W4KA 3OOGA 1DS5A 1P5EA 5CF5A 4ZS0A 4QMVA 3AC4A 3M11A 5AJQA 4YU2A 2BVAA 4IZYA 3GBZA 5FBOA 1S9JA 2XRUA 2YA9A 5AADA 2XM8A 2NP8A 4AW2A 4FC0A 2YIXA 4WNMA 4MVFA 3TZ7A 3TNQB 5JH6A 3UZRA 5KBRA 4ZJVA 5IQIA 4IX4A 5H3QA 4AT5A 4CEGA 4MWHA 4M0YA 4ZLZA 3FV8A 4FV7A 4R77A 4ZEGA 4UMPA 4FI1A 5AA9A 3EQRA 4FT9A 5KMNA 2UW6A 5AFVA 4WT6A 1J7UA 2PWLA 4U41A 5H8BA 3LPBA 4CT1A 3TUCA 4OTWA 4CFNA 3OUKA 1OKZA 2WQMA 5C4KA 4LM5A 4V05A 1XJDA 2YN8A 3BEAA 5FXRA 4YJNA 2PPQA 1WVWA 4RIXB 4C4JA 3LJ0A 4ZTHA 3R8ZA 5C8KA 3OOMA 2CJMA 2YDJA 5B2LA 3WE8A 2PZIA 3FMHA 4FKGA 2QOBA 3Q5ZA 2BZHB 3WARA 4AZVA 4NM7A 4YJRA 2I0YA 4BCJA 1B6CB 4BTKA 4XV9A 4C34A 4YTFA 4O1PA 3MJ1A 2VD5A 4O7ZA 5DEWA 2BMCA 3DFCB 1J3HA 2BIYA 2GPHA 4X2JA 5FBNC 2X81A 4QT1A 2O8YA 4Y72A 1U54B 3SHEA 3LFAA 3NUPA 4BB4A 4YLKA 1HCKA 4KINA 3S0OA 2ETMA 3VHEA 2ACXA 5M4CA 4CZUA 5KNJA 4IADA 3UOLA 4U0IA 4IAIA 3GGFA 3QQLA 4AT3A 4MXZA 4DAWA 2VTRA 1F5QA 3FQEA 1OZ1A 3BU3A 5J95A 5M06A 3QBNA 3U87A 2WIHA 5HBEA 2R3OA 5HKMA 3CBLA 3W18A 3ZLYA 3PZEA 2ZV7A 5KKRC 3VF8A 4F1MA 3FLWA 4JG6A 4HVIA 5ANJA 4EQCA 4DFNA 4MBJA 3VW8A 5I3RA 4TXCA 1FVRA 3W8QA 5LVPA 2UZDA 4O82A 3GXLA 4UN0C 3P86A 4FIEA 3ORZA 5ACKA 3NSZA 5AR7A 3N4UA 2OH4A 3UP2A 4WBBB 3Q4ZA 2X7FA 5HI2A 4GYGA 3BU6A 4EKKA 4UV0A 5CX9A 4K1BA 4E4MA 3CE3A 5JGDA 2XK7A 2ONLA 2XM9A 3MJ2A 4G3GA 5HNBA 4C57A 4I0RA 3OBGA 3Q32A 4JVGA 3ID6C 1YXVA 3AT4A 1M2RA 2Y4IB 1J1CA 4FTRA 5CSWA 4QMQA 2VWVA 3BQRA 4JG7A 2R3FA 4G3DA 4HPUE 3VS1A 3W10A 1OL7A 4XOYA 3NS9A 4WUAA 4D1ZA 4YMJA 1H1RA 2OZAB 4CFFA 2XKDA 3FSFA 2HIWA 3LW0A 1H1QA 5EHYA 4FEWA 2PHKA 3KGAA 3LQ8A 4OUCA 3BCEA 4RWJA 3DB6A 2EB3A 3LFQA 1H01A 4FVPA 4F1OA 5KX8A 5DG5A 4M8TA 4IJ9A 5HG7A 3RZBA 4CRSA 5EYMA 3CS9A 4QMOA 4I41A 5FEQA 4A9TA 5J7HA 4B99A 3I7BA 2WU7A 4PL4A 3L1SA 1OIQA 5B2KA 1V0OA 4Q2AA 4FTUA 3KVXA 3IW8A 4I94A 3KQ7A 5A6OA 2I40A 2OK1A 1I44A 2W1EA 2HXQA 2OIDA 3FQHA 4JR3A 4JIKA 3ZBXA 5CEIA 3JR1A 4AQCA 3NAYA 5HVKA 4FT0A 4KKEA 3BQCA 5G6VA 2UZVA 4B0GA 4FF8A 4RIYA 4JAJA 4ZMEA 4YZCA 2CMWA 1X8BA 3ZMMA 3OBJA 4D4RA 4YTIA 3ORLA 3MW1A 3QX4A 1XH6A 5CT7A 2PULA 5IEVA 4P90A 3WZUA 5LVOA 5IUGA 2IWIA 3BHUA 4NU1A 3QTZA 4U79A 2HZ4A 2JITA 3QQHA 2JKQA 3BYOA 4BL1A 4C38A 2VTJA 1PMVA 3ATTA 4K33A 3DCVA 2F7EE 3DJ5A 4NFNA 3QUEA 2RG5A 3NIEA 1G8AA 3QCXA 2WGJA 2HXLA 2ZMCA 2UZTA 4GJ3A 4D0WA 5HICA 2BRNA 4FZ6A 3UNKA 2W1CA 4R6VA 3LAUA 4UB7A 5ITAA 2BZKB 3O50A 4ZLYA 2R4BA 5BVEA 3DK6A 3DQWA 1UU7A 3LCOA 3HMMA 2UVYA 2VTMA 3MSSA 5AP5A 4YC3A 2WMQA 4A06A 4B8MA 2YM4A 2YZAA 5HESA 5BMSA 4XLVA 4AZWA 2YIQA 3E3PA 3FPMA 3HUBA 4BF2A 4FSYA 5GIOE 3G9NA 3BHHA 4P2KA 3ZDIA 2XF0A 3R22A 5HE0A 3ZXTA 4BCGA 4C3RA 3UMWA 3R28A 2R3MA 4FTOA 4WIHA 1ZWSA 3C4CA 4RVLA 3FJQE 2RFEA 5M57A 3NW6A 2XK3A 5LCKA 4AGWA 4AWIA 5IMEA 2YZLA 4ACDA 4A7CA 4LYNA 2R3HA 4CFWA 3QYZA 4FNWA 4X21A 3BYUA 3NUNA 4BI1A 3FMKA 3COIA 2ONLC 4FV0A 5IQBA 4IM0A 3KN5A 4FTMA 1PXOA 4G9RA 3SW7A 3IK3A 3IO7A 4XG8A 2PMOX 2CGVA 3EFWA 3EN9A 4DGNA 3DBEA 2VN9A 3UC3A 5TE0A 4ZZNA 4C4HA 1PXIA 5I0BA 2J5FA 4I0TA 4H3QA 3C51A 3MPMA 1KSWA 2ZV9A 3CGFA 1PXKA 4U40A 5AUTA 3VUDA 4J52A 3VS3A 4RPVA 3NPCA 3QRTA 2QOKA 4D2SA 5C1QB 3IW5A 1Q8TA 3H3CA 1NXKA 4KSQA 4LV5A 2XEZA 5IEYA 3EFJA 5CVGA 2YM6A 3V5TA 1FOTA 