2B4SB

Crystal structure of a complex between ptp1b and the insulin receptor tyrosine kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
294
Chain Sequence
DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/transferase
molecule keywords Tyrosine-protein phosphatase, non-receptor type 1
publication title Crystal Structure of a Complex between Protein Tyrosine Phosphatase 1B and the Insulin Receptor Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 294
sequence length 297
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2b4sB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2b4sB01
4C0TA 4FUXA 4GH2A 5KNJA 4FYOA 4X3FA 2AYPA 2WTKC 3ZS5A 5HX8A 3OG7A 3B2TA 4RA4A 1JQHA 3M11A 2BTSA 2VN9A 3OHTA 5BQ0A 5B0XA 4FZAB 4OTIA 4K9YA 3R28A 5KHWA 4Y8DA 2ESMA 4ANOA 4XX9A 3HMMA 5J1VA 1ZLTA 2G15A 4PF4A 4QPAA 4HPTE 3TACA 3DZQA 1ZWSA 5C4KA 4NTSA 3UIMA 1FBNA 4ALVA 1OPLA 4L45A 3AT2A 4YGAA 5EM5A 5HICA 5IDPA 3FI8A 2DUVA 3HL7A 4RLLA 4YJTA 4USEA 4ANSA 3RCDA 2Z7LA 5DMZA 3OEFX 4FIEA 3OZ6A 2IG7A 3VUKA 2G9XA 1OKZA 4FV8A 2W4JA 2XNPA 3FMDA 4IH8A 5J9YA 4FKWA 4TZRA 5K5NA 4AE9A 4GVAA 3TJDA 3LFCA 3V5WA 3R2BA 5E8SA 2A19B 2WOUA 4MAOA 4FK6A 1SVGA 3T3UA 5CY3A 3LFFA 5DR9A 5IF1A 1M2RA 3GXLA 2PHKA 3MSSA 4QTAA 4O2PA 4F1TA 4GK2A 5FP6A 3SA0A 3C4WA 5BMMA 2ETMA 3G51A 2CGWA 2WIPA 2C30A 2VTOA 3I7CA 4IVAA 3ZONA 3ZFMA 2FO0A 4OT6A 5M55A 2QLQA 2YA9A 5J1WA 3FLWA 4FKLA 5M09A 3ANQA 3DK3A 1OUYA 4PPCA 4EOQA 3G0EA 4HNIA 4M8TA 3L9PA 4ZTHA 1OIYA 3R2YA 4O86A 3O8PA 3UOLA 4YLKA 4CFWA 4DH5A 1VYZA 4CLJA 2GQRA 5HTIA 4CRLA 1O9UA 4KIKA 2IVVA 1GZ8A 4PTGA 3FY2A 4AA4A 4IZAA 3VW8A 3DLSA 4DEEA 5FTGA 4R3PA 2C69A 3QWKA 4RX9A 1M2QA 3VBVA 3ZSIA 3WYYA 2WIHA 2R3JA 3D2IA 5DR2A 5CEIA 3VUHA 4AT3A 1REJA 4F9AA 2PMIA 4WNPA 4YP8A 2C5VA 2W9ZB 3W33A 4OT5A 5EW3A 3QALE 5HESA 4EH3A 2R3KA 3FLZA 1Z5MA 3PTGA 4EOOA 2YZLA 5EW9A 4TY1A 3OROA 3D94A 3SXFA 2YIQA 3FUPA 5I3OA 3SW4A 3GENA 2B9HA 3GCPA 1Y6BA 3L8XA 1FINA 3R7YA 1H25A 2NP8A 2XBJA 1XQZA 2X39A 1QL6A 5E8YA 3ZZWA 3PXKA 4GG5A 4F99A 2IZUA 2P4IA 5DT3A 3R9OA 2GCDA 4FX3A 4TNDA 5GJFA 3NYVA 3RINA 2R7IA 4I6BA 5L8JA 4B7TA 2ZMCA 3ZC5A 2EXMA 3E3BX 2VTNA 5TKDA 1NW1A 3RBWA 2FSOX 2VTQA 4EH7A 2Z7QA 4ERWA 4ZK5A 4YJOA 2PVYA 1IA9A 5I9YA 4ZSEA 2OIDA 3OW3A 3V51A 4EHGA 4D2WA 4XG4A 3BWJA 5CU6A 3SAYA 1BI8A 4DGOA 5I9VA 4XV2A 1SYKA 2IVSA 4NKAA 3SRVA 2KULA 2UZBA 4MXXA 4HZRA 4UZDA 5FRIA 1UU3A 1PXJA 2R4BA 2C68A 4FIFA 4UN0C 3ORXA 4YHFA 2XM8A 2IVUA 4CNHA 3VBTA 3FMEA 2QONA 4RQKA 2VTRA 1SM2A 1UA2A 3BHUA 3TTIA 2PY3A 4ZJVA 2XNMA 2OI4X 1SVEA 1JLUE 3GQLA 3KULB 1FGKA 5AV1A 3QQHA 4L42A 2Y4IC 1GIHA 4BCGA 3L1SA 4I6FA 4Y85A 1DI8A 3ZXZA 5IQBA 4DBXA 1HCKA 2ITUA 5TE0A 2BR1A 4RLKA 5A4LA 3F7WA 3MI9A 4O7TA 3TM0A 3N51A 5CVGA 4FIIA 4QO9A 1E9HA 2HZIA 4AG8A 4J97A 2VZ6A 2VWZA 5EW8A 2YM3A 3QQUA 4MF0A 3UPZA 2VO7A 2BZIB 1PKGA 4HGLA 2XRUA 4LFIA 5GIOE 5F95A 2IW9A 4OTQA 3I6UA 1QCFA 3BYSA 4DFNA 1MQBA 2W1ZA 2C6EA 3LHJA 5CENA 1YI6A 3C51A 4G5PA 4I20A 2HAKA 2WMSA 3MB6A 5DG5A 4ZZMA 3RPVA 3UGCA 2RG6A 3I4BA 4J53A 3SOAA 2NO3A 4IC8A 3NR9A 3PZEA 1PKDA 4DT9A 4JXFA 2X4ZA 1OBGA 2XJ0A 3GUBA 3PA5A 3NCZA 4GG7A 4ZXTA 3UIBA 3ATSA 3CQWA 4QMOA 4AW5A 3CD3A 3KA0A 4XG6A 4CV9A 1J3HA 3TNWA 3TZ9A 3FDNA 3ENMA 3UMXA 4I5HA 4C37A 4C34A 4E20A 4ERKA 3NUNA 1LEZA 3PSCA 4IE9A 5D7VA 3MY1A 1KE9A 3PUPA 5I9XA 2ZM4A 3Q60A 4OTRA 4JNWA 5L2IA 2BVAA 3DLZA 3GQIA 3EKNA 4FNZA 1GZKA 3JYAA 5HVJA 4EQCA 4RX5A 4C7TA 4CG9A 4UWCA 3IG7A 4X2GA 3EFWA 5C26A 3UOJA 4EHZA 4OAVB 1KSWA 3GU8A 3FKLA 3LM5A 3QTQA 4PL5A 5EH0A 3KMWA 1EH4A 4FK3A 4L3LA 4TN6A 2WMBA 3UIXA 4BGQA 4E4XA 5HX6A 5EHYA 4PRJA 4XG8A 1RJBA 3HV3A 3WF6A 1IASA 4NSTA 4QP9A 3U8WA 5I9WA 2ONLA 3MTFA 4D55A 4BIBA 2GQSA 4NCTA 2I6LA 1ZOGA 2RF9A 1UU9A 3I60A 4CFFA 1PMVA 2R7BA 3VWAA 4EWQA 4EZ3A 4WRGA 3FMNA 3F3WA 3BX5A 4P7EA 4BDFA 2ZMDA 4HYSA 4M66A 5A9UA 3KVXA 1BL7A 2YEXA 5J87A 3W2OA 3NUXA 5JMSA 3QXPA 4IB0A 4HCTA 4E26A 3V5TA 2W1CA 5ANIA 1OBDA 2OFVA 5CYIA 3TNPC 3TCPA 3G33A 3HUBA 5F94A 3R02A 3CEKA 2W5BA 2QOKA 2Y6OA 3UVRA 1PYXA 4GRBA 4O0RA 2Y8OA 5C8KA 5J9LA 4DA5A 4UWBA 5M07A 2DQ7X 2YLFA 3O7LB 3CS9A 4IAAA 3O8UA 3EWHA 4KINA 2YN8A 3AC5A 4WBBB 3SW7A 3A8XA 4IDTA 1YDTE 3DBCA 4M15A 4D58A 4DAWA 2BKZA 2FYSA 3Q04A 4O0TA 1REKA 2PPQA 4YTFA 4O0SA 3VS5A 4U3YA 3T8OA 3IO7A 3MPTA 5DN3A 1O6KA 3QTRA 2WKMA 5LXMA 3C5UA 2P55A 2GQGA 1ZOHA 2JLDA 4N6YA 4H3QA 4K0YA 4IW0A 3Q4CA 4GU6A 4FIJA 4FGBA 4ALUA 2UVZA 3D5XA 2VRXA 3DQWA 4P4CA 4O7LA 2JDSA 4FNXA 4YHJA 1UWHA 2XH5A 2ITQA 3IK3A 3W16A 1PW2A 2Z2WA 3KULA 3MPAA 4RVKA 2RGPA 3R7IA 5CT0A 4L44A 3QKKA 3TIYA 4BWPA 5A4QA 3EN7A 4FKTA 3GI3A 5BYYA 3RAKA 4Y5QA 3PPKA 4XBRA 4ASDA 3B8RA 4NYEA 5FUTA 1U4DA 3LFNA 3UMWA 3EQDA 4B8MA 2QD9A 4D9UA 3ULIA 4C4EA 3WILA 5GZAA 4D9TA 4O7SA 4FKRA 1JNKA 2ERKA 3ORPA 3PVWA 5FXSA 3QD4A 5AAFA 4D4VA 5IZFA 1UNHA 4YMJA 4IWPA 1OECA 1GAGA 4PMTA 3TV6A 4BDGA 2WHBA 2JITA 3ZFXA 4BYJA 2B9FA 1BKXA 2E9OA 2RFSA 2WMAA 5GZ9A 4CZUA 2C5OA 3OEZA 4IAYA 4I3ZA 2YLEA 2UZUE 4S2ZA 4XBUA 2OICA 4XRLA 4ORKA 3D5WA 3QUDA 3REPA 3KEXA 4FL2A 5M4CA 1YHVA 5FDXA 3C0HA 3S4QA 1V1KA 4JDIA 5JQ5A 5HE1A 2UW3A 3RJCA 3CTHA 5BVOA 5DFPA 4FV6A 4EH2A 1QPJA 