1GNGA

Glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
349
structure length
348
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title The Structure of Phosphorylated Gsk-3Beta Complexed with a Peptide, Frattide, that Inhibits Beta-Catenin Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 348
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gngA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gngA01
1H1WA 3BE9A 5EYDA 5EQYA 1H28A 1P5EA 1UV5A 4I5MA 4IAKA 5EYMA 5AUUA 3LMHA 3DQWA 5A4QA 4IWDA 5BMMA 2P4IA 4KAOA 2QURA 4R77A 2EXCX 1YQJA 2WQMA 2JFMA 3OBJA 3W2OA 2P2HA 3SW7A 2R0IA 3R7UA 4X2GA 3EYHA 4ZTSA 2FVDA 3Q9XA 4P7EA 4DEHA 3OF0A 3FV8A 3ORNA 4RC4A 3G2FA 4FTIA 3OY1A 4FL1A 2WTJA 5B2KA 5L8LA 3F3TA 4MXXA 4NTSA 4JLCA 3IW8A 2I1MA 2VTSA 3EQFA 3QX2A 4JOAA 4BZDA 4FSRA 3UQCA 4UMRA 2ZVAA 3CE3A 4DEBA 3TT0A 3F2NA 4Z55A 2GS2A 5I5ZA 4TYEA 4FKQA 4OW8A 4MQ1A 3TUCA 3FZPA 2FSTX 4BBEA 2ONLA 1PXOA 3ORIA 5C01A 2XK8A 4J8NA 5A46A 1BL7A 3R9HA 4CCUA 4CFFA 4A9TA 2VWBA 4CFMA 4U9AA 4JQ7A 3BHVA 5JH6A 3KXMA 2ITVA 3QCQA 4E93A 3A7GA 5BQ0A 1KE8A 4I1ZA 4D5KA 4YR8A 2YISA 3ZXZA 1SMHA 3T8OA 2H9VA 4ZTMA 4I4FA 3QX4A 3E8DA 2QU6A 4JXFA 4WBBB 3V5TA 4D9UA 4JDIA 5AP3A 5H3QA 4FEUA 1MP8A 5HORA 5IQBA 1CKPA 1G3NA 1PXNA 3PSCA 2UW5A 2BRMA 5LCJA 4YJPA 4FSNA 4C8BA 4TL0A 2DS1A 5KMIA 4LL5A 3V3VA 5HIEA 1FPUA 1WCCA 4FIHA 3RI1A 4NIFB 3ORPA 1A06A 2YCFA 3UIBA 5FTGA 2C3JA 3OD6X 1IR3A 3H9RA 3K5UA 2WTDA 3P86A 1U59A 3ZLXA 2QVSE 3BYSA 3FE3A 2A0CX 3LJ0A 3QTWA 3VS1A 2F7XE 5CY3A 4RLLA 4CQEA 4DT8A 3KREA 1SYKA 4U3YA 3A4PA 3IO7A 4NUSA 1PKDA 4C57A 3ZM4A 2B9IA 3HMMA 3B2TA 3OWJA 4FT3A 4ALUA 4O7WA 2VWZA 4RJ3A 1PW2A 4TYIA 1MRUA 1R0PA 4C2WA 3E8CA 2Q0BA 1VR2A 3E64A 4ZSEA 4AX8A 3PWYA 3CCNA 3TKHA 5CAUA 5C4KA 5HO6A 4CZTA 2PYWA 2B54A 3PJ8A 4KB8A 5HE1A 2NNWB 2IVVA 4I6BA 3G33A 3P1AA 5GZAA 1T46A 3IK3A 4BWPA 5M07A 2ZJWA 3DNEA 4TNBA 2W9ZB 3DU8A 2QCSA 3FPQA 3R7GA 3DLZA 3UODA 4U97A 4IC8A 3ACJA 2ZV7A 4ONAA 1H1PA 2VX1A 3PG3A 2BHHA 5EI8A 4H3QA 2WZJA 3UO4A 1H1SA 4WRSA 2C0IA 3FLYA 4XBUA 4FSMA 3TV7A 2VWUA 3UPXA 4AF3A 4AW0A 3PZHA 3Q5IA 3JY9A 4FTKA 4DGLC 1SVGA 4MK0A 3A8WA 2CKPA 1F5QA 3CIKA 4MBLA 2BZKB 2C5YA 1RQQA 3ZMMA 3P9JA 3NVKI 4HVHA 1BMKA 1G8SA 3T3UA 4PL5A 3VHKA 4YJQA 3F7ZA 3GP0A 3ZS5A 3QD2B 3UBDA 4GL9A 1STCE 3PIYA 2B7AA 2XVDA 5HO7A 4FBXA 5TF9A 4CT2A 1JVPP 3EKNA 4I41A 5HCXA 4C33A 4JQEA 4PTGA 4BIDA 4B6LA 2R4BA 2UZDA 2UZOA 2GCDA 2ZM3A 2FH9A 3QD3A 4JG7A 3C4CA 2GFSA 5HI2A 3R7VA 3C0GA 4Y95A 4CSVA 4ERKA 4MQ2A 4PY1A 4LL0A 3FMHA 5CVFA 3R9NA 4G1WA 4FV7A 2WQOA 1YXXA 4K0YA 3LIJA 4CRSA 4E6DA 2JKKA 5CXZA 3QQKA 4E4NA 3F3ZA 4DFBA 4FSZA 5BVDA 2JBOA 2UZWE 3OMVA 3BYMA 4XOYA 5C27A 1EH4A 1Z57A 4H3BA 3ETAA 1S9JA 2VU3A 4S2ZA 4IAIA 4OBQA 3QGWA 5D7VA 5IF1A 4BDJA 3VS4A 3G15A 2YDKA 4BCJA 3ORTA 4DFLA 2B9FA 3GC8A 3PJ3A 1H26A 3ID6C 3CC6A 3FQEA 4DF3A 1AGWA 3U8WA 3E3BX 3RGFA 3MA3A 4BDAA 2VWWA 3CSVA 4WT6A 3RNIA 5FM3A 2CHLA 3FHRA 1YDSE 3MA6A 5AP5A 2WQBA 4AW5A 4CZYB 4DTBA 3FQHA 2PVRA 4EWHA 4JJRA 3LJ1A 3QQUA 3PA5A 2CJMA 4O82A 3KFAA 4UX9A 3AGMA 1LP4A 4RA4A 4CMTA 3EWHA 4QMUA 1OL6A 3KCKA 3UZRA 4QP6A 4LV8A 4F99A 4FSUA 4CCBA 4F6UA 4Y46A 2P33A 3LXLA 3UE4A 5CQUA 4IAAA 2ZAZA 5JRSA 3PVGA 5JQ5A 3VBVA 4GW8A 2OXDA 2W4JA 5GIOE 3I4BA 4ZTLA 2GHMA 3OCGA 3ZO2A 2EXMA 2OW3A 4YUQA 3KXXA 4U79A 5DVRA 5CF6A 3Q60A 4XRLA 2UVYA 5EYCA 1VYZA 3IG7A 4OT6A 5DYJA 3WIKA 4ACDA 5L3AA 2JIUA 4M12A 5J7BA 1REJA 1BUHA 3UP7A 4M3QA 3PJ2A 5DOSA 2V7AA 1ZMVA 2VTAA 1ZXEA 3FXWA 3KA0A 4IDVA 4PTEA 1PXIA 4CFUA 4YJUA 1J3HA 5CLPA 4E6AA 3MB7A 2IW6A 4I92A 2VTLA 4ACHA 2XBAA 3MFTA 5CAVA 3D5WA 5GZ8A 4NCTC 2J0MB 4D4SA 3A2CA 3ZDUA 2XNBA 1SVHA 2Y7JA 3D2IA 4YZMA 4EHGA 4A06A 1U4DA 3P7CA 4RGJA 3TIYA 4FEWA 4R1YA 3V6SA 1WBPA 4PNKA 5GIPE 3G6GA 5KMNA 3MTFA 3ITZA 4MXOA 3VIDA 4ANSA 2HK5A 3L1SA 1TQMA 3KULA 4MKCA 4C4FA 1PYEA 4TT7A 3SKCA 1LPUA 4AS0A 1O9UA 2X7GA 3IGOA 4RT7A 1OITA 1OKWA 2I0EA 2RFNA 3BV3A 2WMSA 4W4XA 2QKRA 4AE9A 4BTJA 3GU6A 3KXGA 4AOIA 2W5BA 1VYWA 5T68A 2BAKA 3OCSA 3JUHA 5EM6A 4FVRA 3SA0A 3ZUUA 2BRNA 5I3OA 3BU6A 2HW7A 2RFDA 2BMCA 2HY0A 2X8IA 2X6EA 3R8LA 3MPTA 4FUXA 4ZS4A 4U43A 4OAUC 4A7CA 5AJQA 2UV2A 1UVRA 4C36A 3HV6A 4O1PA 5HE2A 2JIIA 3RMFA 3REPA 5KKRB 3C13A 4X2NA 4D2SA 2QODA 4FIJA 3E8NA 2JEDA 2YAKA 3ZLYA 4D4VA 5IQDA 3NYXA 4BDIA 3CY2A 3O17A 3KVWA 3O7LB 3QTRA 5GJFA 1CSNA 1VJYA 3HMOA 3P4KA 4O7YA 4Y73A 3Q3BA 4L7FA 1W0XC 1XBCA 2O0UA 3NUYA 3POOA 4QP2A 4LI5A 3BX5A 2UZUE 1BYGA 3GU7A 4IHPA 4EBVA 5GJGA 2JDRA 2VTRA 5L2QA 3OHTA 4V04A 5IQCA 4G6OA 4FZ7A 5ANJA 3C4EA 4FGBA 3FDNA 4IZ5A 4KIKA 4X6RA 3RBWA 5HLWA 1JSTA 3F66A 2X7OA 1OECA 2ONLC 4BTFA 2NO3A 2W17A 3Q6WA 4QD6A 5IPJA 4XLIA 4DE4A 4ZZOA 1H25A 2FUMA 3A4OX 3ORKA 3OTVA 4UYAA 3GQLA 2A2AA 4GYGA 3A99A 4ZZMA 3RAKA 1XBBA 1J7UA 3C5IA 3GU5A 4QP7A 4I5HA 4LMNA 2F49A 3PXKA 3LM0A 3I1AA 1PXMA 5A9UA 5M55A 3JXWA 3DT1A 3IS5A 2W1EA 4GVJA 5I9YA 3NUSA 3FMMA 4U44A 3CKXA 5FXQA 3L8SA 4IVBA 2C6KA 3FC2A 1WFCA 3HGKA 4TYGA 4FTNA 3TNHA 3HV3A 4B7TA 2XJ2A 4D2RA 4AZTA 3R9RA 5M06A 4ITHA 2ITNA 4FV9A 4LOOA 2CGVA 3O71A 4IFCA 4MD7E 3PPZA 2WTKB 3R73A 3DXPA 1F3MC 3KVXA 3U4UA 