2B4SB

Crystal structure of a complex between ptp1b and the insulin receptor tyrosine kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
294
Chain Sequence
b'DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein phosphatase, non-receptor type 1
publication title Crystal Structure of a Complex between Protein Tyrosine Phosphatase 1B and the Insulin Receptor Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 91
structure length 294
sequence length 297
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2b4sB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2b4sB01
4K2RA 5FD2A 4QMNA 4IVDA 3F5XA 4GVJA 4QP4A 3DA6A 2XB7A 1UWHA 3OMVA 3ROCA 4BYIA 2AC5A 3OWLA 3UQCA 3ZFXA 1GIHA 2PU8A 3Q9XA 3CY3A 4OR5A 3ZONA 3H9OA 2W1FA 1P5EA 4EJNA 5GJGA 3W2SA 4F7JA 4AACA 4HZRA 1Q4LA 4H05A 3PY3A 2W99B 2DS1A 4A9RA 5CEOA 2F2CB 3Q6WA 4IC7A 4WG3A 5FUTA 3FXZA 3UODA 1IAJA 3HMNA 3VVHA 5J1VA 5HIBA 3ROYA 3OOMA 4YJSA 3FDNA 4ALUA 2GNGA 3VBQA 1YQJA 2XIKA 3THBA 4MXYA 3QRIA 1UU8A 3UZRA 3GCPA 4LOOA 2OF2A 4ORKA 3QWJA 1UVRA 2QKRA 3RZBA 4MQ2A 4YZCA 2OKRA 1YXSA 4OUCA 4YTFA 2O8YA 2UZDA 4M69A 1M7NA 4EWHA 3VUKA 2J2IB 4M13A 1BX6A 1XQZA 4WNKA 4EZ3A 3AC3A 4ZZMA 4W8DA 3TIZA 1XH9A 3VUDA 2BRGA 2WO6A 4FTJA 3FJQE 4CEGA 3O71A 4Q5HA 4BDIA 4CV8A 2WFYA 3VHKA 4CKIA 4BCGA 5IU2A 3G5DA 3PIZA 2IVTA 4UEUA 4FT5A 3POZA 2ZM4A 5ANJA 5HE0A 3FLQA 3NYXA 3OHTA 3PJ3A 4QPMA 5JRQA 2YERA 2ITVA 1HCLA 2E9VA 2E9UA 2PSQA 2X8EA 5KMJA 4W4VA 3WZDA 4IAIA 4R3CA 3KREA 4H1JA 4XYFA 2J50A 4FIHA 4QMXA 4AGCA 4C62A 4C58A 2A27A 3UP7A 2ZB0A 4APPA 4LQMA 2C1BA 4DGLC 2ETRA 2YM4A 3FV8A 3HZTA 1KE5A 5HO8A 4LOQA 3HYHA 4Q9SA 4BIDA 3RWQA 4E7WA 4E6CA 4O84A 3I79A 3LXPA 4EH9A 3VULA 3UZTA 3ZM9A 3DQXA 3ALNA 4ZJVA 2JDRA 5EM5A 3LJ1A 4U9AA 3LCTA 2DUVA 3CGFA 3NNXA 1FGIA 4M97A 4F7SA 4O7SA 1WBOA 4E1ZA 2QVSE 2FSTX 4ITJA 1Q8ZA 3HRBA 2JIIA 4O82A 2C1AA 1M7QA 4FSRA 4YBJA 1JPAA 2QONA 4ZTMA 3E7VA 1PMVA 4I0SA 4OBQA 4YJOA 4TYJA 5T6KA 1YW2A 4FZ6A 4A4LA 1WFCA 5BUEA 4O81A 3SXFA 3F2NA 3F5PA 3HGKA 2GNLA 4YC8A 4NJ3A 5J79A 1CSNA 5HG9A 5CSVA 4RIOA 4YPDA 4J7BA 3QA8A 1DI9A 3TWJA 3IGOA 4I94A 2B9HA 3KXXA 3V6SA 4BICA 3QKKA 4ERWA 5HO6A 4D2PA 1M52A 3ZFMA 5IA0A 2BAJA 1R1WA 1CDKA 4XLIA 4H39A 3Q4CA 5K0XA 4Y5QA 5FTQA 3O8UA 3Q4UA 2BDFA 1XH6A 3ZFYA 2Z7QA 3LQ8A 4AG8A 2FUMA 4UYNA 4EQUA 2OSCA 2F9GA 2BIKB 2X9FA 4KIKB 4R78A 4QYHA 3UDBA 4F1OA 1HOWA 2UZWE 4G6LA 5F94A 4YSJA 1W84A 1H27A 5M4UA 3HKOA 4HGSA 1KOBA 5A4CA 3CQWA 1H0WA 5I4NA 3NGAA 4PMTA 4YJUA 3W2PA 3P7BA 2WD1A 1OKVA 3ENHA 1KV2A 3HMOA 3VJOA 3LFEA 2YIRA 3QRJA 2W17A 1M2QA 4YZBA 3HUBA 3GQIA 3LLTA 3PZEA 5J95A 1OUYA 3TZ7A 3OWPA 4ID7A 2QD9A 2W5HA 3OTVA 2XYUA 3R73A 4KB8A 5AUUA 4IM0A 4GK3A 4R7BA 5IEXA 4F63A 3GCUA 3LFNA 4GIHA 4GT5A 4FVQA 4YHTA 3FMEA 2VO6A 4CV9A 3TTJA 4YSMA 4EYJA 3JR1A 3O50A 3IS5A 3QQJA 3KVWA 5AA9A 2RG5A 3MFRA 3UC3A 2B9FA 4JI9A 4O0SA 3EN4A 3R7EA 5JH6A 4DCAA 3MESA 2G2FA 3KXGA 3PXRA 4GJ3A 2PZPA 3QLGA 4QQJA 2QO2A 4FTMA 4UMPA 4CKJA 1YI4A 3H30A 3GOPA 2WU7A 4EKKA 4P90A 3DS6A 5AAFA 3RPRA 4NH1A 5J87A 3BLHA 4GV1A 5C8MA 3QZIA 3V5WA 2HY0A 2C69A 2NP8A 3EFKA 4RWIA 3V8SA 5J9YA 4FNXA 3MFUA 5B7VA 1BL7A 1R39A 4EZ7A 4YR8A 4RJ6A 4O0TA 3BZ3A 3R1NA 3U55A 2HCKA 2O63A 4AGDA 4KBKA 1IA9A 4CFWA 4O0RA 4ONAA 2OH0E 2Z8CA 5IDNA 4PDOA 3NYNA 2BZJA 3MY0A 4P5QA 2WTIA 5KMOA 4Y85A 4EH4A 4L6QA 1VR2A 3HMMA 4CMUA 3KULB 4I23A 3II5A 4LL0A 3QRKA 2X4FA 4GYIA 4P2KA 2C6EA 2XH5A 3DCVA 4M0YA 2UW4A 3ORKA 4AU8A 1LP4A 4AZVA 5CF8A 2PL0A 2REIA 3C1XA 4MNEB 5CU6A 3HAMA 3FPQA 2CNUA 4FV3A 2BRNA 2ETMA 5AJQA 5AR7A 3HRFA 3R2BA 4EOIA 4PTGA 2XUUA 1JVPP 2HZ0A 2ITUA 3OD6X 2B52A 5CAOA 4G5PA 1UNHA 4TZRA 4U79A 4DLIA 4F64A 3H4JA 2P4IA 4LGGA 3SG8A 2VZ6A 1F0QA 3FHRA 3A62A 4RZWA 1B6CB 4ANBA 1O6KA 4XG8A 4QYFA 3PPKA 5CF5A 5HE3A 3HDNA 5KUPA 1H1PA 1PXKA 3BEAA 5CYIA 1WBWA 3CJGA 2PY3A 3ORLA 3QTUA 4RJ4A 3WF8A 4QTEA 4S2ZA 3VUTA 4IDTA 2ZV8A 4FICA 5EQPA 3TNHA 4C35A 4PTCA 4D2SA 2OI4X 2UW3A 4AX8A 4C4GA 2IZTA 5CT7A 1ZZLA 2JAMA 2BVAA 3A4PA 3DT1A 5CI7A 2OXXA 3R71A 4M7IA 3OVVA 4EKLA 3O96A 4DLJA 5CASA 2NPQA 2BDWA 4XEYA 1WBVA 3IW7A 2F57A 2PULA 3C13A 3KA0A 3QTQA 4LRMA 1WBNA 1ATPE 3G0EA 4AOTA 4FTCA 5J9ZA 5DT3A 3RBWA 3RHKA 4FOCA 5ETAA 4PNKA 4KUJA 4BI1A 5L2TA 5E4HA 2P3GX 3ZXZA 2QOKA 1G8SA 1SYKA 2RFSA 3DNEA 3BV2A 3G15A 3BQCA 1YOMA 3EL7A 4NTSA 3VUMA 2ONLC 3OCGA 2JC6A 4TRLA 2UZOA 5EH0A 4BCNA 3C4WA 4RJ8A 2UUEA 3LFCA 4BTFA 4UV0A 5K4JA 5CS6A 3EH9A 2C3IB 3NYVA 2VAGA 4XCUA 4M69B 3RPYA 5DG5A 2VTIA 1PY5A 4DCEA 5CEIA 5IH5A 1KE6A 1PW2A 2OFUA 4V05A 4YHJA 2C3LA 5CI6A 3TNPC 3UG2A 4GK2A 3HRCA 4BI0A 3TACA 3UYTA 2G15A 4CG8A 2QU5A 1F3MC 4V01A 3Q9YA 2W5BA 3A7HA 5IA1A 3A7IA 3ZC5A 2QOLA 3PA3A 5K4IA 3BELA 3HLLA 3MDYA 4CKRA 4IX3A 3V3VA 2WMSA 4EK5A 5DA3A 1O9UA 1MRVA 2W4OA 1GY3A 5EHOA 1SNUA 1WVYA 1ZOEA 3N4VA 4BI2A 1PMEA 4EWQA 5BYLA 3HA8A 5DHJA 5KMIA 3P08A 4FVPA 3KU2A 5AV3A 4FV2A 3EMGA 4FZAB 3ZRKA 5AUTA 4YMJA 3U6JA 4O91A 5CSXA 3DTWA 4I5CA 4BTKA 2WQEA 1FQ1B 1OPLA 2V62A 4YTIA 4IWDA 2A0CX 3MY5A 3BBTB 1DS5A 4RX8A 4AW0A 1YHVA 5M09A 5GZAA 2ETKA 2WTWA 4AOJA 5KNJA 2X1NA 3RPSA 2KULA 3TN8A 2GCDA 2NRUA 1H00A 4QMOA 5DYJA 4TWCA 1V0OA 3R8MA 