2B4SB

Crystal structure of a complex between ptp1b and the insulin receptor tyrosine kinase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
294
Chain Sequence
DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein phosphatase, non-receptor type 1
publication title Crystal Structure of a Complex between Protein Tyrosine Phosphatase 1B and the Insulin Receptor Tyrosine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 91
structure length 294
sequence length 297
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2b4sB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2b4sB01
5HD7A 2VWVA 2FGIA 3O50A 5CT0A 1Q8YA 2WQEA 3Q6WA 3TNPC 3V01A 1CKJA 4O91A 3KKVA 3CJGA 1Q24A 4LGHA 4KRDA 2BTSA 1M7QA 4TPTA 2J0IA 2VD5A 3AD6A 4JAIA 3DKGA 5CI6A 3E88A 2BRMA 1H01A 4F0FA 2CJMA 4DAWA 4JOAA 3O8PA 4RFMA 4CYJA 4FG7A 4E4LA 1YWVA 4BDCA 3BI6A 4BI1A 3LCDA 4F7JA 3I6WA 4TNBA 1TQPA 5TR6A 3UO5A 2C0OA 5CF5A 4YC6A 4U3YA 4USDA 2VO6A 2XBAA 4KS8A 4EK8A 3KVXA 4IWPA 4FL3A 4PMSA 5AM6A 5AMNA 4BZDA 4F7NA 4LRMA 5KMIA 3SG8A 2VTPA 2B0QA 2V5QA 4RC4A 2GQGA 4YZDA 5FEDA 3TXOA 2I40A 4IACA 4J7BA 4ERKA 3R73A 3SXSA 5J5TA 3MFUA 3MPMA 5AJQA 5DHJA 2WEVA 3QXPA 1Q3DA 3P7AA 4UMRA 2UZLA 1Q5KA 3UVRA 4S30A 5BUJA 4ZZMA 5AAGA 5DA3A 3VJNA 2WQOA 3HNGA 2GFCA 4RFZA 4XG6A 3U9NA 5IEYA 4HVIA 5IEXA 5HHWA 4GKHA 1J7LA 1NA7A 2OFVA 3FQSA 4KS7A 5EI8A 2CPKE 2H9VA 3EQRA 4D2PA 3PG1A 4E6DA 2FSTX 2UZTA 2XYUA 3MY1A 4IX6A 4DFZE 4WD5A 4EKKA 3RJCA 2R3LA 3VBWA 3FLQA 5KMKA 5BVEA 5I5ZA 4FTKA 3IKAA 1H00A 5HNIX 3Q2JA 3ORKA 4GUBA 3GT8A 3R71A 1RQQA 2WKMA 5AV1A 3ZU7A 3UOLA 5A3XA 2ITVA 4QQTA 1ZXEA 4RZVA 2VWIA 2VGPA 3BV2A 2GPHA 3R1QA 4N4SA 5LJJA 2QOOA 4TWPA 4ORKA 5AUWA 5DI1A 4K2RA 3G0EA 1CKIA 2XNNA 2FO0A 1H1QA 2G2IA 5FQDC 4X2JA 3BYSA 3MI9A 3R7VA 3R9DA 2R3PA 5TE0A 3QYZA 3IW5A 3KXNA 3WZEA 4N6YA 2Y4PA 4PF4A 4EC8A 5LOHA 3SW4A 2ERKA 1V0BA 3R21A 4JIAA 4UMTA 2OICA 3UTOA 3II5A 2YCFA 5AX3A 3EN7A 4A9RA 4C4GA 2V55A 3RINA 4EEVA 3TI1A 2OZOA 4RVMA 4M0YA 5E92A 3W8LA 4EONA 4OTWA 5LWNA 3HECA 4MXAA 3VW8A 5CNOA 3SC1A 4JRNA 2JC6A 2XUUA 3BE9A 2R3MA 4L53A 4F9BA 4Q9SA 4HW7A 4KBKA 3LFCA 4O0SA 5FGKA 1KWPA 3R28A 2YCSA 4FOCA 3DNEA 1VYZA 4H05A 3IGGA 2J90A 3LXLA 4MWIA 3G9NA 2BIKB 2HZNA 3S2PA 4AXAA 1UU8A 2J7TA 4EK5A 2BPMA 4QMLA 5I9UA 4ANLA 3IOPA 5AA9A 2BIYA 3F3ZA 3C1XA 4ZEGA 3GU7A 5J8IA 3SXFA 2EU9A 3AXWA 3DFCB 2BROA 2R0UA 4O0XA 1ZYDA 4YJQA 5CASA 3IONA 4M68A 4TYHB 5B2MA 4O22A 3LAUA 1KV2A 3A7FA 3D7ZA 3WYXA 3NIEA 4BDFA 4DFYA 4EK6A 3QTZA 3QKKA 4J52A 3VF9A 4MXOA 5C8MA 1ERKA 5D7AA 5GIOE 4G1WA 2B1PA 2DUVA 2V7AA 3BU3A 1KV1A 4FV2A 3KREA 3FC1X 1K3AA 4FICA 4CG9A 2EWAA 3Q3BA 3NCZA 2CKOA 4AGWA 3F7WA 3KK9A 4AFJA 4JBVA 1CMKE 3PY3A 4NM3A 3AG9A 1BKXA 1PRYA 3EN4A 3UVQA 4FKLA 5L2IA 1VR2A 4BDEA 4C36A 3ZSIA 1V0OA 1WZYA 3DY7A 3F3UA 4GIHA 4E6CA 4GKIA 2Z7RA 4M97A 1XBBA 2C6OA 1J1CA 2YITA 2QODA 2H34A 2F2UA 4I20A 2QO7A 1IAJA 3UE4A 3EQGA 2IO6A 4GK4A 2OJJA 1Q4LA 5CU3A 2F49A 3UVPA 1OPKA 3U4WA 2Y4IB 4FC0A 1KOBA 4QMUA 4DEHA 5FUTA 2ITOA 4YNOA 3VS5A 3DFAA 3PYYA 2IJMA 5DVRA 2VTQA 3FSKA 3QTXA 4D2VA 4EHGA 2EB2A 5DE2A 2WO6A 1GJOA 4FZFB 5ANOA 5IF1A 3NW5A 3CQEA 4I21A 4RRVA 3I60A 3UP2A 5DIAA 3VS3A 4CXAA 4DHFA 4YO4A 4HYUA 2YJRA 3PIYA 5AR5A 4AZEA 3RM6A 5AEPA 3G0FA 2XEZA 2QLUA 5L2SA 3P08A 3UPZA 3R7YA 2UZOA 4X2NA 3E93A 3ZLWA 3MIYA 1O6YA 4YTIA 3ZBXA 3ACJA 3DB8A 5HVKA 1PMEA 3QCXA 3VBXA 2BVAA 2BHEA 2EB3A 2XCKA 4OBQA 3CGFA 4WNPA 2R3KA 4HJOA 1ZOEA 4JG8A 5CQUA 3CTHA 3I7CA 2XB7A 4HNIA 4O0VA 4DFUA 4XG8A 3QQHA 4OW8A 3TV7A 4DBXA 2HZIA 5HO8A 2C5VA 3LJ0A 3MV5A 4C58A 4OTQA 4WNMA 4UMQA 2QO2A 3PZEA 4LOOA 2PMNX 4U6RA 4LV8A 2XCHA 4IAIA 4JX3A 2VTIA 2BILB 4WNOA 2VU3A 3I0OA 4D4RA 4EH5A 5KCVA 4BTMA 2XKCA 5E7RA 2BAJA 4M3QA 3KL8A 4PMMA 4WRGA 3DK6A 3QL8A 3A60A 3N4TA 2HY81 1U4DA 2GNJA 2WTJA 5KE0A 3ZUVA 3BRBA 1LUFA 4UEUA 1AQ1A 4XG3A 3PSDA 2GNHA 5CYIA 2BAKA 3UO6A 4BDJA 3VO3A 1Z9XA 4PMTA 4NCTA 3NUPA 2A19B 4XP0A 5DG5A 2A0CX 4BB4A 4M66A 4ZJVA 4FIIA 4ZMFA 5CVGA 4BF2A 4EYJA 4L3JA 2RFSA 2A2AA 1M17A 4GK2A 3KXHA 3KQ7A 2C6TA 1YW2A 5EHYA 4HGLA 3CIKA 4ALUA 4KWPA 4QT1A 4BVUA 2QKRA 3LFFA 4F4PA 4D4YA 1G5SA 3IGOA 4M7IA 3CPBA 4X2GA 2PVYA 1R1WA 4G3CA 2R3OA 5DWRA 4AF3A 4NZWB 4O7VA 1GIIA 4EK4A 4U5JA 2C1BA 1I44A 4YZ9A 3SHEA 5JGAA 5I9ZA 3TUCA 1JLUE 4FTIA 4GUEA 1W84A 3A8WA 5AV0A 4A9YA 4GU6A 2J0JA 2J5FA 4RJ8A 1O6LA 3PRFA 3W2QA 5AAFA 4BCIA 4I24A 3ZH8A 3N51A 3ORMA 5IA1A 1BYGA 5CAPA 4DLJA 4TYIA 3F2NA 5FTOA 2W1IA 1R0EA 3MFRA 3NSZA 4V04A 5IA5A 4YZMA 3VHKA 2W06A 3Q4ZA 1GZNA 3F61A 3RI1A 3W33A 2YM3A 2ACXA 1NVRA 2YAKA 3COKA 4E7WA 4E5AX 3RZFA 3NYVA 1L8TA 4YTFA 4RVKA 4PTGA 1CM8A 