5HVKA 3BYUA 3IW4A 3GCSA 1PY5A 3QRUA 3QGYA 1JKTA 4NJDA 4II5A 5HGIA 2YABA 4UALA 4DFYA 3JVSA 3SD0A 4HCUA 4TXCA 4ZTQA 3RALA 3ZO4A 4F6WA 1TVOA 1Y8GA 3KGAA 4F7JA 2G01A 4MXAA 4DLIA 3F5PA 5KHWA 3K3IA 2BIYA 4EWQA 1DAYA 5KBQA 4EK6A 3CLYA 4XV3A 2VTQA 3LQ8A 4K33A 2WOUA 4O83A 3O2MA 4GG5A 2F9GA 4R1VA 4GU9A 2OF4A 3PXFA 4N70A 5DGZA 3TZ8A 4ZXTA 2XKEA 3BEAA 4RX9A 5CSHA 4JDKA 1H27A 3OZ6A 2ETRA 3D0EA 4FKIA 4O2PA 5HG9A 5LVNA 4IX6A 5ACBC 2CKQA 3Q2JA 3LFSA 4N6ZA 4DEGA 3ZRLA 2R3QA 3F7WA 2XNMA 1LUFA 3GI3A 3FAAA 4O7ZA 1HCLA 1GIHA 1UWHA 4R7HA 2HAKA 4ANOA 3WBLA 3QCYA 1MQBA 2OJGA 5J1WA 3R7YA 4WA9A 3ZRKA 4EEVA 4X2JA 5CTPA 3O50A 1ZRZA 2ITYA 2OG8A 2W1FA 4XP3A 5BVOA 5GINE 3PY3A 5KMMA 2X2KA 3D15A 3I79A 2YA9A 3OWKA 3OTUA 3OT3A 5F94A 4CMOA 4CYJA 4HVDA 4O7SA 3RK7A 5KNJA 4IVCA 3KCFA 4FKWA 4O38A 1Z5MA 3NUNA 3UC4A 4DT9A 5LJJA 3LFFA 3P08A 4NT4A 4YGAA 3M1SA 3E7OA 4I20A 5H8EA 3TV4A 1PJKA 3NW6A 1Q8ZA 4RSSA 4JVGA 3QZHA 4P5QA 4R7IA 3COMA 4ZTRA 5JGBA 5JFSA 3HA6A 4G3FA 4KRCA 4MVFA 2WIHA 3GB2A 3OCBA 5IUGA 2QLUA 2XK7A 5DG5A 3TN8A 4PF4A 5M51A 3AMYA 1PMEA 5AM6A 4MNEA 4E4MA 2JKOA 3U9CA 4ASZA 2J51A 3CY3A 3VBXA 4RVKA 4A9SA 4KBCA 5D41A 1KWPA 4YPSA 5AR5A 1KOBA 4NSTA 4XUFA 2QI8A 4TZRA 2VX3A 1ZARA 2VV9A 4CTCA 5JFWA 3ZXTA 4U5JA 4E5BA 1ZZ2A 4I22A 3HV4A 3MIYA 4FNXA 5AR4A 5LARA 5CVGA 3EZVA 4YZNA 4D4YA 2R3KA 1H4LA 4FTJA 5AA8A 3DY7A 4DGGA 3RK9A 1OBDA 1KV1A 5IH5A 2B0QA 4JIAA 2YDIA 3PVUA 2W4KA 3FYKX 2J2IB 3BRBA 4IX5A 4LUEA 4I5CA 4OTHA 3BEGA 3MWUA 4CLIA 2W9FB 4U81A 3RWQA 2PVKA 3PE1A 2WMAA 4ZOGA 3AOXA 3LFAA 3ANRA 3LHJA 4AZFA 4DCAA 2JBPA 4USDA 3R22A 5AP0A 1GNGA 3VQUA 4R6VA 4NW5A 5TR6A 2R3LA 4EOJA 3UQGA 2OXYA 4AOTA 1ZMWA 3C5UA 3PY0A 5AEPA 3FHIA 2VX0A 4BCGA 2PVLA 4Q5HA 4JI9A 5HIBA 3BYVA 3CQWA 4MF1A 1IA8A 5IDPA 1H01A 4MWHA 4BKZA 4FKPA 3QC4A 5DR2A 2IWIA 1GIJA 3UOHA 1G5SA 4ZTHA 4YZ9A 2BUJA 3MH0A 3QTQA 4ZLYA 4QPAA 4EH3A 2YHVA 2BKKA 2G9XA 5IQEA 3IOKA 3PG1A 3TZMA 3GUBA 4G31A 2WTCA 3CTHA 4BCPA 5IEXA 4P90A 2YCQA 4RMZA 3RCDA 2VTTA 3O23A 4P5ZA 5AUZA 3A7JA 5FEQA 4BCFA 3OEFX 3ORXA 2QNJA 3C0HA 3FMJA 4L3PA 5JK3A 4F1TA 3DJ5A 3TKIA 3FI2A 3Q9YA 5IA5A 3EQDA 3ZU7A 1ZY5A 2PHKA 3W1FA 5EW9A 3WOWA 2XM9A 4DEIA 5L6OA 2F7EE 3R00A 3VRZA 3V5QA 4ENYA 4QO9A 2FB8A 3HMIA 4O2ZA 2NP8A 4E5WA 5I9VA 1YWRA 2OZAB 3E87A 4JBQA 1SNUA 4NIFA 2CDZA 3A7FA 5AAGA 3WI6A 2FSOX 1JNKA 4FNWA 2ETKA 4E26A 4ASDA 4HNIA 3VS2A 4IM0A 4IAFA 4RQVA 2XS0A 5EI6A 2GMXA 4QYHA 4RVMA 5IQHA 4UWBA 2VWXA 3MH2A 1P4FA 4I3ZA 5FQDC 1YHSA 5AR3A 4FL2A 4LQMA 4UN0C 3DLSA 1OIQA 4A9RA 3QZIA 3VO3A 4GSBA 3QUEA 3WZKA 1H1RA 4JG6A 4L3JA 4DA5A 4EJ7A 1KV2A 3LVPA 2ITUA 4L67A 2RFSA 4O21A 3UQFA 4XH6A 4AA4A 2CPKE 4U7ZA 2G15A 4DFZE 2PMLX 3ORMA 1E1VA 4ITIA 4S31A 3HAVA 5HBJA 2ITQA 2Y6MA 1WVWA 4EZ5A 4DG0E 3FMLA 4TWNA 4D58A 3LCSA 4BCIA 5HIDA 5IA4A 3UDBA 5E1EA 2R3RA 4BC6A 1XH5A 3QTSA 2DUVA 4CVAA 4RJ6A 4MXCA 4ORKA 4QT1A 3GFEA 4UEUA 4BI2A 4DFUA 1UKIA 3A7HA 3I5ZA 3CJFA 3I6UA 5CVHA 4WIHA 4FICA 2HYYA 3NNWA 4IE9A 5AUVA 2WB8A 3TV6A 5DHJA 3V6RA 1E9HA 2G2HA 2KULA 4B8LA 4C02A 4KUJA 4UMPA 2WMUA 2BHEA 2EB3A 3ANQA 3G0FA 3QXPA 4OR5A 4RPVA 2WOTA 4AWIA 3TUDA 3PUPA 3R8UA 4IFGA 3LKMA 3TDVA 4CGAA 2IW9A 3Q4TA 1H24A 1SVEA 3FLQA 4CMUA 3D7TB 3MW1A 2DWBA 4BCNA 4F1OA 3LCOA 4HVSA 5A6NA 3OUNB 2JDSA 4HVGA 4F65A 2HY81 2B4SB 2HCKA 3ZFMA 2WU7A 3ZLSA 2HXQA 3C4FA 3FY0A 4CRLA 2XCHA 4XV2A 3LQ3A 5AIKA 1PKGA 3DBEA 2VO0A 4GU6A 4J7BA 1HCKA 5JZJA 4O6EA 3RINA 1Z9XA 4C35A 5HNGA 4BDCA 2XNGA 5FGKA 4IBMA 1MQ4A 4LGHA 4B99A 5LQFA 5LVPA 3LJ2A 2XKFA 3ZSHA 4BKJA 1KOAA 2FSMX 4KD1A 4LUDA 1OM1A 2QU5A 5J8IA 4N4SA 5CNOA 3QTZA 5K4IA 3MY0A 3HNGA 4GT4A 3KL8A 3R01A 3AD6A 3CTJA 4NU1A 4U41A 4ASXA 1YHWA 4D5HA 3L9MA 2WTIA 3FZTA 2PUIA 3U6JA 4TRLA 4D2PA 4BR3A 3POZA 3TEIA 2JLDA 3OBGA 1GZNA 2C6DA 3P23A 5AAEA 1Q8TA 2REIA 5L2WA 1DS5A 4RWIA 2X4ZA 3E8EA 3UMXA 2ITWA 4BHZA 3OXZA 5E8ZA 2RFEA 4LV5A 4JDHA 2R3NA 2RIOA 4BICA 3ZOSA 5DA3A 4F64A 1DAWA 2C5VA 1YKRA 3SX9A 4UBAA 3DZQA 1SZMA 1ZZLA 2YZAA 3RWPA 4JIKA 4AOJA 4FX3A 1W98A 2Y4IC 2DYLA 3QRIA 1FVRA 4HOKA 2VTHA 4BN1A 3G9NA 5F95A 2W7XA 2YCRA 4E6CA 1OZ1A 2XK6A 3FSKA 1ZYLA 1B38A 3OW3A 2JKMA 4EHVA 3HLLA 3PLAE 4G3EA 5EM7A 3MH1A 4N0SA 4J97A 3KU2A 4GK3A 2UZLA 5ETAA 4IB5A 5TT7A 3EL7A 3W2QA 3VS6A 4D1ZA 3Q9WA 4RIXB 3OT8A 2JD5A 4U0IA 1R3CA 4BYJA 4DFXE 3IW6A 2BZHB 4F9BA 3BPRA 3Q4ZA 3ZONA 3UVPA 2A1AB 3PP1A 2XZSA 4NM5A 2QOFA 4FKJA 3L9LA 3R6XA 4IZYA 3V04A 4ZK5A 3HMPA 3MI9A 3ROYA 3Q4UA 4MX9A 4UYNA 3RM7A 4EC8A 4J98A 4C3PA 3ZZWA 3ZLWA 5M4UA 3C51A 3RZFA 1GZ8A 3GQIA 4ANLA 4YC8A 5E8WA 5CT7A 3H30A 3LCDA 4FTRA 1OIUA 3E63A 5JFXA 1A48A 3ZFYA 5IQGA 4RVTA 3ZEWA 5HD4A 2XIRA 4FV5A 4RIWA 4F08A 3S00A 5AMNA 4JBPA 4DGMA 4WUAA 3IONA 3IDPA 4Q2AA 5ETFA 3LFNA 3PVBA 4FTLA 4PX6A 4I6QA 2IZRA 2VWYA 1OPJA 1V1KA 2EUFB 4O22A 4U6RA 5FBNC 4YSJA 1WBSA 3FJQE 1H0VA 5T6KA 1XR1A 3EYGA 5KZIA 5JQ8A 5HNBA 1CKIA 3LPBA 4OTQA 4GMYA 4BCHA 3PE2A 3S1HA 1UU3A 4YLJA 1UU7A 2BCJA 5GZ9A 4FEVA 2ZV2A 4OLIA 2W0JA 4CG8A 1UU9A 4UZDA 4FKRA 4RRVA 4V0GB 2VO6A 3NYVA 4ZY6A 3PIZA 2GQSA 3ODZX 2Y8OA 4X3FA 2ITXA 3SC1A 3UNKA 1QL6A 3EMGA 2WO6A 3HDNA 1Y91A 1RE8A 4F9AA 1BLXA 4LRMA 