4I1ZA 4FTUA 2AC3A 5DVRA 4EJ7A 3LFAA 4BRXA 4PTEA 3KXHA 4JR3A 4XG2A 3FSKA 4J52A 4HPUE 4IAAA 4RC2A 3VNTA 2J0IA 3W8LA 4NU1A 4U42A 3S2PA 5TOZA 2A2AA 4NWMA 3EOCA 4YNEA 2C5NA 3GB2A 3DKOA 4XG9A 4FX3A 4F4PA 1H28A 5IPJA 2GSFA 2GQSA 4O7LA 2ZMDA 4QNYA 3MPMA 1S9IA 3ERKA 3BYOA 2NO3A 3MTLA 5EYMA 5CSPA 3MS9A 2VX1A 3NUPA 4FT0A 4A06A 3GENA 3UOLA 4U44A 4JAJA 4DFXE 2WEVA 2VWZA 4AS0A 2WTKC 3CEKA 4GKHA 3KRJA 2ZVAA 4S31A 4U7ZA 4TPTA 3DKFA 2J5FA 2WQOA 4LGDA 5D7VA 5EM8A 2Z02A 3GU5A 4C7TA 4EOOA 5M07A 4HYUA 2YISA 2OBJA 3BX5A 3D83A 3SOAA 2BUJA 3IDPA 3K54A 4MF0A 1XH8A 4JX7A 4XLVA 4BC6A 4E5WA 4CXAA 5AM7A 3KKVA 4RVLA 4X6QC 3ZH8A 2GNFA 4RLKA 4PPCA 2RGPA 2XP2A 3NNVA 4CZTA 5DPVA 4GH2A 4U43A 1WVXA 4NEUA 5FXRA 4CTCA 4JDHA 2PVJA 4YJTA 4L7FA 4TWPA 3R9OA 3T9TA 3B2TA 3LOKA 3NUSA 3ZSGA 5EM7A 3ODYX 3QCQA 4QPAA 1JSVA 4IANA 1FGKA 3BYMA 2CHLA 3FI4A 4O6LA 4FGBA 4AP7A 2PVHA 4BDHA 5LOHA 2VX3A 2J0MB 3P9JA 4TT7A 5FEDA 3PIYA 2JIVA 2PK9A 1LR4A 4BDJA 4EI4A 3AC1A 2BCJA 3AOXA 4O27B 4RC4A 1YRPA 2ZV2A 4FT9A 2YM7A 4X7QA 4DC2A 2R5TA 4RIXA 4DN5A 4TYHA 5CU0A 4HVDA 5HBHA 3NVMB 3SW7A 1Q8YA 3EQBA 3FMJA 3IKAA 3KCFA 2P2IA 5AUZA 4XBRA 4CYIA 5H3QA 3OY3A 4UN0C 2GTMA 4I21A 3CLYA 4EHVA 3ZOSA 4M84A 2R4BA 3DBEA 3IW4A 4EK3A 5H8EA 5BVNA 4UY9A 5AP3A 4XS2A 3LCOA 3FXWA 3R0TA 4U3YA 4BVUA 5FDPA 3EL8A 2OK1A 3ZLSA 2VTLA 5KMNA 5ACBC 3FMLA 4IWQA 3BWFA 3QTXA 3ZCLA 1YXXA 4WNPA 3DBCA 3QTSA 5I0BA 1STCE 5EOBA 4DH1A 1PXIA 5LMKA 4FKWA 4QQCA 2W9FB 4AT5A 3PIXA 4FKVA 3GBZA 3HP2A 4QTDA 4C33A 2J5EA 4HNFA 3R9NA 3S3IA 2O2UA 1M2PA 2E2BA 2AYPA 2ITWA 4XP0A 2XIXA 3FKOA 2R7IA 1UU9A 2XBJA 3LZBA 5L2WA 5M55A 2UZUE 4X3JA 5CZIA 2I40A 4J95A 5HU3A 2XF0A 4FKLA 5E8UA 5I9UA 1VJYA 4XOZA 5LMAA 4KBAA 2VTRA 5A4EA 4C59A 4KIPA 2X2LA 2YCFA 1H0VA 3Q60A 2Y4IB 3GGFA 1PHKA 3PPJA 1Q8UA 4JXFA 3WE4A 3CY2A 4ZLZA 3KRRA 3TJDA 3Q53A 2C0IA 4C4IA 3Q96A 3FMHA 4GG7A 3U6HA 4RSSA 2OGVA 3AT4A 1Q41A 2RL5A 2A19B 4K11A 4L46A 4RX7A 3UPXA 4QYGA 2CPKE 2PUUA 2C6LA 3HV5A 4MQ1A 1H1RA 5I9YA 3PWYA 4IX5A 4OTWA 4AA4A 2VD5A 2JITA 5ANEA 2F4JA 4M67A 4WUAA 3TG1A 4S33A 3VUGA 1B38A 2F2UA 1NY3A 2V5QA 3LFSA 4L3PA 2OZAA 3QL8A 5ANOA 1SNXA 3S1HA 4EHZA 4PP9A 4Q2AA 2ITNA 3L9PA 4DEBA 3F3ZA 2WQBA 3UVQA 1YWVA 1UA2A 3ZLYA 4R1YA 1TVOA 1QL6A 2ACXA 1ZOHA 3GFWA 4UWBA 3E8CA 3P86A 4BBEA 3MY1A 2NNWB 4TWNA 3SA0A 5KO1A 4LRKA 3RNIA 3QX2A 4PP7A 4UMRA 2EWAA 2BZHB 4CFUA 2H8HA 1JKKA 4C3RA 3KFAA 3QHWA 3FL5A 4BHNA 3HP5A 3H3CA 1OB3A 3FZSA 1QMZA 4ACDA 4GS6A 2UV2A 3VBWA 3F88A 3K3JA 4FSYA 5ITAA 2UVZA 4PX6A 4J96A 2WB8A 1G3NA 1T46A 3F61A 3QWKA 3DLSA 4DBXA 2C3JA 1H01A 2Z2WA 3DKCA 4OTDA 3VBVA 5FRIA 3CTHA 3N51A 5DR2A 3U8WA 5D12A 4CFMA 3A99A 5JFVA 4PQNA 3R04A 5EK7A 4AA0A 4EUTA 2CGUA 4BGHA 4ZP5A 2UZVA 4ASZA 3PY1A 4FEVA 1AGWA 3VO3A 2WMWA 3FC2A 4HCVA 4MXXA 2R64A 2ZYBA 3E63A 3HV6A 5L2QA 1BI8A 1JBPE 2YCRA 4E4LA 2YM3A 4TNBA 4AFJA 3I60A 3L8SA 3BHUA 3GOKA 2PMNX 5IUGA 2VV9A 2OJFE 3LHJA 3OG7A 5HICA 4DTBA 1YI3A 2IW6A 3FI8A 3NZ0A 3DLZA 1P4OA 4FYNA 5CQUA 4AOIA 4AZSA 4AZEA 4QMPA 4GW8A 4UWYA 4X3FC 5BMSA 5E8VA 3PLSA 5HTCA 1ZY4A 3C5UA 4LMUA 3ITZA 3MV5A 1RQQA 3QGYA 2HK5A 3BE9A 3KN5A 3H0ZA 3IDBA 3QZGA 4IZAA 4YO6A 4O7WA 3FBVA 2G2HA 3DDQA 4BIEA 4RX9A 3O2MA 1FINA 5E8WA 2PPQA 4NIFA 2IW8A 3BV3A 2Z7SA 5LVLA 2HIWA 5BVFA 3EYHA 4IDVA 4QMYA 2WU6A 4O0UA 3BI6A 2PVFA 4EOQA 5M56A 3IG7A 2QO9A 3KF7A 3MB7A 5I9ZA 3PJ2A 2HXLA 1Y8GA 3QQHA 4FL1A 4G31A 4PL4A 3H9RA 4PMPA 5A6OA 3AC4A 2OW3A 4OT6A 3R9HA 4RA5A 2X9EA 4F0FA 4IAKA 1M14A 4XV1A 5E8ZA 3BYVA 1NT2A 4CMOA 4DGOA 4UXLA 3CKXA 4D2WA 2XNOA 2C5XA 3UNKA 1WVWA 5IQFA 4I6FA 2OZOA 2X8IA 3W2CA 2VTMA 4AT3A 4YZMA 4WSYA 4IWPA 3RM6A 4PF4A 3SXRA 4BKJA 2HYYA 4U3ZA 4BCPA 4FTQA 4OGRA 5D11A 5JSMA 2YDJA 2XKFA 3GP0A 2BAQA 3OP5A 4Y95A 2GQRA 3O23A 2YJRA 3NSZA 4ZSJA 5JT2A 4FE2A 4KA3A 3Q4ZA 2XNNA 3PSCA 2Y4PA 4I92A 2GNJA 3P78A 4MHAA 5KHXA 2YM8A 5E9EA 2YITA 4O21A 4O96A 5C9CA 2FVDA 5IH6A 4YZDA 3GXLA 1OL7A 2OJGA 3KULA 4IX4A 4YJQA 4ZY4A 4JQEA 4EK8A 4ZY6A 3PWDA 4UALA 2JFMA 4QYYA 3LCDA 3D15A 5KMLA 4ASDA 1ZRZA 2C0TA 3A8WA 5IMEA 3U87A 3DBDA 5HEZA 4U97A 5TO8A 2ZB1A 4IX6A 3ZO4A 3C4XA 3OEFX 3EN5A 3OFMA 4FSTA 4RQVA 4UZHA 5LWNA 4JBQA 2PYWA 3V5JA 1PXPA 4HYHA 5ETCA 2OH4A 5JMSA 1ZMWA 3AMYA 3R6XA 3I6UA 5HLPA 5BUJA 4RVKA 5HKMA 3C7QA 4RWKA 4XG4A 1OZ1A 2XBAA 3LMGA 4ZTHA 3F5GA 3W10A 3EYGA 3VHEA 3DFAA 3QTIA 4DEIA 3ZTXA 3SHEA 5KZ0A 3CJFA 3SLSA 2XNEA 2QO7A 3CP9A 1JKLA 4QT1A 4FUXA 5C8NA 4RQKA 3EQIA 4F1MA 4L7SA 2Y6MA 4JX3A 4CZUA 4D0XA 4FA2A 3ENMA 1Q99A 3E7OA 5HGIA 4XV3A 4KIOA 3KRXA 3ODZX 4D2VA 2CKEA 1ZZ2A 3PJ8A 5CSWA 2ZDUA 4F6SA 1OPKA 3VWAA 3NR9A 3FZ1A 4IJ9A 4F9WA 4DGNA 4II5A 4ITIA 3VF8A 3M2WA 3EZVA 5J7BA 3L1SA 2PE0A 3HDMA 2X7GA 4NKSA 3VRZA 3I81A 3NNUA 3B2WA 3QYWA 1H8FA 2C6IA 2XNMA 1VYZA 4WBBB 3BHHA 4LI5A 5IQDA 2R3LA 4C61A 2GHMA 4L67A 5IA2A 1EH4A 5CAVA 5IH4A 3LCSA 3EKKA 3MWUA 3LCKA 3AT3A 3QF9A 4GFMA 3FYKX 2WPAA 3IO7A 4MD8E 2PMIA 5JGDA 5M53A 1OMWA 1B39A 4MXCA 2PE1A 2P33A 3C9WA 4EBWA 4N70A 1MRYA 2GU8A 5EDQA 3LFQA 4XG7A 5EDRA 2PTKA 3MSSA 1U59A 3LPBA 4APCA 2YAKA 2WZJA 5HCXA 5JFXA 2CDZA 3F5UA 5KKRB 4YBKA 2XJ1A 4MAOA 1PXJA 2EXMA 3TZ9A 5CU2A 4CMTA 4BWKA 4E6AA 3FAAA 2VTNA 4IE9A 