3PUPA 4JG6A 3ACKA 5HESA 2CLQA 3TTIA 3R1SA 1OKYA 4FA2A 4DEBA 5HG8A 3RTPA 3MW1A 4O96A 1RJBA 2YAAA 3A8XA 4ACGA 1YI3A 4AT5A 3K5VA 4L01A 4FV1A 3NLBA 4AQCA 2UZVA 5HOAA 4D2TA 1OUYA 1LEZA 3C5IA 3IW7A 2Z7QA 4X0MA 5K3YA 5DNRA 4WA9A 4FKWA 3OT8A 2QOBA 1FGKA 2X2KA 4XRLA 5JRSA 4FIHA 4PQNA 4WOVA 3ZZEA 3NIZA 3QALE 2LAVA 3ZSGA 4JRVA 1OBDA 3IW4A 2JDVA 2NRYA 2YHVA 5JMSA 3DGKA 4MXYA 4QP6A 1S9JA 2WMQA 4YZBA 1T45A 4AA4A 3MIAA 3R8ZA 4QMNA 3FXWA 2OXDA 2WU7A 4I4EA 4BCJA 4Z3VA 5A4CA 4O7SA 3SX9A 5CI7A 1HCKA 1IA8A 2G2HA 3EQCA 3GU8A 3QLGA 3C0GA 3O8UA 1F0QA 4MNEB 5EHLA 4WUAA 3FZ1A 4LMUA 4IB3A 4L44A 4FTMA 1LEWA 1Q99A 4I6HA 3GI3A 4L67A 4MBJA 4W4YA 3NZ0A 3EYGA 4UWYA 5ANDA 5E1EA 4DH7A 3F2RA 3PY0A 4P5ZA 3P1AA 2WNTA 4EOMA 4OAUC 4LOPA 4QMWA 4EQMA 4RIYB 4ALVA 5D9HA 1ZYLA 1YRPA 2XK8A 4WT6A 5CU4A 2B54A 3EYHA 1H25A 4NUSA 1FMKA 1U54B 2AYPA 2HXLA 5K0KA 2ZDTA 2CSNA 2P3GX 4DH8A 4TXCA 3OXIA 4CZTA 3OBGA 5AUVA 3QXOA 4LFIA 4AW5A 2Z8CA 4J99A 4IM0A 4QTAA 4YU2A 4ZTNA 2O8YA 4RIWA 2BKZA 2OZAB 4IANA 1TKIA 2WMXA 5IDNA 2QR8A 3BQCA 4CFXA 3PFQA 3UQGA 3E3BX 2XK6A 3AT2A 5HE2A 4UXLA 1ZZLA 2JITA 3KCKA 5FP6A 4YJSA 4CKJA 4EZ5A 1TVOA 1Y6BA 4K9YA 4D1XA 3AC2A 1LPUA 1YOJA 1U46A 4JLCA 5HU3A 5I9VA 4KB8A 2ITUA 3TUDA 1KE5A 4YTCA 1CSNA 4WBOA 3FUPA 3L8SA 2V62A 3VS4A 3NNWA 1MRVA 4CT1A 3UQCA 3HX4A 4I6FA 3FPQA 3UYTA 4AUAA 4D0WA 4K6ZA 5AADA 4I23A 4J8MA 4AZFA 5AIKA 4KBCA 3ITZA 3LFEA 4GH2A 5M4CA 4DFLA 4IJ9A 4KAOA 1PJKA 3LXPA 3P79A 4JDIA 4QRCA 4ZLZA 5B2LA 5BMSA 3UYSA 2BZKB 5EI6A 4ACCA 5FRIA 4CFNA 4EL9A 2WQMA 4KABA 4QMPA 5HICA 4FKSA 4MBLA 4YHJA 3EL7A 4E4XA 1ZLTA 4CEGA 2JIVA 2PVHA 3HA8A 4IFCA 5AV2A 3RAWA 5M44A 3DQXA 2Y7JA 4DGOA 3L9MA 4AACA 2HW6A 3CY3A 3HUBA 4ZTMA 5EW3A 3RAIA 5CAOA 1ND4A 3LLAA 3BKBA 2BZJA 3WIGA 3BEGA 3CBLA 3FMJA 3BGZA 3GCSA 2WOTA 1M7NA 2GS2A 3OS3A 3ATSA 5HTIA 4PL4A 3EZRA 4JNWA 4EHEA 4FYOA 4RBLA 3E7VA 4ASEA 2A1AB 2O2UA 4A4OA 3THBA 3TT0A 3K5UA 3LLTA 2WTKB 4IFGA 5E9EA 2VNWA 5E8XA 4QYFA 4W4WA 5LVMA 2AC5A 2QOQA 3ALOA 3G2FA 5A6NA 5ETAA 4XG7A 5JQ5A 3E8NA 1SM2A 4RIXB 4ZIMA 5ETFA 4IDVA 3WF7A 3R2BA 3UNKA 5GINE 4IVAA 4CTCA 4QMMA 2JFMA 4FUYA 4GK3A 4QTCA 2QG7A 3D7TB 5IA0A 4BBEA 2J50A 4TYGA 4Z55A 1TQIA 4IWOA 4ZSJA 3UP7A 5KO1A 2F7EE 5EHOA 4CLJA 4E4MA 4FV4A 4CTBA 4C02A 4HCVA 2C4GA 4FKVA 4NIFA 3W18A 5CZHA 3UNJA 4DT8A 1JSUA 4RJ5A 4TWCA 3B8RA 4M12A 4AG8A 3R0TA 4CMOA 2JBPA 3F9NA 2I0YA 3OG7A 2ZM3A 3GCUA 2XM8A 3MH2A 3PVGA 3RWPA 1UU3A 2YDKA 4FG8A 3OUNB 3TIYA 5CZIA 4IH8A 5EH0A 4NYEA 4YLKA 4YURA 4C2VA 5B7VA 5FTQA 3S95A 4USEA 1XR1A 4XOZA 4KKGA 5GHVA 2W1GA 5IZFA 2OJGA 3TM0A 1WBWA 3E8DA 4IJPA 2QURA 2X6EA 1QPDA 2BZHB 3DV3A 3R7IA 5IUGA 1YKRA 1KSWA 3DDQA 2FA2A 2I6LA 2X6DA 3RKBA 1YDSE 2OU7A 3ODYX 4YC8A 5CSVA 3VUDA 1IA9A 5M07A 5DT4A 4GYIA 4FTNA 1R39A 3ZO4A 5M08A 3VUGA 1I09A 4MEDA 2JDOA 3A61A 3RZBA 4E4NA 1BUHA 3A7IA 5KNJA 5LMAA 2PVMA 2CN8A 3UMXA 3HRBA 4TN6A 3ORTA 4B0GA 1HOWA 2GSFA 2QHNA 2UZDA 4WRSA 4ZZOA 4AW1A 4FVPA 4WSYA 3PJ2A 1XHAA 3DBDA 4I5MA 1FMOE 4EJ7A 4FMQA 2XIXA 3OW3A 2W05A 4YUQA 2YZLA 5A4LA 1M14A 3PXFA 2YIQA 5HGIA 5BMMA 2VWUA 3EN5A 4XG4A 5DBXA 4NW6A 4UWCA 5J7BA 2YLEA 4IWQA 5IISA 2PUPA 5HEZA 4B7TA 2ZAZA 4F0GA 4BR3A 3ORXA 1QPCA 4F9WA 1G8SA 3OUKA 2OGVA 5IMXA 1KE6A 3JY9A 4IX4A 2RIOA 3KCFA 4S33A 3H9RA 1UWHA 3GP0A 4CSVA 3V5LA 3QRUA 2J4ZA 1KUTA 1GIJA 4G9RA 5EM7A 2O3PA 4FT5A 4C3RA 2W4KA 4FSMA 2X8EA 4L68A 2IVTA 3LFAA 4EOQA 4E20A 3NPCA 3DPKA 3O23A 5JQ8A 4KIKB 3PP0A 2WTDA 3K2LA 5KMNA 4O6LA 4YPDA 3TV4A 2XNBA 2OF4A 2PVRA 3R1YA 5K4JA 3CJFA 4BDDA 5CT7A 4RVTA 2O5KA 1MUOA 3OCTA 4KA3A 3DK7A 5EM8A 3ZC6A 3QCQA 3MJ2A 4EOPA 5HORA 4O2ZA 2ITZA 4FG9A 4J95A 1IASA 5EM5A 3ZTXA 2BRHA 3QUEA 4YLJA 3UOJA 3R9OA 2ITTA 2IZTA 4P2KA 3A7HA 4IX5A 4I1ZA 4B99A 4FV5A 4IX3A 4MWHA 4EH7A 2ZM4A 4DEAA 2R7BA 4C4EA 4YZNA 1WFCA 3TUBA 4LG4A 1ZYCA 2UW0A 2B7AA 4R5SA 5H8BA 1IR3A 1H27A 4ZTSA 3VUKA 2Y9QA 3V6SA 2YDIA 1B38A 5LVNA 3P9JA 5E4HA 2VWWA 4EUTA 3AOXA 4CQGA 2UW3A 1W7HA 4FSUA 2JDTA 1H0WA 4X7QA 4EOLA 4GFGA 2OXYA 2JGZA 5ANGA 4ZAUA 1H08A 2KTYA 5CAQA 3IPHA 4O27B 5HG7A 2QOKA 2NO3A 2O0UA 3QTQA 3MY0A 4K77A 3E92A 4XCUA 4D5HA 4IEBA 5IQBA 2YCRA 4IMYA 4RFYA 5EYDA 3FI4A 3UIUA 3I79A 4FTLA 5L8JA 1PXIA 2FUMA 3HV4A 3TNWA 3U9CA 3VBTA 3QU0A 5DFPA 1YQJA 3O17A 4JG7A 4FV7A 4WG4A 3BEAA 3EQIA 2IWIA 2Q0NA 3CR0A 1XWSA 4YTHA 4MD8E 5EI2A 3IO7A 2IG7A 2CCIA 1V0PA 4KNBA 2WPAA 3F6XA 1SZMA 3IOKA 2R5TA 3LCTA 4HGSA 3T9TA 3TG1A 1JAMA 4QMVA 1OVEA 1RW8A 2VX1A 4OTFA 3GGFA 5DEWA 5L6WL 2PMOX 4BKYA 4WG5A 5AX9A 1J7IA 1UKHA 2VTRA 4KIPA 3W2SA 4F09A 3P7CA 4CFVA 1WBVA 2GCDA 2ZMCA 4U43A 2OO8X 4BIEA 3BE2A 3PIXA 2PZPA 3LQ5A 1XH8A 1YWNA 3E8EA 4A4LA 