5M56A 3IECA 5ANJA 2YZAA 4IANA 2J7TA 5IA2A 2B9IA 2RIOA 5L2TA 3RZFA 4CRSA 4F65A 3FL5A 2OH0E 4MWIA 4D0WA 4IVBA 4WRSA 2PVKA 3M2WA 3OBGA 3LQ5A 3DJ7A 3HRFA 5E8WA 3II5A 3UP2A 3VHKA 3S0OA 4NEUA 4FTTA 2PZRA 5M4UA 5HZNA 5KO1A 5FEQA 4FC0A 4WNKA 5AAEA 3LCDA 4C8BA 3HV6A 2A4LA 4QMQA 1KUTA 1I44A 1PXLA 4OTGA 3ZO3A 3HMPA 4O7ZA 3BIZA 3CY3A 5CSXA 2OK1A 3LCOA 5HD4A 1T45A 4UMRA 4C57A 4EC8A 3FE3A 2UW4A 3MH3A 5HVKA 2W99B 3GBZA 2F4JA 2XK9A 2V7OA 2JD5A 3ACKA 4XP0A 1MQ4A 4G34A 5IG1A 3DQXA 3PFQA 2ZAZA 2B1PA 2B53A 3ZEPA 1JKTA 2W17A 2FSTX 4RMZA 4NZWB 4C4IA 1UKIA 2AC5A 4C3RA 3GCVA 4KKHA 4UYNA 4EH5A 2QOHA 3C9WA 3UOHA 2OFUA 2Q0NA 4YZDA 2CHLA 3OWJA 3D15A 3VN9A 5IQFA 5AP5A 2CNQA 1LR4A 4MNFA 4AAAA 2VTIA 1JKKA 5ANEA 3OY1A 2PMLX 4FG9A 4ID7A 2WOTA 4AOJA 5EI2A 3AGMA 4MTAA 4M67A 3VIDA 3BYUA 4O7VA 1TQMA 2BAQA 4RRVA 4P90A 4WNOA 3G15A 4L01A 1JWHA 1XBAA 4I5CA 2OSCA 5IPJA 4NM7A 5CI7A 5AUUA 3SXSA 2GTNA 3R1NA 5ETIA 2BTRA 3QCXA 2I1MA 4BI1A 2X9EA 4LMNA 1OI9A 4CEGA 1H0VA 1YXXA 5AM6A 4FKVA 4ACGA 1SMHA 2C6OA 2VO0A 4CXAA 3FV8A 2Z8CA 5ANGA 3RNYA 3MW1A 2Y6MA 3PY3A 3PJCA 1XH5A 1YOJA 4QT1A 1OB3A 3KGAA 1OMWA 2XYUA 2PU8A 3F88A 3E7OA 3V5LA 3S00A 2YFXA 1NXKA 3RPYA 3W1FA 3HDNA 4NU1A 4F6WA 5KMIA 1UVRA 3R9DA 3MS9A 5EYCA 1QPEA 2QO9A 2XM9A 5LMKA 2CDZA 1OITA 2X8IA 1XH6A 2YM8A 2YJSA 2XZSA 3PWYA 4I0RA 4KSPA 4C35A 2WAJA 5LVPA 4J1RA 4G5JA 5CSWA 4UYAA 4CCBA 2IW8A 2R3OA 3AG9A 2IN6A 3ORKA 2X8EA 3MVJA 5EQPA 3FKOA 3H3CA 3KXZA 3OOMA 4RJ5A 2EXEA 4RFZA 5GJDA 3TWJA 3BV3A 3MH0A 5C8MA 3GC8A 4BKJA 3PJ1A 2I0HA 3TV7A 1MRVA 4XV3A 5A46A 4U8ZA 2JIIA 2OW3A 3CR0A 4E6AA 4NFNA 3BLQA 4I94A 2JEDA 1URWA 3BYMA 5HCZA 4UX9A 2R3RA 3E87A 4L68A 4U9AA 4ZTQA 4FL1A 3UQGA 5AP6A 5C8NA 3LFAA 4G6NA 4HGSA 3UG2A 2IPXA 2XIRA 2WMTA 2GS2A 3O7LD 3P86A 1BLXA 3GEQA 4OR5A 4CYIA 2ZJWA 4DG3E 4FODA 4FVQA 4BBFA 4ASZA 3VBQA 5KMJA 4RGJA 4RFMA 3D5UA 3F5UA 5IUGA 1V0BA 4D4SA 3DT1A 3FZSA 3PIXA 1XBBA 3PLAE 2R3MA 3HLLA 3GC0A 1NVRA 4FOCA 4G6OA 2BRNA 4LUDA 5EDPA 2HK5A 3OS3A 3A7IA 3DGKA 5CEQA 5CF5A 3LJ2A 3N4TA 3FLYA 5M44A 2GU8A 3CLYA 3NUUA 4FBXA 2OJIA 3O50A 2XNEA 3QYWA 4PL3A 5IMEA 4YJRA 5AA8A 5FG8A 3QHRA 3LXPA 4LRJA 3QCYA 3QZGA 3HYHA 2VTSA 1L8TA 3LE6A 3AC3A 4D2PA 4O6LA 3ZUTA 2VWBA 4BDIA 2HZ0A 1CKIA 2OWBA 4NUSA 3D7ZA 4I6HA 4C36A 4J95A 4A9RA 4QP1A 3HDMA 4GCJA 5CX9A 5TR6A 5HU9A 4OBPA 5IEVA 3Q9YA 1FQ1B 1LPUA 3OUNB 1KE5A 4LV8A 3VJNA 2X6EA 5KBQA 1GZNA 2JAVA 3F2RA 3LM0A 4NIFB 3LFEA 2HXLA 3L9LA 2XNBA 4GS6A 5EK7A 4FTLA 4OW8A 4ZSGA 4YJQA 4ZY6A 5DR6A 5FBOA 4OTDA 4A9SA 3GU7A 3V3VA 3DFAA 1U5RA 4IDVA 4AUAA 3UQCA 2YDKA 1U5QA 3K2LA 4YLJA 4G3DA 3PVBA 5HNBA 1WBTA 3Q9ZA 3POOA 2W1GA 3ALOA 3PSBA 4G3EA 3FY0A 5AUTA 2A2AA 2GS6A 2V55A 3Q5IA 2WTCA 4QP2A 5C03A 2ZYBA 3HKOA 4JOAA 3IW8A 3GP0A 3KRJA 3VBWA 2I0YA 3Q9XA 1Q8ZA 2PULA 2VTHA 4M13A 3KU2A 2ITZA 3CCNA 4TRLA 4GIHA 4MEDA 4XG2A 3FMLA 4GL9A 2CKPA 4WG3A 1UV5A 4PMMA 5CXZA 3LLAA 2QNJA 2HXQA 4U79A 5J7HA 5M4FA 1F5QA 1DI9A 3KF7A 2VWYA 4MKCA 2H34A 2C6TA 1FVTA 3VUDA 3R8VA 5A4TA 1M7QA 1A48A 3IW7A 4DYMA 3NGAA 5IQCA 3AMAA 3R8PA 3U9NA 4J99A 4YJPA 2WU7A 2PK9A 5H8EA 4G3GA 2WEVA 3ZOSA 4E3CA 4PPAA 4AZSA 5K3YA 2QURA 2PMNX 3FQSA 4HVDA 4PDPA 4DINA 3ORIA 5HEZA 4O7NA 4MQ2A 3R1QA 3ZCLA 3DDPA 4EK3A 5M4IA 3ZLSA 4ACDA 4D5HA 3U55A 4DEHA 4XHKB 4A07A 3TTJA 2PVFA 5CU0A 2B9JA 2C1AA 4K2RA 5CWZA 3GU5A 2VNWA 3KMUA 3GVUA 5CXHA 4NW6A 4IAZA 5AR4A 3QD3A 3AD4A 3K5UA 3EJ1A 3EYHA 4GJ2A 4L67A 5AP7A 4B99A 4YNEA 1XJDA 2HY0A 2Z7RA 3TKUA 2O65A 5F1ZA 1Q97A 2QOIA 3F3ZA 4F08A 3UJGA 3BE9A 2BRBA 3ZLYA 2YCRA 4YTIA 5A4EA 5D1JA 3FPMA 3P78A 2YCFA 5JFSA 4S32A 4QMPA 3LLTA 3KC3A 1NY3A 5FDPA 2W4KA 2ZDTA 5ANDA 4XLIA 4EQMA 2CN5A 2YCSA 5CI6A 4DFZE 4MD9E 4I21A 5DE2A 4YNOA 1M14A 4D1XA 3CIKA 4ZZOA 5LVNA 4MXZA 2IO6A 2UZDA 2OGVA 4CFNA 4CYJA 1FPUA 4RIYB 3KQ7A 5CEMA 3ETAA 4C59A 4FV5A 1FVRA 4FSMA 4IQ6A 2IZTA 5AR7A 2GHLA 3MA6A 4L3JA 4C62A 4QOXA 4U45A 5BMSA 2F2UA 2OXXA 2QKRA 3UZPA 4LM5A 4BCNA 5LWMA 3LQ3A 3VQHA 2C3KA 4EOPA 3QQLA 5EM7A 1WZYA 3RHXA 3V6SA 2WZJA 3EQPA 2C3LA 2EXCX 3EQIA 4M14A 3TEIA 1P4FA 1S9IA 1H1SA 2PVHA 4R77A 3OT8A 1B39A 1J1BA 4FKIA 3P5KA 4OTFA 4C4JA 5DRDA 2J50A 5EI8A 5G1XA 4NJDA 4YSJA 1Q8TA 3DS6A 3W55A 4KBKA 2PVRA 4RJ8A 3MIAA 2XS0A 3HMNA 4C4GA 1ZZLA 3DAJA 4MQ1A 3ZUVA 3JY9A 4ACHA 4B0GA 3NUSA 2YIXA 1SVHA 2ZV2A 4GK4A 3ZRKA 4B4LA 3RAIA 5IH5A 1H1PA 2ZM1A 3FZ1A 3WARA 1W83A 5C4LA 3HRBA 3R9RA 4I4EA 4R5SA 2JKQA 1UU8A 4TXCA 5CTPA 3FPQA 4K77A 3W8QA 4DH8A 3EQHA 2CGXA 4G9CA 4E4NA 2PYWA 2R2PA 4NIFA 4QYHA 1PMUA 4PTCA 4F0GA 3LMIA 4U97A 3Q32A 3R8MA 4ACMA 4DEAA 5CU2A 2H96A 4JDKA 4JT3A 4G16A 1GIIA 3B8QA 3HP2A 4UMTA 4AN3A 2JBOA 4YURA 4Z7GA 4QP8A 3LCKA 3LQ8A 4EK4A 4J96A 5ETAA 4MYGA 4DC2A 4CMOA 4QMXA 2CN8A 3FC2A 3WF7A 3GU4A 4IBMA 2IZRA 1OVEA 3L8SA 5IISA 3F5PA 4X3FC 5ANOA 4AGUA 5KMMA 1VYWA 4AW2A 2VO3A 1ZOEA 2G01A 4MWHA 3CPCA 4NM5A 2EVAA 3AXWA 3QUEA 3SXRA 5BVNA 4BWKA 2E9VA 2V62A 2LAVA 4CV8A 4I24A 2BPMA 4RIXB 4ZEGA 4D4RA 4EUUA 4FT7A 4ZAUA 4DBNA 4W8EA 4O1OA 5FTQA 4EYMA 3PXQA 5DNRA 4PP9A 3NIEA 3CPBA 1OL5A 2CNVA 4HNFA 3QQGA 4D4YA 4YPSA 2X9FA 2W4OA 3EKKA 2UW0A 3HV7A 2OJFE 4FI1A 4RSSA 1MRYA 4GU9A 4YZBA 4HGTA 3POZA 2A1AB 5AR3A 3I7BA 