4O1PA 1JKTA 4HPTE 3GC8A 3UIBA 4B8MA 2IWIA 1W98A 2ZV7A 4QP3A 5L2IA 4LV5A 4NW6A 2RFNA 4F99A 4YC6A 4BHZA 5AV0A 5M51A 3DKGA 2JDOA 2YABA 4XMOA 1Z5MA 2WOTA 4WG5A 1JKSA 5EG3A 4OTGA 2WIHA 3A61A 3RAKA 2ESMA 1H1SA 1CKJA 4QQ5A 2IJMA 1QPCA 1FOTA 2ERZE 3FHIA 4U40A 3SD0A 3A2CA 3NAXA 5FQDC 2OZAB 4H3PA 3WF9A 4A9YA 4CFXA 4CG9A 3HV7A 3ZRMA 3T3UA 2CN8A 3TT0A 5L6OA 1E9HA 3VW8A 2V55A 5JQ5A 4TL0A 2XNBA 3KC3A 2ITQA 5HG7A 2QR8A 1Q5KA 4GT3A 2DQ7X 5FP6A 5M44A 1PKDA 3NEWA 3V8WA 1JWHA 4HVSA 2A4LA 3JYAA 2RFEA 4L3LA 2XNPA 4BCQA 4W4YA 2UW8A 2ONLA 3MJ1A 2QC6A 4EC9A 3W8QA 2HWPA 4CT2A 4BDKA 3OZ6A 2GS2A 4QP8A 5TT7A 5IA4A 1H07A 1RDQE 1ZLTA 1ZYDA 4IAZA 5KE0A 3EFWA 4CSVA 4RBLA 1W0XC 3MBLA 5DNRA 4IB1A 4B4LA 4DBNA 3O7LB 2VWXA 4K1BA 5FLFA 5D1JA 2ZAZA 4IAFA 5CF6A 1P14A 3ZO1A 4BY9E 4ZK5A 3NW5A 1XWSA 4A9SA 3KL8A 3JPVA 5B2KA 3CIKA 4WG4A 3W16A 4HYSA 3UZPA 1G8AA 3S4QA 3A60A 4FTAA 2HXQA 5IQIA 3IK3A 3B8RA 3MVLA 4N0SA 3FXXA 4EQCA 5KMKA 4QYEA 3OWKA 4N57A 5FTGA 2C5VA 2CN5A 3ULZA 3SV0A 3FMMA 5J9LA 4C3PA 4NCTC 4GKIA 2WMAA 3NVKI 3G6HA 4AAAA 2WEIA 1PJKA 4QTCA 4GSBA 4WA9A 3RCDA 2OXDA 2PVLA 3R1QA 3ATTA 4NM0A 3W18A 4AZWA 4BFMA 2C68A 4F65A 5EKNA 3TNQB 2WELA 3D0EA 4B8LA 1YWRA 4WKQA 4DGGA 4FG9A 5HVKA 3EQPA 1PMUA 5JZNA 3G9NA 3D5XA 3U4UA 4HGLA 4NIFB 4Y46A 4D5KA 4D1SA 3VS4A 4DA5A 1QCFA 5HQ0A 2B9IA 4L01A 5B2LA 4AXAA 3O17A 2UVYA 2PE2A 3EKNA 1Z9XA 3ORTA 3QD0A 3QHRA 3QRUA 5LXMA 3OF0A 3M42A 5C03A 3WYYA 3R7IA 3ZM4A 4O7YA 2I0YA 4ZIMA 4C4HA 4DEAA 2J4ZA 4YJNA 4JNWA 4G3GA 3RVGA 4ITHA 3C0IA 1CTPE 3D5WA 2JFLA 1UV5A 4HVHA 1UKHA 2PVKA 2EXCX 5H8GA 3PRIA 1APME 3FY2A 4C4JA 2DWBA 4DT9A 4OTHA 4DTAA 3ZS5A 2Q0BA 2W1IA 5KHWA 4GRBA 4LRJA 3RJCA 2XIRA 2H96A 4RFYA 5JN2A 5IA3A 3BHYA 3WZJA 5K5NA 4TYGA 4X2JA 2VTJA 4DHFA 2P55A 2XKCA 4DEGA 3NMUF 4GYGA 5E1EA 3DQWA 2PZYA 5KBQA 3LQ3A 4ACHA 3DBQA 3LFDA 3GU7A 3EN7A 3I4BA 3CTQA 2CCHA 4IC8A 2RSVA 3FI3A 5EKOA 3AC8A 1V1KA 2W4JA 1I09A 3WYXA 5E7RA 2UZTA 5M57A 4GT4A 4IH8A 4L3JA 4DITA 5CAPA 4ARKA 3MIYA 3EQFA 3EIDA 5E8YA 3PG1A 4J97A 1XH7A 2XA4A 5HU9A 2OICA 2H34A 4FL2A 3UP2A 5ETIA 4YTCA 4UB7A 5FGKA 5AEPA 4RX5A 5AADA 2XIYA 3E88A 5EHYA 3LFFA 4D9UA 3Q9WA 3RAIA 4C37A 4CTBA 4J71A 4CFFA 1KE8A 4FNZA 2R9SA 2QOHA 4GVAA 3DK7A 4IZYA 2VWUA 3L9NA 1BI7A 4JG8A 5EYDA 2R3KA 4O0YA 2WMUA 3VBXA 3WARA 2GFCA 1ZMVA 3GT8A 4FTOA 4WHZA 2QR7A 2XNGA 4PDPA 4CRSA 1NXKA 1R0PA 1GIJA 1F5QA 2EU9A 2ERKA 4FIEA 3BGPA 2QKWB 2W1ZA 4P5ZA 3UIMA 4G9CA 3CS9A 3K3IA 3TDWA 2GTNA 2WMRA 1FVVA 3QGWA 4E26A 3DAEA 2B7AA 4G1WA 4JBOA 3DDPA 4FKTA 4TYIA 1BLXA 4JDJA 4KAOA 4CLIA 4R3PA 5HLWA 3COMA 2B0QA 1DAWA 2E9OA 1WBPA 3AD4A 1XKKA 4ZTRA 4BZOA 3VQUA 4JG6A 3TNIA 5EDPA 4ERKA 3GCSA 3WZKA 3EQRA 4ZJIA 5IDPA 1FBNA 1H1WA 4F9YA 1VEBA 3SRVA 4ZOGA 1YKRA 5I9WA 4PDYA 4D4VA 2QCSA 3DAKA 3JS2A 1UU7A 3GC9A 1XJDA 4MBJA 3DK6A 4XBUA 1OIUA 3PJ1A 3Q52A 3N4TA 3MH0A 4ACMA 1ERKA 4RJ7A 4M12A 3DGKA 3LFBA 3QFVA 4X2KA 4YZNA 4QMQA 2QODA 1DAYA 3MJ2A 2CSNA 3DB6A 4XNEA 2UZEA 4CVAA 5CENA 2HAKA 1TKIA 4RA4A 4CNHA 4IADA 1X8BA 4FKQA 4C34A 5ANGA 2JLDA 1W83A 2W4KA 3G9LX 3TUDA 4L53A 1V0PA 3SDJA 3IDCA 3QCYA 3LW0A 3ZO3A 3GVUA 4O7RA 3NS9A 4FV8A 1YDTE 3FKNA 4QP7A 5AP0A 5T3QA 2VWBA 4EH7A 1NW1A 4TTHB 2UW6A 4FSZA 1JQHA 3C4EA 2V7OA 3W55A 3HECA 3UO4A 5G1XA 3CR0A 3R83A 5GIPE 4A7CA 3ET7A 3GCVA 3NNWA 3W2QA 1KE7A 3F3UA 4KNBA 3OY1A 4OW8A 5K5XA 3OXIA 4Y83A 3VS2A 5ANKA 3QYZA 3D2KA 4QMZA 4I4FA 4FV5A 1GIIA 1ND4A 3O8PA 1E1VA 2W5AA 1WZYA 4WRGA 1V0BA 4FZFB 4RIWA 4BL1A 2QG5A 3BU6A 4FV1A 4OTPA 3GC0A 2XK7A 3PXQA 1RJBA 3Q3BA 3RPVA 4O7ZA 3SOCA 4IVBA 4DGMA 3FLNC 4DFBA 4USDA 3D4QA 3AQVA 4NW5A 2FSMX 4XV2A 3DXPA 5E8TA 2XEZA 3KMUA 3LAUA 1H24A 3FQSA 4FKSA 5M08A 5A6NA 2XK8A 1CM8A 4NYEA 3UVRA 2CJMA 3MA6A 2PVYA 4K8AA 5H8BA 4WT6A 3ZU7A 4XRJA 3NIZA 2XKDA 3FLSA 3D14A 5BYZA 3EN6A 4G17A 3PE2A 4XRLA 1O6LA 3EZRA 3KMWA 2C5YA 3Q2MA 3AXWA 5DLSA 5EW3A 2R3QA 2C0OA 3CPCA 2Z7RA 4JQ7A 4ZTNA 4ANNA 4ZSAA 3QC4A 3UJGA 1XH4A 3QC9A 5CT0A 5DH3A 5BPYA 4X3FA 2ZM3A 4G16A 4IWOA 5CXHA 4ZAUA 4G6OA 4GG5A 4IIRA 5CQWA 3A7JA 3K5UA 2R3OA 3KXZA 3ETAA 4LL5A 3W1FA 3NCGA 4Z55A 3F3TA 2ITOA 4AE9A 1GZ8A 1ZAOA 3R28A 4I6BA 4J1RA 2R3IA 3CSVA 4M66A 4GFOA 2PUNA 4FSQA 3L8PA 3P5KA 3E62A 4XJ0A 2G9XA 2XMYA 3QU0A 4FL3A 4AF3A 3DNDA 1VYWA 3FMDA 5AAEA 2ITXA 5LVMA 2C6KA 4ZTLA 3NYOA 3F2RA 1PKGA 4GU9A 5K9IA 4FTRA 3KB7A 4IFGA 3KVXA 4C02A 5IZFA 4L68A 4R6VA 2YJSA 4ZS0A 4YP8A 4D58A 5E8SA 5IQCA 4S32A 2YLFA 5IEVA 4CZYB 4NUSA 3NUUA 2WGJA 1CMKE 4BDEA 5CTPA 3MH3A 3RWPA 3E8NA 3WF7A 5C26A 3L9MA 4E6DA 3ACKA 2O0UA 3P4KA 2PZIA 3OUNB 2IVUA 1OI9A 3VC4A 4IACA 1OBDA 3PP0A 5DIAA 2C6OA 2Y8OA 4QTAA 4RPVA 3HL7A 3BYUA 4LOPA 3R00A 1IAHA 3ELJA 4DG2E 2Q0NA 3PE1A 4AT4A 2CNQA 2VTTA 4EYMA 5EYCA 4AN9A 2OO8X 1Y6AA 2X7OA 4C8BA 1K9AA 4TW9A 5FEQA 4IM2A 4USEA 3LMIA 3VBTA 4XUFA 4BCJA 1DM2A 4FEUA 3QALE 3F66A 4YZ9A 2WTKB 4D5HA 3REPA 2BTRA 4FV6A 2YFXA 2BROA 3FUPA 3GCQA 4M0ZA 2OJIA 2VWYA 4DT8A 1FVRA 4LUDA 4KKHA 4EH6A 4UMUA 4BTJA 2X7FA 3LXNA 4I20A 2BRBA 2RIOA 3AD5A 5LQFA 2BILB 1CKIA 1ZYSA 5BVOA 4JOAA 2XVDA 1J3HA 2HWOA 5HTIA 3OBGA 5D10A 3F82A 5CVGA 4I6QA 5J1WA 4BZDA 5I9XA 4IB5A 5H2UA 3D5UA 4R7HA 1PMNA 3H10A 4QP2A 5TF9A 4OAVB 