1YOMA 2VZ6A 3IW8A 4FSZA 1XBCA 4TKSA 1M2RA 2PUIA 2ZVAA 3CKXA 3KEXA 4P90A 3VAPA 2XK7A 2XVDA 3V8SA 4O7YA 4ZP5A 3OXTA 4QD6A 3JVRA 2Z2WA 4O21A 3Q04A 4U9AA 4TZRA 1UVRA 2OKRA 4NTTA 2FSOX 3HMIA 2P0CA 3MTLA 3DXPA 4U8ZA 2V22A 3Q5IA 1BI8A 5BNJA 3UOHA 3Q53A 2PHKA 4RX9A 2VAGA 4FV6A 3BELA 2WXVA 5DYJA 4IZYA 2J2IB 5ANKA 2UZEA 3FMHA 3F88A 3I5ZA 3ZMMA 2GNIA 4JR7A 3Q60A 3RHKA 4ITHA 4FV9A 4UZDA 4ZS4A 3PLAE 4MTAA 4IWDA 3TKHA 3E64A 3NGAA 2QVSE 2UUEA 1QPJA 2OIQA 1Y6AA 4XV2A 5IU2A 4PMPA 5HZNA 2Z60A 4UYAA 3HEGA 1MP8A 1ZOHA 2WTVA 2W5BA 3HDMA 2YIXA 2XF0A 3I4BA 3WILA 3EB0A 4YHTA 1OL2A 3NW6A 4BN1A 3FY0A 3OMVA 3EFLA 4L8MA 4FV0A 3SW7A 4FT3A 3QA8A 5EM6A 3LPBA 3CTQA 1J91A 3PXKA 4MAOA 5L6PA 3QD3A 3A7GA 3C0HA 2C30A 3QGWA 2CKEA 4E93A 5HTCA 4O7ZA 2OFUA 5IA2A 3GOKA 5C8NA 2XKDA 2BRBA 4LYNA 4YJPA 3PVUA 5K5XA 5IQAA 3FLSA 4JVGA 4G17A 4A7CA 2JBOA 4X21A 4O82A 4ZTQA 5I9XA 5EDQA 1H0VA 3EKNA 3WE4A 3KVWA 5LVOA 5IA3A 4XH6A 4FKPA 5L2TA 3JS2A 2EXEA 1OL5A 3EFJA 3S0OA 3RPYA 4FKTA 3EQBA 2BDWA 3PZHA 3MVHA 3LM5A 1WAKA 5I3OA 1UNGA 3F5PA 2X8IA 4FUXA 5A9UA 5HO7A 3RBWA 4RIOA 4R6VA 5DR9A 5KKRB 1REJA 3PP1A 4X3FB 1JKSA 3WF9A 2PTKA 3KMUA 5FDPA 4FTCA 2REIA 3OD6X 1WBSA 2C3IB 5D12A 3U6HA 5FLFA 3E63A 3N4UA 4ASDA 3IECA 1Y57A 3D0EA 3NCGA 3KULB 1OGUA 1YXVA 4J53A 3AT3A 4BZOA 1KOAA 3UZPA 5DT3A 2R3GA 3QRTA 3OY1A 1X8BA 4BBMA 2VO0A 3VQUA 2V0DA 1YHVA 2X2MA 2PVKA 2JFLA 3QX2A 3D5VA 3NAXA 3MBLA 4HVHA 3SVVA 3UQFA 3DA6A 3FYKX 1STCE 4C8BA 3PTGA 5JFWA 2UW4A 3GQIA 1FBNA 3MFTA 2ZOQA 2PULA 5BVFA 1W98A 2WMTA 4OTHA 2I1MA 2IVSA 5LCJA 2X81A 5JSMA 4AP7A 2C5NA 3MJ1A 5E8ZA 2Y0AA 3OHTA 1OI9A 3AC5A 2QOFA 5HE1A 3WARA 4D58A 2HAKA 2WMVA 3GU5A 2OBJA 2VO7A 2VUWA 4FR4A 3T3VA 3V04A 4LMNA 3WF6A 2GNGA 1R78A 3FDNA 4JT3A 5K4IA 4O7TA 4O83A 5AR2A 2CHLA 3CSVA 4UYNA 3BQRA 4FYNA 5IA4A 2XNOA 1Z57A 5AV4A 2H96A 2W1DA 2Q0BA 3POZA 4PY1A 1OPLA 3BLHA 4LM5A 5DRDA 3ZLXA 4RA5A 4D4SA 4ASZA 4DEIA 5EQEA 3R9RA 1H07A 2X4ZA 3CCNA 3HMNA 5HD4A 4LGGA 3OXZA 3RPOA 3ZLSA 3COIA 2WZJA 5AP5A 4C61A 4X2FA 4EQUA 5EW9A 4NCTC 3FQHA 3FY2A 4I0RA 4IC8A 4JBOA 4FIJA 3Q96A 3FLZA 2WB8A 4PL5A 4F1TA 2RKUA 3AMYA 3KRRA 4YSMA 3SGCA 2NPQA 2QG5A 2X2LA 3DBQA 2C6LA 3KMMA 3KY2A 3GCPA 3FZRA 3QWKA 4MQ1A 4R7IA 3RCJA 5HBJA 5JGDA 4XP2A 3ODZX 4OTGA 5CLPA 1Q3WA 4YMJA 3U54A 1REKA 5AP3A 3LW0A 3W55A 4D9TA 2G15A 3D14A 4RT7A 4V05A 4Y95A 4QPSA 3QLFA 1NW1A 3VF8A 5CEKA 2XMYA 4X2KA 3W10A 2VNYA 3HV5A 1ZY5A 2SRCA 3LJ1A 4ZOGA 2JEDA 3GC0A 4U80A 2G01A 5KMOA 3W2OA 4FZ7A 5EYKA 3NVKI 2F2CB 2VTSA 3WF8A 4UMPA 4EH6A 4WSQA 2GFSA 1ZAOA 3ZO3A 2FYSA 2F7ZE 3H0ZA 5AAEA 3LFNA 4DCAA 3I0QA 3R8LA 3NUAA 3C4FA 3R02A 3OT3A 4CQEA 4QTEA 1GOLA 2F57A 3HDNA 3V6RA 5C4LA 3BZ3A 5IKWA 4EZ7A 5EFQA 5AR7A 1JSVA 1Y91A 5CU2A 2QKWB 2OLCA 4MD7E 1QCFA 2NP8A 3DTWA 3WZKA 4DF3A 3HYHA 3HZTA 4M67A 4F7SA 2DYLA 3BPRA 4IADA 4D1SA 2VTAA 3EWHA 3ENHA 3RK9A 3ZDUA 3BHUA 4QNYA 4XV1A 5CEMA 2HXQA 2HYYA 2OJIA 4ZY6A 3W16A 2GNLA 3ET7A 3GEQA 1AD5A 3TJCA 1OIYA 2I0EA 3H0YA 5DEYA 3V8WA 3IS5A 3DTCA 3Q4UA 5I9YA 4ZS0A 5JFSA 3EQHA 4FEWA 1P5EA 5FBNC 4MX9A 2C1AA 3VRYA 1CKPA 2P4IA 4UBAA 4FV8A 4ZTHA 3W2RA 3ZO1A 2OK1A 3QRJA 4TWNA 3NAYA 4AOIA 5JRQA 4O86A 3K54A 5HNGA 4JQ8A 5JZNA 4D55A 3BGPA 1PXOA 4I92A 5DPVA 2OH4A 2YFXA 5IUHA 2Y6MA 3AC1A 1H28A 2YWVA 1W8CA 4LUEA 5FBOA 2UV2A 2WQNA 2B9IA 2XRUA 4Q5HA 4XV9A 4CRSA 3HV6A 5HLPA 1Q61A 3R7UA 4E5BA 4ZMEA 1H8FA 3QA0A 3LOKA 3NUYA 4FGBA 4U3ZA 2QOHA 1YXXA 3DOGA 4JR3A 5HIBA 3MA3A 2W0JA 3LM0A 4PNKA 5H2UA 1E1XA 3UMWA 2WU6A 2GS7A 3CS9A 3DB6A 3MH0A 4ZTLA 2DS1A 4G3GA 3CC6A 1H1PA 4XLIA 4ID7A 2UW9A 4PRJA 3QZIA 4L00A 2UZNA 4HVGA 3PA4A 4EHVA 4XBUA 4C2WA 5J95A 5CF4A 5CSPA 3EJ1A 2VO3A 4NFMA 2F4JA 1MQBA 4BCKA 4F1MA 4K18A 1UKIA 4RX7A 3G90X 3SLSA 4RMZA 4L3PA 5BUEA 5KZ0A 4I41A 3C9WA 3LFDA 3VUTA 1O6KA 2P2HA 5L2QA 4F99A 2ITXA 3RAHA 5CAVA 4NTSA 4ZSEA 2JIUA 4AOJA 3DKFA 4NFNA 3NNXA 4FT0A 3TZ9A 3FHRA 1PKDA 4OBPA 4ZLOA 1BLXA 5J7HA 2C6EA 3UC4A 4DFXE 3Q9ZA 4D1ZA 4XP3A 1W0XC 4HGEA 4CKRA 3KXMA 3SOCA 1M2QA 4FKOA 4XLVA 3T9IA 4F6SA 5E8TA 5I0BA 4O7WA 3QTIA 5C4KA 4JS8A 3FEGA 4FTAA 3A7JA 1FVTA 3OFMA 4FTRA 5JN2A 5IH4A 3HAMA 1Y8GA 4R7BA 3BU6A 2WMSA 2UZUE 3C4ZA 2IN6A 2XA4A 4PPBA 4AT4A 4BDKA 5GZ8A 5HCZA 5I4NA 1PMNA 3NNUA 3E8CA 3CD3A 5T3QA 3MPAA 4XG2A 3FZSA 3IDPA 4EKLA 3PG3A 3QUDA 3MA6A 5IDPA 3V5QA 5GIPE 2VGOA 3LXKA 1UNHA 4UY9A 4FKUA 4NKAA 3QYWA 3IDCA 3AT4A 5B2KA 4DH1A 3PRIA 5CEIA 3ALNA 3QKLA 4M69B 2XS0A 4RJ7A 5BVDA 4HYIA 2B4SB 3FMEA 2BZIB 3AGLA 3OWJA 4G6OA 1JOWB 2HW7A 4NL0A 3ZC5A 1YOLA 3SRVA 4BCOA 2UW5A 3DBFA 5C01A 4ACHA 4F63A 5CENA 3PE2A 3L8XA 5IG1A 3L8VA 4WHZA 4V01A 3HP2A 5FTGA 3NS9A 4ACDA 2XK4A 4W4XA 4BYJA 