3VVHA 3VHEA 1JAMA 4O96A 3FL4A 1YXTA 3R9HA 1YRPA 5AP1A 2WQOA 4E5BA 3FI3A 4FT5A 2YJRA 3JXWA 5HG5A 3OCTA 4Y73A 3R04A 4BICA 3G9LX 4BCOA 2C5YA 5DH3A 3ZZEA 4KIOA 1H26A 4APCA 5B2LA 3P7CA 4OBQA 4O91A 4R7BA 3H0ZA 3C13A 1H24A 4RC4A 5FQDC 1RE8A 5ANKA 4QMLA 3VUMA 2BCJA 4AN9A 2X81A 5HIEA 4JBOA 5JH6A 3RK5A 3ZSGA 3I81A 4X3JA 3EQFA 4FF8A 4MH7A 4GFMA 3QU0A 3A4OX 1XH9A 3LXLA 3A99A 2CSNA 3QA8A 4S34A 5KKRB 3R7UA 5CASA 5HLPA 3UC3A 4PMPA 3ORNA 4BCKA 4FR4A 4R1YA 4CFUA 4EQUA 4EUTA 2WMXA 3BQCA 3PDTA 1NVQA 5HO8A 2A27A 4QTCA 4YHTA 1YOMA 4JBPA 4R8QA 5FP5A 4RFYA 3PP1A 4G31A 4QYFA 5CVFA 3LXNA 4YTCA 1WFCA 2PUIA 4RIYA 2PE2A 4FZFB 2VWVA 3ROYA 4CKIA 3ERKA 5CZHA 1IAHA 4L52A 4IWOA 4E93A 4DFBA 3NSZA 2QOOA 5FBNC 1IA8A 4CFMA 4EYJA 3UBDA 5EG3A 2QHNA 3EFKA 3R21A 4QQCA 4F09A 1UKHA 4UMUA 3BHHA 4RT7A 3O71A 1Y8YA 3WI6A 4BDCA 1P5EA 3EYGA 4G3CA 3O17A 4XMOA 4F6SA 4AN2A 5M57A 1XR1A 3P79A 4O7RA 4ANQA 3SDJA 2XKDA 4ZTRA 5TOZA 5DLSA 3VF9A 1PF8A 3GCQA 1JPAA 3T9IA 2ITPA 3ROCA 4QP4A 3LIJA 4AQCA 3RM7A 2WTJA 5J7BA 4F0IA 3F7ZA 5TF9A 3EN4A 2PUNA 3DPKA 4RBLA 2CNUA 4JL9A 5FGKA 3OCSA 2XNNA 4GJ3A 4AOTA 5EOLA 1H0WA 4JDHA 4O21A 5JSMA 3VRZA 3R71A 4R3CA 4Y95A 4BDDA 4ZLZA 5JZJA 4LQMA 3RHKA 4BN1A 1AQ1A 3U54A 2E9UA 3DK6A 5FEDA 5DGZA 2G2FA 4G1WA 3MJ1A 1IR3A 2YCQA 5E8TA 3NLBA 3VS2A 3QLGA 3V01A 4C38A 4D2TA 2YABA 4DF3A 4FSRA 4YPDA 4HVGA 2XJ2A 2CGVA 2VWWA 3FWQA 1KV2A 1GY3A 4HPUE 3KRRA 3E93A 2CCHA 4TYHB 4AZWA 5CEPA 1Q24A 4FTAA 3SHEA 3MVMA 4G17A 1H1QA 2ZV8A 3V8TA 5K4IA 4GKIA 3MPMA 2VX0A 2VTJA 4ASEA 2I7QA 4PL4A 3C1XA 4Q9ZA 4D0XA 4DT8A 4TNBA 3ZHPC 3QKMA 4IXPA 3BE2A 3UYTA 4MXOA 4RIXA 4R7IA 1JKLA 2OIQA 4F7SA 3EN9A 2PZ5A 3DXPA 4X6RA 4PWNA 5IQDA 5FEEA 2WQEA 3QRTA 3DNDA 3RWQA 3NNVA 3NVMB 2Y7JA 5JT2A 5HNIX 5DT0A 2UZEA 3NX8A 5GNKA 4WNMA 3D2KA 1RW8A 3DA6A 3THBA 2WTDA 1H28A 3QD2B 1Z9XA 3A60A 3GCUA 4AACA 4EL9A 2ITOA 3F5XA 2B4SB 2YIWA 3G90X 5AP0A 3PJ8A 2QLUA 4X2NA 2GPHA 5HO6A 4F9BA 3F9NA 4DE4A 5HD7A 5L3AA 2O64A 5AR2A 4F4PA 1H4LA 2JDOA 3LJ1A 1Y6AA 4GEOA 4ZS0A 2C1BA 4NTTA 3ZEWA 3SOCA 3ITZA 3RAHA 3VF8A 4IM2A 1W0XC 4JX7A 3C4XA 4LL0A 3IDPA 4NW5A 1JKSA 3F3UA 4FSUA 4JQ8A 4IAFA 4Q9SA 3AQVA 4W4YA 4A9YA 3QA0A 4J98A 4O0VA 4BC6A 4L3PA 5L8KA 4O84A 5IDNA 4BCJA 3BWFA 5M51A 3DKCA 5CEKA 3KKVA 5HCXA 1FVVA 2BRGA 2XKFA 3AT4A 4CVAA 4O0YA 4FEQA 4FA2A 2P33A 2W9FB 5TT7A 2P0CA 4PDSA 4IM0A 3KF4A 5HBHA 4EH8A 1IAJA 4IAIA 4TWPA 5CNOA 4CQGA 3FXZA 3OMVA 4QQJA 4M97A 3TG1A 3FSKA 4ZZNA 4DFXE 3BI6A 3ZRMA 2BIYA 3TJCA 5CANA 4QYYA 4JS8A 1U59A 2XCKA 3D14A 3JVSA 2WB8A 4RZWA 1FGIA 5ICPA 2ONLC 3M1SA 4IEBA 1KE8A 2UV2A 4NCTC 1ZZ2A 5L8LA 2VGPA 3DAEA 3PRIA 4PP7A 2XB7A 4Y83A 1GZOA 5HG9A 4ANBA 2BUJA 2GNLA 3HVCA 4I5PA 5BUEA 3GC7A 5HLWA 4U6RA 1PXKA 4FTUA 4MNEB 4PUZA 4YSMA 3ZBFA 4BGGA 3W2SA 4FTCA 3PXFA 5DPVA 3MVHA 4KIQA 2HELA 3G6HA 3OP5A 3ORLA 3WIKA 3RAWA 3DAKA 4IZ5A 4AS0A 3GU6A 1B6CB 3EN5A 3FMKA 3U51A 3V5PA 3HGKA 2FGIA 4H58A 4ZY5A 4CQEA 5BUJA 5IU2A 2V7AA 3AT3A 2WQMA 4CLIA 4C58A 2W7XA 4DG0E 4NWMA 4WO5A 4DGGA 1G8AA 3NIZA 4MCVA 3PRFA 3PJ2A 4JLCA 5IH4A 5IA4A 3LMGA 4R6VA 3D0EA 4EH6A 3V8SA 3H9RA 2OZAB 3NS9A 4A4XA 2ITWA 5AADA 5E8UA 4I4FA 2WTWA 4P5ZA 1B38A 2BDFA 3BEGA 2BDWA 2PVMA 4L43A 2G2HA 5EKNA 2XA4A 2QU5A 4IZ7A 2P2IA 3VW6A 4BTJA 1CKPA 4WUAA 3HP5A 5AM7A 3IS5A 3N4VA 3BLHA 4TYHA 5AR5A 5GINE 3AMBA 4HJOA 4NK9A 3CGFA 3E7VA 1WBPA 1Q41A 2VX3A 5EI6A 4LUEA 1QPCA 5AUYA 3PG1A 4F9WA 5IA1A 2CGUA 3EHAA 4ALWA 5E8VA 1QPDA 2BROA 5C27A 3NYXA 3KREA 3QQJA 5E9EA 2GNFA 4YU2A 2UW6A 3E88A 3JVRA 2J0IA 1PRYA 5HBEA 3CE3A 3KN6A 3QKLA 3BBTB 4LRMA 2QC6A 2R3HA 4DGNA 2XP2A 4UZHA 4UEUA 3UODA 4FTOA 4L8MA 4TWCA 2O5KA 4C33A 4DEGA 1DAYA 3AD6A 3ZO2A 4QNAA 1WVYA 3FHIA 3UO4A 3GB2A 4JRNA 4BZOA 4ZOGA 4AU8A 3EOCA 3C5IA 2WMWA 5HKMA 4E6QA 4FMQA 3TUBA 3IW5A 1OL6A 1PYEA 4H1MA 1ND4A 2QCSA 5IA0A 5GJGA 3PXRA 2YM6A 2ZM3A 3UTOA 3TZ7A 3D5VA 1BMKA 4A4LA 5AUWA 1I09A 3PJ3A 3E3PA 4Z55A 5IEYA 1ZRZA 4AWIA 2FH9A 3ZDUA 3SKCA 4BCIA 4OTPA 1SNUA 4HOKA 4RQVA 4TT7A 5HE0A 4ZSAA 3ZDIA 5DA3A 3JR1A 1P2AA 3OD6X 3WF9A 2FA2A 4E5AX 1H08A 3OY3A 5LVMA 5CALA 4XP2A 2VTTA 3VULA 5AUXA 3FXWA 3HMOA 3HA8A 3R8LA 3ENHA 4FOBA 4DCEA 2ITTA 3S2PA 2BRHA 2NRUA 4A9TA 2R0UA 3UVPA 3BEAA 3ORZA 5AMNA 3V04A 4FSZA 4FG8A 5GZ8A 3AMYA 5BYLA 3KCKA 4AT5A 2UZOA 3GC9A 1XKKA 4JBQA 2GNGA 4RPVA 4EKKA 2KTYA 3R22A 4PX6A 3TV4A 5CAUA 4IWQA 4FV0A 2JGZA 3D7TB 4ZTSA 3R7OA 2XF0A 1PXPA 4IB3A 2FB8A 4CCUA 4EZ5A 4YC8A 1VR2A 2R3IA 1R0PA 5JZNA 4EJNA 3R00A 5FM3A 1W8CA 3IKAA 3R7VA 3VUTA 5EOBA 4R7HA 4AZVA 5EQYA 5CF8A 5ETFA 3TIZA 4TL0A 3QZHA 5HGIA 2PWLA 4YC6A 3SLSA 4MD8E 2E9NA 4CKJA 4O7YA 5AIKA 5AUZA 2JDRA 2C5NA 3DXNA 4CTCA 5ACKA 3GFWA 4MD7E 2R0IA 3KXXA 5H8GA 2WXVA 5IUHA 3W18A 4BI0A 2ZB1A 5EM6A 3ZRLA 4ZJIA 4O0UA 3N4UA 3FYKX 5BNJA 5K9IA 1WBWA 4I0SA 2C0OA 1K3AA 4D5KA 3ID6C 2W05A 1ZYDA 5IQIA 4J7BA 1WVWA 5HNGA 1YHWA 3NW7A 4U43A 3BU3A 3MYGA 2PZYA 4BDEA 3MV5A 3RZBA 3ACJA 2OZAA 5FM2A 1Q8WA 4XV9A 1U46A 5T3QA 5AR8A 3KXNA 5D41A 3HZTA 2JKKA 2UW8A 4W4XA 4CZYB 5AAGA 2GSFA 2J90A 4CT1A 2QQ7A 4ZTMA 1WVXA 5CAVA 4S33A 3MY0A 5E91A 3ODZX 3K3JA 3G5DA 3R9NA 4EOJA 1YDRE 1W82A 4RVLA 2OJJA 3IQ7A 2J0KA 3QWJA 4A7CA 2UW7A 4PDOA 5IQHA 1OKYA 