3FI2A 1YI6A 1OVEA 1U46A 3QQKA 2VO0A 5EI8A 1PF8A 4ANQA 4KSPA 5F1ZA 4D2TA 4D4RA 3MGYA 2A1AB 5HO7A 4FIFA 4WUNA 3C0GA 3BLRA 5A9UA 4EEVA 1MQBA 5L6PA 4NM3A 2J9MA 3NDMA 5DRDA 3JY0A 2B54A 3F7WA 3GFEA 3F9NA 3TCPA 3FMNA 4FBXA 4YJVA 5LARA 1M2RA 1H1QA 5AP4A 5J8IA 2XM8A 3DTCA 5AUYA 4GCJA 5M4IA 2W9ZB 3GC7A 3FLWA 1WAKA 2HENA 5GJDA 2WTCA 2XJ0A 2YCQA 3KN6A 2YDKA 2OIQA 4F6WA 5AR3A 4IM3A 5L4QA 3QD4A 4F1TA 2C30A 4ACCA 4FYOA 1LPUA 1NA7A 1QPEA 4NKAA 3V8TA 4O22A 3OTUA 3CTJA 4O7TA 4RVMA 2QNJA 3OW4A 3VS1A 3BCEA 5C4KA 3BWJA 1NVQA 3OXTA 5GNKA 3TM0A 3N9XA 1XBCA 4F7LA 2FYSA 4FOBA 4B7TA 4E8AA 5A14A 4DFNA 3TV7A 2WOUA 3KEXA 3ZUVA 5C01A 4FEWA 3QBNA 4L8MA 5CEQA 1O6YA 2Y9QA 4Z16A 3C4FA 3R7GA 4CQGA 4ZSGA 4ZTQA 1IEPA 3PSDA 5JFSA 2R7BA 1TQPA 3ZDIA 3O8TA 3POOA 3SRVB 2KTYA 3FPMA 3PYYA 4S34A 5M06A 2I7QA 4BKZA 3D2IA 2ITPA 3E93A 2FA2A 3MA3A 4UWCA 4U6RA 2ITZA 3VS0A 2XK3A 3R7YA 5HVJA 3PXYA 4MX9A 4D4SA 2PZRA 1Q97A 3C4CA 4YGAA 3VF9A 1Q24A 4QMSA 4BGGA 3AMAA 5CEMA 1TQIA 2QHNA 1GAGA 3PUPA 3PRFA 5AFVA 1A9UA 3PSBA 2W1EA 4PL3A 4BDBA 2CKQA 2W96B 3AT2A 3VBYA 4RWLA 4KRDA 3RAHA 2W06A 4DE4A 4YLKA 3EN9A 3ZYAA 4J8MA 2CCIA 4IMYA 3TZ8A 5HBEA 3OCBA 3UC4A 4ZMEA 2WQNA 4PUZA 5FEEA 5ICPA 4H36A 2WXVA 2IPXA 5IQAA 3PA5A 4A4OA 4MBLA 4IJPA 1Q3WA 4AFEA 2XRWA 1OL6A 4GUEA 1FMKA 4KABA 1TQMA 1YWNA 4HZSA 3VRYA 4L45A 3BPRA 1Q61A 5AAGA 3RCJA 3UQFA 4G2FA 4EOKA 3NPCA 2WTVA 4IHPA 3HV3A 3P23A 3OT3A 5L3AA 3RMFA 1JOWB 2EB2A 5HNIX 2QOIA 4ZXTA 1OM1A 2J0JA 5IG1A 2ZV9A 2OU7A 3H9FA 5CNNA 4NK9A 2QU6A 1A06A 3K2LA 4Z3VA 4Q9ZA 4HCTA 3BHVA 5LVPA 2GDOA 2IZRA 3OOGA 5IUIA 4XOYA 2QHMA 3DU8A 1W8CA 1YDSE 2RF9A 2X6DA 3GU8A 5DFPA 4RIWB 2GHGA 5AMNA 5HOAA 2IN6A 3PFQA 3V5PA 2ZJWA 3DBFA 3KRWA 4XHKB 4ANOA 5GHVA 3L9LA 1H26A 4WIHA 2I0HA 5HD4A 1PXOA 2UVXA 2B53A 4OT5A 4Y72A 2PHKA 4RRVA 3R8PA 3MH1A 1ZWSA 4C2VA 4YPSA 4QP6A 5DT0A 4EH5A 4N6ZA 3ZZWA 3UOJA 1OIQA 3RAWA 5HTBA 2DYLA 4FF8A 4OAUC 5DI1A 2E9NA 3PXKA 3WILA 2I6LA 4O0WA 3MVJA 2XCHA 3QTWA 2BIYA 4IQ6A 2JGZA 3VS3A 4I41A 1URWA 2W0JA 4TXCA 4X0MA 2CGVA 5EW8A 5HBJA 5LVNA 2CKOA 4Z7HA 5AR8A 4DEDA 1ZYJA 1OL5A 4TKSA 4AW5A 4A9UA 4EK6A 3R21A 3PVBA 3EQDA 2VRXA 4NCTA 5JEBA 4M15A 4FKIA 1ZARA 4QRCA 1Y91A 3ZRLA 1JNKA 3FQEA 5FM2A 4AA5A 4MXAA 2WTDA 1NVSA 3PA4A 5HIEA 5EM6A 5GIOE 3VUHA 4IEBA 5HZNA 2WMVA 4A07A 3GQLA 3P1AA 4X3FB 4O7VA 2JDVA 4QP1A 4FTTA 1ZYCA 3UMXA 1BL6A 5AWMA 4BCHA 3FZTA 1AD5A 3COHA 3ZBXA 3QQGA 2E9PA 4EONA 2QOCA 4XG3A 3R1SA 4GMYA 4MCVA 5IQEA 2WQMA 4G3CA 5J7HA 2GMXA 4OLIA 3ANQA 4F70A 2FSOX 4DG3E 5DR6A 4D2RA 4FT3A 5L2SA 5DGZA 2YM5A 3MH2A 3JY9A 4U0IA 4ZLYA 5FM3A 5AP6A 3W2OA 4H58A 3PVGA 3NAYA 3QD2B 5JQ8A 3FZPA 4FT7A 4FC0A 3R22A 1LEZA 3O51A 3GU6A 4A4XA 4PDSA 3CXWA 4K33A 4TY1A 2HOGA 5HHWA 4ASEA 2VTAA 2QOFA 2W1DA 4D9TA 1MUOA 4RWJA 3DOGA 1QPJA 2RKUA 3RPOA 4AZFA 2JDTA 3DJ7A 3PTGA 5JFWA 2R3NA 1HCKA 4TN6A 3ZLWA 2BMCA 3ID6C 2VTQA 4FV7A 2LAVA 4KINA 4CCUA 4Q5EA 5FBOA 5HNGA 3CQEA 1Q8TA 3RHXA 4JT3A 5CXZA 5CY3A 5I3OA 4I5PA 2CLXA 3NUYA 1OL1A 5CAQA 2R3MA 4PPAA 4I0RA 4QO9A 2JKQA 4JG7A 4MD9E 4FIJA 2G2IA 5KMMA 1REKA 4HGTA 2OLCA 4D1ZA 3I5NA 4FSNA 4E5AX 3PVWA 4YNOA 3R7VA 4L52A 2BRMA 2YM6A 4FNYA 4K18A 2XK4A 4E5BA 5HE2A 2X2KA 1XBAA 3RI1A 4R1VA 4N6YA 4EH3A 2VTOA 3E8EA 1OKWA 3JUHA 4G3DA 3R8VA 1DI8A 2YCSA 3VN9A 2J90A 3U9CA 3LLAA 2LGCA 2Z7LA 5EI2A 4NT4A 3RK5A 3CC6A 4FG7A 4FGRA 2C47A 2J7TA 2Y6OA 2V7AA 5E90A 4ANSA 4J98A 3Q4TA 5I3RA 5AX3A 5FP5A 5LWMA 4MXOA 4GIIA 3V51A 3MTFA 2IVSA 1I44A 3OW3A 3QCSA 3KCKA 4M14A 1U54A 3D7ZA 4QD6A 4UX9A 4V04A 4EOPA 4BDFA 2BFXA 2YN8A 4A9TA 3R02A 3R8LA 4AZTA 1MRUA 1WBSA 3H0YA 4NFMA 3FSFA 3ZEWA 3S0OA 4KS8A 2B4SB 3BLQA 1YHWA 5HCYA 1PYXA 4FTIA 3W32A 1OGUA 5BUIA 4Y5HA 3V5TA 4GL9A 4JDIA 5TR6A 4B0GA 2Q83A 3MPTA 4EQMA 3VAPA 3DV3A 2YACA 2XKEA 5K3YA 3TXOA 1SVHA 4EHGA 4MEDA 5DEWA 5M4CA 5IISA 2I1MA 2JKMA 5AV2A 4R77A 2VGPA 4E3CA 3T9IA 5CVFA 4C4FA 2OF4A 4XP3A 5GZ8A 3FZRA 4O2ZA 4E93A 5L8KA 2VTSA 3HMIA 3VUIA 4FR4A 5IMXA 4JIAA 2R3HA 3PVUA 4BN1A 4BB4A 5GJFA 3C5IA 4I3ZA 1XO2B 1NVRA 2BHHA 4FODA 1BUHA 1FVTA 3DJ6A 3WIGA 4U8ZA 3U4WA 4ANMA 4RFMA 3BHTA 2XZSA 1OBGA 3P79A 5HE1A 4FKPA 3IOPA 3VIDA 4C57A 3R30A 2RFDA 4I0TA 3FQHA 3OCTA 4H3QA 5TKDA 4I24A 4O83A 2IO6A 5EQEA 1MP8A 5GINE 3W33A 2AUHA 4AUAA 3V5LA 5AA8A 1OIRA 2C6TA 4MXZA 4G3FA 2P2HA 3R01A 1URCA 5DN3A 3SG9A 5FTOA 4RMZA 2BZKB 4BZNA 5KBRA 4GFGA 2WKMA 2PUIA 3COKA 1WCCA 4AW1A 1YXTA 2BRHA 4FKOA 4FUYA 2JIUA 5CU4A 3UTOA 1J91A 3EFJA 3PXZA 3QTRA 4MBIA 2CNVA 2F49A 4IBMA 5T68A 3R7UA 1RE8A 2X6EA 3WOWA 2R2PA 4OBOA 3LKMA 2W1CA 3EQCA 4PMSA 1IR3A 3UOKA 4U45A 3BIZA 3BE2A 4WNOA 5CEKA 5M4FA 5FDXA 4HOKA 3D7TA 1A48A 3UNJA 1YOJA 3MYGA 1G5SA 4QNAA 3MPAA 2XS0A 4WRSA 4YURA 5D9HA 3ANRA 4U5JA 3R8ZA 4FKGA 1S9JA 3DK3A 1MQ4A 5JGAA 5GZ9A 3KK8A 4FTKA 4RVTA 2C3KA 2OFVA 4V0GA 1CKPA 3ULIA 3Q32A 2YAAA 5IUHA 4YHFA 5HD7A 5FG8A 3WE8A 3KGAA 2OXYA 5IQGA 3FY0A 3QUDA 1U5QA 1YXUA 3E64A 4KKGA 4ANLA 3DXNA 4DFYA 2X81A 1XHAA 5L8JA 1OKZA 2ITTA 4LV8A 3F6XA 2VWIA 4FVRA 2J0KA 4R5SA 3BYSA 3P0MA 4QP9A 1PXMA 5BYYA 3DJ5A 3ZXTA 4NM7A 5LCKA 3ZSHA 3QKLA 2IZSA 4J53A 5C1QB 3L8XA 4P7EA 2JBPA 3D5VA 4O6EA 4BCIA 3QCXA 4X2NA 4YJPA 3RK7A 2YIYA 