3KKVA 4NH1A 2UZLA 1Y6AA 3EQFA 4GK2A 2Q83A 1UNLA 2EXEA 3TN8A 3C5UA 3KXZA 5L8JA 4AFJA 4EWHA 5L8KA 4H05A 2Z60A 5HVYA 3WIKA 1VR2A 2BDWA 4QPMA 5DEYA 4QQ5A 4EOQA 5D1JA 1XBCA 2QR8A 3D5XA 5AP3A 4QMXA 4I4FA 5CF8A 3HGKA 4B6LA 4RLKA 2W1FA 4ZAUA 1XBBA 2BRMA 4XS2A 5BX0A 1Y8YA 3TUDA 4W4VA 3P4KA 5CAUA 2WMUA 4E26A 5JZJA 3UC4A 2QD9A 3PPZA 5JRSA 3UZPA 3GQIA 5AAFA 4E4XA 3QTUA 4TNDA 2QOCA 3AMYA 1JSVA 1FGKA 2OJFE 4FG7A 4IB3A 4X6QC 2IVSA 3SC1A 4XRJA 2ZM3A 2W9ZB 3RCDA 3UPZA 4FOBA 3E62A 4M67A 1RW8A 3ORKA 2PE1A 2B52A 4Q5EA 1H1WA 3S95A 3WF9A 3TI1A 2W5BA 2UZEA 4BIDA 3ZO3A 3ZSHA 2C5VA 4UMRA 4DH5A 3OD6X 3DXNA 3Q6WA 4FV3A 3E93A 2IZSA 4WHZA 2J5EA 1GIIA 3AC1A 4DT8A 4U8ZA 4BBEA 3Q2MA 3HKOA 2HW6A 2HK5A 2XK6A 2OBJA 4O6LA 5CY3A 5B0XA 5CXZA 3CJFA 4UMTA 5EM6A 4DE4A 4XBUA 3KF7A 4TKSA 1H25A 1NVRA 4PMTA 5AP0A 5HHWA 4EC9A 2XP2A 4IMYA 5LMAA 4F4PA 2XIYA 3CPCA 4FKSA 4X2KA 3KU2A 3NUYA 3UO4A 4F64A 2O63A 1YWNA 4Z7HA 3NZ0A 2HY0A 2VX0A 3AG9A 2CKEA 4H36A 4BWXA 3Q2JA 4GL9A 5M4UA 3A61A 4BCMA 3ZOSA 1KE7A 4DH3A 5HVJA 1YI6A 5TOZA 4AA4A 1GZNA 2IVUA 2W5AA 3LJ2A 4FSUA 3AOXA 5CAQA 4G31A 5IZFA 3PJ8A 4KBKA 3L8VA 3PIXA 4G3FA 4XV3A 1T46A 3HZTA 3KMWA 4EH5A 5I9VA 5A4CA 4JI9A 4O91A 5CSVA 4QP8A 3U6HA 4YR8A 4XYFA 4RJ4A 5CU3A 2BRGA 3I5ZA 5EKOA 3MA6A 3PIZA 4UXLA 2HCKA 5HTCA 4KBAA 4L01A 3DNDA 4LMUA 4YC6A 3U9CA 4G34A 5F1ZA 5IF1A 4XH6A 3Q4CA 2ZM4A 3ZFYA 5HG5A 2BKKA 4DEAA 4JR7A 2OKRA 3OUNB 2ZV8A 3EB0A 3OT8A 4GFOA 4DC2A 4BGHA 2X1NA 2XS0A 2GU8A 4GFGA 5HO8A 4IEBA 3ODYX 2QKRA 3PJ3A 4D2RA 1YVJA 2BROA 2REIA 4QO9A 4E4NA 5FTGA 3QRJA 5TT7A 3RM6A 2C69A 2DQ7X 3AD6A 4R7HA 4F0GA 1BL7A 1VYZA 3QL8A 3QQFA 4NCTA 1OL2A 4FKRA 1WFCA 3C0IA 3OWKA 4IM2A 3ZDUA 3A7FA 2CCHA 4FX3A 2WMWA 4LRMA 3MFTA 4YLLA 4WSQA 3RPRA 2JDSA 2V22A 2J4ZA 3H30A 5EYCA 4BCNA 3LMHA 5M4FA 3KY2A 4O27B 3OF0A 3MFUA 4W4XA 1Q8UA 3BX5A 2XNOA 2VGOA 1OPLA 3F3UA 3MYGA 3PIYA 4CZYB 3OCBA 2PUUA 3C7QA 2XEYA 3OT3A 3OW4A 3VS7A 4CFUA 1U4DA 3NW5A 4M12A 4TWOA 3Q4UA 4A9YA 2OH0E 4FVRA 2PE2A 4KBCA 2CHLA 3G2FA 4J98A 4NFMA 3RPYA 2YIYA 3KULA 5D9HA 4FNZA 3FZ1A 4FICA 2O64A 3DPKA 2PY3A 3O96A 4HNIA 3VRZA 2EXMA 3U6JA 3BV2A 3A62A 5DA3A 1WBOA 4TYIA 1PJKA 1U5RA 2X2LA 5DH3A 2C47A 1NVSA 4FEVA 2WB8A 1OPKA 2J6MA 2VX3A 3GCUA 1OIRA 3BWFA 4WG3A 1P14A 2PK9A 1Q24A 4C2VA 3WZJA 4DG2E 3HMIA 1OL1A 2I0EA 5EW8A 3FZSA 4MD9E 2XIKA 3I1AA 4EONA 4FYOA 5CXHA 3OG7A 4PPCA 2P33A 2X6EA 3A7GA 4CCUA 5L8LA 3H9RA 2IVVA 4FV2A 3F5PA 3ZZWA 4QQCA 3DS6A 4K77A 3L9PA 3F3TA 4DEDA 3EN5A 5KMIA 1HCLA 3R7GA 5KZIA 4I22A 3DK3A 1AGWA 4RGJA 4ZSAA 1OB3A 1WBTA 4JRNA 2QLUA 5J9LA 4HVSA 5IH6A 2PVJA 4R5SA 4FIGA 4EOSA 4O0XA 4WNKA 5JT2A 1AQ1A 3FY2A 4QMTA 5D10A 3R9OA 3KL8A 2EXCX 1CM8A 5T6KA 2PTKA 5D12A 4RWLA 5L2SA 5C4LA 2R3IA 3SXFA 5KCVA 5DVRA 2YCRA 4ERWA 4ENXA 3MH1A 3IKAA 1XBAA 2ZMDA 4TWPA 4C59A 3T3VA 5K4IA 2QC6A 2QOOA 4W8EA 5FTOA 3LM5A 2JBPA 4F7JA 5JN2A 4FZFB 4RFYA 5CU6A 3DKCA 4L53A 3AXWA 2BHEA 4ALUA 4IAKA 3PXQA 4IWQA 5CU4A 3VUGA 3FQSA 4BCOA 4D9UA 3VBQA 3O17A 3F69A 4MF1A 4BCPA 5EDPA 4E5WA 2R3JA 4CT2A 4MYGA 3DLSA 3G9LX 4QYEA 4N57A 1IG1A 4QYYA 4NK9A 3WBLA 4F65A 3HVCA 3EN7A 4LOQA 3FYKX 1UV5A 3OROA 2GNHA 4NCTC 5AR3A 4RC2A 4EHVA 2E9OA 5CWZA 1KE6A 2XNBA 4Y8DA 4FKPA 