1Y8GA 4E7WA 3F2NA 4AGWA 1CKJA 5C01A 3UQFA 1CSNA 1RDQE 1WBSA 4IX4A 3W2CA 4O82A 4WG4A 4CGAA 1UNLA 4IHPA 3SGCA 1XH7A 5BVKA 4XLVA 3RPOA 4UMPA 5LMKC 3KVWA 2X7OA 1YXSA 2QR7A 1SNXA 4LRKA 5IA5A 2RSVA 3MN3A 3VNTA 5I3RA 3UZTA 2X8DA 4HGEA 4AE6A 3VBYA 3DDQA 5HTBA 3PVGA 4U80A 4QTEA 4ZJJA 3Q5ZA 4O0WA 4F1OA 4PY1A 3NUPA 2BFYA 1STCE 1Q61A 2VUWA 2IZSA 1J1CA 2C47A 3LKMA 4TTHB 3E8EA 2AC3A 2BAKA 3A7HA 4AXAA 2B54A 2PL0A 5CQUA 5KHXA 3C4FA 2FSLX 5CNNA 4W8DA 1MRUA 2XNGA 4U5JA 3QTZA 4A06A 4R5YA 5D10A 4YJUA 4H36A 2BFXA 3ELJA 4IJ9A 4N0SA 2HW7A 4BCFA 2UZLA 3E8NA 1J7IA 3PPZA 4IM3A 4ZP5A 5A14A 3TKHA 4M0ZA 4L46A 4Y5HA 4F70A 3DNEA 3P7AA 2OZOA 3ZO1A 4UXQA 1OUKA 3PY0A 5L2SA 5IA3A 4LG4A 3P4KA 2W96B 3PPJA 2F49A 2ITNA 3TXOA 5L6PA 3OXIA 3QRIA 2DYLA 2Y0AA 1ZARA 2WTKB 2ETRA 5ETCA 4YJVA 4BHNA 3FMMA 2QO7A 5BYZA 2X4FA 4UB7A 3UE4A 4RVMA 4EOLA 3FQHA 2VAGA 3EB0A 4D1ZA 4GKHA 3E8DA 1WBOA 1IEPA 3LFQA 3H4JA 3O2MA 4BFMA 4RX8A 3UOKA 4AW0A 4BTFA 3CXWA 3FHRA 5CSVA 4I0TA 5I9UA 4OLIA 2QOQA 3Q6UA 3D7TA 3PYYA 4TW9A 3NUYA 4CMUA 3MWUA 1YXUA 3PIZA 4AZTA 3OCBA 3AC2A 3P0MA 3E64A 4FTIA 4YUQA 3C50A 1X8BA 3GFEA 4YZCA 5CF4A 4D2SA 3DK7A 2HZNA 3Q4ZA 3R83A 4IVDA 3BYVA 3UO6A 3W2RA 2RFNA 3ATTA 4X2KA 4BKZA 2HW6A 3TKIA 4BL1A 4DEDA 4ZY4A 3VS3A 2XMYA 2CLXA 4XYFA 4AX8A 3FMHA 4FYNA 4PPBA 3LMHA 4YO4A 5J79A 4QMYA 4U42A 3HNGA 5IEXA 3R6XA 4IJPA 4RC3A 3DB6A 1YI4A 4BCQA 4HVSA 3CTQA 3CKWA 3NW6A 2HOGA 2Z60A 3D83A 3IGGA 4NH1A 5HG7A 5L2QA 4DTKA 5FD2A 3QQKA 4YLLA 4R78A 2UUEA 4F0FA 4WKQA 3DY7A 4GFGA 4UMQA 5HCYA 4G6LA 3Q6WA 4KWPA 4KRCA 4XOYA 2Y9QA 5HLNA 1KV1A 2QOFA 3SG9A 2IVTA 4GVJA 4Y72A 3MH1A 5D9HA 5EFQA 4AA5A 5DIAA 3TNHA 1A9UA 4FKPA 2BDJA 3FXXA 4WG5A 4DLJA 1UU7A 3FJQE 4TYGA 3UPXA 4QMNA 5KUPA 1OL1A 4M84A 4EHEA 1TQPA 3OWKA 2BILB 1LEWA 3OBJA 4ITIA 3PA3A 5GHVA 4IB1A 4P2KA 4U40A 3S3IA 3Q9WA 3H9OA 4IVCA 2JKOA 2GMXA 3COKA 3QCSA 3KXMA 1XWSA 4QQ5A 3R01A 4ZS4A 5B2MA 3I1AA 3C0IA 1L3RE 3RPSA 3BPRA 4L7FA 5AX3A 1ZAOA 4KKGA 4JG6A 5ITAA 4L6QA 4AZFA 3I0OA 2FVDA 3GCSA 2P2HA 1ERKA 3IDCA 3KMMA 4TKSA 2ERZE 4FSQA 4YZNA 5KX8A 4BCHA 3DXQA 3BV2A 3PG3A 4GMYA 3HEGA 4F63A 1JOWB 4DHFA 4K33A 4FV1A 2R3NA 4TPTA 5H3QA 2G1TA 2C4GA 5K0XA 1CDKA 4FL3A 4H1JA 5E1SA 4ZIMA 4FZ6A 4ZMEA 4UBAA 4YBKA 4JG8A 5LOHA 3MIYA 4AW1A 4JVGA 4AT4A 2Y4PA 2VGOA 3QTUA 4IZYA 4U3ZA 4NFMA 5HU3A 4GFOA 4FEWA 2ZDUA 2OJ9A 3FEGA 1J91A 3DTWA 4KRDA 4E73A 3UNZA 4KIPA 3VJOA 3FC1X 2WEIA 4DITA 1H8FA 3PIYA 4BKYA 4FV9A 5IQEA 4GYIA 2R5TA 4R3RA 4X2JA 1WMKA 3TL8A 2BALA 3KCFA 3CJFA 4FNYA 4XS2A 5JFWA 3WE4A 5CSHA 4FGRA 2WPAA 2W1HA 4M68A 1Q62A 1K2PA 3MA3A 4BF2A 4EC9A 2OH4A 4Z9LA 4ZLYA 3OXTA 5E8XA 3NVKI 2UZTA 4RX7A 2XEYA 2F2CB 1BYGA 4LI5A 3QGYA 3CP9A 1WBNA 2CMWA 3UNJA 2J5FA 2W5HA 3NNUA 5ACBC 5EM8A 5IQAA 1W84A 4FT0A 1FMOE 3HRCA 2PUUA 2Y4IB 3IDBA 4WIHA 3F82A 2GHMA 3WIGA 2VWIA 4FKJA 1KE7A 2ZV7A 3ZO4A 3W10A 5LCJA 3ORTA 4UV0A 4ENYA 3SRVB 1YW2A 4KKEA 5LCKA 4KB8A 1PXMA 4KD1A 3CQEA 4JAJA 3G0FA 3P9JA 4CTBA 2WNTA 3JS2A 4XP3A 1ZXEA 2H8HA 3NZ0A 4RJ6A 4I92A 2JBPA 4PNIA 2BZJA 3DOGA 4JDJA 3TZMA 4U0IA 4EK8A 3VS6A 2R3QA 3BU5A 2O2UA 2VWXA 2I0EA 4FTKA 5L6WL 4G9RA 1J7UA 3EN6A 3HAMA 3GOPA 4YZMA 4BDJA 2QI8A 3K5VA 2CCIA 4FKQA 4USDA 4KA3A 3QFVA 1XHAA 3KRWA 3KXHA 3MBLA 3Q52A 4OTHA 4RJ3A 4D1SA 4C4FA 4F6UA 3S1HA 3QHWA 3L8VA 4MXAA 3MDYA 2XK8A 2DWBA 4UY9A 5JKGA 2JFLA 4XV1A 4B6LA 3H0YA 3BCEA 4BR3A 5JRQA 5J95A 5KMNA 5EQEA 4UXLA 2AUHA 3VUGA 4F1MA 4USFA 2PZIA 5F20A 2YAKA 3QBNA 2HY81 4QRCA 4WBOA 1ZMWA 4WSYA 3RK9A 4ITJA 4HW7A 4WA9A 3ZU7A 2C6MA 4FIHA 4HVHA 2XIYA 1HOWA 4QNYA 3EH9A 4JX3A 5LMBA 4FICA 4M69B 4RJ4A 4PQNA 5CZIA 4MX9A 3RM6A 1RQQA 3S95A 5BVFA 5F4NA 2WMRA 2Z02A 3C4CA 3FSFA 5LJJA 2YDJA 3QLFA 4KSQA 3TN8A 1PMNA 2X7GA 5BVWA 5KCVA 4PV0A 4WT6A 4XOZA 3ZUUA 2JIVA 2QO2A 1KE6A 4PMSA 4QMUA 2ITVA 4FSNA 3G6GA 4TYIA 5E90A 4GT5A 5HIDA 3SX9A 4QPSA 3AOXA 3LJ0A 5D12A 3NAYA 4F9YA 4HCVA 3RMFA 3NAXA 4U7ZA 3MFUA 1OPKA 4J8NA 2NRYA 3HA6A 5DVRA 3KFAA 4F7LA 4BHZA 4FTJA 3I5ZA 1OL7A 3E62A 4BCMA 1J7LA 2WFYA 4KS8A 4NM3A 3V8WA 3QCQA 4U44A 3TZ8A 2YWVA 3OTVA 4I41A 5DEWA 5HOAA 5HO7A 4FSTA 2QU6A 3KXGA 1P4OA 2UW9A 4Q5EA 5IKWA 3BHTA 2W1DA 2W1EA 1IG1A 3QX4A 4ACCA 1G8SA 4KABA 3NYOA 2GS7A 2HWPA 3SV0A 5EKOA 3F2AA 4X2FA 4O83A 4M12A 5HQ0A 4L7SA 4H39A 3DCVA 2CKEA 1TQIA 3A7JA 3OTUA 3NEWA 4RZVA 5T68A 3WE8A 4XH6A 3V6RA 2C0IA 2RG5A 4FIGA 1OM1A 3ORMA 4Y46A 1TKIA 1LP4A 4MXYA 4LGGA 5BX0A 4FTNA 3F66A 4ASXA 4BDHA 5K4JA 3FI2A 4O1PA 2ETKA 4E4MA 3SVVA 3IGOA 3JUHA 2UZVA 4JIAA 4ZSLA 4KUJA 5HI2A 4FV7A 1PHKA 5A6NA 2HZ4A 3AD5A 4QD6A 5FXQA 1VEBA 4DH1A 5AV2A 3WBLA 4D2VA 5IUIA 1ZYSA 3EL7A 3UDBA 1F0QA 4DH3A 1PMEA 4H3PA 2CPKE 3F61A 4OTWA 5L4QA 2J4ZA 5IMXA 5J9ZA 1OL2A 4Z3VA 4CKRA 2C6IA 2X1NA 3Q53A 4LV5A 2BIKB 4EKLA 2I40A 3WF8A 4BIDA 3OXZA 5D7AA 5CQWA 4M7IA 4GW8A 3ZTXA 1SZMA 2YM7A 3RWPA 2WU6A 3NRMA 5JN2A 3UZRA 1FMKA 3EZVA 4JIKA 3AGLA 3DFCB 3R7GA 1H1WA 2B7AA 3EQGA 4H05A 1NA7A 3T9TA 4DFUA 2GDOA 3QGWA 3Q2JA 3ODYX 1UNGA 4NM0A 1TVOA 5FWKK 2I0VA 2PTKA 3MB7A 2F7XE 3FZPA 4DGLC 5KMOA 4E5WA 4CZTA 4FSWA 1OIRA 3W8LA 3FBVA 1YOLA 3R7EA 1FOTA 4GYGA 4LL5A 1YWRA 5AV4A 5C1QB 2O8YA 4AFEA 4DTAA 3FQEA 4K18A 1ZYJA 2F57A 2XCHA 