2WNTA 4BYIA 4KKGA 4ZY4A 4WG5A 5KO1A 3KN5A 3SRVA 2YWVA 2YM6A 3NWWA 4PDOA 2P55A 4QMYA 1YXVA 3AC4A 2VN9A 4C4EA 4FZ6A 2QOCA 3CEKA 1KE7A 2O63A 4X2FA 3RAIA 5A4LA 5H8GA 4AZWA 4O27B 3WE8A 4IEBA 5L2IA 3RHKA 4K8AA 3MVJA 3NNXA 2A19B 3MJ2A 5CAPA 2HXLA 4M84A 3KC3A 5C9CA 5CANA 1WBOA 3FC1X 3P5KA 4LRJA 3EFLA 3G90X 4CV9A 1TQPA 4HGLA 2IJMA 2OFUA 3Q32A 3PZEA 4HPUE 2QC6A 4ZEGA 5C03A 5I9ZA 1YXSA 2WQNA 2OJIA 2ZYBA 2VGPA 5I9WA 4XOZA 1B6CB 2SRCA 3DK6A 2UZVA 3F69A 5DN3A 1MRVA 4LGGA 4IJPA 5KBRA 3UOJA 4UXLA 1UNHA 3E92A 5AUYA 5BYYA 1JQHA 2XIZA 4DH7A 1LR4A 3R30A 4A4XA 3ZC6A 1FMOE 4IVDA 4M0ZA 1GZOA 1ZMUA 1F0QA 3AQVA 1PXLA 3M42A 2OIBA 1Q62A 4I6HA 4C2VA 4MEDA 5IZFA 3HVCA 1YW2A 4HCTA 4WBOA 4UMTA 3CXWA 5HCZA 5HG5A 5HLPA 4AQCA 3CGOA 4L46A 2X2LA 3LLTA 3DKGA 5HESA 3I0OA 4FSQA 2J0IA 4FG8A 4H58A 4M69B 4F7LA 5EQPA 3V5JA 2HWOA 3VRYA 3G6HA 3FZ1A 4APCA 2IPXA 5E9EA 1BI7A 3RPYA 3QFVA 4C34A 2F2CB 5AP1A 4DAWA 2B52A 3F9NA 1XO2B 3EL8A 5ANGA 3M11A 1YRPA 1TKIA 2BILB 3GC9A 4IJ9A 1REKA 4CEGA 1FGIA 3QD4A 2QQ7A 3UVRA 1BL6A 3U87A 2VTOA 2CLXA 4H39A 2QR7A 1M2RA 1APME 2J7TA 3JYAA 4ACCA 4DCEA 3SOAA 3W8LA 5DBXA 4LOPA 4NM3A 3UYSA 2WELA 5D7AA 4F7NA 3G51A 1NVRA 2W5HA 4D55A 2CN5A 3OROA 4GUEA 4CG9A 2RG5A 5E7RA 3TNQB 4L53A 3WYXA 4WNMA 4IWPA 2PZIA 3R02A 4JAJA 4XG3A 3VS3A 2GDOA 2I6LA 3GNIB 1M14A 1U54B 4O7RA 4QRCA 4WO5A 3TACA 3ZH8A 4ANQA 3LXNA 3OFMA 2WPAA 5BYZA 3KRWA 2XNPA 3D94A 5FTQA 4BGGA 3MVLA 4E4LA 2C6LA 2XJ1A 3HECA 3I7CA 3UIMA 4ZMFA 4EJNA 4RG0A 4E3CA 3NIZA 4LGDA 1P2AA 3U54A 2PE0A 3BHTA 2E9UA 4QPSA 4EH7A 1O6YA 4WNOA 2I0YA 4QQCA 4IANA 2B9HA 4ENXA 3RM6A 4YTHA 4DTAA 4HGSA 3NVMB 4YTCA 3C4ZA 5E8UA 4QP3A 4EZ3A 4NL0A 3D83A 2YCSA 4ZS0A 3MS9A 4O0SA 4Z3VA 5AAFA 3AC8A 1T45A 2C0TA 2WMXA 2ZM4A 3SXSA 3WZJA 1XH9A 5JGDA 3DKCA 2QO2A 1XKKA 3DKFA 5M08A 4EOSA 3DBCA 4IMYA 3DJ7A 3ZO3A 3EH9A 4TYHB 2Z02A 4O7TA 2PVFA 3HV5A 1Q24A 4AN9A 2YM4A 3BZ3A 3D14A 4DH1A 2R0UA 4HGTA 3KRJA 3L9NA 2GNLA 4WNKA 4DYMA 3R7EA 2VTPA 3JS2A 3QCXA 3FY2A 5CU3A 2YITA 2QOHA 2VGOA 3VUMA 2VTJA 4EHEA 5HU3A 2QO7A 4RX5A 3NNUA 4QMNA 4NFMA 5AV4A 1QPJA 4M7IA 3GEQA 2PZYA 2UVXA 2HZNA 1U5RA 3HDMA 4XP2A 3LZBA 3TKUA 1UKHA 4AAAA 4EBWA 2E9NA 3C9WA 4FV8A 5GJDA 3RKBA 4GIIA 4NYEA 4FSYA 4V01A 3VUDA 1JKKA 2JDVA 2JIVA 3II5A 4AA5A 4ACGA 4RWLA 4CYIA 3LAUA 1NW1A 4AN3A 3K3JA 5JRQA 3NUPA 4FVPA 2E9VA 5IQFA 5K9IA 4FYNA 4YJSA 4M68A 2BFXA 3F5GA 5HX6A 4BB4A 4L68A 2BZIB 3QZGA 4X0MA 4HVIA 4NW6A 3FL5A 2F57A 3V51A 4H3PA 1JSVA 4NK9A 3TG1A 3ZCLA 2J0JA 2R3OA 4GJ3A 5ITAA 1ZOGA 3O8UA 5E8VA 1YDTE 3SXRA 1ATPE 2QOLA 3T9TA 2JGZA 4BVUA 4DEEA 3E93A 2IZTA 4UWCA 3HEGA 3PXQA 4XG9A 4OT5A 4G3GA 3LMIA 1UA2A 2J4ZA 1WBWA 2QOIA 3QD0A 4IXPA 3TZ9A 3ULIA 3ZDIA 5JKGA 2X2MA 3MN3A 3IOPA 3VF8A 3W2RA 5CASA 3QC9A 5CU4A 4IWOA 3RPOA 3UC3A 3WF9A 3GCUA 2JDOA 3ORLA 1JOWB 2DQ7X 3P0MA 3PSDA 5EW3A 4W9WA 3C4WA 4EOIA 4MD9E 4Q5EA 4DHFA 1M2PA 2VRXA 3MY1A 3NUXA 1M52A 2Q0NA 2WAJA 3KRRA 2AC3A 3MVMA 4BDGA 2J6MA 4HYIA 2ERKA 4YJTA 4L3LA 1OL2A 3V5PA 3IQ7A 3OUKA 4L45A 3IGGA 4PPAA 4CV8A 5CSWA 5K0XA 3F3UA 4FTTA 2C6TA 3UOLA 2OH0E 3FI4A 3GU8A 2XA4A 4GKIA 2BDJA 3JVRA 1OB3A 4EK3A 3RZBA 4OTIA 4KS7A 2GFCA 5IEYA 3ENMA 4I24A 4HNFA 4JR7A 2PVJA 3GVUA 5DEWA 2PSQA 3WYYA 3QBNA 4W4VA 1KSWA 4ID7A 1RJBA 5CEOA 3S0OA 4HYUA 3F82A 4K9YA 3DV3A 4G3DA 4CLJA 4ANMA 4D4RA 2GHGA 2Z7QA 4F4PA 4GT5A 3RVGA 3MY5A 5TKDA 3MVHA 4HZSA 5HCYA 3W2CA 4ZP5A 5BPYA 4WG3A 1QPEA 3AC2A 3HA8A 4AGWA 5IH4A 3QF9A 4OGRA 1M17A 1YXUA 4PL3A 4FG9A 3SQQA 3PWDA 2IG7A 1CMKE 2QOQA 2C0OA 1AD5A 2R7BA 2VWIA 3L8XA 3LMGA 4G17A 4X3FC 4BCKA 3L9PA 5GHVA 1IAJA 4EH4A 4R3PA 5DE2A 2RF9A 3CJGA 3RPSA 5FLFA 2LAVA 3VUIA 1M7QA 5HOAA 1XWSA 4GIHA 5C26A 3UNJA 3TL8A 5K4JA 2O5KA 3FZRA 2ETMA 5AP7A 3NMUF 3DZOA 4PV0A 3BELA 4DGNA 5M53A 2PMNX 2PK9A 5AV0A 3KMWA 3V8WA 3HMNA 2EXEA 3BBWA 2IN6A 5KUPA 5IDNA 5CT0A 3IW5A 3UMWA 4CT1A 5JZNA 1L8TA 4GK2A 2QD9A 2OK1A 1J7IA 1H08A 2RL5A 1OMWA 3NYNA 3P79A 3EIDA 5DLSA 4EOMA 4X3JA 5AR8A 3F2AA 4I0SA 3R21A 3TIZA 2PMOX 2VO7A 2FA2A 3HP5A 2YLFA 4G34A 3W2PA 4WHZA 5LVLA 3H0ZA 5LMBA 3U9NA 2ZOQA 3DAEA 4DBXA 4OTFA 4QMXA 2PMIA 3SAYA 4R7BA 4JX7A 5LVMA 2VUWA 4FV6A 4PL4A 4D1SA 4LRKA 4OTRA 3MB6A 2R3FA 1R39A 3QALE 5D12A 5EM5A 5FTOA 4QMTA 5DR9A 3GGFA 2YIYA 4AACA 3DAKA 1K2PA 3DBFA 4C37A 3BGZA 4YTIA 4L44A 3I0QA 3QRJA 4RIYA 4YTFA 4TYJA 4A4OA 2XNEA 2V7OA 3MH3A 3OW4A 3HRBA 4M0YA 1GY3A 3HUBA 4QP1A 3G0EA 3QHRA 3TJDA 1BKXA 3FMNA 1XHAA 3H9FA 2Y0AA 3QRKA 4MYGA 3DFCB 3IW7A 3EZRA 5K0KA 2WTKC 5ANEA 4KKHA 4FKTA 5AV2A 2PULA 3CQUA 4FUYA 3LXKA 4G5JA 4X6QC 5IA3A 5DT4A 4GEOA 5EHLA 4ZSGA 5A3XA 3GXLA 3DNDA 2C69A 5EHYA 2PPQA 3UZPA 1AQ1A 3ATSA 4FV1A 3SG8A 3R8PA 4WKQA 4QYEA 2CCIA 4EKKA 3R2YA 4IZ7A 4WG4A 4G2FA 1E1XA 4BKYA 4PDSA 4NH1A 3V01A 2OZOA 2RKUA 2C6OA 4FNYA 2O8YA 5CZIA 3RPVA 1ZWSA 3NUUA 4PQNA 5E8TA 3ULZA 3PYYA 2B9JA 3GT8A 2XRWA 3K5VA 3SOCA 1Q97A 1JPAA 4YZDA 4C4GA 3GC0A 2R64A 2GU8A 4BCMA 5AFVA 4DGOA 3A8XA 3COHA 4AGCA 4KSPA 1H0WA 4RIXA 4RFMA 5CI6A 5BVNA 3CGFA 4JNWA 3K54A 2QOKA 3VS0A 1OI9A 4M67A 3HAMA 3OVVA 4L6QA 4XBRA 3OWLA 5EKNA 2HIWA 2BRBA 3FKOA 3Q04A 3R7OA 5HE3A 4E7WA 1I44A 3QKKA 4U42A 2XK9A 2BDWA 