3PP0A 3SX9A 4YTCA 3BV3A 3FI4A 2UW8A 3G5DA 4MK0A 5HO6A 1KV1A 3CQUA 5EYKA 2B9JA 3GP0A 1STCE 2WOTA 2XJ0A 4TYHB 3U9NA 5M07A 4ZTQA 4NJDA 4ACGA 4AS0A 1WVYA 4W9XA 5E91A 3L9NA 3OXIA 4FKQA 2G01A 1O6KA 1FMOE 4GCJA 5J9YA 2PUIA 3G15A 2XYUA 3DT1A 3P23A 4RX8A 5CAOA 3C4XA 4HZSA 1ZZLA 4XG7A 4DT9A 2WEVA 4AAAA 5AP6A 4QMNA 4YHFA 5E8TA 4JDJA 2JD5A 5C8NA 5GHVA 5HU3A 4EQUA 2IG7A 1WBVA 2GNFA 4NWMA 4RMZA 1JQHA 4U3ZA 4DITA 4RX7A 4V0GA 3RAWA 4FEXA 4L44A 3EOCA 5BYLA 1Q8WA 4LI5A 3RWPA 1YI3A 1U46A 2R64A 4X2GA 1H07A 1PXNA 3FZOA 3RNYA 3L9MA 4FOCA 3ZUTA 5I4NA 3SVVA 4QP7A 1CMKE 1SVGA 1SZMA 2W4JA 5JMSA 2ZM1A 4ZSGA 2YIRA 3KN6A 4ASZA 3E8NA 1O9UA 3QCQA 5BUJA 5AM7A 2QOFA 5L6OA 3OY3A 1OPJA 3DJ6A 3E8DA 4AE6A 4DGLC 3FLYA 4LGDA 4R1YA 3BBTB 4U3YA 3QWKA 3AC2A 3GQLA 1VJYA 4FTKA 4YURA 2PYWA 4L8MA 1Z5MA 2VWUA 5K5XA 1ZY5A 4HYSA 5HZNA 3EHAA 3W2RA 4HGTA 4KABA 3KCFA 3MB7A 1WMKA 2Y8OA 3DAKA 4UZHA 1M7QA 1BL6A 4QMYA 3ATSA 2JKOA 1OIYA 3PA4A 4BCIA 4FK3A 4BCHA 5L2WA 2PVYA 3FSKA 4KSPA 3D5VA 3NNVA 4I5MA 4EZ7A 3VJNA 4IFGA 2WMAA 4WG4A 2GQSA 2Z2WA 1H24A 2J0MB 4YNOA 1W83A 1ZYLA 4D0XA 2XBJA 4CCBA 3DXPA 5JRQA 4DTKA 4P5QA 4U80A 3FLQA 5BVOA 4TWNA 5F4NA 4H58A 1JKLA 3LFFA 3TT0A 1DM2A 3UMXA 3UVPA 4QPAA 4OBQA 3F2RA 5EW9A 3T9IA 2J0IA 3UOJA 3G6GA 3PPKA 5HBJA 5DYJA 1G8SA 4G6LA 2LGCA 2YACA 4CQGA 5T68A 1H1SA 3QD4A 1Q4LA 2E9PA 3K5UA 2VTOA 2W96B 3QLFA 5D7AA 5E92A 5I9YA 4I6FA 3IDCA 4ZY6A 1SNUA 3RALA 3ZUUA 3P08A 2J7TA 1A06A 3PG3A 4CMTA 2F2UA 2FB8A 3KK9A 3MPAA 3CP9A 4QQJA 4YHTA 4O86A 2C6DA 3ITZA 4YO6A 4IIRA 2O2UA 4U44A 3BHYA 1TVOA 3AMAA 2WMSA 5KE0A 3I0QA 2GQGA 4MXAA 2A4LA 3BI6A 3KRWA 4JDHA 4UALA 3RM7A 1FBNA 1H0VA 4M69B 2YFXA 2JIVA 4ZIMA 2J51A 5E9EA 4MD7E 3DDPA 4E93A 4ARKA 4DBXA 4XRLA 2WELA 3ORTA 5KMLA 2A0CX 2F7ZE 3LJ1A 5TR6A 5FXSA 4AW0A 4NM3A 3EH9A 1KV2A 4UYNA 4EBVA 3ZO2A 3LFDA 5KMMA 3D7TB 2JIIA 4MD8E 3WYYA 1JVPP 4B9DA 4XG4A 5ICPA 5LWMA 2BZIB 3CJGA 2HWPA 4YJUA 5AV1A 5HU9A 2J50A 4RJ8A 3PRFA 1Y8GA 4C4EA 4EH4A 4XBRA 3CKXA 3D7TA 4QYHA 1ZYDA 2IW6A 3LXKA 4PDPA 5KKRB 4GVJA 5IEXA 3ZRKA 2JKMA 3H4JA 4OTIA 5J87A 2PZRA 3ZH8A 3IW6A 4ALWA 2C6LA 4Y85A 1YWVA 4R8QA 4X3JA 3IW4A 3EQDA 3B8RA 2G1TA 5DFPA 4PPAA 4BI2A 3PVUA 5E8UA 4A9SA 3R8VA 4LFIA 2GMXA 3NDMA 4J96A 3TKIA 3W2PA 3W1FA 3VUMA 4BFMA 2Z7QA 4GV1A 2W1HA 3ETAA 1XO2B 3R63A 3NVKI 5DPVA 1XH4A 5HG9A 3GT8A 3R71A 3OW3A 3GUBA 4F6UA 4DFBA 2Z02A 4C37A 4CD0A 1WVXA 4ERKA 3MN3A 4LQMA 3F61A 2GHGA 2X7GA 4IVDA 5AR2A 4BCKA 5K0XA 4OAUC 3MY1A 5FRIA 4PP9A 3KF4A 2OJGA 5HORA 4GUBA 2JDRA 3BGZA 4FL3A 4JQEA 4S2ZA 5AM6A 3NYOA 4O0TA 5E90A 4CFXA 4XUFA 4PX6A 4DEHA 2JC6A 2OI4X 2VTIA 1FQ1B 2W4OA 1JAMA 2QODA 3FE3A 2XKFA 2C6KA 2OG8A 1CSNA 3TWJA 2QOLA 4FV9A 4CV9A 4AX8A 4P4CA 1H26A 2C1BA 3NR9A 5CQUA 3SXSA 4QOXA 4O21A 2B4SB 3ZSGA 4PUZA 2ITUA 5L3AA 3WYXA 4L46A 4DEEA 5JKGA 4MF0A 3KRXA 4F6SA 4J7BA 2OXYA 4D4VA 3CTHA 3LOKA 2PVMA 3E5AA 3UIXA 1REKA 3RTPA 1LEWA 3FAAA 4LRKA 5KHWA 4IWOA 3FXWA 5ANDA 3SOAA 3VAPA 3ORXA 3RHKA 5DBXA 5GNKA 3MI9A 2W0JA 4FTAA 4JL9A 4BDDA 4U6RA 4UY9A 2J2IB 3IOPA 1W7HA 1M17A 3EFLA 5AR8A 4IC8A 3QHRA 2CLQA 2YLEA 3PA5A 3LM0A 4I93A 1APME 3M1SA 4QMLA 4AE9A 3I5NA 1ZAOA 1I09A 3LE6A 3R9RA 5CZHA 4ACHA 2VTSA 4FIIA 4R1VA 