2XK4A 3WZKA 2X7FA 1E1XA 2VTMA 2XVDA 4FTRA 5AP4A 5CU3A 1ZMVA 2J0JA 3LOKA 4L53A 4N6ZA 4X21A 4YJSA 4DEIA 1BUHA 2C3JA 4XRJA 2O0UA 4S30A 4ZLOA 3QF9A 1JSTA 3OVVA 5A3XA 5CVHA 3JY0A 3P1AA 2Q83A 2RFDA 1CMKE 4KAOA 4CFXA 3ET7A 2PE0A 3U6IA 3GGFA 2XIKA 3LFBA 2BHEA 5AIRA 4BCPA 4BDKA 5J5TA 3OCGA 4O38A 2REIA 4FVPA 3KK9A 1GIJA 2VX1A 4BVUA 2PE1A 3BELA 3M42A 4GK3A 2WD1A 1WCCA 4UWYA 1GJOA 4M69A 3PZHA 4PDYA 3IONA 3BQRA 5DWRA 5EYKA 1UWJA 3HX4A 3IW6A 2J9MA 3CKXA 3NWWA 5KMKA 1V0PA 4WSQA 3OF0A 1KWPA 3WZUA 1Q5KA 5T6KA 5K0KA 5AUVA 5LQFA 3ZFYA 3RNIA 5KE0A 4QQTA 3IPHA 4O22A 2YERA 3COHA 3VS1A 5CAQA 4C3FA 2SRCA 4JAIA 3LFDA 3MH2A 4ITHA 5LMAA 2X2MA 3R8UA 4EHVA 5EHOA 5AFVA 1ZY5A 3FZTA 2C6LA 4FSYA 4DLIA 1T46A 5EDRA 4AP7A 5CSPA 4KBCA 3SC1A 5LVOA 4DN5A 5EYMA 4AA0A 3UNKA 4I1ZA 3VS0A 1M17A 4ZSJA 3TDVA 4RG0A 1F3MC 1Q4LA 2XYNA 4EI4A 4BTMA 3VAPA 2E2BA 1S9JA 5AEPA 2C0TA 2QKWB 3FLQA 3NUAA 3UIUA 4IIRA 4FNWA 2XJ1A 2BZKB 3COIA 4W4VA 3K54A 5E8ZA 2OF2A 3VO3A 3QTSA 4IX5A 3HV4A 3NYNA 4OGRA 4DCAA 5JQ8A 4OBOA 3MFSA 2JIUA 3AC8A 5KKRC 2C5XA 3FMJA 4QPMA 2GFSA 3ALNA 4OAUC 1K9AA 3DBFA 3Q4TA 2JAMA 4HYHA 4TWNA 4W9WA 4JG7A 1BX6A 5E1EA 4EORA 4EJ7A 4BY9E 3ZSHA 2O3PA 2WMUA 3R1YA 4FKSA 3ULZA 3WZEA 3QRUA 3QZFA 1QMZA 4I22A 2J5EA 1A06A 2X2KA 4E8AA 4WD5A 5D11A 2PVLA 4FEUA 4EEVA 2GNJA 4FKOA 3CC6A 4C02A 3ZBXA 3UP7A 2VNYA 1Y57A 4LOQA 3PA4A 5IH6A 3DTCA 3PVUA 3A8WA 4FTQA 4EOKA 1NVSA 1JSVA 5J8IA 3WZJA 4B8LA 4PNKA 2J51A 4ANLA 2R9SA 2ZVAA 3A7GA 2ITYA 5AP2A 2F7ZE 5EYDA 3UC4A 3U9CA 4DEBA 4BBMA 4TYJA 3C4EA 1APME 4DH7A 2PSQA 2VD5A 3RCJA 3U4WA 2XBAA 5JEBA 4XEYA 1YKRA 1O6YA 3A4PA 3I5NA 4IACA 4IX3A 5J5SA 4N4SA 4KNBA 4RWJA 5KZIA 4QMZA 2XK7A 4F7NA 2ZOQA 4O0XA 2GFCA 3Q96A 3KK8A 3LXKA 4A4OA 4CSVA 2EB2A 4AF3A 5HBJA 4G2FA 4FE2A 3Q3BA 2J0LA 3T3VA 3MTLA 3MESA 2NNWB 3OC1A 3QL8A 2VWUA 5B7VA 3L9MA 3FZOA 1Q8YA 3UG1A 2QOBA 3E92A 3BGPA 3V5QA 3G2FA 3F3VA 3RI1A 2C6KA 2QOLA 2WTVA 3MFRA 3P7BA 4II5A 3EFLA 4YBJA 5HHWA 3FKNA 4A9UA 4BI2A 3KY2A 4AGDA 3DJ6A 5HORA 4IFCA 4XNEA 5CF6A 4FVRA 3VBXA 4FT3A 2BAJA 2QG5A 2PVNA 4BWXA 5H9BA 3IOKA 1YWNA 2DS1A 2OJGA 2VTPA 2BRMA 3QX2A 2YM5A 2GNIA 2HIWA 4J71A 4UALA 4V01A 3F6XA 4EOIA 3O51A 4AGCA 3BHVA 1JVPP 4LYNA 1ATPE 4M0YA 1PXOA 3P08A 1DAWA 4RVTA 3PXYA 4C4HA 3CD8A 4MK0A 3RPRA 2H6DA 4YC3A 4YTHA 4EK6A 1Z57A 1YVJA 5AA9A 2NPQA 5M06A 1YHSA 4GT4A 2VV9A 2ZB0A 2CJMA 4NJ3A 3CY2A 4EOSA 3OW4A 4QP3A 2V5QA 4EOMA 2OXYA 3QUPA 3E5AA 4F64A 4GSBA 2UW5A 3KRLA 4I23A 3WOWA 3C4ZA 4FG7A 3OUKA 3QTXA 3UO5A 2WTIA 3L8PA 4L9IA 1GNGA 2BMCA 3W2PA 3E63A 2WMQA 4LMUA 5CEOA 2IJMA 2X2LA 3QC4A 4EZ7A 2R3FA 3TI1A 4F7JA 1CTPE 1U54B 3HUCA 1PJKA 3IOPA 5CS6A 4ENXA 4Z7HA 2YISA 5I4NA 1M2PA 4C2WA 4FV2A 2OXDA 3QRJA 3OWLA 4MXCA 5E4HA 1H01A 4FEVA 1CM8A 4GV1A 2EUFB 3QD0A 1JBPE 4BB4A 3MFTA 3RTPA 4NKSA 1H27A 4BIEA 2FUMA 3DKOA 4I5MA 3RKBA 4AFJA 5DYJA 3JPVA 3LW0A 4JJRA 4DG2E 4YR8A 3AC1A 4BTKA 3CTJA 3A62A 4Q5HA 3QTWA 5A4CA 2OKRA 3VRYA 3HMIA 2YIRA 2ZV9A 3R63A 2B0QA 5M08A 5AP3A 4EWHA 3LVPA 4HYIA 3ZM4A 1LUFA 3CJGA 3OOGA 4J8MA 3DBDA 2OF4A 4YZ9A 4JQEA 4TWOA 2XKEA 3CSVA 4IB5A 2JFMA 3FLNC 4GUEA 4O81A 4FV3A 2CKOA 4HYUA 4ONAA 2W1IA 3ZYAA 2IWIA 2J2IB 2JDTA 4GIIA 3I6WA 4QYEA 3FYJX 5I5ZA 4LOOA 2BZHB 5DBXA 4CG8A 3E8CA 3BBWA 3RALA 4DFLA 5H8BA 1XH8A 4MNEA 2F9GA 4O6EA 4BYIA 4FUYA 3DV3A 5KBRA 3ZMMA 3DB8A 3NDMA 2QHMA 5E7RA 3DBEA 4FZ7A 4DGMA 2H9VA 2UZNA 3O23A 1VZOA 5BVDA 1H07A 3FI4A 2P3GX 3BU6A 3MVLA 3QQFA 4J52A 2RKUA 2WELA 4JRVA 5AX9A 3WYXA 4CMTA 2JC6A 4FT9A 3TT0A 4L00A 3WF5A 4D2RA 1WAKA 4EH9A 3Q2MA 4K1BA 5HTCA 3RP9A 3TNIA 4MBJA 2XRWA 3RVGA 3R1SA 4N70A 3U87A 1GOLA 4TYEA 4ZTNA 1XH4A 4BDBA 3NW5A 2R3LA 1R78A 2QG7A 5IQGA 1M52A 4KBAA 4LGDA 2PUPA 2W5AA 3SG8A 3RGFA 3SQQA 3TUDA 4I6QA 2W06A 4LOPA 4E6CA 3FAAA 2GHGA 2OU7A 3LCTA 3DU8A 3O96A 4K8AA 3VUIA 5CAPA 4FV4A 1DM2A 1M7NA 2R3PA 2UVYA 4V0GB 2VU3A 1H1RA 3KN5A 3HAVA 4RIOA 5AWMA 4D28A 4CFVA 3BZ3A 5FTOA 3ZH8A 5GIPE 1E1VA 1OGUA 1P14A 2R64A 4RIWB 4JQ7A 2XUUA 2GTMA 1OZ1A 3HECA 5K5XA 4H3BA 4PTEA 5I0BA 5LWNA 1YI3A 2EWAA 2VO6A 2YDIA 5TO8A 4ANNA 4ANMA 4DTBA 5DT4A 1ZYLA 3GOKA 4QMMA 4RJ7A 4QMWA 2RFEA 4BGHA 4JI9A 5HIBA 1YDSE 4W9XA 3BKBA 4BRXA 1PXNA 2OIBA 3DJ5A 3DZOA 4OUCA 3DKFA 3LPBA 1H00A 4QP7A 1Y91A 1IRKA 1W7HA 2C6DA 2X0GA 3EIDA 3PLSA 4IADA 3ZXTA 4ARKA 2Z7SA 5KZ0A 1O6LA 2YHVA 3BGZA 3CBLA 4U81A 3R8ZA 4ZMFA 4F9CA 2HYYA 3NNXA 5HE2A 3LZBA 2PVJA 2EU9A 3G9NA 4MBLA 5E92A 5JGBA 2JKMA 3ZC6A 5KMLA 3CQUA 3LCSA 3O0GA 5BPYA 4O27B 2E9PA 1BL6A 1U54A 1R0EA 3VS4A 4IWDA 2OBJA 3MJ2A 4Q2AA 1G5SA 3I79A 1NT2A 1KOBA 5JRSA 4BZDA 3EQBA 1AGWA 2R3GA 3QAME 1OIQA 3QYZA 5CU4A 3IW4A 4RA5A 5A54A 2VTAA 2WQNA 1OPJA 5F9EA 1JSUA 4K6ZA 3A61A 3BGQA 4JR7A 3A7FA 5M53A 3DKGA 5JFVA 3A2CA 4QMTA 4HVIA 4FEXA 3PY1A 3TUCA 3H10A 3LFSA 4O2ZA 1ZY4A 4U41A 3EFJA 3V5JA 4AZEA 3NPCA 3UVQA 5DHJA 2O63A 5EHLA 1AD5A 1ZYCA 3EZRA 2YM4A 4YJNA 5G6VA 5JFXA 4MBIA 4EONA 4X3FB 4LGHA 3EL8A 3W32A 4N57A 3H30A 4S31A 3BYOA 1KOAA 1Q3WA 4RWKA 4I93A 3C0GA 2X6DA 3K3IA 5H2UA 4JBVA 5DI1A 3PE2A 1YXVA 4QTDA 1BI7A 4QP6A 1R1WA 3BRBA 4XUFA 2B55A 2OO8X 3U4UA 3B2WA 4GUBA 2ACXA 4RC2A 5HG8A 3D4QA 3UYSA 2VTLA 1XO2B 3QC9A 2BHHA 2YITA 1VJYA 