3TV4A 1WBTA 3MVMA 4ACGA 3DXQA 5KCVA 3G51A 1KUTA 1JAMA 2V22A 3MB6A 3HEGA 4FG8A 4FTNA 4FV9A 2J6MA 2QOBA 3LVPA 1H4LA 4I4EA 3E3BX 5AV1A 4N4SA 5IEYA 3TI1A 3QQLA 3M1SA 5D41A 4HNIA 3CQUA 5IKWA 1ZOGA 3TUBA 3EHAA 3F7ZA 4FTLA 2PVNA 4LM5A 4YUQA 3UMWA 3ZDUA 5BX0A 2I0EA 2W7XA 4FSMA 2VTPA 4OTRA 2R3GA 3MI9A 2W05A 3R9RA 2R3FA 3DY7A 3NCZA 3NX8A 3JVSA 3UGCA 2BALA 3LIJA 2UW5A 3FLYA 2XIZA 1QPDA 3UO6A 2XYNA 3OBJA 2GNHA 3I5ZA 3LXLA 4ALWA 3ZMMA 3Q2JA 2YLEA 1FPUA 1KWPA 5EOLA 3QRTA 4FKUA 4DFLA 3UG1A 4PNIA 4L43A 4BGQA 3UQGA 5C8KA 3SXSA 2JKOA 2HZ4A 3EFLA 2BTSA 3I6WA 2J51A 2Y7JA 1SZMA 3TKHA 3ZC6A 3IW5A 5HX8A 1PXNA 3LQ5A 4EC8A 2GHLA 4NFNA 3LE6A 2WHBA 3O7LD 1OL2A 5IF1A 3QLFA 4FZDB 4FKJA 4XV9A 2PMLX 3MFTA 3QQFA 4NJDA 4X2GA 5LCJA 4AGWA 2JDSA 3U51A 4MVFA 4RJ3A 3CKWA 5A54A 4F09A 4FSWA 3T3VA 3GI3A 3QQUA 2F7XE 1L3RE 3F3WA 1GNGA 1ZMUA 5B2MA 2O5KA 4KKEA 4PPBA 5AP1A 3HUCA 2FO0A 4FI1A 1RW8A 2ZMCA 3PPZA 4F0IA 3RP9A 5LJJA 2WMXA 2UW9A 1Q62A 4WO5A 3OROA 3D9VA 3KK9A 5HORA 4X21A 5EW9A 4LGHA 1LUFA 2GQGA 4RIYA 3AGMA 3HA6A 3LM5A 3RGFA 4AQCA 3C0HA 1PXLA 2FH9A 4M8TA 5DOSA 1PRYA 2OIBA 4ENYA 5HVYA 3ZEPA 4K9YA 2PVMA 4UXQA 1UU3A 5DE2A 4KIQA 2IW9A 3IW8A 3NUAA 4J8NA 3BQRA 3DFCB 4IVCA 5BMMA 2PMOX 3AC2A 3IECA 3NRMA 2XJ2A 3TUCA 3IPHA 4X6RA 5EYKA 2EVAA 5CZHA 4E6QA 1U54B 2EB3A 1UNLA 4GEOA 5H9BA 3S95A 4DYMA 2UZBA 2VWVA 3LXKA 2C6DA 3FMKA 5ACKA 2VN9A 3DZQA 5AUXA 3HX4A 1J1CA 1OECA 2JD5A 3VS7A 4RG0A 3TEIA 3CPBA 1LEWA 2PWLA 2HY81 2C4GA 2VX0A 3BU5A 3I0QA 4BWPA 4BCOA 4O2PA 3TKIA 3ORPA 1K3AA 4DH8A 5A4TA 5F9EA 3MN3A 4GJ2A 5E91A 2JKKA 3NW7A 3HV4A 2WIPA 3ORXA 1T45A 4CD0A 5AUWA 5G6VA 4KRCA 2ZDTA 1JSUA 3BRBA 3ZLXA 4DF3A 1GZNA 2UZNA 4C4EA 4QMUA 4G9RA 3A7FA 3QZFA 4O38A 3FZOA 4PL5A 4BWXA 4FSUA 4DTKA 4B99A 1JSTA 2BHEA 4G3EA 4DAWA 3HNGA 2VGOA 3EQHA 4DINA 4HVGA 5ANDA 1YVJA 3C50A 2BZIB 2PVRA 2W1GA 3ORMA 1SMHA 3TKUA 4OTFA 4R3RA 4UYAA 3CE3A 2IVVA 2QLQA 4XG6A 5TE0A 5JZJA 1UKIA 4DEHA 5I9VA 4FNWA 1W82A 2GPHA 2IZUA 3U54A 3OWJA 4TNDA 3LM0A 3QTZA 4U41A 4F6UA 1GZKA 3I7CA 4FKRA 3JVRA 3V04A 4L44A 4LYNA 3ZZEA 1SM2A 3ACJA 3LJ0A 3QD3A 3QKMA 3HAVA 2BAKA 4MWHA 2OJ9A 4M3QA 3RM7A 3N4UA 4Y8DA 3L8VA 4D55A 5ANIA 4BCKA 4D4YA 4DG0E 4E73A 5AIKA 4ZEGA 4EBVA 3G33A 4D28A 3AGLA 4QQTA 2F7ZE 4CQEA 1K2PA 4JIKA 2XM9A 2X2MA 3OCSA 1P2AA 3A4OX 3ZUUA 4QMMA 3WBLA 2FSLX 4C2WA 3VQHA 2BPMA 3CBLA 4ZTSA 1YXVA 3A7GA 3CD3A 3CCNA 4RLLA 4JS8A 2BKKA 5HCZA 4JRNA 3NW6A 4YJRA 3VS6A 3ORZA 4TYEA 2OJJA 3E3PA 4DFUA 1YOLA 5FXQA 2Z60A 4DH5A 4F0GA 1KOAA 3VJNA 4PMMA 1GJOA 3IW6A 3UVPA 3LMHA 4DH3A 3ALOA 3Q5IA 3SW4A 1XH5A 4HYIA 3KRLA 5DWRA 4PRJA 5CLPA 3R9DA 3WF5A 4E4NA 4E4MA 4KS7A 4JDKA 4M68A 4IZ7A 4HCUA 3JXWA 3UIXA 3D7TB 3UIUA 2WMTA 5CNOA 1J7LA 3OEZA 4HJOA 2WAJA 4FZ7A 3T8OA 2XRUA 3ORIA 1J7UA 2YHVA 2OWBA 3BEGA 3BKBA 4XH6A 3VW6A 4E4XA 4QPSA 2BDJA 2W1HA 4ZSEA 1IASA 3G90X 4RC3A 3OS3A 4F7NA 4F9BA 2Y4IC 3G6GA 4V0GB 3RNYA 4JJRA 5A46A 1W7HA 2HELA 3FWQA 4R8QA 4RZVA 4CGAA 5F95A 4K6ZA 4LG4A 2BFYA 3V6RA 4D1XA 5AM6A 4B9DA 4NL0A 2X0GA 4EOLA 4AW2A 1XBBA 3QUPA 4U81A 4NSTA 5AUVA 3UYSA 3KXMA 4I93A 2UW0A 4FK6A 1AQ1A 3BU3A 1WMKA 3SVVA 3KXNA 2R3JA 4HGEA 3TZMA 4EHEA 2QOOA 3DPKA 4W9WA 1IA8A 3R1YA 2HZNA 5KZIA 1KSWA 3UBDA 3WZUA 1ZY5A 4MYGA 3AD6A 2XK6A 1OITA 4BF2A 2HW7A 3DB8A 5DMZA 3PLAE 1OKYA 4EOSA 4CCBA 4CFVA 2WMQA 5AR2A 4GUBA 3CGOA 3EWHA 3PG3A 3MVHA 1UNGA 1IRKA 4JVGA 4EOJA 2JAVA 4BDGA 4EOMA 3SX9A 3PXFA 1GOLA 2QQ7A 4I6HA 3TTIA 3SC1A 4R7IA 5A4QA 1Y6BA 3FYJX 4W9XA 3K5VA 2OG8A 4EH8A 4FEXA 4KSQA 1YHSA 3EJ1A 1R3CA 3KY2A 4YTHA 4CFNA 3F69A 3R2YA 4DH7A 1Z57A 4HW7A 3GNIB 3E8DA 3PZHA 3WZEA 4WSQA 4D0WA 1BYGA 4ZZNA 3IQ7A 2I0VA 5EI6A 2ITYA 4ZLOA 4OTQA 3RZFA 4RT7A 4RJ5A 2QOQA 4PY1A 4WNMA 2R0UA 4G34A 3S00A 1Q3DA 3EQGA 4UMQA 3RALA 3ZO2A 5L8LA 2WMBA 3P7AA 4NTTA 4MWIA 3QA0A 2FGIA 4L42A 5AX9A 2NRYA 3FEGA 5F20A 4AE6A 1OIYA 3VS5A 4DEEA 4RGJA 2YZAA 5AR4A 3TL8A 4E20A 3SGCA 4I5MA 3RKBA 4MK0A 4ZZOA 5I5ZA 2YWVA 2FB8A 3CD8A 3M11A 4C38A 3NWWA 3IGGA 4PWNA 5DEYA 3RK9A 3P7CA 5A3XA 4FV0A 4KD1A 2O65A 4IW0A 3UE4A 5AP2A 3A8XA 2Y0AA 4IAYA 5BVDA 3OC1A 4ASXA 2XK9A 5CSHA 1VZOA 3PDTA 4CT1A 3Q5ZA 3Q9ZA 4FEQA 1KV1A 2C6MA 2H6DA 3G0FA 4FV4A 2R0IA 2XEYA 3PJCA 4XP2A 4UZDA 2EUFB 4YC3A 4JBPA 4QOXA 1Y57A 2YIWA 4QMTA 4BCMA 3KMMA 3TJCA 4MKCA 3V5QA 2UW7A 3IOKA 2QI8A 1ZYLA 4F08A 5AV4A 3ZUTA 2B9JA 4JRVA 5EHLA 4PV0A 2SRCA 3QAME 1H08A 4CYJA 4QMLA 5DBXA 1GZOA 4JQ8A 5CF4A 5CU3A 5EFQA 5CANA 5C27A 1UWJA 4W8EA 2G01A 3UNZA 2VTHA 4O0XA 3E5AA 3UOHA 4JBVA 4RIYB 3KF4A 5J5TA 4KWPA 4YLLA 4U80A 4JR7A 5LMBA 3TDVA 4K0YA 4UBAA 5AP5A 4ZS4A 5CX9A 5AP7A 1REJA 3TNWA 5A4LA 2P0CA 4F9CA 4IB0A 5E1SA 5JRSA 3E87A 3W2RA 1OPJA 2CKPA 4BDDA 4CLJA 3COIA 3F3VA 4NZWB 5IQBA 3EB0A 2GNIA 4BDAA 3GUBA 4MD7E 4O1OA 4EZ5A 3D94A 4ZY5A 4O86A 4BR3A 3HVCA 3GEQA 3OUKA 4MNFA 5HESA 1PYEA 2X4ZA 4JAIA 4J99A 4P4CA 3G2FA 3ZSIA 5HNBA 3HMPA 3FC1X 5K0KA 2IG7A 3QXOA 4IVAA 2ZM1A 2EXEA 5BVWA 3ZBFA 5HLNA 3F2AA 3NLBA 4FMQA 3B8QA 2XCKA 2BR1A 4EORA 5JKGA 5HI2A 3FL4A 2YWPA 2O3PA 1YDRE 3V01A 2ZOQA 2C5OA 4G6NA 3U6IA 2VNWA 2CLQA 2J0LA 4K77A 2G1TA 3PY0A 1Q8WA 2X8DA 4I22A 3NUXA 4IB3A 4LMNA 4BCFA 3QX4A 4MH7A 4QMWA 4JL9A 5D7AA 