3G51A 5AV3A 4BDHA 5G1XA 3MB6A 2PVKA 2X6DA 3GCVA 3PWDA 1ZMUA 1IR3A 3R9HA 1YHVA 4CTCA 4BKZA 3D7ZA 3DA6A 4H1MA 2UZNA 4F9CA 5J1WA 4O0YA 1PXPA 3AC3A 3K54A 5AUYA 5CAPA 2WPAA 3UO5A 3FMEA 5A3XA 2W9FB 2CNQA 2HWOA 2Q0BA 3BELA 3ZFXA 4EHEA 3U4WA 1JBPE 4BC6A 5FDPA 1L8TA 3ET7A 3NWWA 5GZ9A 3VHKA 4BDGA 3VBYA 3R9NA 4NYEA 4GFMA 4IFCA 2R3LA 3TEIA 1Q97A 3Q04A 4FIHA 5I9XA 3POZA 4EI4A 3LXNA 5DT4A 3ZSIA 1BX6A 4UX9A 1OVEA 4H3PA 2ITNA 2IW8A 1CKIA 5HQ0A 3ALNA 4J99A 3AMBA 4BI0A 3S3IA 3HDNA 4D4YA 3MVLA 4EK6A 5E7RA 3F3ZA 4ZY4A 2YAKA 2IW9A 4DCEA 5AR5A 1OMWA 5ACBC 3VO3A 3ZC6A 3TIYA 1WBSA 4FMQA 4C4IA 4CYJA 4Z3VA 4O7SA 2ITYA 1YOMA 3GNIB 4ITJA 5IA0A 1S9IA 3AC5A 1QPDA 3V5WA 3HDMA 3LVPA 5J7BA 2CLXA 2V55A 4BDFA 3BRBA 5ETIA 2YWVA 2C3LA 5IA3A 2IN6A 3D2KA 2GCDA 1QPJA 4S34A 5HTIA 2V7AA 4DFLA 3JY0A 3DDQA 4Y5HA 5HEZA 2IZTA 3RI1A 4F0FA 5AUWA 4FVQA 3KB7A 2OFUA 3E87A 4O7LA 4IB1A 3UOKA 1BKXA 3IDPA 4LMNA 1DI9A 4IAAA 4FGBA 4Z7GA 2NRYA 3EJ1A 4IM3A 3KEXA 3ORPA 5EH0A 4ZTMA 4I4EA 5E8ZA 2GFSA 3CPBA 3OS3A 4FKLA 2RIOA 3FZRA 4ZZMA 1MRVA 3DK7A 4DFXE 3NLBA 5AV0A 2R3QA 2Y7JA 4RA5A 5FP6A 4ANQA 3BLRA 2DWBA 4L00A 1OKVA 2PUNA 4RIYB 4HW7A 4L42A 4IX5A 3VNTA 2OGVA 3MPTA 3L9LA 3MS9A 5HCZA 4XP0A 4LOOA 2C6OA 4LUEA 4WSYA 1QCFA 4FBXA 3PY1A 3FMDA 4ZTLA 3BKBA 4EUUA 2P2HA 4DFZE 4QMWA 4BKYA 4AN3A 3NEWA 4RFZA 4RIWA 5HCYA 1OL5A 4WKQA 5CALA 2WEIA 2WKMA 4DFUA 4AFEA 3PVGA 4B8LA 3EL7A 2VRXA 4FSWA 3SGCA 5DE2A 3EKNA 3MIAA 3PXKA 5F9EA 2WMTA 3ANQA 3V5QA 3ZO1A 4ZJJA 3NUAA 3EYHA 4O2PA 4G6NA 5FM2A 3AT2A 3JYAA 3A99A 3MGYA 3HAVA 4AA5A 2A1AB 1ZOEA 5IMXA 4O6EA 2QOHA 5AR4A 3Q52A 2ZOQA 4DG0E 5HX6A 3OZ6A 3QALE 4FKTA 5BUEA 3V5PA 1UNHA 4FV1A 2VZ6A 3NIZA 2HY81 1HOWA 4FSZA 5EDRA 5BPYA 2PVHA 4FT5A 3R1YA 5EHOA 2UV2A 1FVTA 3IGGA 3SKCA 3MY5A 4RWIA 1IA9A 3C0HA 5CT0A 2X39A 4D2VA 4QTEA 3JVSA 4UWYA 3SG9A 4FKVA 2QHMA 3GI3A 3ZTXA 4ENYA 4FL2A 4DLIA 1ERKA 3FLNC 4FSNA 1JKTA 4GSBA 4PWNA 3TIZA 3QAME 4C4GA 3MDYA 5DWRA 5FQDC 4FTCA 4C36A 5I9WA 2FSLX 4QP3A 3R8LA 2WU6A 5AUUA 3Q96A 4S31A 3R7YA 2O65A 1ZYCA 3H0YA 3DLZA 3R73A 3LLTA 4M13A 3CSVA 2KTYA 3IQ7A 1YXUA 3ZLWA 1ND4A 3N4TA 4L52A 3HV7A 4QNYA 4RJ5A 4O0WA 2FO0A 1JLUE
chains in the Genus database with same CATH superfamily
4ZZOA 5AP7A 3E63A 3ZRLA 4F9BA 3P7AA 1ZYSA 1UNGA 2BCJA 4H3BA 3FKOA 3QLGA 3MFSA 3SRVA 3RBWA 3QD2B 3G33A 4M66A 3DZOA 4EJNA 2CGWA 3Q9XA 5M56A 3FYJX 3FPQA 4I21A 1YDSE 4MXCA 4L43A 3GCSA 4FTQA 1A9UA 4OLIA 1TQPA 2VAGA 1F3MC 4RSSA 5EM5A 2IZUA 4ITIA 3FC2A 5AA8A 4QP2A 5I9ZA 4IVBA 1IA8A 4QMSA 3UG2A 4JNWA 3JS2A 4AZTA 2VWWA 4USDA 2CDZA 1CKJA 5AUZA 1GIJA 1RQQA 1TKIA 3CD3A 4LG4A 3GC7A 3LQ5A 1PXLA 1XKKA 3BEGA 4FSMA 4JBPA 4YNEA 4KUJA 3RHXA 5JSMA 4CLIA 4IX3A 3FEGA 3WZKA 4C7TA 3THBA 5IA2A 5FEDA 1R1WA 5IQDA 5H8EA 4NIFA 4M68A 5BVWA 3EWHA 3WZDA 2C6MA 5FG8A 3TJCA 4DEBA 2WAJA 4EHGA 3PUFC 4Z16A 3U51A 2F4JA 3FDNA 3OC1A 2VTTA 3BE9A 4O96A 3BPRA 2IF8A 2XIZA 4M7IA 5A4QA 4GEOA 4ORKA 4D5KA 4I23A 2G2IA 1SYKA 5J8IA 4C61A 4F99A 5KMKA 2J0KA 4AGDA 2JKKA 3OXZA 4UZDA 2GHLA 2G15A 4I5PA 4MQ1A 5IG1A 3AQVA 4OAVB 4PMMA 5DRBA 4GJ2A 4K2RA 5AUVA 3V3VA 4XG6A 4JDKA 4IW0A 5L4QA 2HZ0A 3HA6A 5B7VA 3F66A 4BJJB 2C5YA 4NEUA 4XP2A 4JLCA 4CZTA 4JBVA 5AX3A 4J8MA 