2YAAA 4XG7A 3GT8A 3CGOA 3HV5A 2UVXA 3O8TA 4FKUA 4BZNA 3RK7A 2CLQA 3QTIA 2HENA 3EQCA 4EBWA 5JK3A 2WMVA 1Q99A 5DOSA 5BUIA 4X7QA 1YQJA 4EH4A 5DEYA 4MHAA 4XJ0A 2YIYA 2QOCA 3EMGA 4V04A 4XCUA 2GNHA 2IW6A 5JGAA 3ANRA 4RWIA 4IC7A 1OKWA 2PZPA 3NNWA 4C2VA 3OT3A 2WO6A 1WBVA 1OKVA 2PMOX 5JGDA 3R0TA 4W4WA 3EQRA 3VC4A 2XK6A 2EB3A 4IAKA 2Q0BA 5BVEA 3NMUF 2ITXA 4V0GA 3TDWA 4FKGA 3P23A 1MUOA 3WZDA 3N9XA 3OFMA 4NT4A 4IMYA 1URCA 2B52A 3I0QA 4R1VA 4RIWA 3DBQA 4E6DA 4B9DA 2OG8A 4WOVA 1HCLA 3U6JA 5LVLA 3ZM9A 5AV3A 4QMSA 1ZMUA 2C3IB 3R73A 1G3NA 4IFGA 4RWLA 4X0MA 4ZTLA 3R30A 5C9CA 4K11A 4E4LA 4V05A 5I9ZA 3MGYA 2XK3A 4KIKB 3D9VA 4BDAA 3FZRA 3FLSA 4MF1A 2XNOA 3PSDA 3SD0A 4AOIA 2YWPA 2QODA 5FLFA 3BLRA 3PXZA 4M3QA 3KL8A 5CLPA 2XKCA 2J6MA 2XIXA 4MVFA 4Z16A 4CD0A 4CT2A 5L6OA 4QTBA 4C3PA 5L2WA 1Q8UA 3COMA 3F5GA 3OWPA 5HVYA 5HE3A 1OIUA 5B2KA 4HCUA 5AV0A 3ZLXA 1PY5A 3F3TA 5LARA 5DRBA 2UZWE 2HWOA 1XBCA 2G2IA 2LGCA 1R3CA 3Q4UA 4HZSA 2XIZA 3H9FA 3KB7A 4YO6A 4KS7A 3ZLWA 2FSMX 3VQUA 4GT3A 5EDQA 3QRKA 1R39A 4O7WA 3F69A 3AC4A 4FTMA 3U6HA 2WQBA 4EBVA 2V0DA 4G3FA 4BBEA 1W98A 2J0MB 4WHZA 4EK5A 5FXRA 2OLCA 3TNQB 2A0CX 4FZDB 3PP0A 2V22A 1PXIA 4JR3A 5AJQA 5CAOA 2QVSE 3KRXA 2XEZA 4X6QC 3PWDA 5A6OA 2YACA 1V0OA 3BHYA 4P5QA 4E1ZA 2F7EE 3GNIB 4DFYA 4APPA 3C7QA 1DS5A 2W0JA 2CKQA 4WUNA 4QMVA 3VS7A 1Q3DA 2QR8A 3W2QA 2JDVA 4XG9A 3LAUA 3PE1A 4NL0A 2W1FA 2BKKA 3L9NA 3QXOA 2RL5A 3MY5A 3NCGA 1MP8A 2WGJA 1YWVA 3QZIA 2HCKA 4XG3A 4QYGA 4C61A 4IX6A 5CT7A
chains in the Genus database with same CATH superfamily
4C0TA 4FJVA 4FUXA 4GH2A 5KNJA 4FYOA 4X3FA 2AYPA 2WTKC 3ZS5A 5HX8A 3OG7A 3B2TA 4RA4A 1JQHA 3M11A 2BTSA 2VN9A 3OHTA 5BQ0A 5B0XA 4FZAB 4OTIA 4K9YA 3R28A 5KHWA 4Y8DA 2ESMA 4ANOA 4XX9A 3HMMA 5J1VA 1ZLTA 2G15A 4PF4A 4QPAA 4HPTE 3TACA 3DZQA 1ZWSA 5C4KA 4NTSA 3UIMA 1FBNA 4ALVA 1OPLA 4L45A 3AT2A 4YGAA 5EM5A 5HICA 5IDPA 3FI8A 2DUVA 3HL7A 4RLLA 4YJTA 4USEA 4ANSA 3RCDA 2Z7LA 5DMZA 3OEFX 4FIEA 3OZ6A 2IG7A 3VUKA 2G9XA 1OKZA 4FV8A 2W4JA 2XNPA 3FMDA 4IH8A 5J9YA 4FKWA 4TZRA 5K5NA 4AE9A 4GVAA 3TJDA 3LFCA 3V5WA 3R2BA 5E8SA 2A19B 2WOUA 4MAOA 4FK6A 1SVGA 3T3UA 5CY3A 3LFFA 5DR9A 5IF1A 1M2RA 3GXLA 2PHKA 3MSSA 4QTAA 4O2PA 4F1TA 4GK2A 5FP6A 3SA0A 3C4WA 5BMMA 2ETMA 3G51A 2CGWA 2WIPA 2C30A 2VTOA 3I7CA 4IVAA 3ZONA 3ZFMA 2FO0A 4OT6A 5M55A 2QLQA 2YA9A 5J1WA 3FLWA 4FKLA 3UDZA 5M09A 3ANQA 3DK3A 1OUYA 4PPCA 4EOQA 3G0EA 4HNIA 4M8TA 3L9PA 4ZTHA 1OIYA 3R2YA 4O86A 3O8PA 3UOLA 4YLKA 4CFWA 4DH5A 1VYZA 4CLJA 2GQRA 5HTIA 4CRLA 1O9UA 4KIKA 2IVVA 1GZ8A 4PTGA 3FY2A 4AA4A 4IZAA 3VW8A 3DLSA 4DEEA 5FTGA 4R3PA 2C69A 3QWKA 4RX9A 1M2QA 3VBVA 3ZSIA 3WYYA 2WIHA 2R3JA 3D2IA 5DR2A 5CEIA 3VUHA 4AT3A 1REJA 4F9AA 2PMIA 4WNPA 4YP8A 2C5VA 2W9ZB 3W33A 4OT5A 5EW3A 3QALE 5HESA 4EH3A 4AQKA 2R3KA 3FLZA 1Z5MA 3PTGA 4EOOA 2AQXA 2YZLA 5EW9A 4TY1A 3OROA 3D94A 3SXFA 2YIQA 3FUPA 5I3OA 3SW4A 3GENA 2B9HA 3GCPA 1Y6BA 3L8XA 1FINA 3R7YA 1H25A 2NP8A 2XBJA 1XQZA 2X39A 1QL6A 5E8YA 3ZZWA 3PXKA 4GG5A 4F99A 2IZUA 2P4IA 5DT3A 3R9OA 2GCDA 4FX3A 4TNDA 5GJFA 3NYVA 3RINA 2R7IA 4I6BA 5L8JA 4B7TA 2ZMCA 3ZC5A 2EXMA 3E3BX 2VTNA 5TKDA 1NW1A 3RBWA 4AXEA 2FSOX 2VTQA 4EH7A 2Z7QA 4ERWA 4ZK5A 4YJOA 2PVYA 1IA9A 5I9YA 4ZSEA 2OIDA 3OW3A 3V51A 4EHGA 4D2WA 4XG4A 3BWJA 5CU6A 3SAYA 1BI8A 4DGOA 5I9VA 4XV2A 1SYKA 2IVSA 4NKAA 3SRVA 2KULA 2UZBA 4MXXA 4HZRA 4UZDA 5FRIA 1UU3A 1PXJA 2R4BA 2C68A 4FIFA 4UN0C 3ORXA 4YHFA 2XM8A 2IVUA 4CNHA 3VBTA 3FMEA 2QONA 4RQKA 2VTRA 1SM2A 1UA2A 3BHUA 3TTIA 2PY3A 4ZJVA 2XNMA 2OI4X 1SVEA 1JLUE 3BL7A 3GQLA 3KULB 1FGKA 5AV1A 3QQHA 4L42A 2Y4IC 1GIHA 4BCGA 3L1SA 4I6FA 4Y85A 1DI8A 3ZXZA 5IQBA 4DBXA 1HCKA 2ITUA 5TE0A 2BR1A 4RLKA 5A4LA 3F7WA 3MI9A 4O7TA 3TM0A 3N51A 5CVGA 4FIIA 4QO9A 1E9HA 2HZIA 4AG8A 4J97A 2VZ6A 2VWZA 5EW8A 2YM3A 3QQUA 4MF0A 3UPZA 2VO7A 2BZIB 1PKGA 4HGLA 2XRUA 4LFIA 5GIOE 5F95A 2IW9A 4OTQA 2XALA 3I6UA 1QCFA 3BYSA 4DFNA 1MQBA 2W1ZA 2C6EA 3LHJA 5CENA 1YI6A 3C51A 4G5PA 4I20A 2HAKA 2WMSA 3MB6A 5DG5A 4ZZMA 3RPVA 3UGCA 2RG6A 3I4BA 4J53A 3SOAA 2NO3A 4IC8A 3NR9A 3PZEA 1PKDA 4DT9A 4JXFA 2X4ZA 1OBGA 2XJ0A 3GUBA 3PA5A 3NCZA 4GG7A 4ZXTA 3UIBA 3ATSA 3CQWA 4QMOA 4AW5A 3CD3A 3KA0A 4XG6A 4CV9A 1J3HA 3TNWA 3TZ9A 3FDNA 3ENMA 3UMXA 4I5HA 4C37A 4C34A 4E20A 4ERKA 3NUNA 1LEZA 3PSCA 4IE9A 5D7VA 3MY1A 1KE9A 3PUPA 5I9XA 2ZM4A 3Q60A 4OTRA 4JNWA 5L2IA 2BVAA 3DLZA 3GQIA 3EKNA 4FNZA 1GZKA 3JYAA 5HVJA 4EQCA 4RX5A 4C7TA 4CG9A 4UWCA 3IG7A 4X2GA 3EFWA 5C26A 3UOJA 4EHZA 4OAVB 1KSWA 3GU8A 3FKLA 3LM5A 3QTQA 4PL5A 5EH0A 3KMWA 1EH4A 4FK3A 4L3LA 4TN6A 2WMBA 3UIXA 4BGQA 4E4XA 5HX6A 5EHYA 4PRJA 4XG8A 1RJBA 3HV3A 3WF6A 1IASA 4NSTA 4QP9A 3U8WA 5I9WA 2ONLA 3MTFA 4D55A 4BIBA 2GQSA 4NCTA 2I6LA 1ZOGA 2RF9A 1UU9A 3I60A 4CFFA 1PMVA 2R7BA 3VWAA 4EWQA 4EZ3A 4WRGA 3FMNA 3F3WA 3BX5A 4P7EA 4BDFA 2ZMDA 4HYSA 4M66A 5A9UA 3KVXA 1BL7A 2YEXA 5J87A 1W2CA 3W2OA 3NUXA 5JMSA 3QXPA 4IB0A 4HCTA 4E26A 3V5TA 2W1CA 5ANIA 1OBDA 2OFVA 5CYIA 3TNPC 3TCPA 3G33A 3HUBA 5F94A 3R02A 3CEKA 2W5BA 2QOKA 2Y6OA 3UVRA 1PYXA 4GRBA 4O0RA 2Y8OA 5C8KA 5J9LA 4DA5A 4UWBA 5M07A 2DQ7X 2YLFA 3O7LB 3CS9A 4IAAA 3O8UA 3EWHA 4KINA 2YN8A 3AC5A 4WBBB 3SW7A 3A8XA 