5H3QA 5AP0A 3VUHA 5CEPA 5A6OA 3R63A 4AW0A 4CZYB 3U51A 4E1ZA 1ZYJA 5AR4A 4S31A 4P5QA 3VUMA 1ZARA 3MESA 3SAYA 3HA6A 2E9PA 3MY5A 3RM7A 5KHWA 4KKEA 4MVFA 4QP3A 4BCQA 4BI2A 3F5GA 3TV6A 3ZLYA 2HOGA 4BDHA 4OTDA 1YDRE 4ZK5A 4GT3A 1JVPP 1GIHA 5EOBA 4L52A 3V51A 3O0GA 3M1SA 2YEXA 3MVMA 3VRZA 2G1TA 2BCJA 3VBYA 4RQVA 4NK9A 2WOUA 4XRJA 5C9CA 2VN9A 3ORLA 4E5WA 4O0UA 2BKKA 2RG6A 3TCPA 4L7FA 3LQ8A 4CG8A 1KE7A 4U97A 1WBOA 4HVDA 2HELA 1OKZA 3FXZA 4G6LA 2C6IA 4PX6A 1BI7A 4RJ4A 5DN3A 2R3QA 2R2PA 1YXTA 3EIDA 4RPVA 4FE2A 3L1SA 3ZEWA 3UG2A 2JAVA 4RIXA 2LGCA 4FNZA 4ZTRA 3IQ7A 2GDOA 4QQJA 5IUIA 3R83A 3E7OA 4B8MA 4IAZA 4XBRA 3D7TA 3ZDIA 4O7NA 3C50A 4NSTA 5M51A 4PDYA 2IZSA 3JYAA 4ZJJA 4FNWA 3R8PA 5KMJA 3IDBA 3QTUA 4FF8A 2RFEA 3RMFA 4IB0A 3R01A 1YXSA 4FKJA 4QP9A 3LMHA 3DK3A 5GNKA 1Y8YA 3WYYA 4UALA 4RSSA 4DFBA 5A4TA 3C4CA 3QX4A 3VBVA 4Y5QA 2GS6A 5CEQA 5FM3A 4OTRA 1J1BA 3T3UA 4WNKA 1M52A 2YERA 3TKUA 3BWFA 2W9ZB 1FINA 4BL1A 1B39A 3FZTA 3W2CA 4ARKA 3I5NA 4F70A 5HX8A 3BU5A 3OCGA 4ITJA 5CU6A 4RWJA 3EH9A 5AUZA 5HVJA 4AN9A 4C3PA 4FSQA 5E1SA 1TQMA 2JAMA 2YISA 3GENA 4YJUA 3KA0A 2IW8A 3ZCLA 4G3EA 2WHBA 4O38A 4O1OA 2VWZA 4AS0A 4DC2A 2YA9A 1XO2B 4PPCA 5BPYA 1H26A 5BYLA 2XJ0A 1FPUA 2UW6A 3VUIA 5A14A 4QPAA 4ALWA 5FD2A 4ENYA 5J79A 4DH3A 1DS5A 2J0MB 5K5NA 5M4UA 5JT2A 3OVVA 2QU5A 5CAUA 1PF8A 2O65A 1F5QA 4TYEA 3RPRA 3OCSA 4BI0A 2H6DA 5M06A 3ZUTA 2W99B 4LOQA 4ZSLA 4RX5A 5EOLA 5L6OA 4PDOA 3ZO2A 4QQCA 1QMZA 2J0KA 4TTHB 2WAJA 4JDKA 2FH9A 2WMRA 4XG9A 3AC3A 4MH7A 4RC2A 4O6EA 5E8VA 3CE3A 3RGFA 4DEDA 2HY0A 4E73A 3NVMB 4FEXA 3SKCA 3MB7A 4EH9A 3BIZA 2YM5A 4I5PA 2C47A 2JDRA 4H3BA 2JKKA 3REPA 3QAME 3ZONA 3ORPA 2OJ9A 3BHHA 2VTMA 5AP4A 2CLXA 4FVRA 2GTMA 4IM2A 3R00A 4M13A 4APCA 3C5UA 1QL6A 3FMNA 3F5UA 4J98A 4J96A 2ITPA 4AGDA 5IQHA 2RL5A 2XJ1A 5HCYA 1MQ4A 3EKKA 2CGUA 5GJFA 4B8LA 4IIRA 1RDQE 3GCQA 5DOSA 3PDTA 3D83A 2X9EA 4FEUA 4QP7A 2R0IA 5I9WA 3D5WA 4MHAA 1WVWA 3ENMA 3HLLA 4DG2E 2VTJA 3MPTA 4GS6A 4IAKA 4IHPA 4GIIA 5HBEA 3ZRMA 1DAWA 1H1SA 3LJ2A 1PXNA 2GHMA 2VTTA 4RZWA 5CU0A 4I6QA 4AZSA 3VS0A 3DAJA 5F4NA 4O0RA 2E9UA 2YIYA 4XHKB 4FEQA 3FKLA 5TOZA 3O51A 2R3HA 1Q97A 1J3HA 3QZHA 4HYHA 1OZ1A 2PSQA 5HI2A 4UXQA 4APPA 4DFNA 4V0GA 4EWQA 4ZZNA 3MVLA 4ZY4A 3G51A 2UVYA 3QC9A 4UX9A 4N70A 4G16A 4AT3A 4BKJA 4FTQA 2NRUA 4BTKA 2WIPA 4GSBA 5M57A 1XH6A 4FZDB 4RX8A 3R7GA 3QWJA 4IVBA 3H9FA 4PPAA 5D11A 4H39A 4BDGA 3UPXA 4C59A 4H3QA 2H8HA 2PVJA 2GQSA 4X6RA 3PXQA 1WMKA 3MH1A 4YBJA 4BWXA 2W96B 3FHIA 2X4FA 4U79A 5AP2A 5KBRA 1K9AA 4OGRA 5ANIA 4JQEA 4YZCA 2ZDUA 2OH0E 1Q62A 3KK8A 1PXMA 3F82A 3ZSHA 3EQPA 4W8DA 5B0XA 5CF8A 5K9IA 5KUPA 1UA2A 4RWLA 4AZWA 4H58A 4C4HA 1V1KA 2PK9A 3UZTA 2R9SA 4Q5EA 2OW3A 5AUTA 3FXXA 4CV8A 3NDMA 4YGAA 2B55A 2WMUA 3ZFXA 4OT5A 3AMBA 2PU8A 1OITA 2QCSA 4FNYA 4IQ6A 5CEOA 1SVGA 4EH2A 1IRKA 1UU7A 3TNIA 3UIBA 3DAEA 2O63A 2QNJA 5TO8A 5ICPA 4II5A 1DI8A 3D94A 3FWQA 3NYNA 3GU4A 5DMZA 3KN5A 2HWPA 4MXZA 4BCPA 4YPSA 3QF9A 3U6IA 3D5UA 1FQ1B 4AA5A 4U42A 2XNMA 4FX3A 3VHEA 4L42A 3R9HA 3MGYA 2C5YA 5GZAA 2VTOA 2B53A 3QBNA 1VEBA 3FPMA 4JAJA 4OR5A 4BHNA 5IQGA 4HVSA 3KF4A 4K11A 4CD0A 5C8KA 3ZYAA 4RJ3A 2OXXA 4EOOA 4AN3A 3AMAA 3QZGA 4DTKA 3TNHA 4USFA 2HZ0A 5J9LA 5BUIA 3LCOA 3L9NA 4GJ3A 4A9TA 4TW9A 3GVUA 1MRYA 1E9HA 1NVQA 1OUKA 1ZMWA 4ONAA 2JIIA 3I6UA 5G1XA 4AU8A 4L9IA 3EFKA 3UG1A 5EW8A 4DINA 4Z7GA 4PWNA 4G5JA 3UODA 1JKLA 3D9VA 1OIRA 3M42A 4W9XA 2XIZA 2ZMDA 4YJOA 5TF9A 5BQ0A 4L46A 2WTWA 2YCQA 4GL9A 3CQWA 3MDYA 4XYFA 2HIWA 3JY0A 4C3FA 3OF0A 3F3WA 2GHLA 2YM8A 5M4FA 2WD1A 2R4BA 3OBJA 3F66A 5E8YA 3PA5A 3OTUA 3VS6A 4F1OA 3U8WA 3QQFA 4DCEA 1URWA 1P14A 3LIJA 1U5RA 4Y8DA 4L3LA 4L45A 3UBDA 2HCKA 1BX6A 3RCDA 1JWHA 1ZZ2A 5AIRA 2PZ5A 4NIFB 1VJYA 4EOKA 4G31A 3BV3A 3LZBA 3RNIA 2FSMX 1A9UA 4D28A 5DRBA 4UB7A 2RGPA 3HV7A 3Q5ZA 5LXMA 1Q41A 3FKNA 3O7LD 4JDJA 3KMWA 4NWMA 3S3IA 3U6JA 2VX0A 1NXKA 4IZ5A 3ULZA 4QOXA 3R7EA 4C0TA 4OUCA 4WO5A 3COHA 3H4JA 4J97A 3C13A 4DEEA 4ANNA 3FLYA 2C0TA 2F9GA 4XS2A 5C1QB 2UZWE 4BCGA 4QQ5A 2GMXA 1FVVA 2CCHA 3CQUA 2OF2A 3K3IA 4QYEA 3QHRA 3QZFA 2Y4IC 3KFAA 2YIRA 4QP8A 5D1JA 2IW9A 4BIBA 3S4QA 4E26A 2EUFB 1G3NA 4FNXA 4U41A 3E5AA 2X1NA 3PJ8A 4X3FA 5ANJA 4GVAA 3R8UA 4DG0E 3QD2B 4HOKA 5HE0A 5M56A 5AP6A 2PL0A 3PLSA 3Q9YA 2AC3A 4PTEA 4I5CA 4LQMA 2QOCA 5LQFA 2YM6A 1H1RA 4IBMA 5CSXA 1FOTA 4XJ0A 5EK7A 3PVWA 3EN6A 2AUHA 2IVUA 4I94A 1Z5MA 4JX7A 3TTJA 1YI6A 3FMLA 3QTSA 5L3AA 1DM2A 4R3PA 4Q2AA 3M11A 3GU6A 1U5QA 2OIDA 2XH5A 3NUUA 3OW4A 3WBLA 1U59A 4C33A 3KN6A 1APME 3JXWA 2QR7A 2VTLA 3EZVA 4HZRA 1OPJA 3L9LA 3PPZA 2BALA 4BGHA 4IAYA 5TKDA 1LR4A 1GNGA 2JKMA 2C3LA 3CPCA 