5GJDA 4JRVA 5EM7A 1QMZA 3QRUA 4O4BB 2C4GA 3P0MA 5K0KA 3UZTA 3VULA 2XARA 3L8SA 2RGPA 3MIYA 4NM0A 5HX8A 3KRJA 4BJJA 4EC8A 4ANLA 4OW8A 3BGQA 4PPBA 3T8OA 3HV6A 4II5A 4H39A 5AAEA 4TRLA 1UU9A 4KRDA 4RQVA 2OXDA 3OTVA 3AKKA 5M09A 2CN8A 4ZTNA 2GS2A 2R7BA 1G8JA 4B4LA 1FINA 3V6RA 2ITOA 3TACA 1UKHA 3T9TA 3QXPA 5A46A 4IHPA 2C30A 1NA7A 3EN4A 5EKNA 4I6QA 3D94A 4JDIA 2JGZA 2V5QA 3ORNA 4MEDA 3PG1A 3QC4A 4ASXA 5E4HA 4JT3A 4Q9ZA 3MY0A 3OCTA 2QG5A 3R7EA 2Q0NA 2B53A 3HMNA 2XAOA 4YZBA 4EZ5A 4DCAA 3RK7A 3ZLSA 2WMXA 3LXPA 3FLZA 2VUWA 3KC3A 4M3QA 2GNJA 1JSTA 1TQIA 1QL6A 1WBPA 2QVSE 4AU8A 1H27A 4A4XA 5JGAA 3NGAA 2NRUA 4WO5A 3MBLA 2C1AA 5IPJA 3CTQA 2CNUA 1YRPA 4G9CA 2QURA 3DFAA 4M0ZA 3KXNA 3PJ2A 3WOWA 3EQBA 3FKNA 5A6NA 2PVFA 4K8AA 3GC0A 4G5PA 2W99B 4TT7A 3DKGA 3NRMA 3CY2A 3DZQA 4FSQA 4ZS4A 2VNWA 4WNOA 4APCA 1PMNA 4DLJA 1ATPE 3HRFA 1W84A 4I5CA 3G90X 4I92A 3I0OA 4FKOA 4R3CA 3UVRA 5L2TA 5LVMA 1IASA 3Q60A 3PVBA 2JAVA 4C02A 3GOPA 4BDBA 5HE1A 4YTHA 4Y83A 4E3CA 1GJOA 4N6YA 4O0VA 2VO0A 2B9HA 3F7ZA 3WI6A 3NUXA 4BWPA 1ZARA 4G16A 3ROCA 4AGUA 3QCSA 3KULB 3RMFA 2B9FA 2VWYA 1T45A 2A19B 3R1QA 3I7CA 4DGOA 1VLRA 3AKLA 2OSCA 4Z55A 2WTKC 4RT7A 3I4BA 4C62A 1B38A 4FKJA 2XUUA 4PTCA 4CKJA 2X2MA 5DR9A 4R5YA 3ZEWA 2XK4A 4G6OA 5L2QA 4FL1A 3EKKA 3GU6A 4FT7A 4BN1A 3FMLA 3R6XA 1WCCA 4MNEB 4YJTA 1KUTA 1W0XC 2C6TA 3NNUA 2EB2A 5CSXA 2ZAZA 3JY9A 5A14A 1GOLA 3GC8A 4BTMA 2BDFA 2VTAA 3MH3A 1BYGA 1RJBA 2GNLA 3EQCA 4L3PA 4MNEA 4BCQA 4CKIA 3CQEA 5IA1A 4FZDB 4CQEA 2EVAA 4N70A 2OLCA 2XCHA 1ZYJA 3S2PA 3VBXA 3I60A 2E9NA 3ZCLA 3DBDA 2JIUA 5LARA 4BZDA 3EIDA 1PYXA 3VBVA 3F5XA 1P4FA 3KXGA 2Z7RA 4W8DA 4ALVA 4ANOA 5ANGA 5CEOA 3LFCA 3M2WA 4EZ3A 3QRKA 5L2IA 4YJSA 2AC3A 3DY7A 1ZOHA 2ITQA 4O7TA 4OTGA 2B0QA 3QZGA 4C8BA 2YISA 2VWIA 4PTGA 4BBFA 3TZ9A 4ANMA 2ERZE 3DOGA 4KWPA 4MXYA 5IUHA 3BLQA 3CC6A 2LAVA 2BKZA 3PY3A 2XBAA 3T3UA 2UUEA 3QTWA 2YM3A 1JNKA 1ZMVA 2QG7A 1ZRZA 3BLAA 5FD2A 5GINE 3BIZA 2BTSA 4EORA 4RRVA 4PNKA 3UGCA 3EQPA 2CGUA 3V04A 3KREA 2XJ1A 4O7VA 3TNIA 4E5AX 2IJMA 4FYNA 3QTIA 3QZIA 4IACA 2YLFA 2VWBA 2BZJA 2XK8A 2C0OA 3RPSA 3RWQA 3SXRA 4XG9A 2W7XA 3F2AA 3NAXA 3PE1A 5CSPA 3QCYA 3QQKA 4CYIA 2UVXA 1TQMA 1O6YA 2P4IA 3BE2A 3DU8A 3JPVA 3VUIA 5M55A 3C13A 4UEUA 3P1AA 4F7SA 4AAYA 1JKSA 3O0GA 3H9OA 4JS8A 5CNOA 1NVQA 2PMIA 1K2PA 4NZWB 4ZSLA 4G3CA 5F95A 3D2IA 2CSNA 2W1ZA 2X2KA 3Q9YA 4DGGA 4WOVA 3TZMA 4JQ8A 3PY0A 4J95A 2GTMA 3HP2A 3REPA 4DF3A 3QZFA 5FLFA 2XK9A 2XNGA 4GG7A 4QPSA 1L3RE 1XWSA 1PHKA 2X4ZA 4FK6A 4YBKA 5AIRA 1KE8A 3WZEA 4CFMA 4BIEA 4P7EA 4DEIA 1JKKA 1KWPA 1Q62A 3ZZEA 4EK3A 4UXQA 1Q8YA 3BBWA 5A54A 1Z9XA 5E1SA 2UVZA 4V0GB 5TKDA 4AN9A 1R39A 4FKIA 3ZO4A 4CKRA 2H8HA 3D4QA 2WHBA 1IEPA 4K9YA 2GS7A 2W5HA 4PRJA 1M2QA 2YM5A 4PTEA 3P9JA 3BL7A 2DYLA 1DAYA 4JIAA 3K3JA 3A4OX 5T3QA 4O7RA 5EG3A 3VQUA 3C4EA 4AOIA 3LCTA 4Z9LA 3GU7A 2HW7A 2XIXA 3FL4A 2G2HA 3R04A 4K6ZA 4F63A 2WTVA 5JZNA 3F3VA 3LMIA 3D5UA 3LMGA 4IQ6A 5CNNA 4R7BA 4AOJA 4BBMA 4BIBA 4YSJA 3RPOA 3V5JA 2PZYA 3PTGA 4AOTA 4L9IA 5DT0A 4L67A 4IB0A 3FMNA 2UZOA 2AQXA 2YM7A 5BVNA 3DGKA 4K0YA 3OXTA 5BNJA 3TNHA 2R5TA 3VWAA 3QGYA 4AF3A 3IOKA 3TZ8A 4HNFA 2HZIA 2WMRA 3R1NA 4KIOA 3UPXA 3IS5A 4RBLA 