5B0XA 3ZSGA 4L43A 1J1CA 3AD5A 4DC2A 1S9IA 3UZTA 4L00A 4ZLZA 3SG9A 1BX6A 5IISA 1GJOA 1URCA 4FTAA 3TJCA 4TPTA 4IAZA 2CGWA 2HZ0A 5CZHA 5FUTA 4Y72A 1ZY4A 5CSVA 2OH4A 4X2KA 3D9VA 3FSFA 4XG6A 5AX9A 2PUNA 3KXZA 4CFVA 3L8PA 2EVAA 4UMQA 4DLJA 3SHEA 5EYKA 4I21A 4GT3A 2XKCA 5J1VA 3OXIA 5DMZA 1M7NA 4RLKA 5H2UA 1FQ1B 5L8JA 1HOWA 1H8FA 1NA7A 3KULB 3LCTA 4IX4A 2E2BA 4M66A 5HBHA 1DI9A 4F6SA 5M57A 2LGCA 4EYMA 4MF0A 4OTPA 1WZYA 3JPVA 5D9HA 4FEQA 4ALVA 2I40A 3RNYA 3WE4A 3OG7A 1OIYA 4JRNA 4F1MA 4YJNA 2YIWA 4RJ5A 2XMYA 4RFZA 3MESA 5J79A 4EOOA 4IM2A 1PXKA 4FR4A 3IKAA 4BWXA 4EHZA 4FGRA 4CZUA 2YWPA 4QYFA 4FSWA 4QMWA 5DT0A 3EHAA 3FZOA 3PJCA 3DB6A 3QUPA 1V0OA 2GNFA 4PPBA 3DJ6A 5IA1A 3VJNA 4GKHA 4BWKA 2WMTA 4P4CA 4UZHA 5K3YA 4YURA 1GOLA 3FPMA 5EOLA 3TXOA 3V5WA 3WILA 2JAMA 4F0GA 3IPHA 4E5AX 3I60A 4XMOA 4O96A 3WIGA 4BDEA 1FINA 1YOJA 5J5SA 2Z2WA 3PDTA 4APPA 5CQWA 2QR8A 3GOPA 3MSSA 3HP2A 2WMWA 3F61A 3RTPA 3C0IA 4B4LA 1ND4A 2FGIA 3K2LA 3KRLA 2UW8A 1V0BA 3PFQA 4OBOA 4C3RA 5BUIA 4ZMEA 4IB1A 1K9AA 1U5QA 4XV1A 3COKA 3R71A 4FG7A 3OOMA 4LM5A 5ANOA 2JDTA 4EH2A 2W06A 2ZDTA 1OL5A 2X8EA 4PMTA 4F0IA 5HQ0A 2X4FA 5L2TA 4A4LA 4B8MA 4EI4A 4H1JA 3ZYAA 4YP8A 5IU2A 4FNZA 4Y8DA 4FTMA 5GNKA 3AMBA 5AUXA 2F2UA 2XKDA 3LFQA 4EKLA 2X9FA 3R1QA 3JR1A 3DDQA 4MXZA 5AV3A 3TWJA 3S4QA 2HZ4A 1Q3DA 4FKLA 1PYXA 2VWVA 4J8MA 3QXOA 5L6PA 1J91A 1Q4LA 4JG8A 5CAOA 2YFXA 1OKZA 1WVYA 5CSXA 5IMXA 3QKMA 5KCVA 3MV5A 1FMKA 1QPDA 5CWZA 3FYJX 1KE9A 5F1ZA 2CMWA 5BVWA 4OUCA 4F9YA 3UP2A 3NEWA 3VQHA 4FZDB 5IG1A 4YU2A 4RZVA 5TOZA 4UWYA 1YHVA 1YVJA 4AT4A 4RVLA 4FV0A 3ZTXA 1WBNA 1H00A 2BTSA 4K1BA 4M13A 4WD5A 3VBWA 4FKGA 2H6DA 3D7ZA 5I3RA 2Y4IB 2BAJA 3ZFXA 5AX3A 2YJSA 3MFSA 3QWKA 5HO8A 4K11A 3Q9ZA 4A9UA 5CENA 4AT3A 4ZIMA 4JBOA 2WXVA 4EH8A 1QMZA 5FRIA 4CXAA 4DEAA 2CLQA 4J53A 5A4CA 5DRBA 5J9ZA 1ERKA 4IW0A 2R3PA 1L3RE 5HKMA 2CKEA 4FV2A 3T9IA 4USEA 4QPMA 5HVJA 5C1QB 4QMZA 4KINA 4QMLA 4XYFA 3ELJA 4BZNA 1P14A 1YDRE 2I0HA 4XJ0A 4MXYA 2WKMA 1IEPA 2X9EA 3FBVA 4GVAA 3BU5A 5AADA 1H07A 4KIQA 3ZSIA 4J96A 3DOGA 4DH5A 1R78A 2V55A 4TKSA 4UV0A 5LVOA 4FTQA 4FSTA 4Y5HA 4FIFA 3SW4A 5HEZA 3DK3A 1O6LA 2BAQA 4Z7GA 4OTGA 1MUOA 2OICA 4AZSA 4GFOA 4YHJA 3O0GA 1CDKA 3U51A 5CYIA 3ATTA 3QUDA 4JT3A 3PP0A 2QONA 2Y4PA 5CEMA 2NPQA 5E90A 1X8BA 3I6WA 5IMEA 3BV2A 4OTDA 4PMMA 3D5XA 5BVKA 4FF8A 4GFGA 3VJOA 4QYYA 2X7FA 4BY9E 4O84A 2X6DA 1WBTA 3COIA 3QQJA 5IEVA 1YOMA 5E92A 1DM2A 2CNVA 4BIEA 2YEXA 4MNEB 4TYHA 4EK5A 4BBFA 5CF4A 4K2RA 3PTGA 4EUUA 2IZSA 2BIKB 2QHNA 4WSQA 2C6IA 5AM7A 5BUEA 2I7QA 3EN6A 3EOCA 1OUYA 3F2RA 3W55A 3RPRA 3GENA 2WHBA 2C6EA 3O8PA 4H36A 2PUUA 2XP2A 2J5EA 4ZSLA 3H4JA 4G6LA 2GTNA 2QKWB 3UO6A 1ZOHA 3QZFA 3FLSA 5A4EA 3EQRA 4IADA 5HLNA 4TN6A 4QNAA 3OS3A 3WZUA 5LMKA 2Y9QA 4D0WA 4D2VA 3DAJA 5M4FA 4O7NA 5A4TA 3QCSA 3QU0A 5DEYA 5CAQA 1URWA 4FEXA 5G6VA 2YN8A 1JKLA 2JC6A 5EQEA 2PWLA 2QO9A 3KQ7A 4QMVA 5I0BA 4CKIA 4EC9A 2RGPA 3AT2A 2OO8X 1H1QA 2BFYA 1OKYA 2GPHA 3RK5A 2WGJA 3SDJA 4JDJA 3RCJA 3NDMA 4TWOA 4OBPA 1R0EA 5EM8A 5F9EA 4O7LA 4UXQA 1YOLA 3VWAA 4FC0A 2A27A 2IW8A 4FT7A 3R83A 3KMUA 3P7AA 5CI7A 3KK9A 4A07A 4FL3A 5I4NA 5I9XA 2C3IB 3NZ0A 4NM7A 2UW7A 3SGCA 2C3KA 5AR7A 3BI6A 2OIDA 4MAOA 2W1DA 2GQGA 2WD1A 2YJRA 3NW5A 3F3WA 4EQMA 1PMVA 3JY0A 2G2IA 4ZY5A 1NXKA 2C30A 2IVSA 5EDRA 1W7HA 4CTBA 3VUKA 2W5AA 5F4NA 3UO5A 1KE6A 2J50A 1M2QA 4XP0A 1OIRA 3AC1A 4D2WA 3F5XA 4GFMA 1OGUA 3BGQA 3HKOA 4RJ4A 3BQCA 5EFQA 2XH5A 4O6LA 2GQRA 1JAMA 3PXYA 4GYIA 2B1PA 4NEUA 3UIUA 1KE5A 1GAGA 4U40A 2V0DA 4KNBA 2P3GX 2UVZA 3KF7A 2GNJA 4FTOA 4O1OA 4J95A 4Z9LA 3R7IA 4AT5A 5CSPA 3R1SA 4F9CA 1VZOA 3C50A 5AR2A 1OL7A 3WF7A 1GZKA 3LXPA 1WBVA 5EW8A 5H8BA 4G16A 4ZJJA 5HTCA 3TZ7A 4FV4A 4MBIA 3LFCA 4W4WA 4CNHA 3QTXA 4KS8A 2R7IA 4I94A 4RA5A 5J9YA 3PA4A 3CS9A 4IB0A 1IG1A 1ZYSA 4Q9ZA 5KMKA 2BALA 4RFYA 4YJRA 3WZEA 5BUJA 2WMVA 4FT9A 4EQUA 2YAAA 2IZUA 3NLBA 3ALNA 1I09A 5M4CA 2BR1A 2GNHA 2HW6A 5FDXA 4OTWA 2GNIA 2WMBA 4YNEA 4ZZNA 4YSMA 4RJ7A 5HHWA 5L6WL 5IH6A 5K5XA 4FYOA 3CD3A 4I4EA 4F63A 3FXZA 2ESMA 4W8EA 3VBTA 4KKEA 3ZBFA 1Y8YA 1B39A 2BDFA 3BGPA 3KK8A 3ODYX 2UZTA 3EN9A 3QYWA 4JAIA 3EN4A 4WRGA 4D2TA 1PMUA 2XRUA 3A60A 3DFAA 4PDPA 2PL0A 2W1IA 5FWKK 4C3FA 4EYJA 1RW8A 2WMQA 1NVSA 4E1ZA 4FKSA 4O7VA 2P0CA 3MIAA 1XJDA 2ZV8A 3Q5ZA 2XJ0A 2J5FA 3HRCA 4ALWA 4PNIA 3KRXA 1TQIA 4S34A 2XYNA 4D0XA 4ACMA 4RJ8A 1NT2A 4NKSA 2YM7A 1DI8A 3NW7A 2C5NA 4YHFA 2YM3A 2ACXA 3BYOA 4PMSA 3C4XA 5G1XA 3S3IA 2HELA 5ANKA 1FOTA 5BNJA 3D5VA 3DXQA 3H9OA 3PPJA 4BL1A 5CS6A 2PZ5A 4PTCA 3R28A 5KMLA 3BQRA 4YHTA 2C6MA 4QMOA 5CXHA 2CKOA 4QTCA 4GH2A 3FMEA 3BBTB 2YACA 4EQCA 3Q4CA 4O0RA 2J9MA 2CN8A 3GCVA 3GCQA 3BHHA 1PXPA 4ANNA 2R3JA 3U4WA 4TNDA 4RZWA 5FG8A 4JBVA 3EFKA 1UNGA 2R2PA 3MYGA 5JSMA 5CF5A 5KX8A 5DFPA 3MDYA 3TTJA 4QQ5A 2W1GA 4EORA 3PA3A 1SM2A 3F5UA 4EH6A 4YZCA 2GSFA 3UPZA 2BROA 3DTWA 3BHYA 3HX4A 4O0VA 3WF5A 4I0RA 5KHXA 3R8MA 5I9UA 3FLNC 2E9OA 2ITPA 3BIZA 2F4JA 4O0TA 3UG2A 2OLCA 5M4IA 4AUAA 1IASA 2BRGA 1W82A 3DQXA 3AC3A 4RWKA 1BI8A 5ACKA 3QQGA 4F70A 2XK3A 2GS6A 4O0WA 3DXNA 3H0YA 4IM3A 3LE6A 3MPAA 4X21A 5DH3A 4R3CA 4F09A 