4IDTA 1YDTE 3DBCA 4M15A 4D58A 4DAWA 2BKZA 2FYSA 3Q04A 4O0TA 1REKA 2PPQA 4YTFA 4O0SA 3VS5A 4U3YA 3T8OA 3IO7A 3MPTA 5DN3A 1O6KA 3QTRA 2WKMA 5LXMA 3C5UA 2P55A 2GQGA 1ZOHA 2JLDA 4N6YA 4H3QA 4K0YA 4IW0A 3Q4CA 4GU6A 4FIJA 4FGBA 4ALUA 2UVZA 3D5XA 2VRXA 3DQWA 4P4CA 4O7LA 2JDSA 4FNXA 4YHJA 1UWHA 2XH5A 2ITQA 3IK3A 3W16A 1PW2A 2Z2WA 3KULA 3MPAA 4RVKA 2RGPA 3R7IA 5CT0A 4L44A 3QKKA 3W0QA 3TIYA 4BWPA 5A4QA 3EN7A 4FKTA 3GI3A 5BYYA 3RAKA 4Y5QA 4QDVA 3PPKA 4XBRA 4ASDA 3B8RA 4NYEA 5FUTA 1U4DA 3LFNA 3UMWA 3EQDA 4B8MA 4AXDA 2QD9A 4D9UA 3ULIA 4C4EA 3WILA 5GZAA 4D9TA 4O7SA 4FKRA 1JNKA 2ERKA 3ORPA 3PVWA 5FXSA 3QD4A 5AAFA 4D4VA 5IZFA 1UNHA 4YMJA 4IWPA 1OECA 1GAGA 4PMTA 3TV6A 4BDGA 2WHBA 2JITA 3ZFXA 4BYJA 2B9FA 1BKXA 2E9OA 2RFSA 2WMAA 5GZ9A 4CZUA 2C5OA 3OEZA 4IAYA 4I3ZA 2YLEA 2UZUE 4S2ZA 4XBUA 2OICA 4XRLA 4ORKA 3D5WA 3QUDA 3REPA 3KEXA 4FL2A 5M4CA 1YHVA 5FDXA 3C0HA 3S4QA 1V1KA 4JDIA 5JQ5A 5HE1A 2UW3A 3RJCA 3CTHA 5BVOA 5DFPA 4FV6A 4EH2A 1QPJA 5M56A 3IECA 5ANJA 2YZAA 4IANA 2J7TA 5IA2A 2B9IA 2RIOA 5L2TA 3RZFA 4CRSA 4F65A 3FL5A 2OH0E 3PUFC 4MWIA 4D0WA 4IVBA 4WRSA 2PVKA 3M2WA 3OBGA 3LQ5A 3DJ7A 3HRFA 5E8WA 3II5A 3UP2A 3VHKA 3S0OA 4NEUA 4FTTA 2PZRA 5M4UA 5HZNA 5KO1A 5FEQA 4FC0A 4WNKA 5AAEA 3LCDA 4C8BA 3HV6A 2A4LA 4QMQA 1KUTA 1I44A 1PXLA 4OTGA 3ZO3A 3HMPA 4O7ZA 3BIZA 3CY3A 5CSXA 2OK1A 3LCOA 5HD4A 1T45A 4UMRA 4C57A 4EC8A 3FE3A 2UW4A 3MH3A 5HVKA 2W99B 3GBZA 2F4JA 2XK9A 2V7OA 2JD5A 3ACKA 4XP0A 1MQ4A 4G34A 5IG1A 3DQXA 3PFQA 2ZAZA 2B1PA 2B53A 3ZEPA 1JKTA 2W17A 2FSTX 4RMZA 4NZWB 4C4IA 1UKIA 2AC5A 4C3RA 3GCVA 4KKHA 4UYNA 4EH5A 2QOHA 3C9WA 3UOHA 2OFUA 2Q0NA 4YZDA 2CHLA 3OWJA 3TYKA 3D15A 3VN9A 5IQFA 5AP5A 2CNQA 1LR4A 4MNFA 4AAAA 2VTIA 1JKKA 5ANEA 3OY1A 2PMLX 4FG9A 4ID7A 2WOTA 4AOJA 5EI2A 3AGMA 4MTAA 4M67A 3VIDA 3BYUA 4O7VA 1TQMA 2BAQA 4RRVA 4P90A 4WNOA 3G15A 4L01A 1JWHA 1XBAA 4I5CA 2OSCA 5IPJA 4NM7A 5CI7A 5AUUA 3SXSA 2GTNA 3R1NA 5ETIA 2BTRA 3QCXA 2I1MA 4BI1A 2X9EA 4LMNA 1OI9A 4CEGA 1H0VA 1YXXA 5AM6A 4FKVA 4ACGA 1SMHA 2C6OA 2VO0A 4CXAA 4FRFA 3FV8A 2Z8CA 5ANGA 3RNYA 3MW1A 2Y6MA 3PY3A 3PJCA 1XH5A 1YOJA 4QT1A 1OB3A 3KGAA 1OMWA 2XYUA 2PU8A 3F88A 3E7OA 3V5LA 3S00A 2YFXA 1NXKA 3RPYA 3W1FA 1ST0A 3HDNA 4NU1A 4F6WA 5KMIA 1UVRA 3R9DA 3MS9A 5EYCA 1QPEA 2QO9A 2XM9A 5LMKA 2CDZA 1OITA 2X8IA 1XH6A 2YM8A 2YJSA 2XZSA 3PWYA 4I0RA 4KSPA 4C35A 2WAJA 5LVPA 4J1RA 4G5JA 5CSWA 4UYAA 4CCBA 2IW8A 2R3OA 3AG9A 2IN6A 3ORKA 2X8EA 3MVJA 5EQPA 3FKOA 3H3CA 3KXZA 3OOMA 4RJ5A 2EXEA 4RFZA 5GJDA 3TWJA 1TFFA 3BV3A 3MH0A 5C8MA 3GC8A 4BKJA 3PJ1A 2I0HA 3TV7A 1MRVA 4XV3A 5A46A 4U8ZA 2JIIA 2OW3A 3W0RA 3CR0A 3UDTA 4E6AA 4NFNA 3BLQA 4I94A 2JEDA 1URWA 3BYMA 5HCZA 4UX9A 2R3RA 3E87A 4L68A 4U9AA 3KIOC 4ZTQA 4FL1A 3UQGA 5AP6A 5C8NA 3LFAA 4G6NA 4HGSA 3UG2A 2IPXA 2XIRA 2WMTA 2GS2A 3O7LD 3P86A 1BLXA 3GEQA 4OR5A 4CYIA 2ZJWA 4DG3E 4FODA 4FVQA 4BBFA 2ZFYA 4ASZA 3VBQA 5KMJA 4RGJA 4RFMA 3D5UA 3F5UA 5IUGA 1V0BA 4D4SA 3DT1A 3FZSA 3PIXA 1XBBA 3PLAE 2R3MA 3HLLA 3GC0A 1NVRA 4FOCA 4G6OA 2BRNA 4LUDA 5EDPA 2HK5A 3OS3A 3A7IA 3DGKA 5CEQA 5CF5A 3LJ2A 3N4TA 3FLYA 5M44A 2GU8A 3CLYA 3NUUA 4FBXA 2OJIA 3O50A 2XNEA 3QYWA 4PL3A 5IMEA 4YJRA 5AA8A 5FG8A 3W0PA 3QHRA 3LXPA 4LRJA 3QCYA 3QZGA 3HYHA 2VTSA 1L8TA 3LE6A 3AC3A 4D2PA 4O6LA 3ZUTA 2VWBA 4BDIA 2HZ0A 1CKIA 2OWBA 4NUSA 3D7ZA 4I6HA 4C36A 4J95A 4A9RA 4QP1A 3HDMA 4GCJA 5CX9A 5TR6A 5HU9A 4OBPA 5IEVA 3Q9YA 1FQ1B 1LPUA 3OUNB 1KE5A 4DDGA 4LV8A 3VJNA 2X6EA 2IF8A 5KBQA 1GZNA 2JAVA 3F2RA 3LM0A 4NIFB 3LFEA 2HXLA 3L9LA 2XNBA 4GS6A 5EK7A 4FTLA 4OW8A 4ZSGA 4YJQA 4ZY6A 5DR6A 5FBOA 4OTDA 4A9SA 3GU7A 3V3VA 3DFAA 1U5RA 4IDVA 4AUAA 3UQCA 2YDKA 1U5QA 3K2LA 4YLJA 4G3DA 5BV3A 3PVBA 5HNBA 1WBTA 3Q9ZA 3POOA 3BLAA 2W1GA 3ALOA 3PSBA 4G3EA 3FY0A 5AUTA 2A2AA 2GS6A 2V55A 3Q5IA 2WTCA 4QP2A 5C03A 2ZYBA 3HKOA 4JOAA 3IW8A 3GP0A 3KRJA 3VBWA 2I0YA 3Q9XA 1Q8ZA 2PULA 2VTHA 4M13A 3KU2A 2ITZA 3CCNA 4TRLA 4GIHA 4MEDA 4XG2A 3FMLA 4GL9A 2CKPA 4WG3A 1UV5A 4PMMA 5CXZA 3LLAA 2QNJA 2HXQA 4U79A 5J7HA 5M4FA 1F5QA 1DI9A 3KF7A 2VWYA 4MKCA 2H34A 2C6TA 1FVTA 3VUDA 3R8VA 5A4TA 1M7QA 1A48A 3IW7A 4DYMA 3NGAA 5IQCA 3AMAA 3R8PA 3U9NA 4J99A 4YJPA 2WU7A 2PK9A 5H8EA 4G3GA 2WEVA 3ZOSA 4E3CA 4PPAA 4AZSA 5K3YA 2QURA 2PMNX 3FQSA 4HVDA 4PDPA 4DINA 3ORIA 5HEZA 4O7NA 4MQ2A 3R1QA 3ZCLA 3DDPA 4EK3A 5M4IA 3ZLSA 4ACDA 4D5HA 3U55A 4DEHA 4XHKB 4A07A 3TTJA 2PVFA 5CU0A 2B9JA 2C1AA 4K2RA 5CWZA 3GU5A 2VNWA 3KMUA 3GVUA 5CXHA 4NW6A 4IAZA 5AR4A 3QD3A 3AD4A 3K5UA 3EJ1A 3EYHA 4GJ2A 4L67A 5AP7A 4B99A 4YNEA 1XJDA 2HY0A 2Z7RA 3TKUA 2O65A 5F1ZA 1Q97A 2QOIA 3F3ZA 4F08A 3UJGA 3BE9A 2BRBA 3ZLYA 2YCRA 4YTIA 5A4EA 5D1JA 3FPMA 3P78A 2YCFA 5JFSA 4S32A 4QMPA 3LLTA 3KC3A 1NY3A 5FDPA 2W4KA 2ZDTA 5ANDA 4XLIA 4EQMA 2CN5A 2YCSA 5CI6A 4DFZE 4MD9E 4I21A 5DE2A 4YNOA 1M14A 4D1XA 3CIKA 4ZZOA 5LVNA 4MXZA 2IO6A 2UZDA 2OGVA 4CFNA 4CYJA 1FPUA 4RIYB 3KQ7A 5CEMA 3ETAA 4C59A 4FV5A 1FVRA 4FSMA 4IQ6A 2IZTA 5AR7A 2GHLA 3MA6A 4L3JA 4C62A 4QOXA 4U45A 5BMSA 2F2UA 2OXXA 2QKRA 3UZPA 4LM5A 4BCNA 5LWMA 3LQ3A 3VQHA 2C3KA 4EOPA 3QQLA 5EM7A 1WZYA 3RHXA 3V6SA 2WZJA 3EQPA 2C3LA 2EXCX 3EQIA 4M14A 1XMLA 3TEIA 1P4FA 1S9IA 1H1SA 2PVHA 