5CVHA 4PV0A 5E8YA 5GZ8A 3UIMA 3K3IA 4EOOA 3PPJA 3EMGA 2FH9A 4ZSJA 2XJ2A 2QR7A 5KMOA 3QXOA 3DBFA 4JBQA 2I1MA 1YDTE 2ZVAA 3CXWA 4BDKA 3FLSA 2RL5A 3HMOA 4QP6A 4UWCA 2WMVA 4FUYA 5H2UA 3W2QA 4JAIA 3RINA 4FEUA 3FZPA 2ITWA 1Q8ZA 4O7WA 5IQGA 1O6LA 1RDQE 4N4SA 2CKPA 4XOZA 5D41A 3ROYA 1PXJA 2AC5A 2BIKB 4FTTA 1U5QA 4IDTA 2VNYA 3RAHA 2XIRA 3ACJA 4G1WA 3HV4A 4I6BA 4FODA 4AACA 1SMHA 3V01A 3PXFA 3VN9A 3UBDA 3UJGA 4YPDA 4D28A 4FNYA 4RIOA 2PVLA 3B2TA 3DNEA 3QGWA 3RAIA 4BVUA 2G9XA 4M97A 1OUKA 2PMNX 5CEPA 4KKGA 4HVDA 1JOWB 1WBNA 4ZLOA 2BFYA 3OP5A 4IDVA 4Y46A 4IZ7A 5BVFA 4EK5A 3N9XA 3QKMA 5E8XA 5HIBA 4U43A 3LFEA 5AAGA 2FSOX 2OXXA 4QDEA 3W33A 5EI2A 4F1TA 2QU5A 3LFBA 3HECA 2O3PA 3GFWA 3HX4A 4IVAA 4QTAA 1DI8A 2WTIA 4OT6A 4DHFA 3V8SA 4OBPA 4M84A 1YOLA 4U97A 2OJJA 3KVWA 1W8CA 4K11A 2WZJA 4MXOA 3RKBA 1IRKA 3IONA 4KD1A 3UNJA 1Q3DA 2C5OA 3QKKA 3E3BX 4HGLA 4O0UA 2IPXA 1QPEA 4FV6A 4AN2A 2WQBA 2XNEA 4AP7A 1BI8A 3H10A 1JWHA 3H0ZA 2YEXA 3FY0A 5DN3A 5KZ0A 5HLWA 2KULA 4L3LA 2UW3A 3TV7A 3QWJA 1CTPE 3L8XA 4IJPA 2GFCA 5EDQA 2PE0A 1VEBA 3NW7A 4JBOA 1OKWA 2YCQA 4GMYA 4MWIA 2CKQA 4YBJA 4E4LA 2FGIA 2WNTA 3NCZA 5LWNA 4F6WA 1YDRE 4WRSA 4QD6A 4NJ3A 4YPSA 3PWYA 5GJFA 4L68A 4BYJA 3FI2A 1YHWA 3G6HA 4RX9A 4L3JA 4YP8A 5IQAA 4BY9E 4ACMA 3D15A 2V0DA 5EOLA 3PFQA 4DGMA 4EH8A 2VTQA 3PYYA 4F0IA 4QMMA 2NO3A 2RFNA 3QD3A 4FIFA 4D5HA 2GS6A 3FL5A 1U59A 3PLAE 2OIBA 4IZ5A 3KK8A 2H96A 2WIPA 4KB8A 2X9FA 4U9AA 1OKYA 5BUIA 5FP5A 4GUEA 4EEVA 5KBQA 3DBQA 1NW1A 3PLSA 2F7XE 5IQFA 3W16A 1SNXA 2DS1A 5HG8A 1XH5A 5KMJA 1XMMA 1UU3A 4TYGA 3U4UA 3QUPA 4YGAA 4PDOA 5CF6A 1XH8A 4C35A 5EI6A 2F49A 4RJ3A 3RP9A 4FG9A 5L6PA 3FHRA 4JX7A 2BAKA 3HYHA 2ZYBA 4HCVA 2ZV2A 4JG8A 5M53A 4A9UA 4RVKA 2B9IA 4FTIA 3F2NA 3KCKA 3TTIA 3R21A 4C3FA 1UU8A 4WNPA 3D14A 3NYVA 4N6ZA 4DA5A 3A7JA 4OR5A 2C3JA 3U6IA 2WTCA 4O0SA 2E2BA 2JBOA 2OJIA 2E9UA 3R7OA 5IQHA 1Q3WA 4I6LA 2H6DA 1R0EA 2Y4PA 3GFEA 2BHHA 4X3FA 3K5VA 2FA2A 4XP3A 4EJ7A 4I5HA 4WG5A 2J90A 2PMLX 4OTDA 1GZOA 4F70A 3EFKA 3QRIA 1IAHA 3EZRA 5LVLA 2VWZA 2XNNA 4CXAA 2OF2A 5JFWA 3EYGA 4AA0A 5LOHA 1H8FA 2X4FA 3OWPA 5EFQA 4RQKA 1R3CA 2C3KA 2F9GA 2R0IA 3CTJA 4TW9A 2WQNA 2CKOA 4EOKA 4JJRA 3UDBA 4DINA 2FVDA 2XNPA 3FUPA 2J0LA 4RVMA 3F82A 3LCSA 3WE4A 4AZFA 3LLAA 1XH9A 2BTRA 3AC8A 2H34A 4E1ZA 3K2LA 4EH9A 3PXYA 4J53A 3VS6A 4TL0A 2R3NA 2BFXA 1W2CA 4FTLA 3NX8A 4M14A 1H0WA 5C27A 1E1VA 3FMMA 4FT3A 3UTOA 3NCGA 3WF8A 3HL7A 3SDJA 5GZAA 2YERA 4RC3A 1PRYA 5IH4A 5F20A 2PUPA 2IVTA 2OU7A 4U42A 4FSRA 3QZHA 2W06A 4CVAA 1IAJA 4U7ZA 5BQ0A 4D1XA 4BYIA 2EWAA 2XA4A 3GVUA 5AP4A 2C0TA 2ITXA 4RIXA 3OHTA 1FMKA 5K3YA 4QMUA 3EL8A 3DJ7A 4DHZA 5H8GA 5C03A 5EW3A 2QKWB 3ZLXA 4HPTE 4NW5A 1EH4A 3PA3A 2YAAA 4E5BA 5JK3A 5CF4A 1G5SA 3FBVA 2X9EA 3I6WA 5ETAA 4E6AA 4DHIB 1Z57A 1WAKA 3QQJA 2GHMA 3POOA 4CMUA 4CLJA 3Q9WA 1W82A 3PJ1A 4BR3A 4C58A 2XKEA 3IDBA 3Q4TA 2F57A 2FSTX 5FTQA 5HTBA 1J7IA 3E7OA 5IUIA 5HCXA 4GU9A 1P2AA 1U54A 2YCFA 4F7LA 4V01A 3FWQA 2XRWA 3O51A 1LPUA 4DEGA 3HNGA 3MTFA 4E6DA 3DV3A 2R7IA 3COKA 3VBTA 1MQ4A 4EUTA 5LMKA 4S33A 1J7LA 3DAJA 2HELA 4HCTA 4AXCA 2UW7A 4RZVA 4RX5A 4KIKB 4TPTA 3TUBA 5GJGA 4DYMA 3ELJA 5CEQA 4BGGA 5L6WL 4HYHA 2OIQA 