1FBNA 3OWPA 3DA6A 2XNOA 5E1SA 2JFLA 5ANIA 3V5LA 1Q5KA 3O96A 4E20A 2ITTA 3E5AA 3MGYA 4C4IA 2CGUA 2YM8A 3PPKA 4FMQA 3OOGA 1PMNA 2ZV9A 1CM8A 2ZMDA 4FTUA 4RBLA 5AIRA 3VUGA 2WTVA 5LWMA 1QCFA 1G8AA 2ITZA 5B2LA 1XQZA 4FZAB 3N4VA 3TM0A 2GNGA 4I0TA 3ZO1A 3UIXA 1GIIA 2V62A 5A14A 3NGAA 3SVVA 3G9LX 3FWQA 3C7QA 4IVAA 1U46A 3QLFA 4DBNA 4QMPA 2PY3A 2PE2A 2G2FA 4LG4A 5F20A 3VF9A 1OUKA 1XH7A 5FM2A 5LMAA 2RSVA 4MNFA 1V0PA 3D4QA 3EQGA 4NM0A 4AE6A 4EZ7A 2OIQA 3B8RA 3QWJA 4GJ2A 3SLSA 2UUEA 5ICPA 3FMDA 4EOKA 3NAXA 5HX8A 2C4GA 4JQ8A 3QAME 4R8QA 5CU6A 5J95A 4C58A 3DK7A 4L7SA 4D9TA 5M56A 2Z7SA 2WEIA 4AZEA 4NJ3A 2VD5A 3AT3A 3NYOA 5E8YA 2BZJA 2H96A 2I0VA 4HYSA 4M97A 4BGHA 4DITA 2CNQA 2WEVA 4UB7A 5DNRA 5E91A 3DB8A 5HBEA 5DT3A 4BI0A 4Y5QA 1CKJA 3VVHA 2UZBA 4KWPA 3WZDA 3VBYA 4C59A 3O51A 3E3PA 3FZSA 4I6FA 5FBOA 3UVQA 5HG8A 2E9PA 2OFVA 2QHMA 2B53A 4BCQA 5AA9A 5KZ0A 2PZPA 3LW0A 2YLEA 3QA8A 3DBQA 2W1ZA 4LMUA 4NWMA 3BWFA 3CPCA 4BF2A 4BIBA 4BTKA 3GBZA 2XM8A 2OI4X 5HZNA 4MD8E 4YO6A 4CFNA 3GFWA 3NNVA 3QYZA 2BKZA 2XUUA 3Q52A 4FIEA 4RIWB 4C0TA 3I5NA 3LOKA 4LYNA 3VS7A 4G9CA 4XCUA 2W96B 3KF4A 3DDPA 2X0GA 4FOCA 5FEEA 5C8MA 3LQ5A 5IKWA 3FI3A 4DN5A 3R04A 1R1WA 4KBKA 3PXRA 1NY3A 4XG8A 5HICA 3E7VA 4JRVA 1FVVA 4YC3A 3WARA 1WVXA 2VZ6A 2W99B 2CGXA 4XG2A 3PSBA 1ZYDA 2OJFE 2PVNA 3R0TA 3W33A 1J7LA 3QHWA 5EDPA 3P78A 4QMMA 3FL4A 3UGCA 4IDTA 2VTIA 5KE0A 3U55A 2Z8CA 1W84A 2BRHA 3KEXA 4IZAA 5BVEA 3P7BA 2R9SA 4AP7A 3AC5A 4MWIA 4G9RA 1YWVA 4X3FB 4Z7HA 3BLRA 1LEZA 4RC2A 5BYLA 4AFJA 4BGQA 4MTAA 2OU7A 3NX8A 3ACKA 5LMKC 2IVTA 5DWRA 3SRVB 4BTMA 2R3MA 3RAWA 4K6ZA 4V05A 3BU3A 1PXJA 2YDJA 5TO8A 3S95A 3FKNA 1Q41A 4EH9A 3EN7A 4G5PA 4YC6A 4OAVB 3LCKA 4L42A 1XH6A 4R5SA 3QRTA 3NAYA 5DR6A 5FXSA 5TE0A 2BPMA 3C1XA 2UW9A 4WUNA 3NR9A 1JKSA 2OZAA 3FQSA 2C1AA 1ZYCA 4BDFA 3ORZA 4RX8A 5BX0A 4AA0A 4GG7A 4YBKA 5DRDA 2Y6OA 3G5DA 3R63A 3ALOA 5C8NA 2YZLA 4FKUA 5JT2A 4BI1A 1WAKA 3NCZA 2C1BA 4YJVA 3M2WA 1MRYA 2RG6A 4MBJA 4IB3A 5L2SA 2FSLX 5EOBA 4RC3A 2UW6A 1PF8A 2H8HA 4FTCA 1Q8YA 4U3ZA 4C4HA 3CP9A 3DCVA 4WSYA 4EH5A 5KMOA 1JSUA 3E62A 3R8ZA 1UWJA 3OEZA 4I23A 5IUIA 2JKQA 4FKVA 4XLVA 5CEQA 3CPBA 2GTMA 2UZEA 3S2PA 3ZM9A 4FIGA 4B0GA 1J1BA 5ANDA 4RQKA 2IVUA 2O3PA 5BVFA 2H34A 1VEBA 4KIPA 5HTIA 5H9BA 3ZUVA 3I7BA 4HCVA 2WTWA 4RX7A 5EKOA 3NIEA 5BMSA 3EQIA 3BLHA 3V8SA 4F9WA 4Y83A 3W16A 4EOQA 4CFWA 5KKRC 4BDDA 3MFUA 2OJJA 3FXXA 3NPCA 3Q6UA 3SV0A 3R9DA 5ETCA 2BTRA 3SXFA 3MFRA 2AYPA 2R5TA 3AXWA 3DPKA 5FP5A 3HRFA 3LM5A 4S33A 4BFMA 5HNIX 2O2UA 3QLGA 3UTOA 3ROCA 3T3VA 2VTMA 2WMRA 4EOPA 3IECA 4F0FA 4FIIA 4PRJA 3ZUTA 1ZYJA 4AFEA 4QQTA 3D7TA 4ARKA 1OBGA 3KY2A 2EU9A 3EB0A 4H1MA 5C8KA 2UW0A 5JFVA 5J87A 3FKLA 1XH4A 4PUZA 4QOXA 5E8SA 4D28A 4HZRA 3CR0A 5E4HA 1FGKA 2PTKA 4HPTE 2O64A 4C61A 4P2KA 2PVMA 2QOBA 4RWJA 4C62A 3PIXA 2XK4A 3FUPA 5IQAA 3W2SA 3TNIA 4S32A 3QA0A 3GU4A 5EHOA 3A62A 4ZJIA 4BBMA 4KABA 5FXRA 2WFYA 1QPCA 3H3CA 3IDCA 4GK4A 2O65A 4O91A 2PU8A 4FKOA 2ERZE 2XIXA 5J5TA 4I93A 4BCOA 5JMSA 1XH8A 4C38A 2OBJA 3DGKA 3FI8A 4QTDA 2W1CA 5CU0A 3HV7A 4G3CA 1Y6BA 4U45A 3THBA 5CU2A 3TNPC 4B9DA 3QL8A 4XEYA 1SNXA 4RIOA 4CKRA 3TUBA 4S30A 1OKVA 2ZB1A 2C47A 4HJOA 4R78A 5J7HA 4GCJA 1OPKA 3DS6A 4L9IA 4PWNA 4AXAA 3CQEA 5JEBA 4TWPA 5B2MA 2ZM1A 2XCKA 3W10A 3R1YA 4N57A 2ITOA 2G1TA 4DINA 3MBLA 1W83A 2Z7RA 2KTYA 4QYGA 2UZNA 3NRMA 2XIKA 4BDHA 3PXZA 3HZTA 5E8XA 2CCHA 2GHLA 3BCEA 3N51A 3GOKA 5FDPA 4TY1A 4XV9A 4E73A 3Q96A 4U8ZA 3BLQA 3ERKA 4ERWA 2VNYA 5CX9A 4O86A 3AMAA 4FZFB 4KA3A 4C4JA 3EFWA 3EN5A 3IDBA 3KXNA 1YI6A 1JWHA 3HYHA 2P2IA 4TTHB 4CKJA 2W1HA 3FLWA 1KUTA 2C5OA 4QP9A 3WF6A 4ZLOA 4Z16A 5AP2A 5JGAA 4KRDA 4D1XA 4ZSAA 3DTCA 2XNNA 4QP8A 3V8TA 3R1NA 4NZWB 4FI1A 3B2WA 4NTTA 3ZEPA 5M09A 1UU8A 3PRFA 3QQFA 4IACA 3Q2MA 4FT0A 4I5PA 5FD2A 4QTEA 2X8DA 2YIRA 5C4LA 3LFDA 4M15A 2WU6A 3CKWA 3KN6A 3EQPA 4JR3A 4O0XA 2XEZA 2PZRA 2X39A 3QKLA 4FOBA 4QP4A 2Q83A 4PDYA 4FV3A 4DH3A 2PE1A 2UW3A 4O0YA 3RAHA 3N4TA 4X7QA 5KMJA 4IQ6A 4FE2A 4USFA 3QTIA 4XX9A 4BDKA 2J0KA 3U6HA 3O8TA 4IH8A 3EQHA 3E88A 3ZHPC 4KIOA 3ZRMA 3DBDA 3VBQA 5T3QA 3EKKA 5EI2A 3D5UA 1NVQA 2OXXA 1XBAA 4W4YA 2C68A 2VO3A 1LEWA 3NS9A 2GS7A 3R2BA 4L01A 4EL9A 3AG9A 4XRJA 5HD7A 3R8VA 2XYUA 2PVYA 2QLQA 4GUBA 3HUCA 3PLSA 2YIXA 2VAGA 3H10A 4L8MA 3PY1A 4V0GA 1W8CA 3TI1A 4YNOA 4GRBA 4QTBA 1P4OA 1WMKA 5FEDA 2OF2A 2X1NA 3FLZA 3AGLA 4BDBA 4EONA 5D10A 4DFNA 4DTKA 4ITJA 4YBJA 1O6KA 3TTIA 3RP9A 4E8AA 1YXTA 3L8VA 4DH8A 1PRYA 1Q99A 1K3AA 2FO0A 3B8QA 3VNTA 4EK4A 3NCGA 5HG7A 2HOGA 3VAPA 4PMPA 3AD4A 3U6IA 4QQJA 4TW9A 4UMUA 4Q9SA 4HGEA 3VW6A 3W8QA 4AGDA 3TNWA 1YI3A 4KBAA 3VS5A 3VUHA 5EK7A 4BHNA 4J52A 4ZTNA 4HW7A 2HENA 3Q53A 2QOOA 2ZB0A 2HWPA 1Q8UA 1OL1A 3QQHA 4R3RA 4HYHA 5AWMA 2ZMCA 4IIRA 5AP6A 3VC4A 5DIAA 4J99A 4AW2A 4J1RA 3OXTA 3EQCA 4YJOA 4KIKB 5CALA 3HL7A 2CSNA 5HU9A 3LFBA 4MCVA 3EFJA 4AGUA 3MJ1A 2X81A 5HE0A 3VW8A 1UNLA 3OCTA 2AC5A 3KXHA 3QTUA 4EK8A 4PP7A 4C7TA 3FMKA 4XS2A 4AZVA 4JX3A 5FP6A 5LWNA 1JBPE 5AP4A 3NSZA 4ZSJA 3ZC5A 4MH7A 2J0LA 2W05A 4BZOA 1CTPE 2OSCA 5LXMA 5HVYA 3VN9A 2WIPA 3KKVA 4EOLA 5IA2A 3A61A 3DKOA 