2OIDA 4KIKA 2CMWA 5IA5A 5BQ0A 3QUEA 3SQQA 5IQHA 1SVGA 3OXZA 3AC5A 1P4FA 1L8TA 2RG6A 4IXPA 4ZMFA 3C4ZA 4L00A 2YEXA 5J5SA 4BIBA 5E8XA 3ZHPC 1Y8YA 3IONA 4JLCA 3TIYA 4ENXA 2WTJA 4EUUA 5LVOA 4BKYA 5FBNC 4OBPA 1JLUE 3AMBA 4S30A 3FKLA 4Y73A 3I0OA 3MIAA 4NM5A 4QMVA 5CEPA 5DR9A 4WD5A 5EQYA 4EH2A 4LFIA 4AWIA 2CGWA 5FWKK 4O7NA 3MW1A 4DFZE 5DRBA 5BVKA 2YDIA 4XX9A 2GFSA 3DZOA 3WF6A 4FIIA 2B55A 2VO7A 5ETFA 3TV6A 5FXSA 4UMTA 3BBWA 3QZHA 5JK3A 4C3FA 4H1MA 2YZLA 2H9VA 2VO3A 5E92A 2QG7A 2YA9A 4FIGA 2HW6A 3FE3A 1FMOE 3NIEA 4RFZA 4W4WA 4ZSLA 1IG1A 3RTPA 1U4DA 2VUWA 4HVIA 2VNYA 4BDCA 5CAUA 3BGQA 4MF1A 3UPZA 1J1BA 3I7BA 4QTBA 2JBOA 5CALA 5L6WL 4YU2A 1R78A 4FK3A 2V0DA 2X39A 4G5JA 3PP1A 4ZJJA 3KQ7A 4EL9A 3R7OA 1H25A 1M17A 2F7EE 2B1PA 4C0TA 3LJ2A 2GS6A 4LUEA 4OTIA 3GU4A 4MTAA 2R3RA 4L9IA 1U5RA 3WIKA 5BNJA 3BGZA 5HIDA 2CGXA 3ORNA 4B6LA 4C36A 5C4LA 3R63A 2YIXA 3DAJA 4Z9LA 5CWZA 5LMKC 5F4NA 5HG5A 4Z7GA 3RINA 4IFCA 3SKCA 2R3PA 5AIRA 5CVHA 5BVEA 1BKXA 3Q04A 3AG9A 4GU6A 2GS7A 2HZIA 4MNEA 4WBOA 3R8UA 4YO4A 1R0EA 3QXPA 4ALVA 2QURA 3O0GA 4BBFA 5KKRC 4W4XA 2BKZA 4YLJA 1KE9A 1XR1A 5B0XA 4BYJA 4X2FA 2JEDA 2VU3A 2QLUA 1BMKA 3OT8A 1J7IA 1E1XA 2WNTA 3C51A 3WI6A 1OUKA 4AGUA 4USFA 4TWOA 3SAYA 4R5YA 4BTMA 4CRLA 4H3BA 2O64A 3MFSA 3E92A 2PZ5A 4WOVA 5HG8A 3ATSA 4KBCA 4F9AA 2YIQA 1ZXEA 2UZLA 2PUPA 1SVEA 4EK4A 4GK4A 4AN3A 5DT4A 4IZ5A 3U9NA 5JGBA 3I1AA 4O0VA 3UO5A 4BBMA 2VWWA 4RIXB 4AN2A 5AR5A 3Q6UA 4I5HA 4TYHB 5HX6A 5KX8A 3NUNA 3FLZA
chains in the Genus database with same CATH superfamily
4K2RA 5FD2A 4QMNA 4IVDA 3F5XA 4GVJA 4QP4A 3DA6A 2XB7A 1UWHA 3OMVA 3ROCA 4BYIA 2AC5A 3OWLA 3UQCA 3ZFXA 1GIHA 2PU8A 3Q9XA 3CY3A 4OR5A 3ZONA 3H9OA 2W1FA 1P5EA 4EJNA 5GJGA 3W2SA 4F7JA 4AACA 4HZRA 1Q4LA 4H05A 3PY3A 2W99B 2DS1A 4A9RA 5CEOA 2F2CB 3Q6WA 4IC7A 4WG3A 5FUTA 4AXCA 3FXZA 3UODA 1IAJA 3HMNA 3VVHA 5J1VA 5HIBA 3ROYA 3OOMA 4YJSA 3FDNA 4ALUA 2GNGA 3VBQA 1YQJA 2XIKA 3THBA 4MXYA 3QRIA 1UU8A 3UZRA 3GCPA 4LOOA 2OF2A 4ORKA 3QWJA 1UVRA 2QKRA 3RZBA 4MQ2A 4YZCA 2OKRA 1YXSA 1G8KA 4OUCA 4YTFA 2O8YA 2UZDA 4M69A 1M7NA 4EWHA 3VUKA 2J2IB 4M13A 1BX6A 1XQZA 4WNKA 4EZ3A 3AC3A 4ZZMA 4W8DA 3TIZA 1XH9A 3VUDA 2BRGA 2WO6A 4FTJA 3W0SA 3FJQE 4CEGA 3O71A 4Q5HA 4BDIA 4CV8A 2WFYA 3VHKA 4CKIA 4BCGA 5IU2A 3G5DA 3PIZA 2IVTA 4UEUA 4FT5A 3POZA 2ZM4A 5ANJA 5HE0A 3FLQA 3NYXA 3OHTA 3PJ3A 4QPMA 5JRQA 2YERA 2ITVA 1HCLA 2E9VA 2E9UA 2PSQA 2X8EA 5KMJA 4W4VA 3WZDA 4IAIA 4R3CA 3KREA 4H1JA 4XYFA 2J50A 4FIHA 4QMXA 4AGCA 4C62A 4C58A 2A27A 3UP7A 2ZB0A 4APPA 3P5JC 4LQMA 2C1BA 4DGLC 2ETRA 2YM4A 3FV8A 3HZTA 1KE5A 5HO8A 4LOQA 3HYHA 4Q9SA 4BIDA 3RWQA 4E7WA 4E6CA 4O84A 3I79A 3LXPA 4EH9A 3VULA 3UZTA 3ZM9A 3DQXA 3ALNA 4ZJVA 2JDRA 5EM5A 3LJ1A 4U9AA 3LCTA 2DUVA 3CGFA 3NNXA 1FGIA 4M97A 4F7SA 4O7SA 1WBOA 4E1ZA 2QVSE 2FSTX 4ITJA 1Q8ZA 3HRBA 4O4DA 2JIIA 4O82A 2C1AA 1M7QA 4FSRA 4YBJA 1JPAA 2QONA 4ZTMA 2XANA 3E7VA 1PMVA 4I0SA 4OBQA 4YJOA 4TYJA 5T6KA 1YW2A 4FZ6A 4A4LA 1WFCA 5BUEA 4O81A 3SXFA 3F2NA 3F5PA 3HGKA 2GNLA 4YC8A 4NJ3A 5J79A 1CSNA 5HG9A 5CSVA 4RIOA 4YPDA 4J7BA 3QA8A 1DI9A 3TWJA 3IGOA 4I94A 2B9HA 3KXXA 3V6SA 4BICA 3QKKA 4ERWA 5HO6A 4D2PA 1M52A 3ZFMA 5IA0A 3ML1A 4FJVA 2BAJA 1R1WA 1CDKA 4XLIA 4H39A 3Q4CA 5K0XA 4Y5QA 5FTQA 3O8UA 3Q4UA 2BDFA 1XH6A 3ZFYA 2Z7QA 3LQ8A 4AG8A 2FUMA 4UYNA 4EQUA 2OSCA 2F9GA 2BIKB 2X9FA 4KIKB 4R78A 4QYHA 3UDBA 4F1OA 1HOWA 2UZWE 4G6LA 5F94A 4YSJA 1W84A 1H27A 5M4UA 3HKOA 4HGSA 1KOBA 5A4CA 3CQWA 1H0WA 5I4NA 3NGAA 4PMTA 4YJUA 3W2PA 3P7BA 2WD1A 1OKVA 3ENHA 1KV2A 3HMOA 3VJOA 3LFEA 2YIRA 3QRJA 2W17A 1M2QA 4YZBA 3HUBA 3GQIA 3LLTA 3PZEA 5J95A 1OUYA 3TZ7A 3OWPA 4ID7A 2QD9A 2W5HA 3OTVA 2XYUA 3R73A 4KB8A 5AUUA 4IM0A 4GK3A 4R7BA 5IEXA 4F63A 3GCUA 3LFNA 4GIHA 4GT5A 4FVQA 4YHTA 3FMEA 2VO6A 4CV9A 3TTJA 4YSMA 4EYJA 1ST4A 3O50A 3JR1A 3IS5A 3QQJA 3KVWA 5AA9A 2RG5A 3MFRA 3UC3A 2B9FA 4JI9A 4O0SA 3EN4A 3R7EA 5JH6A 4DCAA 3MESA 2G2FA 4AQKA 3KXGA 3PXRA 4GJ3A 2PZPA 3QLGA 4QQJA 2QO2A 4FTMA 4UMPA 4CKJA 1YI4A 3H30A 3GOPA 2WU7A 4EKKA 4P90A 3DS6A 5AAFA 3RPRA 4NH1A 5J87A 3BLHA 4GV1A 5C8MA 3QZIA 3V5WA 3UDZA 2HY0A 2C69A 2NP8A 3EFKA 4RWIA 3V8SA 5J9YA 4FNXA 3MFUA 5B7VA 1BL7A 1R39A 4EZ7A 4YR8A 4RJ6A 4O0TA 3BZ3A 3R1NA 3U55A 2HCKA 2O63A 4AGDA 4KBKA 1IA9A 4CFWA 4O0RA 4ONAA 2OH0E 2Z8CA 5IDNA 4PDOA 3NYNA 2BZJA 3MY0A 4P5QA 2WTIA 5KMOA 4Y85A 4EH4A 4L6QA 1VR2A 3HMMA 4CMUA 3KULB 4I23A 3II5A 4LL0A 3QRKA 2X4FA 4GYIA 4P2KA 2C6EA 2XH5A 3DCVA 4M0YA 2UW4A 3ORKA 4AU8A 1LP4A 4AZVA 5CF8A 2PL0A 2REIA 3C1XA 4MNEB 5CU6A 3HAMA 3FPQA 2CNUA 4FV3A 2BRNA 2ETMA 5AJQA 5AR7A 3HRFA 3R2BA 4EOIA 4PTGA 2XUUA 1JVPP 2HZ0A 2ITUA 3OD6X 2B52A 5CAOA 4G5PA 1UNHA 4TZRA 4U79A 4DLIA 4F64A 3H4JA 2P4IA 4LGGA 3SG8A 2VZ6A 1F0QA 3FHRA 3A62A 4RZWA 1B6CB 4ANBA 1O6KA 4XG8A 4QYFA 3PPKA 5CF5A 5HE3A 4DHZA 3HDNA 5KUPA 1H1PA 1PXKA 3BEAA 5CYIA 1WBWA 3CJGA 2PY3A 3ORLA 3QTUA 4RJ4A 3WF8A 4QTEA 4S2ZA 3VUTA 4IDTA 2ZV8A 4FICA 5EQPA 3TNHA 4C35A 4PTCA 4D2SA 2OI4X 2UW3A 4AX8A 4C4GA 2IZTA 5CT7A 1ZZLA 2JAMA 2BVAA 3A4PA 3DT1A 5CI7A 2OXXA 3R71A 4M7IA 3OVVA 4EKLA 3O96A 4DLJA 5CASA 2NPQA 2BDWA 4XEYA 1WBVA 3IW7A 2F57A 2PULA 3C13A 3KA0A 3QTQA 