1YXXA 4MNFA 5CLPA 3WF6A 4D2PA 1R78A 3JUHA 3WF5A 3RPVA 2XB7A 3MFRA 3UP7A 3A2CA 4FKWA 3A7HA 4KIKA 5TO8A 4EK4A 4FZ7A 2O5KA 2X8DA 5FM3A 3SW4A 1Q41A 3B8QA 2BAJA 2ZB0A 3E64A 3VC4A 3VW6A 3W2SA 1QPCA 1R0PA 4MTAA 2X7OA 3DTCA 1PMUA 3FZTA 1MRYA 1OI9A 4QRCA 3R8UA 4DTAA 3UIBA 3VVHA 3FXZA 4XV2A 4O38A 5CASA 4I20A 2QQ7A 4IC7A 5JGBA 3A8WA 2X8EA 3AGMA 3TNWA 4D2TA 2Z7LA 4XEYA 3SLSA 4D9TA 4X3FC 5A4LA 3ANRA 4QMZA 2CN5A 4RJ7A 4D1SA 4E20A 3R30A 4X6RA 2VTNA 4BHZA 4EL9A 4YC8A 2JLDA 3SD0A 1OIUA 5A4TA 3VS4A 3UDTA 3W0OA 3U54A 3MVMA 4LOPA 1KOAA 2QO9A 5IH5A 2OF4A 3P78A 3QKLA 4RIWB 5EQEA 4OGRA 3C0GA 2HAKA 2R2PA 1YXTA 4O0RA 1M52A 4PL5A 2PZ5A 2ITPA 4YJVA 5C9CA 3HV3A 4J71A 2OZAA 3LIJA 3ZBFA 1LR4A 2RF9A 4BTJA 3GCQA 4UWBA 2XH5A 1BMKA 4GT5A 3GU4A 4E6CA 2ETRA 4TYEA 4XHKB 2QOQA 4ITHA 4X0MA 4I3ZA 3S1HA 4LV8A 3U8WA 2OZOA 3W32A 4EYJA 2PVRA 3M42A 4FUXA 5I5ZA 3TDVA 5K9IA 3F6XA 5FXQA 4GKIA 4D55A 4EOPA 4J97A 2ZFYA 2XNMA 3TNPC 3PUPA 3QUDA 3LQ3A 2OFVA 1ZMWA 3QU0A 2QONA 4XNEA 3PP1A 3VUHA 3LHJA 4FEQA 2UW4A 1XR1A 4EH3A 3FC1X 4CMOA 2HENA 3NUUA 1V0BA 1XQZA 2R3KA 5E8SA 5C26A 1M14A 5HIEA 3VUKA 4CGAA 1YI4A 3OY1A 3ZFMA 3W55A 1GZKA 1H28A 4PDSA 5CTPA 4BDEA 2IZRA 5AV2A 2W1DA 1A48A 5DLSA 4KS7A 3RGFA 4APPA 4A9RA 4FTNA 3C4ZA 4YJPA 3QYWA 5LXMA 2JAMA 2C0IA 4TYJA 1Q5KA 3WF7A 2G2FA 3CY3A 3JVRA 1PXMA 4GK3A 3ZC5A 1UKIA 3GU5A 3IW7A 4QP9A 4JX3A 5BYYA 4MBIA 4C3PA 5DI1A 4D58A 2YCSA 5HGIA 4ZJIA 5AMNA 3QHWA 4LGGA 5J5TA 3SRVB 2F2CB 4FA2A 4FNXA 3E8EA 5CAVA 5LMKC 3N51A 5JFSA 3F7WA 5ANOA 5EOBA 3R8MA 3W2CA 2YHVA 5BMMA 1KE9A 4UMQA 3UYSA 4I24A 5CANA 2SRCA 5HBHA 3TL8A 3ZM4A 2FSMX 3MTLA 1FVVA 2BAQA 2JFMA 2AYPA 2P55A 2A2AA 5BVDA 2PU8A 1BLXA 3ORMA 4IX6A 3VBWA 4EYMA 3TMOA 4I0SA 2GNGA 2PZPA 4KAOA 2R0UA 3R9DA 4HZRA 3ENMA 5A4EA 3ULIA 1GNGA 1YHSA 3Q53A 4ZSEA 4AW1A 1F0QA 5EM8A 5KHXA 4GK4A 5KUPA 1GY3A 3PZHA 3TV4A 2XVDA 4PL3A 3HV5A 4P5ZA 5FUTA 5AP2A 4NIFB 4EKLA 4LRJA 2NNWB 4GT3A 3OTUA 4RVTA 4A4OA 4BZOA 3CQWA 4BHNA 3TCPA 5K4JA 4QTBA 4NTTA 2I6LA 3WILA 4YUQA 3TKHA 4XCUA 1LUFA 4IE9A 3R7VA 2A27A 3EQHA 5IISA 4FR4A 4IANA 2Y4IC 3ODZX 4GU6A 1OGUA 2WTKB 4EOMA 2X8IA 1Y91A 3F5UA 3MWUA 3PE2A 1VYWA 4L7FA 2ITVA 3UE4A 4QDVA 3NMUF 5K5NA 5B2MA 2JEDA 4GYIA 4OT5A 4Y73A 4A07A 3UVQA 5J9ZA 3O7LB 1H08A 5I3OA 3R1SA 5EYDA 2GSFA 2UW0A 3O7LD 4DFYA 4R3PA 2ZB1A 2JDVA 2VO3A 4LGHA 3C9WA 4OBOA 3NUSA 4FTJA 4MAOA 4BICA 2BUJA 4E6QA 3R00A 4OTFA 3R7IA 5IDNA 3V8TA 4PDYA 5DHJA 4K18A 4LUDA 4AXAA 3GU8A 2FUMA 5HD7A 3TV6A 5LJJA 3Q5IA 3GENA 4G17A 1V0PA 1LP4A 1ZY4A 2AUHA 4TWCA 2W1IA 3DTWA 2ESMA 4Q9SA 2I7QA 3RCJA 3E8CA 1PW2A 5M08A 4NM5A 3BYVA 3GB2A 4MH7A 2HYYA 1DAWA 3HLLA 1RE8A 3O8TA 3L8PA 5IA5A 4IZAA 5HLPA 5CQWA 3S4QA 3OMVA 2Z7SA 3OWJA 2QLQA 4RG0A 5BV3A 3QTXA 4FRFA 4MKCA 4ID7A 3EZVA 4MQ2A 5CU2A 5FWKK 1BUHA 2QNJA 4NKAA 3RVGA 4QMPA 4M15A 3TXOA 3KA0A 3ZYAA 3TDWA 1B39A 1MQBA 3W0PA 4AXDA 2O0UA 4DTBA 3P5KA 4C0TA 4IAFA 5CVFA 4LV7A 2J0JA 2OW3A 3QF9A 4BTFA 2ZDTA 2PL0A 2VX1A 2R3GA 4GKHA 4O7NA 2R9SA 4WUNA 2C5XA 3CD8A 2HOGA 2WOUA 5ETCA 4YLJA 3UQGA 5JFXA 5JQ5A 1Y6BA 1M2PA 4FV8A 4TN6A 4MXXA 4HVHA 4DH8A 4R7IA 3C1XA 2J9MA 2GTNA 4FE2A 5CU0A 3SV0A 1YQJA 4LDTA 4HOKA 3PRIA 4R3RA 5EHLA 3A4PA 3FHIA 3SA0A 3VS2A 