4MHAA 5CEKA 4L52A 4Y85A 4AG8A 3I81A 4FVQA 4EUTA 2V5QA 5A54A 5EDQA 4XG7A 3BKBA 1IA9A 2EWAA 4K77A 2CNUA 4W8DA 3UJGA 2W4OA 2YERA 3A7IA 2IO6A 3CD8A 3LFEA 3N9XA 4M69A 4JS8A 1OVEA 2VTNA 5DI1A 4BRXA 5A6OA 3UG1A 4DG2E 4XHKB 2J90A 4JL9A 5AUTA 3WF8A 3LLAA 4QMQA 2OJ9A 3AT4A 4UY9A 4IX3A 4YZBA 5CEIA 2R3IA 1YWNA 3VUTA 4G6NA 2PVHA 3ZZEA 2AUHA 3F3VA 3UNZA 4ANBA 5IA0A 4IAYA 5K5NA 3D2KA 3UYTA 3VULA 2XIYA 1Q8WA 3W32A 3EJ1A 4R5YA 5JN2A 1Y6AA 2YIQA 3OC1A 4TWCA 5EG3A 4GV1A 4F7SA 3BWJA 5CF8A 2Z7LA 2XF0A 3EQBA 5ETIA 3RJCA 4YO4A 4YMJA 4PPCA 4XG4A 3BE2A 2Z60A 5IQIA 4DG3E 3O7LD 4K18A 3OP5A 3ZBXA 3F88A 3OY3A 1PHKA 3CBLA 5M44A 1IAHA 1U54A 4O81A 3PJ1A 4U80A 3UOKA 5J9LA 3FEGA 1ZLTA 4AW1A 3NUAA 4E6QA 3TCPA 5LOHA 2XBJA 4FODA 4NKAA 3QQLA 4FT5A 2R3GA 1Q3WA 1FVTA 4WOVA 3PVWA 4CQGA 1ZOEA 3F6XA 3MTLA 1YI4A 4O0UA 5L4QA 2UW4A 3CTQA 1A9UA 4YPDA 5LCKA 4FA2A 5CEPA 2PUPA 3GC7A 5D11A 4FK6A 4RIYB 4AN2A 4NFNA 3N4UA 1ZAOA 4GS6A 4YLKA 4ASEA 4ZJVA 4DEDA 3R9OA 4XNEA 5EH0A 2NRUA 2VNWA 4LOQA 2FYSA 3MPMA 4IC7A 4W9XA 3PRIA 4PP9A 4WNPA 4H05A 1Y57A 3TDWA 2C5XA 5DPVA 2OWBA 4M8TA 3VHEA 4AU8A 5HTBA 2JAVA 2QG7A 5B7VA 1OPLA 1IRKA 3W18A 2YM5A 4J71A 5D1JA 3KB7A 4YLLA 2A4LA 3GCPA 2R3HA 4NCTA 3RHXA 4ZAUA 3BHUA 2XEYA 2HZIA 5AV1A 2EB2A 1RDQE 5AUWA 4QNYA 2QG5A 1JLUE 2F7ZE 2C3LA 3ENHA 4FK3A 2B55A 4M14A 2OKRA 5CNNA 3KMMA 2V22A 4CD0A 2BVAA 2XB7A 2WQEA 4KSQA 4LFIA 4A9YA 5IUHA 2NRYA 3ET7A 4QMSA 4CFXA 5L8KA 2OGVA 1Q61A 4N6YA 4QTAA 4E4XA 2JITA 2ZDUA 4IWQA
chains in the Genus database with same CATH superfamily
1H1WA 3BE9A 5EYDA 5EQYA 1H28A 1P5EA 1UV5A 4I5MA 4IAKA 5EYMA 5AUUA 3LMHA 3DQWA 5A4QA 4IWDA 5BMMA 2P4IA 4KAOA 2QURA 4R77A 2EXCX 1YQJA 2WQMA 2JFMA 3OBJA 3W2OA 2P2HA 3SW7A 2R0IA 3R7UA 4X2GA 3EYHA 4ZTSA 2FVDA 3Q9XA 4P7EA 4DEHA 3OF0A 3FV8A 3ORNA 4RC4A 3G2FA 4FTIA 3OY1A 4FL1A 2WTJA 5B2KA 5L8LA 3F3TA 4MXXA 4NTSA 4JLCA 3IW8A 2I1MA 2VTSA 3EQFA 3QX2A 4JOAA 4BZDA 4FSRA 3UQCA 4UMRA 2ZVAA 3CE3A 4DEBA 3TT0A 3F2NA 4Z55A 2GS2A 5I5ZA 4TYEA 4FKQA 4OW8A 4MQ1A 3TUCA 3FZPA 2FSTX 4BBEA 2ONLA 1PXOA 3ORIA 5C01A 2XK8A 4J8NA 5A46A 1BL7A 3R9HA 4CCUA 4CFFA 4A9TA 2VWBA 4CFMA 4U9AA 4JQ7A 3BHVA 5JH6A 3KXMA 4QEBA 2ITVA 3QCQA 4E93A 1VLRA 3A7GA 5BQ0A 1KE8A 4I1ZA 4D5KA 4YR8A 2YISA 3ZXZA 1SMHA 3T8OA 2H9VA 4ZTMA 4I4FA 3QX4A 3E8DA 2QU6A 4JXFA 4WBBB 3V5TA 4D9UA 4JDIA 5AP3A 5H3QA 4FEUA 1MP8A 5HORA 5IQBA 1CKPA 1G3NA 1PXNA 3PSCA 2UW5A 2BRMA 5LCJA 4YJPA 4FSNA 4C8BA 4TL0A 2DS1A 5KMIA 4LL5A 3V3VA 5HIEA 1FPUA 1WCCA 4FIHA 3RI1A 4NIFB 3ORPA 1OGYA 1A06A 2YCFA 3UIBA 5FTGA 2C3JA 3OD6X 1IR3A 3H9RA 3K5UA 2WTDA 3P86A 1U59A 3ZLXA 2QVSE 3BYSA 3FE3A 2A0CX 3LJ0A 3QTWA 3VS1A 2F7XE 5CY3A 4RLLA 4CQEA 4DT8A 3KREA 1SYKA 4U3YA 3A4PA 3IO7A 4NUSA 1PKDA 4C57A 3ZM4A 2B9IA 3HMMA 3B2TA 3OWJA 4FT3A 4ALUA 4O7WA 2VWZA 4RJ3A 1PW2A 4TYIA 1MRUA 1R0PA 4C2WA 3E8CA 2Q0BA 1VR2A 3E64A 4ZSEA 4AX8A 3PWYA 3CCNA 3TKHA 5CAUA 5C4KA 5HO6A 4CZTA 2PYWA 2B54A 3PJ8A 4KB8A 5HE1A 2NNWB 2IVVA 4I6BA 3G33A 3P1AA 5GZAA 1T46A 3IK3A 4BWPA 5M07A 2ZJWA 4AXDA 3DNEA 4TNBA 2W9ZB 3DU8A 2QCSA 3FPQA 3R7GA 3DLZA 3UODA 4U97A 4IC8A 3ACJA 2ZV7A 4ONAA 1H1PA 2VX1A 3PG3A 2BHHA 5EI8A 4H3QA 2WZJA 3UO4A 1H1SA 4WRSA 2C0IA 3FLYA 4XBUA 4FSMA 3TV7A 2VWUA 3UPXA 4AF3A 4AW0A 3PZHA 3Q5IA 3JY9A 4FTKA 4DGLC 1SVGA 4MK0A 3A8WA 2CKPA 1F5QA 3CIKA 4MBLA 2BZKB 2C5YA 1RQQA 3ZMMA 3P9JA 3NVKI 4HVHA 1BMKA 1G8SA 3T3UA 4PL5A 3VHKA 4YJQA 3F7ZA 3GP0A 3ZS5A 3QD2B 3UBDA 4GL9A 1STCE 2XALA 3PIYA 2B7AA 2XVDA 5HO7A 4FBXA 5TF9A 4CT2A 1JVPP 3EKNA 4I41A 5HCXA 4C33A 4JQEA 4PTGA 4BIDA 4B6LA 2R4BA 2UZDA 1XMMA 2UZOA 2GCDA 2ZM3A 2FH9A 3QD3A 4JG7A 3C4CA 2GFSA 5HI2A 3R7VA 3C0GA 4Y95A 4CSVA 4ERKA 1W2CA 4MQ2A 4PY1A 3AKKA 4LL0A 3FMHA 5CVFA 3R9NA 4G1WA 4FV7A 2WQOA 1YXXA 4K0YA 3LIJA 4CRSA 4E6DA 2JKKA 5CXZA 3QQKA 4E4NA 3F3ZA 4DFBA 4FSZA 5BVDA 2JBOA 2UZWE 3OMVA 3BYMA 4XOYA 5C27A 1EH4A 1Z57A 4H3BA 3ETAA 1S9JA 2VU3A 4S2ZA 4IAIA 4OBQA 3QGWA 5D7VA 5IF1A 4BDJA 3VS4A 3G15A 2YDKA 4BCJA 3ORTA 4DFLA 2B9FA 3GC8A 3PJ3A 1H26A 3ID6C 3CC6A 3FQEA 3TYKA 1AGWA 3U8WA 4DF3A 3E3BX 3RGFA 3MA3A 4BDAA 2ZFYA 2VWWA 3CSVA 4WT6A 3RNIA 5FM3A 2CHLA 3FHRA 1YDSE 3MA6A 5AP5A 2WQBA 4AW5A 4CZYB 4DTBA 3FQHA 2PVRA 4EWHA 4JJRA 3LJ1A 3QQUA 3PA5A 2CJMA 4O82A 3KFAA 4UX9A 3AGMA 1LP4A 4RA4A 4CMTA 3EWHA 4QMUA 1OL6A 3KCKA 3TMOA 3UZRA 4QP6A 4LV8A 4F99A 4FSUA 4CCBA 4F6UA 4Y46A 2P33A 3LXLA 3UE4A 5CQUA 4IAAA 2ZAZA 5JRSA 3PVGA 5JQ5A 3VBVA 2XANA 4GW8A 2OXDA 2W4JA 5GIOE 3I4BA 4ZTLA 2GHMA 3OCGA 3ZO2A 2EXMA 2OW3A 4YUQA 3KXXA 4U79A 5DVRA 5CF6A 3Q60A 4XRLA 2UVYA 5EYCA 1VYZA 3PFYA 3IG7A 4OT6A 5DYJA 3WIKA 4ACDA 5L3AA 2JIUA 4M12A 5J7BA 1REJA 1BUHA 3UP7A 4M3QA 3PJ2A 5DOSA 2V7AA 1ZMVA 2VTAA 1ZXEA 3FXWA 3KA0A 4IDVA 4PTEA 1PXIA 4CFUA 4YJUA 1J3HA 5CLPA 4E6AA 3MB7A 2IW6A 4I92A 2VTLA 4ACHA 2XBAA 3MFTA 5CAVA 3D5WA 5GZ8A 4AXEA 4NCTC 2J0MB 4D4SA 3A2CA 3ZDUA 2XNBA 1SVHA 2Y7JA 3D2IA 4YZMA 4EHGA 4A06A 1U4DA 3P7CA 4RGJA 3TIYA 4FEWA 4R1YA 3V6SA 1WBPA 4PNKA 5GIPE 3G6GA 5KMNA 3MTFA 3ITZA 4MXOA 3VIDA 4ANSA 2HK5A 3L1SA 1TQMA 3KULA 4MKCA 4C4FA 1PYEA 4TT7A 3SKCA 1LPUA 4AS0A 1O9UA 2X7GA 3IGOA 4RT7A 1OITA 1OKWA 2I0EA 4AXCA 