2YWPA 3PIZA 4I0SA 3I7BA 3P5KA 1YHSA 2XM9A 4BCNA 4FL1A 4M14A 4R5YA 3H10A 3H9OA 5IQDA 5IPJA 4YHFA 2P33A 3F7ZA 4IAAA 5AA8A 3MS9A 1Q8UA 4TY1A 1XKKA 3FKOA 3V5TA 4TRLA 4EH3A 5FDXA 2PVNA 1H24A 1XH9A 1KE8A 4FBXA 3R9NA 5BYZA 4R1YA 4D2RA 1Q8WA 4OT6A 4TYHA 4ACMA 5AFVA 2BRNA 4AOTA 2OSCA 3TZ8A 4I93A 3ZZWA 4YSJA 4F08A 2QU6A 3UDBA 2QI8A 2ZV7A 4QP1A 2IPXA 3ORZA 4RC3A 5EG3A 4U44A 4RWIA 5AR3A 5FEEA 2ONLA 4G34A 3RPSA 4D2WA 1S9IA 4JI9A 4FKGA 3KXXA 4WKQA 2C6DA 3DJ7A 2C6KA 5J1WA 4I3ZA 1PXJA 4QYGA 4FSNA 4EH8A 5E8SA 1YVJA 3C7QA 4KD1A 5J9YA 1KE9A 3P4KA 3EMGA 4G5PA 2ZM1A 3NNVA 1JKKA 4GVJA 4EUUA 4MXXA 4K8AA 3HKOA 4GJ2A 5LCKA 3ERKA 2PMLX 4D9UA 3FSFA 4XMOA 4EI4A 4CVAA 1PHKA 3RPVA 3PJ1A 3QKMA 3BBWA 4OLIA 3KRJA 5CY3A 4ASXA 4CV9A 4UV0A 4GFMA 4DLIA 1A48A 2VRXA 3EHAA 1PKGA 3W8QA 1EH4A 1JPAA 5JZJA 4AE6A 2W1EA 1UU9A 2VTNA 1ZYSA 2CMWA 3RK7A 2BMCA 4OBOA 3B8QA 2R3RA 5EDPA 5F1ZA 4PUZA 4C4JA 3ZFMA 4JQ7A 4FK6A 2XIKA 2GHGA 4R3RA 2QLQA 4PTCA 2CNUA 3ANQA 3DAKA 3PPKA 2X7OA 1ZOGA 4AZTA 4EZ3A 1PYEA 3DKCA 3NUXA 4RLLA 5M55A 3BX5A 1IG1A 4CGAA 2X7GA 4EORA 2ETRA 2J6MA 2DQ7X 2WMAA 2WMWA 4O7RA 2YM7A 4CNHA 3HGKA 4R1VA 3QRKA 3CY2A 3JR1A 3V5JA 3BLQA 4JBPA 3F2AA 4QTBA 4YP8A 3DJ6A 2WELA 2JD5A 4ANOA 3BLRA 3FZOA 1YI4A 3B2TA 2R3NA 2PPQA 4UMUA 5KMLA 5BX0A 1NY3A 3A62A 1YHWA 4RVLA 2E2BA 1JSTA 4PNIA 3GNIB 3R22A 4F7LA 3CGOA 5KHXA 4I0TA 4MF1A 2PVLA 4FTTA 4ERWA 3ZS5A 2JKOA 2YLFA 3L9PA 4H36A 4I4FA 1R0PA 2BFXA 5FWKK 2CNQA 1L3RE 3WZDA 2YM4A 2EXMA 5T68A 4BRXA 4EH4A 3FJQE 1SMHA 4QMYA 1ZRZA 3A4PA 4CZUA 2UW8A 2VTHA 2W1HA 3OC1A 3A99A 4QPMA 3C0IA 4TWOA 4XV3A 5ANEA 4EHZA 3SV0A 2GNFA 4HYSA 2XRWA 5FEQA 4B9DA 4G3FA 5ETCA 5CVHA 3TZ7A 4EJNA 5GJGA 4W8EA 1BL6A 4R3CA 1PYXA 4Y73A 5IH5A 4D0XA 4QMOA 3WI6A 3AQVA 3MSSA 3DBCA 3VULA 2RSVA 3LHJA 3O96A 2GQRA 3TZMA 3NEWA 3TL8A 3GOPA 4QMSA 3R7OA 3VNTA 3MFSA 3ROYA 2UVZA 3BYMA 4FSYA 3HMOA 2JLDA 3DXQA 4BGGA 3EQDA 4NKSA 5FXRA 4P7EA 3RP9A 5KMMA 3UZRA 3BWJA 2BDFA 2W1CA 3ETAA 4QMZA 5JEBA 3RVGA 3WZJA 1SNUA 2B9JA 3GBZA 3PXYA 3NYXA 4IE9A 1ZY4A 3EOCA 4U0IA 2E9VA 4U7ZA 3HUCA 4TYJA 2Q83A 4GFOA 5L4QA 4AAAA 4TL0A 1Q8ZA 3E87A 3FLNC 4RWKA 2KULA 3BGQA 3E62A 1GAGA 5E91A 5EYCA 3TNQB 4D5KA 5J5SA 2BRGA 5FXQA 3FI8A 3ZUUA 1ZMUA 5FM2A 3OWKA 4O2PA 4BGQA 2R3JA 5HQ0A 4AZVA 3RALA 5IQEA 4O0WA 4UWBA 2IZRA 2ITWA 4IZAA 3OEZA 4CMTA 3SQQA 1W83A 2WQBA 4FV3A 4MD9E 2ETMA 1NVSA 5HNBA 3GFWA 3MH3A 4UN0C 4DGGA 2A4LA 5H9BA 3FI3A 5KZIA 3QQKA 2J51A 4RLKA 3LMGA 3P78A 4DA5A 5DT0A 4A9UA 3LQ3A 2WTIA 4FKQA 5JH6A 2Y6OA 2PUNA 3LMIA 4FL2A 1P4FA 4JXFA 4GCJA 4LGDA 4M69A 4WUNA 3V5PA 3WOWA 5CXZA 3RWQA 4FVQA 4LL5A 4EOIA 5LWMA 2RG5A 3FYJX 4QNAA 5BVWA 1G8AA 3D15A 5E8UA 4M8TA 3Q9WA 5LVPA 2X0GA 4BDBA 4C4FA 1SVHA 2B9FA 3GC9A 4IXPA 1AGWA 4GW8A 3OTVA 5JKGA 3PWYA 3D5XA 3W32A 4G2FA 3IW6A 3Q52A 2W5AA 4FSRA 4QP4A 4QTDA 4CRLA 2OJFE 2XP2A 5J9ZA 4A9SA 3PSCA 4JJRA 1OBGA 3PSBA 4ANQA 4QO9A 4YR8A 3DCVA 4CKIA 2J9MA 4C38A 5IQCA 1B6CB 4JL9A 3UC3A 1LP4A 2XIYA 4O81A 4MNEA 1PMVA 1HCLA 3HL7A 4BCMA 4FODA 4LUDA 3VBQA 3FQEA 2C6MA 1MRUA 2C5OA 4IVCA 4KSQA 3C4EA 3VS2A 2W1ZA 3OOGA 1XBAA 2PVFA 3KB7A 4KINA 4BDIA 4L7SA 3POOA 4Z16A 4N6ZA 4BCHA 2C68A 2WTKC 3Q32A 2RF9A 4GT4A 5EYMA 1XH4A 3VC4A 3H3CA 4FSWA 5A46A 3OCBA 3QQUA 3OZ6A 1A06A 4RIYA 3ORIA 4FIFA 2ITYA 2XNGA 3V8TA 4EBVA 5EDRA 2PZYA 2E9OA 4BHZA 4R7HA 1R3CA 5LARA 3E3PA 2FB8A 5HE3A 4FT9A 2XYNA 4C35A 2W5HA 2ZJWA 2RFNA 1U54A 2PY3A 2B9HA 1FGIA 2W4JA 4CCUA 3Q6UA 4YJRA 4KSPA 2PYWA 1OL1A 3P86A 4XEYA 2Z7LA 3UIXA 2CGVA 4AGUA 3DLZA 3QTRA 3UJGA 3WIKA 4AWIA 4E6QA 2OZAA 4ENXA 4HCUA 4R77A 3LCKA 1GZOA 4FTUA 3DU8A 3ZRKA 3QCYA 3L8PA 3RAKA 1WVYA 3TEIA 3WF5A 2I0VA 4AE9A 4NH1A 4HGTA 2JDSA 5F94A 4NU1A 1GZ8A 1BMKA 4BWKA 5CNNA 4CT2A 3GXLA 2NNWB 2HK5A 5FXSA 3MWUA 3TIZA 2X7FA 1OKVA 2WEIA 1SVEA 3Q4CA 4MF0A 4MKCA 3I81A 4FIGA 3QFVA 4O1PA 4DH5A 4S2ZA 1UWJA 3DNDA 4Z9LA 3UO4A 2OI4X 4C62A 3N4VA 4F64A 4N0SA 3SA0A 3A2CA 4U45A 5BYYA 5CX9A 3KGAA 4KIQA 3H30A 1GZKA 4OTPA 3SXRA 5CF6A 4RA4A 4GYGA 5AUXA 2F7XE 4J1RA 4U40A 5CXHA 5FP5A 5LVLA 4FIEA 4AGCA 3FC2A 4G3DA 3LFBA 5K0XA 2OIBA 4NM5A 4M84A 3ZBFA 1F3MC 3O71A 4FI1A 3F3VA 2ERZE 3VWAA 4HCTA 4B4LA 3R8VA 3PA3A 2RFDA 2FSLX 5CTPA 4Y5HA 2ZYBA 4NEUA 5CSWA 2PE0A 2A27A 3U4UA 1JQHA 2ZV8A 5DLSA 4XX9A 5AUYA 2W9FB 3BHYA 2XK9A 2YABA 5L8KA 4BKZA 4I22A 2ZB1A 4TNDA 4PL3A 4BICA 4C57A 4IVDA 2XKEA 4YLLA 3QGYA 3BBTB 2VV9A 1CTPE 4Q9ZA 1P2AA 4DITA 3QD0A 1QPEA 1OIUA 2CN5A 4IAFA 4I5HA 3MVJA 4IB1A 4O0YA 1H1WA 3KRXA 5BVKA 3VQHA 3VVHA 5EQPA 3ZXZA 2OWBA 1RE8A 3LFSA 4WIHA 3ZM4A 3TDVA 1IEPA 4DTAA 4FEVA 3K3JA 1E1VA 2BTRA 4DN5A 3HAVA 3NMUF 4K33A 4Z7HA 3QC4A 3CP9A 3NW7A 5ACBC 