4QQTA 4UBAA 1PYEA 2OWBA 2DUVA 4CSVA 4S32A 2R3PA 3UOHA 3KXHA 3ZXZA 3SAYA 4AZEA 4EWQA 3VS0A 1XHAA 3V6SA 2PSQA 3NYXA 2CPKE 4GS6A 2Y6MA 1E1XA 1PF8A 1OM1A 4OTHA 2H9VA 3MH2A 2YWPA 4YZ9A 3TKUA 5LVNA 4G2FA 5DNRA 3R2BA 3V51A 3IG7A 4ANNA 1FPUA 4ASDA 1G8KA 3N4VA 2C6IA 4HYUA 4XMOA 4W4YA 4NUSA 5FEEA 3AGLA 4AGCA 3VIDA 3QQUA 5CENA 2WTJA 5D11A 2OICA 3EN6A 5DIAA 5IKWA 3HA8A 4XX9A 3D0EA 3UNZA 3HRBA 2UZUE 4UMUA 2OJ9A 3ALOA 3I6UA 2UW5A 3KMUA 5JQ8A 1PKGA 3GC9A 4FV5A 3G0EA 4NW6A 4AXFA 5CEKA 3QTRA 4FG8A 4HCUA 3HP5A 2YJRA 4CNHA 4MHAA 2YABA 3ENHA 4DH7A 3CR0A 3EQIA 4BRXA 2HZNA 3R7UA 4BDJA 3DQXA 3ORIA 1URCA 2YIWA 4BDCA 2I0HA 4A4LA 5ANEA 5DR6A 1AD5A 1OECA 1JPAA 3P79A 5J79A 1ST0A 3LXLA 5EQPA 3ZM9A 1ZZ2A 4KNBA 4O81A 3RZFA 4ZK5A 3IPHA 2I0VA 5IU2A 4AW5A 4BZNA 3II5A 4C4FA 2ZDUA 4CTBA 4PF4A 4USFA 4DHJA 2XZSA 4F9WA 4ASEA 4LL0A 3HUCA 4ZP5A 3FMJA 3RK9A 5IA4A 4O83A 2VU3A 4MCVA 4XJ0A 4U5JA 4AXEA 2Z8CA 2RSVA 4S30A 2VTHA 3F88A 3R0TA 3C5IA 5ANKA 5A9UA 3Q9ZA 3F9NA 2B1PA 4HGEA 2ERKA 3AD5A 5FGKA 1REJA 3BHVA 3E92A 1OUYA 4O84A 1NT2A 4PMSA 2JDTA 4RC4A 3FI8A 2RKUA 5E8WA 2CGXA 2V62A 4JOAA 3GCPA 4KIPA 4OTQA 3QFVA 5DMZA 4DN5A 3FKLA 4EOIA 3BGPA 4F09A 5HNGA 1GIHA 4UYAA 3B2WA 4NSTA 4XLIA 5HIDA 2YDKA 2WTWA 4PY1A 4FZAB 4EK8A 4NL0A 3QTQA 4EH6A 4YO4A 5FDXA 3PSCA 1GZ8A 5AX9A 4IWDA 4RJ6A 4ONAA 3QC9A 4AG8A 1XH7A 5JEBA 3DKOA 2C5NA 5EK7A 2CNVA 2Y0AA 1CKPA 2ITTA 5HE3A 4F7NA 4KS8A 4BDIA 4AZSA 3QA8A 1UWJA 3UQFA 2B54A 3DXQA 5IQCA 4QP1A 4JXFA 4USEA 3Q6UA 3G0FA 3DB8A 1J91A 2BDJA 3A7IA 3BZ3A 4OTPA 5EI8A 3ZRMA 4F9YA 5HO7A 3QD0A 4W9WA 3SOCA 1YOJA 4GT4A 4YSMA 2VV9A 5AEPA 4YJOA 3MVJA 2IO6A 4QYGA 1ZOGA 2NPQA 1J1BA 4ZOGA 1SVEA 3BYSA 3PSBA 5HE2A 1OL6A 4TNBA 2XYNA 5IQEA 4ANSA 4RWKA 4GW8A 3E7VA 3WIGA 3PDTA 1ZLTA 4PQNA 3ZU7A 3UIUA 1YW2A 3COMA 3VRYA 5AWMA 1MUOA 2UZBA 1W2DA 2V7OA 1Q61A 2WXVA 4BCFA 3TTJA 1NY3A 1H00A 1PY5A 4IXPA 4FSTA 4QNAA 3RAKA 2QOIA 3D83A 3V8WA 5CI7A 4YZMA 4O1OA 3CKWA 4D2WA 4V04A 4X2NA 4ZTSA 2WMBA 2YM8A 4E7WA 3Q3BA 4ZTRA 1KOBA 3LCKA 4EHZA 5DRDA 3I81A 4GRBA 4IAZA 4L45A 4U81A 3V5LA 3W8LA 3CEKA 4E8AA 2E9VA 5J5SA 4KA3A 4GIHA 4F08A 3LKMA 5CI6A 4I6HA 4I1ZA 4RZWA 2XANA 4R78A 4ANBA 4ZMFA 5E8VA 5M44A 2VO7A 3F3WA 4X7QA 2EUFB 3OVVA 5GIPE 3IECA 2WQEA 5CZIA 2WO6A 4TYHA 3P7CA 4O7YA 2GNIA 4QTCA 4X2FA 3JXWA 1JSUA 2JFLA 1UA2A 3ZONA 5IDPA 5LMBA 2VTLA 3HAMA 5EQYA 4U45A 3NFGB 2XAMA 4G3EA 2B55A 3MVHA 4FV4A 3ZEPA 5HNIX 5CSHA 3VUTA 2BPMA 4N0SA 1H1PA 4HJOA 3UQCA 4XG2A 3MH0A 3LFSA 3MV5A 2BRHA 1WBWA 2FYSA 2YITA 2WTDA 3P7BA 3CGOA 4QTDA 4RFMA 5H9BA 3QTSA 3TM0A 3KRLA 4GVAA 1FGIA 4PNIA 4CV8A 3CIKA 2P3GX 2ITZA 1Y57A 1K3AA 2RFDA 3GEQA 5CYIA 5HD4A 3S00A 3NVMB 4AQKA 3R02A 2B7AA 3ERKA 2ETKA 2QO2A 2Y6OA 5DGZA 5ETFA 3UO6A 4GH2A 2VTPA 4WRGA 4AUAA 2GQRA 4DDIA 1URWA 5KO1A 4HVGA 1P4OA 2C3IB 4QP4A 1CDKA 1K9AA 3F5GA 4O2ZA 3R2YA 3ZHPC 3RNIA 4KKHA 2W05A 5J1VA 4FGRA 4BDAA 4C33A 1M7NA 3MA3A 4PP7A 3RK5A 3C4WA 3LCDA 4CG8A 5C01A 3OFMA 3R83A 3MESA 3KRRA 4YZDA 4WBOA 4XG3A 2ZJWA 3ZUVA 1GAGA 4EOJA 1G3NA 2P2IA 3SQQA 3PXZA 2QI8A 4F9AA 1E9HA 2BALA 2BR1A 3BYMA 2XCKA 3W0NA 3CLYA 4HGSA 4XV1A 3SG8A 1VZOA 3O23A 3CCNA 3VF9A 4IWPA 2RG6A 5AP1A 3DAEA 3NNXA 4RA4A 2CCIA 3OWLA 4MBLA