2RFNA 3BV3A 2WMSA 4W4XA 2QKRA 4AE9A 4BTJA 3GU6A 3KXGA 4AOIA 2W5BA 1VYWA 5T68A 2BAKA 3OCSA 3JUHA 5EM6A 4FVRA 3SA0A 3ZUUA 2BRNA 5I3OA 3BU6A 2HW7A 2RFDA 2BMCA 2HY0A 2X8IA 2X6EA 3R8LA 3MPTA 4FUXA 4ZS4A 4U43A 4OAUC 4A7CA 5AJQA 2UV2A 1G8JA 1UVRA 4C36A 3HV6A 4O1PA 5HE2A 2JIIA 3RMFA 3REPA 5KKRB 3C13A 4X2NA 4D2SA 2QODA 4FIJA 3E8NA 2JEDA 2YAKA 3ZLYA 4D4VA 5IQDA 3NYXA 4BDIA 3CY2A 3O17A 3KVWA 3O7LB 3QTRA 5GJFA 1CSNA 1VJYA 3HMOA 3P4KA 4O7YA 4Y73A 3Q3BA 4L7FA 1W0XC 1XBCA 2O0UA 3NUYA 3POOA 4QP2A 4LI5A 3BX5A 2UZUE 1BYGA 3GU7A 4IHPA 4EBVA 5GJGA 2JDRA 2VTRA 5L2QA 3OHTA 4V04A 5IQCA 4G6OA 4FZ7A 5ANJA 3C4EA 4FGBA 3FDNA 4IZ5A 4KIKA 4X6RA 3RBWA 5HLWA 1JSTA 3F66A 2X7OA 1OECA 2ONLC 4BTFA 2NO3A 2W17A 3Q6WA 4QD6A 5IPJA 4XLIA 4DE4A 4ZZOA 1H25A 2FUMA 3A4OX 3ORKA 3OTVA 4UYAA 3GQLA 2A2AA 4GYGA 3A99A 4ZZMA 3RAKA 1XBBA 1J7UA 3C5IA 3GU5A 4QP7A 4I5HA 4LMNA 2F49A 3PXKA 3LM0A 3I1AA 1PXMA 5A9UA 5M55A 3JXWA 3DT1A 3IS5A 2W1EA 4GVJA 5I9YA 3NUSA 3FMMA 4U44A 3CKXA 5FXQA 3L8SA 4IVBA 2C6KA 3FC2A 1WFCA 3HGKA 4TYGA 4FTNA 3TNHA 3HV3A 4B7TA 2XJ2A 4D2RA 4AZTA 3R9RA 5M06A 4ITHA 2ITNA 4FV9A 4LOOA 2CGVA 3O71A 4IFCA 4MD7E 3PPZA 2WTKB 3R73A 3DXPA 1F3MC 3KVXA 3U4UA 5HVKA 3BYUA 3IW4A 3GCSA 1ST0A 1PY5A 3QRUA 3QGYA 1JKTA 4NJDA 4II5A 5HGIA 2YABA 4UALA 4DFYA 3JVSA 3SD0A 4HCUA 4TXCA 4ZTQA 3RALA 3ZO4A 4F6WA 1TVOA 1Y8GA 3KGAA 4F7JA 2G01A 4MXAA 4DLIA 3F5PA 5KHWA 3K3IA 2BIYA 4EWQA 1DAYA 5KBQA 4EK6A 3CLYA 4XV3A 2VTQA 3LQ8A 4K33A 2WOUA 4O83A 3O2MA 4GG5A 2F9GA 4R1VA 4GU9A 2OF4A 3PXFA 4N70A 5DGZA 3TZ8A 4ZXTA 2XKEA 3BEAA 4RX9A 5CSHA 4JDKA 1H27A 3OZ6A 2ETRA 3D0EA 4FKIA 4O2PA 5HG9A 5LVNA 4IX6A 5ACBC 2CKQA 3Q2JA 3LFSA 4N6ZA 4DEGA 3ZRLA 2R3QA 3F7WA 2XNMA 1LUFA 3GI3A 3FAAA 4O7ZA 1HCLA 1GIHA 1UWHA 4R7HA 2HAKA 4ANOA 3WBLA 3QCYA 1MQBA 2OJGA 5J1WA 3R7YA 4WA9A 3ZRKA 4EEVA 4X2JA 5CTPA 3O50A 1ZRZA 2ITYA 2OG8A 2W1FA 4XP3A 5BVOA 5GINE 3PY3A 5KMMA 2X2KA 3D15A 3I79A 2YA9A 3OWKA 3OTUA 3OT3A 5F94A 4CMOA 4CYJA 4HVDA 4O7SA 3RK7A 5KNJA 4IVCA 3KCFA 4FKWA 4O38A 1Z5MA 3NUNA 3UC4A 4DT9A 5LJJA 3LFFA 3P08A 4NT4A 4YGAA 3M1SA 3E7OA 4I20A 5H8EA 3TV4A 1PJKA 3NW6A 1Q8ZA 4RSSA 4JVGA 3QZHA 4P5QA 4R7IA 3COMA 4ZTRA 5JGBA 5JFSA 3HA6A 4G3FA 4KRCA 4MVFA 2WIHA 3GB2A 3OCBA 5IUGA 2QLUA 2XK7A 5DG5A 3TN8A 4PF4A 5M51A 3AMYA 1PMEA 5AM6A 4MNEA 4E4MA 2JKOA 3U9CA 4ASZA 2J51A 3CY3A 3VBXA 4RVKA 4A9SA 4KBCA 5D41A 1KWPA 4YPSA 3W0QA 5AR5A 1KOBA 4NSTA 4XUFA 2QI8A 4TZRA 2VX3A 1ZARA 2VV9A 4CTCA 5JFWA 3ZXTA 4U5JA 4E5BA 1ZZ2A 4I22A 3HV4A 3MIYA 4FNXA 5AR4A 5LARA 5CVGA 3EZVA 4YZNA 4D4YA 2R3KA 1H4LA 4FTJA 5AA8A 3DY7A 4DGGA 3RK9A 1OBDA 1KV1A 5IH5A 2B0QA 4LDTA 4JIAA 2YDIA 3PVUA 2W4KA 3FYKX 2J2IB 3BRBA 4IX5A 4LUEA 4I5CA 4OTHA 3BEGA 3MWUA 4CLIA 2W9FB 4U81A 3RWQA 2PVKA 3PE1A 2WMAA 4ZOGA 3AOXA 3LFAA 3ANRA 3LHJA 4AZFA 4DCAA 2JBPA 4USDA 3R22A 5AP0A 1GNGA 3VQUA 4R6VA 4NW5A 5TR6A 2R3LA 4EOJA 3UQGA 2OXYA 4AOTA 1ZMWA 3C5UA 3PY0A 5AEPA 3FHIA 2VX0A 4BCGA 2PVLA 4Q5HA 4JI9A 5HIBA 3BYVA 3CQWA 4MF1A 1IA8A 5IDPA 1H01A 4MWHA 4BKZA 4FKPA 3QC4A 5DR2A 2IWIA 1GIJA 3UOHA 1G5SA 4ZTHA 4YZ9A 2BUJA 3MH0A 3QTQA 4ZLYA 4QPAA 4EH3A 2YHVA 2BKKA 2G9XA 5IQEA 3IOKA 3PG1A 3TZMA 3GUBA 4G31A 2WTCA 3CTHA 4BCPA 5IEXA 4P90A 2YCQA 4RMZA 3RCDA 2VTTA 3O23A 4P5ZA 5AUZA 3A7JA 5FEQA 4BCFA 3OEFX 3ORXA 2QNJA 3C0HA 3FMJA 4L3PA 5JK3A 4F1TA 3DJ5A 3TKIA 3FI2A 3Q9YA 5IA5A 3EQDA 3ZU7A 1ZY5A 2PHKA 3W1FA 5EW9A 3WOWA 4DHZA 2XM9A 4DEIA 5L6OA 2F7EE 3R00A 3VRZA 3V5QA 4ENYA 4QO9A 2FB8A 3HMIA 4O2ZA 2NP8A 4E5WA 3UDZA 5I9VA 1YWRA 2OZAB 3E87A 4JBQA 1SNUA 4NIFA 2CDZA 3A7FA 5AAGA 3WI6A 2FSOX 1JNKA 4FNWA 2ETKA 4E26A 4ASDA 4HNIA 3VS2A 4IM0A 4IAFA 4RQVA 2XS0A 5EI6A 4AAYA 2GMXA 4QYHA 4RVMA 5IQHA 4UWBA 2VWXA 3MH2A 1P4FA 4I3ZA 5FQDC 1YHSA 5AR3A 4FL2A 4LQMA 4UN0C 3DLSA 1OIQA 4A9RA 3QZIA 3VO3A 4GSBA 3QUEA 3WZKA 1H1RA 4JG6A 4L3JA 4DA5A 4EJ7A 1KV2A 3LVPA 2ITUA 4L67A 2RFSA 4O21A 3UQFA 4XH6A 4AA4A 2CPKE 4U7ZA 2G15A 4DFZE 2PMLX 3ORMA 1E1VA 4ITIA 4S31A 3HAVA 5HBJA 2ITQA 2Y6MA 1WVWA 4EZ5A 4DG0E 3FMLA 4TWNA 4D58A 3LCSA 4BCIA 5HIDA 5IA4A 3UDBA 5E1EA 2R3RA 4BC6A 1XH5A 3QTSA 2DUVA 4CVAA 4RJ6A 4MXCA 4ORKA 4QT1A 3GFEA 4UEUA 4BI2A 4DFUA 1UKIA 3A7HA 3I5ZA 3CJFA 3I6UA 5CVHA 4WIHA 4FICA 2HYYA 3NNWA 4IE9A 5AUVA 2WB8A 3TV6A 5DHJA 3V6RA 1E9HA 2G2HA 2KULA 4B8LA 4C02A 4KUJA 4UMPA 2WMUA 2BHEA 2EB3A 3ANQA 3G0FA 3QXPA 4OR5A 4RPVA 2WOTA 4AWIA 3TUDA 3PUPA 3R8UA 4IFGA 3LKMA 3TDVA 4CGAA 2IW9A 3Q4TA 1H24A 1SVEA 3FLQA 4CMUA 3D7TB 3MW1A 2DWBA 4BCNA 4F1OA 3LCOA 4HVSA 5A6NA 3OUNB 2JDSA 4HVGA 4F65A 2HY81 2B4SB 2HCKA 3ZFMA 2WU7A 3ZLSA 2HXQA 3C4FA 3FY0A 4CRLA 2XCHA 4XV2A 3LQ3A 5AIKA 1PKGA 3DBEA 2VO0A 4GU6A 4J7BA 1HCKA 5JZJA 4O6EA 3RINA 1Z9XA 4C35A 5HNGA 4BDCA 2XNGA 5FGKA 4IBMA 1MQ4A 4LGHA 4B99A 5LQFA 5LVPA 3LJ2A 2XKFA 3ZSHA 4BKJA 1KOAA 2FSMX 4KD1A 4LUDA 1OM1A 2QU5A 5J8IA 4N4SA 5CNOA 3QTZA 5K4IA 3MY0A 3HNGA 4GT4A 3KL8A 3R01A 3AD6A 3CTJA 4NU1A 4U41A 4ASXA 1YHWA 4D5HA 3L9MA 2WTIA 3FZTA 2PUIA 1ST4A 3U6JA 4TRLA 4D2PA 4BR3A 3POZA 3TEIA 2JLDA 3OBGA 1GZNA 2C6DA 3P23A 5AAEA 1Q8TA 2REIA 5L2WA 1DS5A 4RWIA 2X4ZA 3E8EA 3UMXA 2ITWA 4BHZA 3OXZA 5E8ZA 2RFEA 3W0SA 