2CDZA 3PPJA 4E6AA 2YN8A 3C4XA 3R04A 5HIEA 3EFWA 2YZAA 4I6BA 3GUBA 2YJSA 5A4QA 4LRJA 4JDHA 5CS6A 4GG5A 3SDJA 4DT9A 5IH6A 5AV3A 4AW2A 2XIRA 2CGWA 4O0TA 3C51A 4HPTE 3ORNA 4EOJA 1DAYA 2X39A 4MNFA 3HRCA 3BCEA 2XEYA 3DJ5A 4C37A 3DQWA 2GTNA 3BHTA 4ZSGA 2GU8A 4BFMA 4KIOA 5IEVA 2QOIA 5F95A 2J5EA 2WFYA 4E3CA 4W4VA 3PJ3A 1OKWA 3ANRA 2XKFA 5LMKC 4FK3A 3TWJA 3ZEPA 4DG3E 4ZXTA 4DYMA 3P23A 3NX8A 4B6LA 1P4OA 4M0ZA 2XK3A 5GJDA 4PDPA 4R78A 4IC7A 3NUSA 2EVAA 4G9CA 3GCVA 4JBQA 3HMMA 4H1MA 3PXRA 4ANSA 3ZFYA 1OECA 2C69A 3OOMA 4FTJA 4EC9A 4ITIA 4LI5A 5EKNA 3TKIA 3ELJA 4A4XA 4YJVA 4F9AA 2BR1A 2X9FA 1VYWA 4WBBB 3QQJA 5JK3A 2PE2A 2I7QA 4N57A 3NYOA 5HX6A 3GC7A 3PJCA 3UNZA 5CANA 5C26A 5HTBA 2IW6A 5T6KA 4L43A 4FZAB 3MB6A 4WG3A 2G2FA 3PY1A 2ITNA 4P4CA 5E90A 4BTFA 2X8DA 3DXNA 4D2SA 5F9EA 3NWWA 1WBNA 4O84A 4CFMA 4BC6A 4MXCA 5AP1A 3DDPA 1PXLA 3G33A 5AM7A 3ZM9A 3M2WA 4ZSAA 1K2PA 4CCBA 3O7LB 3HRFA 5CWZA 5HBHA 4OAVB 4S32A 2BHHA 4BWPA 3SOAA 1XH7A 3QQGA 4YNEA 5HG5A 3BYUA 5TT7A 3GC8A 4AA0A 3S00A 3SRVB 5DR6A 4OTIA 3B2WA 4BBFA 3MYGA 2VWXA 3LFQA 3VIDA 4GEOA 1UNLA 4NM7A 4QYHA 4GU9A 3TN8A 5IMEA 4FT7A 2DWBA 3QRIA 2XZSA 4IB5A 1NT2A 5C27A 4FSTA 4GG7A 2E9NA 5CQWA 4IW0A 3LXNA 4PV0A 1CDKA 3KRWA 1T46A 4F0IA 3FMDA 1XJDA 3IG7A 3Q4TA 3HVCA 3KRLA 4BCFA 4F65A 5JFVA 3WE8A 3U55A 3V5WA 4Y85A 2VWYA 4QP2A 4LL0A 3DS6A 5HLWA 3D2IA 1OM1A 3OEFX 4M15A 3QTWA 2PZRA 4K1BA 3BYOA 4HPUE 2Y8OA 1YWRA 1JNKA 4KIKA 5DH3A 2W4OA 2YIWA 4PP9A 1SYKA 2R3IA 3CXWA 4YC3A 2QQ7A 2W17A 2C0IA 3GB2A 5HKMA 3QCSA 2JKQA 2PE1A 3BHVA 4E8AA 2B52A 4X6QC 3DLSA 5ITAA 3RHXA 3GQLA 1YDTE 4AX8A 5AP7A 3EL8A 2UW7A 1O9UA 2FVDA 5LMBA 2UZBA 5M4IA 5JGBA 5LMKA 3S1HA 5H8EA 3JUHA 1FVRA 3O2MA 2VX3A 2IZUA 2OG8A 3Q2MA 2HWOA 3AGMA 3FBVA 2XNEA 4FOBA 4NM0A 3JVSA 4RIWB 3N9XA 3QHWA 4GT5A 4F9CA 5L8LA 5CALA 3PE1A 4ZLYA 2Z7SA 3MTFA 4X3JA 4HNFA 1PMUA 3FV8A 4BZNA 4GRBA 4ZJIA 4ANMA 4KUJA 3R1NA 3PXZA 1JKTA 2XBJA 3DKOA 1GY3A 2HENA 4KBAA 2QOLA 4IDTA 1XH5A 2IVVA 3W2PA 4PP7A 4BY9E 4MYGA 3GFEA 5AUUA 5EKOA 4IZ7A 3JPVA 4HZSA 5HU9A 1DI9A 3KC3A 2ZB0A 5DR2A 3OY3A 4CFWA 2QHMA 4FTOA 3D4QA 2P55A 2YACA 4EYMA 4F6UA 3LE6A 4GMYA 3G9LX 5M09A 3EQFA 5EQYA 2QC6A 1PXKA 3SD0A 4ANBA 5KKRC 2ESMA 3FL5A 3RNYA 4X3FC 3P7BA 2YDJA 4XUFA 3COMA 3EN9A 3TJDA 5GZ9A 4DGLC 4QMQA 4H3PA 4EQCA 3F5XA 5D7VA 4AN2A 3AD5A 4MCVA 4FKRA 3VJOA 4F9YA 1M2PA 1BL7A 4C4IA 3FZPA 3RK5A 3G6HA 3OWLA 4BTJA 5AR8A 5L2WA 3LCSA 3ID6C 1PXPA 4YJNA 3C4WA 3F69A 4DTBA 5A4EA 4J8NA 3PWDA 4BDAA 3FLWA 3R2YA 4A06A 1PW2A 1VZOA 3DZOA 4RGJA 5E8WA 4DBNA 3I1AA 4PDSA 3FL4A 2QD9A 2V7OA 4FZ6A 1IAHA 5M53A 4FGRA 5D10A 3AC4A 3G6GA 5F20A 4O7LA 3ULIA 1J7UA 3OROA 4NJDA 1XQZA 5HO6A 1PY5A 2WMBA 4KRCA 4DGNA 5IQIA 2ZV9A 4EOSA 4LRKA 5HIDA 2CKQA 2BFYA 4RJ6A 5J87A 2C5XA 3HV3A 3UGCA 3QUPA 3DT1A 3LVPA 1UV5A 2ZV2A 2EXCX 4CMUA 5A54A 4XOYA 2CGXA 1YXUA 2CNVA 1OMWA 1ATPE 3OP5A 4CFUA 4JIKA 3FE3A 3OWPA 3R30A 4Y83A 3KU2A 5ETIA 3VS1A 4DGMA 3NR9A 3VW6A 3ZOSA 3SG9A 4ZY5A 3FMKA 2O64A 2G9XA 3TACA 2PUUA 3ZRLA 1JBPE 4MQ2A 3AD4A 2ONLC 3PVBA 3QQLA 4L6QA 4YJTA 3U87A 5KX8A 1SNXA 5CVFA 1WVXA 3D2KA 3KXGA 4CLIA 2ETKA 3DZQA 5JFXA 3A4OX 4RQKA 2W1FA 3CD8A 4C7TA 2ITQA 3LKMA 3TDWA 4U81A 3AC8A 3CTJA 4R8QA 3FMMA 3R6XA 3T8OA 5J1VA 2XJ2A 4EWHA 2VWBA 1OL6A 2QO9A 5ACKA 5KBQA 2WGJA 3IK3A 4S34A 4EK3A 4RG0A 2BDJA 2HZ4A 2QONA 5CSHA 2I0HA 4GV1A 5HG9A 3P0MA 3F3TA 4V0GB 5AWMA 4QYYA 5C03A 3UIMA 1WBPA 5HCXA 2XNPA 3QD4A 1H4LA 4EBWA 4FKIA 5I3RA 2J0LA 1WBTA 3KF7A 4YO6A 5G6VA 3ATTA 2C3JA 3G5DA 4G6NA 3FAAA 3W1FA 2C3KA 5HLNA 4A07A 3NUNA 4NW5A 2Z02A 1OIQA 3MN3A 4KKHA 5DGZA 1ZMVA 1W82A 2WIHA 3CEKA 2BUJA 4DEGA 3Q9XA 4Y72A 3ZHPC 4BIDA 2R64A 2R7IA 4NJ3A 2PZIA 4W9WA 2P2IA 4BYIA 3KULA 2CKPA 3CKWA 4LV5A 4AFEA 5HVYA 5IQFA 5BVNA 3DBEA 3R8MA 4UZHA 2PWLA 4Y46A 1OL7A 2BAQA 2R3FA 3BYVA 1Q8TA 2PMIA 4H1JA 4TT7A 1ZWSA 2WTCA 4IM3A 1WCCA 3VN9A 3VS7A 3FI2A 4QMXA 3HMPA 5BVOA 4J71A 3ROCA 3HP5A 5FG8A 4NT4A 4DE4A 5D41A 5H8GA 3CLYA 1URCA 4D4VA 3WZUA 2UVXA 3NRMA 3UOKA 4CYIA 3G15A 3V3VA 4F6WA 4MBIA 4C34A 4K0YA 4QMTA 4XNEA 4YBKA 4MK0A 3ZXTA 3KXZA 3O8TA 2W7XA 1OB3A 4CFFA
chains in the Genus database with same CATH superfamily