4R77A 3OT8A 1B39A 1J1BA 4FKIA 3P5KA 4OTFA 4C4JA 5DRDA 2J50A 5EI8A 5G1XA 4NJDA 4YSJA 1Q8TA 3DS6A 3W55A 4KBKA 2PVRA 4RJ8A 3MIAA 2XS0A 3HMNA 4C4GA 1ZZLA 3DAJA 4MQ1A 3ZUVA 3JY9A 4ACHA 4B0GA 3NUSA 2YIXA 1SVHA 2ZV2A 4GK4A 3ZRKA 4B4LA 3RAIA 5IH5A 1H1PA 2ZM1A 3FZ1A 3WARA 1W83A 5C4LA 3HRBA 3R9RA 4I4EA 4R5SA 2JKQA 1UU8A 4TXCA 5CTPA 3FPQA 4K77A 3W8QA 4DH8A 3EQHA 2CGXA 4G9CA 4E4NA 2PYWA 2R2PA 4NIFA 4QYHA 1PMUA 4PTCA 4F0GA 3LMIA 4U97A 3Q32A 3R8MA 4ACMA 4DEAA 5CU2A 2H96A 4JDKA 4JT3A 4G16A 1GIIA 3B8QA 3HP2A 4UMTA 4AN3A 2JBOA 4YURA 4Z7GA 4QP8A 3LCKA 3LQ8A 4EK4A 4J96A 5ETAA 4MYGA 4DC2A 4CMOA 4QMXA 2CN8A 3FC2A 3WF7A 3GU4A 4IBMA 4O4CA 2IZRA 1OVEA 3L8SA 5IISA 3F5PA 4X3FC 5ANOA 4AGUA 5KMMA 1VYWA 4AW2A 2VO3A 1ZOEA 2G01A 4MWHA 3CPCA 4NM5A 2EVAA 3AXWA 3QUEA 3SXRA 5BVNA 4BWKA 2E9VA 2V62A 2LAVA 4CV8A 4I24A 2BPMA 4RIXB 4ZEGA 4D4RA 4EUUA 4FT7A 2X0OA 4ZAUA 4DBNA 4W8EA 4O1OA 5FTQA 4EYMA 3PXQA 5DNRA 4PP9A 3NIEA 3CPBA 1OL5A 2CNVA 4HNFA 3QQGA 4D4YA 4YPSA 2X9FA 2W4OA 3EKKA 2UW0A 3HV7A 2OJFE 4FI1A 4RSSA 1MRYA 4GU9A 4YZBA 4HGTA 3POZA 2A1AB 5AR3A 3I7BA 3VVHA 3VHEA 1JAMA 4O96A 3FL4A 1YXTA 3R9HA 1YRPA 5AP1A 2WQOA 4E5BA 3FI3A 4FT5A 2YJRA 3JXWA 5HG5A 3OCTA 4Y73A 3R04A 4BICA 3G9LX 4BCOA 2C5YA 5DH3A 3ZZEA 4KIOA 1H26A 4APCA 5B2LA 3P7CA 4OBQA 4O91A 4R7BA 3H0ZA 3C13A 1H24A 4RC4A 5FQDC 1RE8A 5ANKA 4QMLA 3VUMA 2BCJA 4AN9A 2X81A 5HIEA 4JBOA 5JH6A 3RK5A 3ZSGA 3I81A 4X3JA 3EQFA 4FF8A 4MH7A 4GFMA 3QU0A 3A4OX 1XH9A 3LXLA 3A99A 2CSNA 3QA8A 4S34A 5KKRB 3R7UA 5CASA 5HLPA 3UC3A 4PMPA 3ORNA 4BCKA 4FR4A 4R1YA 4CFUA 4EQUA 4EUTA 2WMXA 3BQCA 3PDTA 1NVQA 5HO8A 2A27A 4QTCA 4YHTA 1YOMA 4JBPA 4R8QA 5FP5A 4RFYA 3PP1A 4G31A 4QYFA 5CVFA 3LXNA 4YTCA 1WFCA 2PUIA 4RIYA 2PE2A 4FZFB 2VWVA 3ROYA 4CKIA 3ERKA 5CZHA 1IAHA 4L52A 4IWOA 4E93A 3O5AA 4DFBA 3NSZA 2QOOA 5FBNC 1IA8A 4CFMA 4EYJA 3UBDA 5EG3A 2QHNA 3EFKA 3R21A 4QQCA 4F09A 2NYAA 1UKHA 4UMUA 4F78A 3BHHA 4RT7A 3O71A 1Y8YA 3WI6A 4BDCA 1P5EA 3EYGA 4G3CA 3O17A 4XMOA 4F6SA 4AN2A 5M57A 1XR1A 3P79A 4O7RA 4ANQA 3SDJA 2XKDA 4ZTRA 5TOZA 5DLSA 3VF9A 1PF8A 3GCQA 1JPAA 3T9IA 2ITPA 3ROCA 4QP4A 3LIJA 4AQCA 3RM7A 2WTJA 5J7BA 4F0IA 3F7ZA 5TF9A 3EN4A 2PUNA 3DPKA 4RBLA 2CNUA 4JL9A 5FGKA 3OCSA 2XNNA 4GJ3A 4AOTA 5EOLA 1H0WA 4JDHA 4O21A 5JSMA 3VRZA 3R71A 4R3CA 4Y95A 4BDDA 4ZLZA 5JZJA 4LQMA 3RHKA 4BN1A 1AQ1A 3U54A 2E9UA 3DK6A 5FEDA 5DGZA 2G2FA 4G1WA 3MJ1A 1IR3A 2YCQA 5E8TA 3NLBA 3VS2A 3QLGA 3V01A 4C38A 4D2TA 2YABA 4DF3A 4FSRA 4YPDA 4HVGA 2XJ2A 2CGVA 2VWWA 3FWQA 1KV2A 1GY3A 4HPUE 3KRRA 3E93A 2CCHA 4TYHB 4AZWA 5CEPA 1Q24A 4FTAA 3SHEA 3MVMA 4G17A 1H1QA 2ZV8A 3V8TA 5K4IA 4GKIA 3MPMA 2VX0A 2VTJA 4ASEA 2I7QA 4PL4A 3C1XA 4Q9ZA 4D0XA 4DT8A 4TNBA 3ZHPC 3QKMA 4IXPA 3BE2A 3UYTA 4MXOA 4RIXA 4R7IA 1JKLA 2OIQA 4F7SA 3EN9A 2PZ5A 3DXPA 4X6RA 4PWNA 5IQDA 5FEEA 2WQEA 3QRTA 3DNDA 3RWQA 3NNVA 3NVMB 2Y7JA 5JT2A 5HNIX 5DT0A 2UZEA 3NX8A 5GNKA 4WNMA 3D2KA 1RW8A 3DA6A 3THBA 2WTDA 1H28A 3QD2B 1Z9XA 3A60A 3GCUA 4AACA 4EL9A 2ITOA 3F5XA 2B4SB 2YIWA 3G90X 5AP0A 3PJ8A 4AXCA 2QLUA 4X2NA 2GPHA 5HO6A 4F9BA 3F9NA 4DE4A 5HD7A 5L3AA 2O64A 5AR2A 4F4PA 1H4LA 2JDOA 3LJ1A 1Y6AA 4GEOA 4ZS0A 2C1BA 4NTTA 3ZEWA 3SOCA 3ITZA 3RAHA 3VF8A 4IM2A 1W0XC 4JX7A 3C4XA 4LL0A 3IDPA 3BL9A 4NW5A 1JKSA 3F3UA 4FSUA 4JQ8A 4IAFA 4Q9SA 3AQVA 4W4YA 4A9YA 3QA0A 4J98A 4O0VA 4BC6A 4L3PA 5L8KA 4O84A 5IDNA 4BCJA 3BWFA 5M51A 3DKCA 5CEKA 3KKVA 5HCXA 1FVVA 2BRGA 2XKFA 3AT4A 4CVAA 4O0YA 4DHIB 4FEQA 4FA2A 2P33A 2W9FB 5TT7A 2P0CA 4PDSA 4IM0A 3KF4A 5HBHA 4EH8A 1IAJA 4IAIA 4TWPA 5CNOA 4CQGA 3FXZA 3OMVA 4QQJA 4M97A 3TG1A 3FSKA 4ZZNA 4DFXE 3BI6A 3ZRMA 2BIYA 3TJCA 5CANA 4QYYA 4JS8A 1U59A 2XCKA 3D14A 3JVSA 2WB8A 4RZWA 1FGIA 5ICPA 2ONLC 3M1SA 4IEBA 1KE8A 2UV2A 4NCTC 1ZZ2A 5L8LA 2VGPA 3DAEA 3PRIA 4PP7A 2XB7A 4Y83A 1GZOA 5HG9A 4ANBA 2BUJA 2GNLA 3HVCA 4I5PA 5BUEA 3GC7A 5HLWA 4U6RA 1PXKA 4FTUA 4MNEB 4PUZA 4YSMA 3ZBFA 4BGGA 3W2SA 4FTCA 3PXFA 5DPVA 3MVHA 4KIQA 2HELA 3G6HA 3OP5A 3ORLA 3WIKA 3RAWA 3DAKA 4IZ5A 4AS0A 3GU6A 1B6CB 3EN5A 3FMKA 3U51A 3V5PA 3HGKA 2FGIA 4H58A 4ZY5A 4CQEA 5BUJA 5IU2A 2V7AA 3AT3A 2WQMA 4CLIA 4C58A 2W7XA 4DG0E 4NWMA 4WO5A 4DGGA 1G8AA 3NIZA 4MCVA 3PRFA 3PJ2A 4JLCA 5IH4A 5IA4A 3LMGA 4R6VA 3D0EA 4EH6A 3V8SA 3H9RA 2OZAB 3NS9A 4A4XA 2ITWA 5AADA 5E8UA 4I4FA 2WTWA 4P5ZA 1B38A 2BDFA 3BEGA 2BDWA 2PVMA 4L43A 2G2HA 5EKNA 2XA4A 2QU5A 4IZ7A 1ST4A 2P2IA 3VW6A 4BTJA 1CKPA 4WUAA 3HP5A 5AM7A 3IS5A 3N4VA 3BLHA 4TYHA 5AR5A 5GINE 3AMBA 4HJOA 4NK9A 3CGFA 3E7VA 1WBPA 1Q41A 2VX3A 5EI6A 4LUEA 1QPCA 5AUYA 3PG1A 4F9WA 5IA1A 2CGUA 3EHAA 4ALWA 5E8VA 1QPDA 2BROA 5C27A 3NYXA 3KREA 3QQJA 5E9EA 2GNFA 4YU2A 2UW6A 3E88A 3JVRA 2J0IA 1PRYA 5HBEA 3CE3A 3KN6A 3QKLA 3BBTB 4LRMA 2QC6A 2R3HA 4DGNA 2XP2A 4UZHA 4UEUA 3UODA 4FTOA 4L8MA 4TWCA 2O5KA 4C33A 4DEGA 1DAYA 3AD6A 3ZO2A 4QNAA 1WVYA 3FHIA 3UO4A 3GB2A 4JRNA 4BZOA 4ZOGA 4AU8A 3EOCA 3C5IA 2WMWA 5HKMA 4E6QA 4FMQA 3TUBA 3IW5A 1OL6A 1PYEA 4H1MA 1ND4A 2QCSA 5IA0A 5GJGA 3PXRA 2YM6A 2ZM3A 3UTOA 3TZ7A 3D5VA 1BMKA 4A4LA 5AUWA 1I09A 3PJ3A 3E3PA 4Z55A 5IEYA 1ZRZA 4AWIA 2FH9A 3ZDUA 3SKCA 4BCIA 4OTPA 1SNUA 4HOKA 4RQVA 4TT7A 5HE0A 4ZSAA 3ZDIA 5DA3A 3JR1A</