4LRMA 1WBNA 1ATPE 3G0EA 4AOTA 4FTCA 5J9ZA 5DT3A 3RBWA 3RHKA 4FOCA 5ETAA 4PNKA 2XALA 4KUJA 4BI1A 5L2TA 5E4HA 2P3GX 3ZXZA 2QOKA 1G8SA 1SYKA 2RFSA 3DNEA 3BV2A 3G15A 3BQCA 1YOMA 3EL7A 4NTSA 3VUMA 2ONLC 3OCGA 2JC6A 4TRLA 2UZOA 5EH0A 2ZFYA 4BCNA 3C4WA 4RJ8A 2UUEA 3LFCA 4BTFA 4UV0A 5K4JA 5CS6A 3EH9A 2C3IB 3NYVA 2VAGA 4XCUA 4M69B 3RPYA 5DG5A 2VTIA 1PY5A 4DCEA 5CEIA 5IH5A 1KE6A 1PW2A 2OFUA 4V05A 4YHJA 2C3LA 5CI6A 3TNPC 3UG2A 4GK2A 3HRCA 4BI0A 3TACA 3UYTA 2G15A 4CG8A 2QU5A 1F3MC 4V01A 3Q9YA 2W5BA 3A7HA 5IA1A 3A7IA 3ZC5A 2QOLA 3PA3A 5K4IA 3BELA 3HLLA 3MDYA 4CKRA 4IX3A 3V3VA 2WMSA 4EK5A 5DA3A 1O9UA 1MRVA 2W4OA 1GY3A 5EHOA 5BV3A 1SNUA 1WVYA 1ZOEA 3N4VA 4BI2A 1PMEA 4EWQA 5BYLA 3HA8A 5DHJA 5KMIA 3P08A 4FVPA 3KU2A 5AV3A 4FV2A 3EMGA 4FZAB 3ZRKA 5AUTA 4YMJA 3U6JA 4O91A 5CSXA 3DTWA 4I5CA 4BTKA 2WQEA 1FQ1B 1OPLA 2V62A 4YTIA 4IWDA 2A0CX 3MY5A 3BBTB 1DS5A 4RX8A 4AW0A 1YHVA 5M09A 5GZAA 2ETKA 2WTWA 4AOJA 5KNJA 2X1NA 3RPSA 2KULA 3TN8A 2GCDA 2NRUA 1H00A 4QMOA 5DYJA 4TWCA 1V0OA 3R8MA 4I1ZA 4FTUA 2AC3A 5DVRA 4EJ7A 3LFAA 4BRXA 4PTEA 3KXHA 4JR3A 4XG2A 3FSKA 4J52A 4HPUE 4IAAA 4RC2A 3VNTA 2J0IA 3W8LA 4NU1A 4U42A 3S2PA 5TOZA 2A2AA 4NWMA 3EOCA 4YNEA 2C5NA 3GB2A 3BLAA 4DHIB 3DKOA 4XG9A 4FX3A 4F4PA 1H28A 5IPJA 2GSFA 2GQSA 4O7LA 2ZMDA 4QNYA 3MPMA 1S9IA 3ERKA 3BYOA 2NO3A 3MTLA 5EYMA 5CSPA 3MS9A 2VX1A 3NUPA 4FT0A 4A06A 3GENA 3UOLA 4U44A 4JAJA 4DFXE 2WEVA 2VWZA 4AS0A 2WTKC 3CEKA 4GKHA 3KRJA 2ZVAA 4S31A 4U7ZA 4TPTA 3DKFA 2J5FA 2WQOA 4LGDA 5D7VA 5EM8A 2Z02A 3GU5A 4C7TA 4EOOA 5M07A 4HYUA 2YISA 2OBJA 3BX5A 3D83A 3SOAA 2BUJA 3IDPA 3K54A 4MF0A 1XH8A 4JX7A 4XLVA 4BC6A 4E5WA 4CXAA 5AM7A 3KKVA 4RVLA 4X6QC 3ZH8A 2GNFA 4RLKA 4PPCA 2RGPA 2XP2A 3NNVA 4CZTA 5DPVA 4GH2A 4U43A 1WVXA 4NEUA 5FXRA 4CTCA 4JDHA 2PVJA 4YJTA 4L7FA 4TWPA 3R9OA 3T9TA 3B2TA 3LOKA 3NUSA 3ZSGA 5EM7A 3ODYX 3QCQA 4QPAA 1JSVA 4IANA 1FGKA 3BYMA 2CHLA 4DDIA 3FI4A 4O6LA 4FGBA 4AP7A 2PVHA 4BDHA 5LOHA 2VX3A 2J0MB 3P9JA 4TT7A 5FEDA 3PIYA 2JIVA 2PK9A 1LR4A 4BDJA 4EI4A 3AC1A 2BCJA 3AOXA 4O27B 4RC4A 1YRPA 2ZV2A 4FT9A 2YM7A 4X7QA 4DC2A 2R5TA 4RIXA 4DN5A 4TYHA 5CU0A 4HVDA 5HBHA 3NVMB 3SW7A 1Q8YA 3EQBA 3FMJA 3IKAA 3KCFA 2P2IA 5AUZA 4XBRA 4CYIA 5H3QA 3OY3A 4UN0C 3W0PA 2GTMA 4I21A 3CLYA 4EHVA 3ZOSA 4M84A 2R4BA 3DBEA 3IW4A 4EK3A 5H8EA 5BVNA 4UY9A 5AP3A 4XS2A 3LCOA 3FXWA 3R0TA 4U3YA 3PUFC 4BVUA 5FDPA 3EL8A 2OK1A 3ZLSA 2VTLA 5KMNA 5ACBC 3FMLA 4IWQA 3BWFA 3QTXA 3ZCLA 1YXXA 4WNPA 3DBCA 3QTSA 5I0BA 3W0MA 1STCE 5EOBA 4DH1A 1PXIA 5LMKA 4FKWA 4QQCA 2W9FB 4AT5A 3PIXA 4FKVA 3GBZA 3HP2A 4QTDA 4C33A 2J5EA 4HNFA 3R9NA 3S3IA 2O2UA 1M2PA 2E2BA 2AYPA 2ITWA 4XP0A 2XIXA 3FKOA 2R7IA 1UU9A 2XBJA 3LZBA 5L2WA 5M55A 2UZUE 4X3JA 5CZIA 2I40A 4J95A 5HU3A 2XF0A 4FKLA 5E8UA 5I9UA 1VJYA 4XOZA 5LMAA 4KBAA 2VTRA 5A4EA 4C59A 4KIPA 2X2LA 2YCFA 1H0VA 3Q60A 2Y4IB 3GGFA 1PHKA 3PPJA 1Q8UA 4JXFA 3WE4A 3CY2A 4ZLZA 3KRRA 3TJDA 3Q53A 2C0IA 4C4IA 3Q96A 3FMHA 4GG7A 3U6HA 4RSSA 2OGVA 3AT4A 1Q41A 2RL5A 2A19B 4K11A 4L46A 4RX7A 3UPXA 4QYGA 2CPKE 3VONA 2PUUA 2C6LA 3HV5A 4MQ1A 1H1RA 5I9YA 3PWYA 4IX5A 4OTWA 4AA4A 2VD5A 2JITA 5ANEA 2F4JA 4M67A 4WUAA 3TG1A 4S33A 3VUGA 1B38A 2F2UA 1NY3A 2V5QA 3LFSA 4L3PA 2OZAA 3QL8A 5ANOA 1SNXA 3S1HA 4EHZA 4PP9A 4Q2AA 2ITNA 3L9PA 4DEBA 3F3ZA 2WQBA 3UVQA 1YWVA 1UA2A 3ZLYA 4R1YA 1TVOA 1QL6A 2ACXA 1ZOHA 3GFWA 4UWBA 3E8CA 3P86A 4BBEA 3MY1A 2NNWB 4TWNA 3SA0A 5KO1A 4LRKA 3RNIA 3QX2A 4PP7A 4UMRA 2EWAA 2BZHB 4CFUA 2H8HA 1JKKA 4C3RA 3KFAA 3QHWA 3FL5A 4BHNA 3HP5A 3H3CA 1OB3A 3FZSA 1QMZA 4ACDA 4GS6A 2UV2A 3VBWA 3F88A 3K3JA 4FSYA 5ITAA 2UVZA 4PX6A 4J96A 1W2DA 1G3NA 1T46A 2WB8A 3F61A 3DLSA 3QWKA 4DBXA 2C3JA 1H01A 2Z2WA 3DKCA 4OTDA 3VBVA 5FRIA 3CTHA 3N51A 5DR2A 3U8WA 5D12A 4CFMA 3A99A 5JFVA 4PQNA 3R04A 5EK7A 4AA0A 4EUTA 2CGUA 4BGHA 4ZP5A 2UZVA 4ASZA 3PY1A 4FEVA 1AGWA 3VO3A 2WMWA 3FC2A 4HCVA 4MXXA 2R64A 2ZYBA 3E63A 3HV6A 5L2QA 1BI8A 1JBPE 2YCRA 4E4LA 2YM3A 4TNBA 4AFJA 3I60A 3L8SA 3BHUA 2NYAA 3GOKA 2PMNX 5IUGA 2VV9A 2OJFE 3LHJA 3OG7A 5HICA 4DTBA 1YI3A 2IW6A 3FI8A 3NZ0A 3DLZA 1P4OA 4FYNA 5CQUA 4AOIA 4AZSA 4AZEA 4QMPA 4GW8A 4UWYA 4X3FC 5BMSA 5E8VA 3PLSA 5HTCA 1ZY4A 3C5UA 4LMUA 3ITZA 3MV5A 1RQQA 3QGYA 2HK5A 3BE9A 3KN5A 3H0ZA 3IDBA 3QZGA 4IZAA 4YO6A 4O7WA 3FBVA 2G2HA 3DDQA 4BIEA 4RX9A 3O2MA 1FINA 5E8WA 2PPQA 4NIFA 2IW8A 3BV3A 2Z7SA 5LVLA 2HIWA 5BVFA 3EYHA 4IDVA 4QMYA 2WU6A 4O0UA 3BI6A 2PVFA 4EOQA 5M56A 3IG7A 2QO9A 3KF7A 3MB7A 5I9ZA 3PJ2A 2HXLA 1Y8GA 3QQHA 4FL1A 4G31A 4PL4A 3H9RA 4PMPA 5A6OA 3AC4A 2OW3A 4OT6A 3R9HA 4RA5A 2X9EA 4F0FA 4IAKA 1M14A 4XV1A 5E8ZA 3BYVA 1NT2A 4CMOA 4DGOA 4UXLA 3CKXA 4D2WA 2XNOA 2C5XA 3UNKA 1WVWA 5IQFA 4I6FA 2OZOA 2X8IA 3W2CA 2VTMA 4AT3A 4YZMA 4WSYA 4IWPA 3RM6A 4PF4A 3SXRA 4BKJA 2HYYA 4U3ZA 4BCPA 4FTQA 4OGRA 5D11A 5JSMA 2YDJA 2XKFA 3GP0A 2BAQA 3OP5A 4Y95A 2GQRA 3O23A 2YJRA 3NSZA 4ZSJA 5JT2A 4FE2A 4KA3A 3Q4ZA 2XNNA 3PSCA 2Y4PA 4I92A 2GNJA 3P78A 4MHAA 5KHXA 2YM8A 5E9EA 2YITA 4O21A 4O96A 5C9CA 2FVDA 5IH6A 4YZDA 3GXLA 1OL7A 2OJGA 3KULA 4IX4A 4YJQA 4ZY4A 4JQEA 4EK8A 4ZY6A 3PWDA 4UALA 2JFMA 4QYYA 3LCDA 3D15A 5KMLA 4ASDA 1ZRZA 2C0TA 3A8WA 5IMEA 3U87A 3DBDA 5HEZA 