5HD7A 2VWVA 2FGIA 3O50A 5CT0A 1Q8YA 2WQEA 3Q6WA 3TNPC 3V01A 1CKJA 4O91A 3KKVA 4FRFA 4QDEA 3CJGA 1Q24A 4LGHA 4KRDA 2BTSA 1M7QA 4TPTA 2J0IA 2VD5A 3AD6A 4JAIA 3DKGA 5CI6A 3E88A 2BRMA 1H01A 4F0FA 2CJMA 4DAWA 4JOAA 3O8PA 4RFMA 4CYJA 4FG7A 4E4LA 1YWVA 4BDCA 3BI6A 4BI1A 3LCDA 4F7JA 3I6WA 4TNBA 1TQPA 5TR6A 3UO5A 2C0OA 5CF5A 4YC6A 4U3YA 4USDA 2VO6A 2XBAA 4KS8A 4EK8A 3KVXA 4IWPA 4FL3A 4PMSA 5AM6A 5AMNA 4BZDA 4F7NA 4LRMA 5KMIA 3SG8A 2VTPA 2B0QA 2V5QA 4RC4A 2GQGA 4YZDA 5FEDA 3TXOA 2I40A 4IACA 4J7BA 4ERKA 3R73A 3SXSA 5J5TA 3MFUA 3MPMA 5AJQA 5DHJA 2WEVA 3QXPA 1Q3DA 3P7AA 4UMRA 2UZLA 1Q5KA 3UVRA 4S30A 5BUJA 4ZZMA 5AAGA 5DA3A 3VJNA 2WQOA 3HNGA 2GFCA 4RFZA 4XG6A 3U9NA 5IEYA 4HVIA 5IEXA 5HHWA 4GKHA 1J7LA 1NA7A 2OFVA 3FQSA 4KS7A 5EI8A 2CPKE 2H9VA 3EQRA 4D2PA 3PG1A 4E6DA 2FSTX 2UZTA 2XYUA 3MY1A 4IX6A 4DFZE 4WD5A 4EKKA 3RJCA 2R3LA 3VBWA 3FLQA 5KMKA 5BVEA 5I5ZA 4FTKA 3IKAA 1H00A 5HNIX 3Q2JA 3ORKA 4GUBA 3GT8A 3R71A 1RQQA 2WKMA 5AV1A 3ZU7A 3UOLA 5A3XA 2ITVA 4QQTA 1ZXEA 4RZVA 2VWIA 2VGPA 3BV2A 2GPHA 3R1QA 4N4SA 5LJJA 2QOOA 4TWPA 3BL7A 5AUWA 5DI1A 4K2RA 3G0EA 1CKIA 2XNNA 2FO0A 1H1QA 2G2IA 5FQDC 4X2JA 3BYSA 1G8JA 3MI9A 3R7VA 3R9DA 2R3PA 5TE0A 3QYZA 3IW5A 3KXNA 3WZEA 4N6YA 2Y4PA 4PF4A 4EC8A 5LOHA 3SW4A 2ERKA 1V0BA 1XMLA 3R21A 4JIAA 4UMTA 2OICA 3UTOA 3II5A 2YCFA 5AX3A 3EN7A 4A9RA 4C4GA 2V55A 3RINA 4EEVA 3TI1A 2OZOA 4RVMA 4M0YA 5E92A 3W8LA 4EONA 4OTWA 5LWNA 3HECA 4MXAA 3VW8A 5CNOA 3SC1A 4JRNA 2JC6A 2XUUA 3BE9A 2R3MA 4L53A 4F9BA 4Q9SA 4HW7A 4KBKA 3LFCA 4O0SA 5FGKA 1KWPA 3R28A 2YCSA 4FOCA 3DNEA 1VYZA 4H05A 3IGGA 2J90A 3LXLA 4MWIA 3G9NA 2BIKB 2HZNA 3S2PA 4AXAA 1UU8A 2J7TA 4EK5A 2BPMA 4QMLA 5I9UA 4ANLA 3IOPA 5AA9A 2BIYA 3F3ZA 3C1XA 4ZEGA 3GU7A 5J8IA 3SXFA 2EU9A 3AXWA 3DFCB 2BROA 2R0UA 4O0XA 1ZYDA 3TYKA 2AQXA 4YJQA 5CASA 3IONA 4M68A 4TYHB 5B2MA 4O22A 3LAUA 1KV2A 3A7FA 3D7ZA 3WYXA 3NIEA 4BDFA 4DFYA 4EK6A 3QTZA 3QKKA 4J52A 3VF9A 4MXOA 5C8MA 1ERKA 5D7AA 5GIOE 4G1WA 2B1PA 2DUVA 2V7AA 3BU3A 4FJVA 1KV1A 4FV2A 3KREA 3FC1X 1K3AA 4FICA 4CG9A 2EWAA 3Q3BA 3NCZA 2CKOA 4AGWA 3F7WA 3KK9A 4AFJA 4JBVA 1CMKE 3PY3A 4NM3A 3AG9A 1BKXA 1PRYA 3EN4A 3UVQA 4FKLA 5L2IA 1VR2A 4BDEA 4C36A 3ZSIA 1V0OA 1WZYA 3W0MA 3DY7A 3F3UA 4GIHA 4E6CA 4GKIA 2Z7RA 4M97A 1XBBA 2C6OA 1J1CA 2YITA 2QODA 2H34A 2F2UA 4I20A 2QO7A 1IAJA 3UE4A 3EQGA 2IO6A 4GK4A 2OJJA 1Q4LA 5CU3A 2F49A 3UVPA 1OPKA 3U4WA 2Y4IB 4FC0A 1KOBA 4QMUA 4DEHA 5FUTA 2ITOA 4YNOA 3VS5A 3DFAA 3PYYA 2IJMA 5DVRA 4LV7A 2VTQA 3FSKA 3QTXA 4D2VA 4EHGA 2EB2A 5DE2A 2WO6A 1GJOA 4FZFB 5ANOA 5IF1A 3NW5A 3CQEA 4I21A 4RRVA 3I60A 3UP2A 5DIAA 3VS3A 4CXAA 4DHFA 4YO4A 3W0SA 4HYUA 2YJRA 3PIYA 5AR5A 4AZEA 3RM6A 5AEPA 3G0FA 2XEZA 2QLUA 5L2SA 3P08A 3UPZA 3R7YA 2UZOA 5BV3A 4X2NA 3E93A 3ZLWA 3MIYA 1O6YA 4YTIA 3ZBXA 3ACJA 3DB8A 5HVKA 1PMEA 3QCXA 3VBXA 2BVAA 2BHEA 2EB3A 2XCKA 4OBQA 3CGFA 4WNPA 2R3KA 4HJOA 1ZOEA 4JG8A 5CQUA 3CTHA 3I7CA 2XB7A 4HNIA 4O0VA 4DFUA 4XG8A 3QQHA 3PUFC 4OW8A 3TV7A 4DBXA 2HZIA 5HO8A 2C5VA 3LJ0A 3MV5A 4C58A 4OTQA 4WNMA 4UMQA 2QO2A 3PZEA 4LOOA 2PMNX 4U6RA 4LV8A 2XCHA 4IAIA 4JX3A 2VTIA 2BILB 4WNOA 2VU3A 3I0OA 4D4RA 4EH5A 5KCVA 4BTMA 2XKCA 5E7RA 2BAJA 4M3QA 3KL8A 4PMMA 4WRGA 3DK6A 3QL8A 3A60A 3N4TA 2HY81 1U4DA 2GNJA 2WTJA 5KE0A 3ZUVA 2ZFYA 3BRBA 1LUFA 4UEUA 1AQ1A 4XG3A 3PSDA 2GNHA 5CYIA 2BAKA 3UO6A 4BDJA 3VO3A 1Z9XA 4PMTA 4NCTA 3NUPA 2A19B 4XP0A 5DG5A 2A0CX 4BB4A 4M66A 4ZJVA 4FIIA 4ZMFA 5CVGA 4BF2A 4EYJA 4L3JA 2RFSA 2A2AA 1M17A 4GK2A 3KXHA 3KQ7A 2C6TA 1YW2A 4O4BB 5EHYA 4HGLA 3CIKA 4ALUA 4KWPA 4QT1A 4BVUA 2QKRA 3LFFA 4F4PA 4D4YA 1G5SA 3IGOA 4M7IA 3CPBA 4X2GA 2PVYA 1R1WA 4G3CA 2R3OA 5DWRA 4AF3A 4NZWB 4O7VA 1GIIA 4EK4A 4U5JA 2C1BA 1I44A 4YZ9A 3SHEA 5JGAA 5I9ZA 3TUCA 1JLUE 4FTIA 4GUEA 1W84A 3A8WA 5AV0A 4A9YA 4GU6A 2J0JA 2J5FA 4RJ8A 1O6LA 3PRFA 3W2QA 5AAFA 4BCIA 4I24A 3ZH8A 3N51A 3ORMA 5IA1A 1BYGA 5CAPA 3W0NA 4DLJA 4TYIA 3F2NA 5FTOA 2W1IA 1R0EA 3MFRA 3NSZA 4V04A 5IA5A 4YZMA 3VHKA 2W06A 3Q4ZA 1GZNA 3F61A 3RI1A 3W33A 2YM3A 2ACXA 1NVRA 2YAKA 3COKA 3AKJA 4E7WA 4E5AX 3RZFA 3NYVA 1L8TA 4YTFA 4RVKA 4PTGA 1CM8A 3PUPA 4JG6A 3ACKA 5HESA 2CLQA 3TTIA 3R1SA 1OKYA 4FA2A 4DEBA 5HG8A 3RTPA 3MW1A 4O96A 1RJBA 2YAAA 3A8XA 4ACGA 1YI3A 4AT5A 3K5VA 4L01A 4FV1A 3NLBA 4AQCA 2UZVA 5HOAA 4D2TA 1OUYA 1LEZA 3C5IA 3IW7A 2Z7QA 4X0MA 5K3YA 5DNRA 4WA9A 4FKWA 3OT8A 2QOBA 1FGKA 2X2KA 4XRLA 5JRSA 4FIHA 4PQNA 4WOVA 3ZZEA 3NIZA 3QALE 2LAVA 3ZSGA 4JRVA 1OBDA 3IW4A 2JDVA 2NRYA 2YHVA 5JMSA 3DGKA 4MXYA 4QP6A 1S9JA 2WMQA 4YZBA 1T45A 4AA4A 3MIAA 3R8ZA 4QMNA 3FXWA 2OXDA 2WU7A 4I4EA 4BCJA 4Z3VA 5A4CA 4O7SA 3SX9A 5CI7A 1HCKA 1IA8A 2G2HA 3EQCA 3GU8A 3QLGA 3C0GA 3O8UA 1F0QA 4MNEB 5EHLA 4WUAA 3FZ1A 4LMUA 4IB3A 4L44A 4DDGA 4FTMA 1LEWA 1Q99A 4I6HA 3GI3A 4L67A 4MBJA 4W4YA 3NZ0A 3EYGA 4UWYA 5ANDA 5E1EA 4DH7A 3F2RA 3PY0A 4P5ZA 3P1AA 2WNTA 4EOMA 4OAUC 4LOPA 4QMWA 4EQMA 4RIYB 4ALVA 5D9HA 1ZYLA 1YRPA 2XK8A 4WT6A 5CU4A 2B54A 3EYHA 1H25A 4NUSA 1FMKA 1U54B 2AYPA 2HXLA 5K0KA 2ZDTA 2CSNA 2P3GX 4DH8A 4TXCA 3OXIA 4CZTA 3OBGA 5AUVA 3QXOA 4LFIA 4AW5A 3P5JC 2Z8CA 4J99A 4IM0A 4QTAA 4YU2A 