4LV5A 4JDHA 2R3NA 2RIOA 4BICA 3ZOSA 5DA3A 4F64A 1DAWA 2C5VA 1YKRA 3SX9A 4UBAA 3DZQA 1SZMA 1ZZLA 2YZAA 3RWPA 4JIKA 4AOJA 4FX3A 1W98A 2Y4IC 2DYLA 3QRIA 1FVRA 4HOKA 2VTHA 4BN1A 3G9NA 5F95A 2W7XA 2YCRA 4E6CA 1OZ1A 2XK6A 3FSKA 1ZYLA 1B38A 3OW3A 2JKMA 4EHVA 3HLLA 3PLAE 4G3EA 5EM7A 3MH1A 4N0SA 4J97A 3KU2A 4GK3A 2UZLA 5ETAA 4IB5A 5TT7A 3EL7A 3W2QA 3VS6A 4D1ZA 3Q9WA 4RIXB 3OT8A 2JD5A 4U0IA 1R3CA 4BYJA 4DFXE 3IW6A 2BZHB 4F9BA 3BPRA 3Q4ZA 3ZONA 3UVPA 2A1AB 3PP1A 2XZSA 4NM5A 2QOFA 4FKJA 3L9LA 3R6XA 4IZYA 3V04A 4ZK5A 3HMPA 3MI9A 3ROYA 3Q4UA 4MX9A 4UYNA 3RM7A 4EC8A 4J98A 4C3PA 3ZZWA 3ZLWA 5M4UA 3C51A 3RZFA 1GZ8A 3GQIA 4ANLA 4YC8A 5E8WA 5CT7A 3H30A 3LCDA 4FTRA 1OIUA 3E63A 5JFXA 1A48A 3ZFYA 5IQGA 4RVTA 3ZEWA 5HD4A 2XIRA 4FV5A 4RIWA 4F08A 3S00A 5AMNA 4JBPA 4DGMA 4WUAA 3IONA 3IDPA 4Q2AA 5ETFA 3LFNA 3PVBA 4FTLA 4PX6A 4I6QA 2IZRA 2VWYA 1OPJA 1V1KA 2EUFB 4O22A 4U6RA 5FBNC 4YSJA 1WBSA 3FJQE 1H0VA 5T6KA 1XR1A 3EYGA 5KZIA 5JQ8A 5HNBA 1CKIA 3LPBA 4OTQA 4GMYA 4BCHA 3PE2A 3S1HA 1UU3A 4YLJA 1UU7A 2BCJA 5GZ9A 4FEVA 2ZV2A 4OLIA 2W0JA 4CG8A 1UU9A 4UZDA 4FKRA 4RRVA 4V0GB 2VO6A 3NYVA 4ZY6A 3PIZA 2GQSA 3ODZX 2Y8OA 4X3FA 2ITXA 3SC1A 3UNKA 1QL6A 3EMGA 2WO6A 3HDNA 1Y91A 1RE8A 4F9AA 1BLXA 4LRMA 2WNTA 4BYIA 4KKGA 4ZY4A 4WG5A 5KO1A 3KN5A 3SRVA 2YWVA 2YM6A 3NWWA 4PDOA 2P55A 4QMYA 1YXVA 3AC4A 2VN9A 4FRFA 4FZ6A 2QOCA 4C4EA 4LV7A 3CEKA 1KE7A 2O63A 4X2FA 3RAIA 5A4LA 5H8GA 4AZWA 4O27B 3WE8A 4IEBA 5L2IA 3RHKA 4K8AA 3MVJA 3NNXA 2A19B 3MJ2A 5CAPA 2HXLA 4M84A 3KC3A 5C9CA 5CANA 1WBOA 3FC1X 3P5KA 4LRJA 3EFLA 3G90X 4CV9A 1TQPA 4HGLA 2IJMA 2OFUA 3Q32A 3PZEA 4HPUE 2QC6A 4ZEGA 5C03A 5I9ZA 1YXSA 2WQNA 2OJIA 2ZYBA 2VGPA 5I9WA 4XOZA 1B6CB 2SRCA 3DK6A 2UZVA 3F69A 5DN3A 1MRVA 2X0QA 4LGGA 4IJPA 5KBRA 3UOJA 4UXLA 1UNHA 3E92A 5AUYA 5BYYA 1JQHA 2XIZA 4DH7A 1LR4A 3R30A 4A4XA 3ZC6A 1FMOE 4IVDA 4M0ZA 1GZOA 1ZMUA 1F0QA 3AQVA 1PXLA 3M42A 2OIBA 1Q62A 4I6HA 4C2VA 4MEDA 5IZFA 3HVCA 1YW2A 4HCTA 4WBOA 4UMTA 3CXWA 5HCZA 5HG5A 5HLPA 4AQCA 3CGOA 4L46A 2X2LA 3LLTA 3DKGA 5HESA 3I0OA 4FSQA 2J0IA 4FG8A 4H58A 4M69B 4F7LA 5EQPA 3V5JA 2HWOA 3VRYA 3G6HA 3FZ1A 4APCA 2IPXA 5E9EA 1BI7A 3RPYA 3QFVA 4C34A 2F2CB 5AP1A 4DAWA 2B52A 3F9NA 1XO2B 3EL8A 5ANGA 3M11A 1YRPA 1TKIA 2BILB 3GC9A 4IJ9A 1REKA 4CEGA 1FGIA 3QD4A 2QQ7A 3UVRA 1BL6A 3U87A 4O4DA 2VTOA 2CLXA 4H39A 3BLAA 2QR7A 1M2RA 1APME 2J7TA 3JYAA 4ACCA 4DCEA 3SOAA 3W8LA 5DBXA 4LOPA 4NM3A 3UYSA 2WELA 5D7AA 4F7NA 3G51A 1NVRA 2W5HA 4D55A 2CN5A 3OROA 4GUEA 4CG9A 2RG5A 5E7RA 3TNQB 4L53A 3WYXA 4WNMA 4IWPA 2PZIA 3R02A 4JAJA 4XG3A 3VS3A 2GDOA 2I6LA 3GNIB 1M14A 1U54B 4O7RA 4QRCA 4WO5A 3TACA 3ZH8A 4ANQA 3LXNA 3OFMA 2WPAA 5BYZA 3KRWA 2XNPA 3D94A 5FTQA 4BGGA 3MVLA 4E4LA 2C6LA 2XJ1A 3HECA 3I7CA 3UIMA 4ZMFA 4EJNA 4RG0A 4E3CA 3NIZA 4LGDA 1P2AA 3U54A 2PE0A 3BHTA 2E9UA 4QPSA 4EH7A 1O6YA 4WNOA 2I0YA 4QQCA 4IANA 2B9HA 4ENXA 3RM6A 4YTHA 4DTAA 4HGSA 3NVMB 4YTCA 3C4ZA 5E8UA 4QP3A 4EZ3A 3ML1A 4NL0A 3D83A 2YCSA 4ZS0A 3MS9A 4O0SA 4Z3VA 5AAFA 3AC8A 1T45A 2C0TA 2WMXA 2ZM4A 3SXSA 3WZJA 1XH9A 5JGDA 3DKCA 2QO2A 1XKKA 3DKFA 5M08A 4EOSA 3DBCA 4IMYA 3DJ7A 3ZO3A 3EH9A 4TYHB 2Z02A 4O7TA 2PVFA 3HV5A 1Q24A 4AN9A 2YM4A 3BZ3A 3D14A 4DH1A 2R0UA 4HGTA 3KRJA 3L9NA 2GNLA 4WNKA 4DYMA 3R7EA 2VTPA 3JS2A 3QCXA 3FY2A 5CU3A 2YITA 2QOHA 2VGOA 3VUMA 2VTJA 4EHEA 5HU3A 2QO7A 4RX5A 3NNUA 4QMNA 4NFMA 5AV4A 1QPJA 4M7IA 3GEQA 2PZYA 4AQKA 2UVXA 2HZNA 1U5RA 3HDMA 4XP2A 3LZBA 3TKUA 1UKHA 4AAAA 4EBWA 2E9NA 3C9WA 4FV8A 5GJDA 3RKBA 4GIIA 4NYEA 4FSYA 4V01A 3VUDA 1JKKA 2JDVA 2JIVA 3II5A 4AA5A 4ACGA 4RWLA 4CYIA 3W0RA 3LAUA 4F78A 1NW1A 4AN3A 3K3JA 5JRQA 3NUPA 4FVPA 2E9VA 5IQFA 5K9IA 4FYNA 4YJSA 4M68A 2BFXA 3F5GA 5HX6A 4BB4A 4L68A 2BZIB 3QZGA 4X0MA 4HVIA 4NW6A 3FL5A 2F57A 3V51A 4H3PA 1JSVA 4NK9A 3TG1A 3ZCLA 2J0JA 2R3OA 4GJ3A 5ITAA 1ZOGA 3O8UA 5E8VA 1YDTE 3SXRA 1ATPE 2QOLA 3T9TA 2JGZA 4BVUA 4DEEA 3E93A 2IZTA 4UWCA 3HEGA 3PXQA 4XG9A 4OT5A 4G3GA 3LMIA 1UA2A 2J4ZA 1WBWA 2QOIA 3QD0A 4IXPA 3TZ9A 3ULIA 3ZDIA 5JKGA 2X2MA 3MN3A 3IOPA 3VF8A 3W2RA 5CASA 3QC9A 5CU4A 4IWOA 3RPOA 3UC3A 3WF9A 3GCUA 2JDOA 3ORLA 1JOWB 2DQ7X 3P0MA 3PSDA 5EW3A 4W9WA 3C4WA 4EOIA 4MD9E 4Q5EA 4DHFA 1M2PA 2VRXA 3MY1A 3NUXA 1M52A 2Q0NA 2WAJA 3KRRA 2AC3A 3MVMA 4BDGA 2J6MA 4HYIA 2ERKA 4YJTA 4BJJA 4L3LA 1OL2A 3V5PA 3IQ7A 3OUKA 4L45A 3IGGA 4PPAA 4CV8A 5CSWA 5K0XA 3F3UA 4FTTA 2C6TA 3UOLA 2OH0E 3FI4A 3GU8A 2XA4A 4GKIA 2BDJA 3JVRA 1OB3A 4EK3A 3RZBA 4OTIA 4KS7A 2GFCA 5IEYA 3ENMA 4I24A 4HNFA 4JR7A 2PVJA 3GVUA 5DEWA 2PSQA 3WYYA 3QBNA 4W4VA 1KSWA 4ID7A 1RJBA 5CEOA 3S0OA 4HYUA 3F82A 4K9YA 3DV3A 4G3DA 4CLJA 4ANMA 4D4RA 2GHGA 2Z7QA 4F4PA 4GT5A 3RVGA 3MY5A 5TKDA 3MVHA 4JMQA 4HZSA 5HCYA 3W2CA 4ZP5A 5BPYA 4WG3A 1QPEA 3AC2A 3HA8A 4AGWA 5IH4A 3QF9A 4OGRA 1M17A 1YXUA 4PL3A 4FG9A 3SQQA 3PWDA 2IG7A 1CMKE 2QOQA 2C0OA 1AD5A 2R7BA 2VWIA 3L8XA 3LMGA 4G17A 4X3FC 4BCKA 3L9PA 5GHVA 1IAJA 4EH4A 2XARA 4R3PA 5DE2A 2RF9A 3CJGA 3RPSA 5FLFA 2LAVA 3VUIA 1M7QA 5HOAA 1XWSA 4GIHA 5C26A 3UNJA 3TL8A 5K4JA 2O5KA 3FZRA 2ETMA 5AP7A 3NMUF 3DZOA 4PV0A 3BELA 4DGNA 5M53A 2PMNX 4FJVA 2PK9A 5AV0A 3KMWA 3V8WA