4U97A 5TO8A 2ZB1A 4IX6A 3ZO4A 3C4XA 3OEFX 3EN5A 3OFMA 4FSTA 4RQVA 4UZHA 5LWNA 4JBQA 2PYWA 3V5JA 1PXPA 4HYHA 5ETCA 2OH4A 5JMSA 1ZMWA 3AMYA 3R6XA 3I6UA 5HLPA 5BUJA 4RVKA 5HKMA 3C7QA 4RWKA 4XG4A 1OZ1A 2XBAA 3LMGA 4ZTHA 3F5GA 3W10A 3EYGA 3VHEA 3DFAA 3QTIA 4DEIA 3ZTXA 3SHEA 5KZ0A 3CJFA 3SLSA 2XNEA 2QO7A 3CP9A 1JKLA 4QT1A 4FUXA 5C8NA 4RQKA 3EQIA 4F1MA 4L7SA 2Y6MA 4JX3A 4CZUA 4D0XA 4FA2A 3ENMA 1Q99A 2IF8A 3E7OA 5HGIA 4XV3A 4KIOA 3KRXA 3ODZX 4D2VA 2CKEA 1ZZ2A 3PJ8A 5CSWA 2ZDUA 4F6SA 1OPKA 3VWAA 3NR9A 3FZ1A 4IJ9A 4F9WA 4DGNA 4II5A 4ITIA 3VF8A 3M2WA 1TFFA 4LV7A 3EZVA 5J7BA 3L1SA 2PE0A 3HDMA 2X7GA 4NKSA 3VRZA 3I81A 3NNUA 3B2WA 3QYWA 1H8FA 2C6IA 2XNMA 1VYZA 4WBBB 3BHHA 4LI5A 5IQDA 2R3LA 4C61A 2GHMA 4L67A 5IA2A 1EH4A 5CAVA 5IH4A 3LCSA 3EKKA 3MWUA 3LCKA 3AT3A 3QF9A 4GFMA 3FYKX 2WPAA 3IO7A 4MD8E 2PMIA 5JGDA 5M53A 1OMWA 1B39A 4MXCA 2PE1A 2P33A 3C9WA 4EBWA 4N70A 1MRYA 2GU8A 5EDQA 3LFQA 4XG7A 5EDRA 2PTKA 3MSSA 1U59A 3LPBA 4APCA 2YAKA 2WZJA 5HCXA 5JFXA 2CDZA 3F5UA 5KKRB 4YBKA 2XJ1A 4MAOA 1PXJA 2EXMA 4BJJA 3TZ9A 5CU2A 4CMTA 4BWKA 4E6AA 3O5AA 3FAAA 2VTNA 4IE9A 4O1PA 1JKTA 4HPTE 3GC8A 3UIBA 4B8MA 2IWIA 1W98A 2ZV7A 4QP3A 5L2IA 4LV5A 4NW6A 2RFNA 4F99A 4YC6A 4BHZA 5AV0A 5M51A 3DKGA 2JDOA 2YABA 4XMOA 1Z5MA 2WOTA 4WG5A 1JKSA 5EG3A 4OTGA 2WIHA 3A61A 3RAKA 2ESMA 1H1SA 1CKJA 1OGYA 4QQ5A 2IJMA 1QPCA 1FOTA 2ERZE 3FHIA 4U40A 3SD0A 3A2CA 3NAXA 5FQDC 2OZAB 4H3PA 3WF9A 4A9YA 4CFXA 4CG9A 3HV7A 3ZRMA 3T3UA 2CN8A 3TT0A 5L6OA 4ZS4A 1E9HA 3W0NA 3VW8A 2V55A 5JQ5A 4TL0A 2XNBA 3KC3A 2ITQA 5HG7A 2QR8A 1Q5KA 4GT3A 4I6LA 2DQ7X 5FP6A 5M44A 1PKDA 3NEWA 3V8WA 1JWHA 3BL7A 4HVSA 2A4LA 3JYAA 2RFEA 4L3LA 2XNPA 4BCQA 4W4YA 2UW8A 2ONLA 3MJ1A 2QC6A 4EC9A 3W8QA 4F78A 2HWPA 4CT2A 4BDKA 3OZ6A 2GS2A 4QP8A 5TT7A 5IA4A 1H07A 1RDQE 1ZLTA 1ZYDA 4IAZA 5KE0A 3EFWA 4CSVA 4RBLA 1W0XC 3MBLA 5DNRA 4IB1A 4B4LA 4DBNA 3O7LB 2VWXA 4K1BA 5FLFA 5D1JA 2ZAZA 4IAFA 5CF6A 1P14A 3ZO1A 4BY9E 4ZK5A 3NW5A 1XWSA 4A9SA 3KL8A 3JPVA 5B2KA 3BL9A 3CIKA 4WG4A 3W16A 4HYSA 3UZPA 1G8AA 3S4QA 3A60A 4FTAA 2HXQA 5IQIA 3IK3A 3B8RA 3MVLA 4N0SA 2AEGA 3FXXA 4EQCA 5KMKA 4QYEA 3OWKA 4N57A 5FTGA 3UDTA 2C5VA 3TMOA 2CN5A 3ULZA 3SV0A 3FMMA 5J9LA 4C3PA 4NCTC 4GKIA 2WMAA 3NVKI 3G6HA 4AAAA 2WEIA 1PJKA 4QTCA 4GSBA 4WA9A 3RCDA 2OXDA 2PVLA 3R1QA 3ATTA 4NM0A 3W18A 4AZWA 4BFMA 2C68A 4F65A 5EKNA 3TNQB 2WELA 3D0EA 4B8LA 1YWRA 4WKQA 4DGGA 4FG9A 5HVKA 3EQPA 1PMUA 5JZNA 3G9NA 1XMMA 3D5XA 3U4UA 4HGLA 3PFYA 4NIFB 4Y46A 4D5KA 4D1SA 3VS4A 4DA5A 1QCFA 5HQ0A 2B9IA 4L01A 5B2LA 4AXAA 3O17A 2UVYA 2PE2A 3EKNA 1Z9XA 3ORTA 3QD0A 3QHRA 3QRUA 5LXMA 3OF0A 3M42A 5C03A 3WYYA 3R7IA 3ZM4A 4O7YA 3W0QA 2I0YA 4ZIMA 4C4HA 4DEAA 2J4ZA 4YJNA 4JNWA 4G3GA 3RVGA 2AQXA 4ITHA 3C0IA 1CTPE 3D5WA 2JFLA 1UV5A 4HVHA 1UKHA 2PVKA 2EXCX 5H8GA 3PRIA 1APME 3FY2A 4C4JA 2DWBA 4DT9A 4OTHA 4DTAA 3ZS5A 2Q0BA 2W1IA 5KHWA 4GRBA 4LRJA 3RJCA 2XIRA 2H96A 4RFYA 5JN2A 5IA3A 3BHYA 3WZJA 5K5NA 4TYGA 4X2JA 2VTJA 4DHFA 2P55A 2XKCA 4DEGA 3NMUF 4GYGA 5E1EA 3DQWA 2PZYA 5KBQA 3LQ3A 4ACHA 3DBQA 3LFDA 3GU7A 3EN7A 3I4BA 3CTQA 2CCHA 4IC8A 2RSVA 3FI3A 5EKOA 3AC8A 1V1KA 2W4JA 1I09A 3WYXA 5E7RA 2UZTA 5M57A 4GT4A 4IH8A 4L3JA 4DITA 5CAPA 4ARKA 2IEWA 3MIYA 3EQFA 3EIDA 5E8YA 4DDGA 3PG1A 4J97A 1XH7A 2XA4A 5HU9A 2OICA 2H34A 4FL2A 3UP2A 5ETIA 4YTCA 4UB7A 5FGKA 5AEPA 4RX5A 5AADA 2XIYA 3E88A 5EHYA 3LFFA 4D9UA 3Q9WA 3RAIA 4C37A 4CTBA 4J71A 4CFFA 1KE8A 4FNZA 2R9SA 2QOHA 4GVAA 3DK7A 4IZYA 2VWUA 3L9NA 1BI7A 4JG8A 5EYDA 2R3KA 4O0YA 2WMUA 3VBXA 3WARA 2GFCA 1ZMVA 3GT8A 4FTOA 4WHZA 2QR7A 2XNGA 4PDPA 4CRSA 1NXKA 1R0PA 1GIJA 1F5QA 2EU9A 2ERKA 4FIEA 3BGPA 2QKWB 2W1ZA 4P5ZA 3UIMA 4G9CA 3CS9A 3K3IA 3TDWA 2GTNA 2WMRA 1FVVA 3QGWA 4E26A 3DAEA 2B7AA 4G1WA 4JBOA 3DDPA 4FKTA 4TYIA 1BLXA 4JDJA 4KAOA 4CLIA 4R3PA 5HLWA 3COMA 2B0QA 1DAWA 2E9OA 1WBPA 3AD4A 1XKKA 4ZTRA 4BZOA 3VQUA 4JG6A 3TNIA 5EDPA 4ERKA 3GCSA 3WZKA 3EQRA 4ZJIA 5IDPA 1FBNA 1H1WA 4F9YA 1VEBA 3SRVA 4ZOGA 1YKRA 5I9WA 4PDYA 4D4VA 2QCSA 3DAKA 3JS2A 1UU7A 3GC9A 1XJDA 4MBJA 3DK6A 4XBUA 4QDVA 1OIUA 3PJ1A 3Q52A 3N4TA 3MH0A 4ACMA 1ERKA 4RJ7A 4M12A 3DGKA 3LFBA 3QFVA 4X2KA 4YZNA 4QMQA 2QODA 1DAYA 3MJ2A 2CSNA 3DB6A 4XNEA 4BJJB 2UZEA 4CVAA 5CENA 2HAKA 1TKIA 4RA4A 4CNHA 4IADA 1X8BA 4FKQA 4C34A 5ANGA 2JLDA 1W83A 2W4KA 3G9LX 3TUDA 4L53A 1V0PA 3SDJA 3IDCA 3QCYA 3LW0A 3ZO3A 3GVUA 4O7RA 3NS9A 4FV8A 1YDTE 3FKNA 4QP7A 5AP0A 5T3QA 2VWBA 4EH7A 1NW1A 4TTHB 2UW6A 4FSZA 1JQHA 3C4EA 2V7OA 3W55A 3HECA 3UO4A 5G1XA 3CR0A 3R83A 5GIPE 4A7CA 3ET7A 3GCVA 3NNWA 3W2QA 1KE7A 3F3UA 4KNBA 3OY1A 4OW8A 5K5XA 3OXIA 4Y83A 3VS2A 5ANKA 3QYZA 3D2KA 4QMZA 4I4FA 4FV5A 1GIIA 1ND4A 3O8PA 1E1VA 2W5AA 1WZYA 4WRGA 1V0BA 4FZFB 4RIWA 4BL1A 2QG5A 3BU6A 4FV1A 4OTPA 3GC0A 2XK7A 3PXQA 1RJBA 3Q3BA 3RPVA 4O7ZA 3SOCA 4IVBA 4DGMA 3FLNC 4DFBA 4USDA 3D4QA 3AQVA 4NW5A 2FSMX 4XV2A 3DXPA 5E8TA 2XEZA 3KMUA 3LAUA 1H24A 3FQSA 4FKSA 5M08A 5A6NA 2XK8A 1CM8A 4NYEA 3UVRA 2CJMA 3MA6A 2PVYA 4K8AA 5H8BA 4WT6A 3ZU7A 4XRJA 3NIZA 2XKDA 3FLSA 3D14A 5BYZA 3EN6A 4G17A 3PE2A 4XRLA 1O6LA 3EZRA 3KMWA 2C5YA 3Q2MA 3AXWA 5DLSA 5EW3A 2R3QA 2C0OA 3CPCA 2Z7RA 4JQ7A 4ZTNA 4ANNA 4ZSAA