4ZTNA 2O8YA 4RIWA 2BKZA 2OZAB 4IANA 1TKIA 2WMXA 5IDNA 2QR8A 3BQCA 4CFXA 3PFQA 3UQGA 3E3BX 2XK6A 3AT2A 5HE2A 4UXLA 1ZZLA 2JITA 3KCKA 5FP6A 4YJSA 4CKJA 4EZ5A 1TVOA 1Y6BA 4K9YA 4D1XA 3AC2A 1LPUA 1YOJA 1U46A 4JLCA 5HU3A 5I9VA 4KB8A 2ITUA 3TUDA 1KE5A 4YTCA 1CSNA 4WBOA 3FUPA 3L8SA 2V62A 3VS4A 3NNWA 1MRVA 4CT1A 3UQCA 3HX4A 4I6FA 3FPQA 3UYTA 4AUAA 4D0WA 4K6ZA 5AADA 4I23A 4J8MA 4AZFA 5AIKA 4KBCA 3ITZA 3LFEA 4GH2A 5M4CA 4DFLA 4IJ9A 4KAOA 1PJKA 3LXPA 3P79A 4JDIA 4QRCA 4ZLZA 5B2LA 5BMSA 3UYSA 2BZKB 5EI6A 4ACCA 5FRIA 4CFNA 4EL9A 2WQMA 4KABA 4QMPA 5HICA 4FKSA 4MBLA 4YHJA 3EL7A 4E4XA 1ZLTA 4CEGA 2JIVA 2PVHA 3HA8A 4IFCA 5AV2A 3RAWA 5M44A 3DQXA 2Y7JA 4DGOA 3L9MA 4AACA 2HW6A 3CY3A 3HUBA 4ZTMA 5EW3A 3RAIA 5CAOA 1ND4A 3LLAA 3BKBA 2BZJA 3WIGA 3BEGA 3CBLA 3FMJA 3BGZA 3GCSA 2WOTA 1M7NA 2GS2A 3OS3A 3ATSA 5HTIA 4PL4A 3EZRA 4JNWA 4EHEA 4FYOA 4RBLA 3E7VA 4ASEA 2A1AB 2O2UA 4A4OA 3THBA 3TT0A 3K5UA 3LLTA 2WTKB 4IFGA 5E9EA 2VNWA 2X0QA 5E8XA 4QYFA 4W4WA 5LVMA 2AC5A 2QOQA 3ALOA 3G2FA 5A6NA 5ETAA 4XG7A 5JQ5A 3E8NA 1SM2A 4RIXB 4ZIMA 5ETFA 4IDVA 3WF7A 3R2BA 3UNKA 5GINE 4IVAA 4CTCA 4QMMA 2JFMA 4FUYA 4GK3A 4QTCA 2QG7A 3D7TB 5IA0A 4BBEA 2J50A 4TYGA 4Z55A 1TQIA 4IWOA 4ZSJA 3UP7A 5KO1A 2F7EE 5EHOA 4CLJA 4E4MA 4FV4A 4CTBA 4C02A 4HCVA 2C4GA 1ST4A 4FKVA 4NIFA 3W18A 5CZHA 3UNJA 4DT8A 1JSUA 4RJ5A 4TWCA 3B8RA 4M12A 4AG8A 3R0TA 4CMOA 2JBPA 3F9NA 2I0YA 3OG7A 2ZM3A 3GCUA 2XM8A 3MH2A 3PVGA 3RWPA 1UU3A 2YDKA 4FG8A 3OUNB 3TIYA 5CZIA 4IH8A 5EH0A 4NYEA 3W0PA 4YLKA 4YURA 3BL9A 4C2VA 5B7VA 5FTQA 3S95A 4USEA 1XR1A 4XOZA 4KKGA 5GHVA 2W1GA 5IZFA 2OJGA 3TM0A 1WBWA 3E8DA 4IJPA 2QURA 2X6EA 1QPDA 2BZHB 3DV3A 3R7IA 5IUGA 1YKRA 1KSWA 3DDQA 2FA2A 2I6LA 2X6DA 3RKBA 4DDIA 1YDSE 2OU7A 3ODYX 4YC8A 5CSVA 3VUDA 1IA9A 5M07A 5DT4A 4GYIA 4FTNA 1R39A 3ZO4A 5M08A 3VUGA 1I09A 4MEDA 2JDOA 3A61A 3RZBA 4E4NA 1BUHA 3A7IA 5KNJA 5LMAA 2PVMA 2CN8A 3UMXA 3HRBA 4TN6A 3ORTA 4B0GA 1HOWA 2GSFA 2QHNA 2UZDA 4WRSA 4ZZOA 4AW1A 4FVPA 4WSYA 3PJ2A 1XHAA 3DBDA 4I5MA 1FMOE 4EJ7A 4FMQA 2XIXA 3OW3A 2W05A 4YUQA 2YZLA 5A4LA 1M14A 3PXFA 2YIQA 5HGIA 5BMMA 2VWUA 3EN5A 4XG4A 5DBXA 4NW6A 4UWCA 5J7BA 2YLEA 4IWQA 5IISA 2PUPA 5HEZA 4B7TA 2ZAZA 4F0GA 4BR3A 3ORXA 1QPCA 4F9WA 1G8SA 3OUKA 2OGVA 5IMXA 1KE6A 3JY9A 4IX4A 2RIOA 3KCFA 4S33A 3H9RA 1UWHA 3GP0A 4CSVA 3V5LA 3QRUA 2J4ZA 1KUTA 1GIJA 4G9RA 5EM7A 2O3PA 4FT5A 4C3RA 2W4KA 4FSMA 2X8EA 4L68A 2IVTA 3LFAA 4EOQA 4E20A 3NPCA 3DPKA 3O23A 5JQ8A 4KIKB 3PP0A 2WTDA 3K2LA 5KMNA 4O6LA 4YPDA 3TV4A 2XNBA 2OF4A 2PVRA 3R1YA 5K4JA 3CJFA 4BDDA 5CT7A 4RVTA 2O5KA 1MUOA 3OCTA 4KA3A 3DK7A 5EM8A 3ZC6A 3QCQA 3MJ2A 4EOPA 5HORA 4O2ZA 2ITZA 4FG9A 4J95A 1IASA 5EM5A 3ZTXA 2BRHA 3QUEA 4YLJA 3UOJA 3R9OA 2ITTA 2IZTA 4P2KA 3A7HA 4IX5A 4I1ZA 4B99A 4FV5A 4IX3A 4MWHA 1TFFA 4EH7A 2ZM4A 4DEAA 2R7BA 4C4EA 4YZNA 1WFCA 3TUBA 4LG4A 1ZYCA 2UW0A 2B7AA 4R5SA 5H8BA 1IR3A 1H27A 4ZTSA 3VUKA 2Y9QA 3V6SA 2YDIA 1B38A 5LVNA 3P9JA 5E4HA 2VWWA 4EUTA 3AOXA 4CQGA 2UW3A 1W7HA 4FSUA 2JDTA 1H0WA 4X7QA 4EOLA 4GFGA 2OXYA 2JGZA 5ANGA 4ZAUA 1H08A 2KTYA 5CAQA 3IPHA 4O27B 5HG7A 2QOKA 2NO3A 2O0UA 3QTQA 3MY0A 4K77A 3E92A 4XCUA 4D5HA 4IEBA 5IQBA 2YCRA 4IMYA 4RFYA 5EYDA 3FI4A 3UIUA 3I79A 4FTLA 5L8JA 1PXIA 2FUMA 3HV4A 3TNWA 3U9CA 3VBTA 3QU0A 5DFPA 1YQJA 3O17A 4JG7A 4FV7A 4WG4A 3BEAA 3EQIA 2IWIA 2Q0NA 3CR0A 1XWSA 4YTHA 4MD8E 5EI2A 3IO7A 2IG7A 2CCIA 1V0PA 4KNBA 2WPAA 3F6XA 1SZMA 3IOKA 2R5TA 3LCTA 4HGSA 3T9TA 3TG1A 1JAMA 4QMVA 1OVEA 1RW8A 2VX1A 4OTFA 3GGFA 5DEWA 5L6WL 2PMOX 4BKYA 4WG5A 5AX9A 1J7IA 1UKHA 2VTRA 4KIPA 3W2SA 4F09A 3P7CA 4CFVA 1WBVA 2GCDA 2ZMCA 4U43A 2OO8X 4BIEA 3BE2A 3PIXA 2PZPA 3LQ5A 1XH8A 1YWNA 3E8EA 4A4LA 1YOMA 2VZ6A 3IW8A 4FSZA 1XBCA 4TKSA 1M2RA 2PUIA 2ZVAA 3CKXA 3KEXA 3W0RA 4P90A 3VAPA 2XK7A 2XVDA 3V8SA 4O7YA 4ZP5A 3OXTA 4QD6A 3JVRA 2Z2WA 4O21A 3Q04A 4U9AA 4TZRA 1UVRA 2OKRA 4NTTA 2FSOX 3HMIA 3W0OA 2P0CA 3MTLA 3DXPA 4U8ZA 2V22A 3Q5IA 1BI8A 5BNJA 3UOHA 3Q53A 2PHKA 4RX9A 2VAGA 4FV6A 3BELA 2WXVA 5DYJA 4IZYA 2J2IB 5ANKA 2UZEA 3FMHA 3F88A 3I5ZA 3ZMMA 2GNIA 4JR7A 3Q60A 3RHKA 4ITHA 4FV9A 4UZDA 4ZS4A 3PLAE 4MTAA 4IWDA 3TKHA 3E64A 3NGAA 2QVSE 2UUEA 1QPJA 2OIQA 1Y6AA 4XV2A 5IU2A 4PMPA 5HZNA 2Z60A 4UYAA 3HEGA 1MP8A 1ZOHA 2WTVA 2W5BA 3HDMA 2YIXA 2XF0A 3I4BA 3WILA 3EB0A 4YHTA 1OL2A 3NW6A 4BN1A 3FY0A 3OMVA 3EFLA 4L8MA 4FV0A 3SW7A 4FT3A 3QA8A 5EM6A 4QDVA 2IF8A 3LPBA 3CTQA 1J91A 3PXKA 4MAOA 5L6PA 3QD3A 3A7GA 3C0HA 2C30A 3QGWA 2CKEA 4E93A 5HTCA 4O7ZA 2OFUA 5IA2A 3GOKA 5C8NA 2XKDA 2BRBA 2IEWA 4LYNA 4YJPA 3PVUA 5K5XA 5IQAA 3FLSA 4JVGA 4G17A 4A7CA 2JBOA 4X21A 4O82A 4ZTQA 5I9XA 5EDQA 1H0VA 3EKNA 3WE4A 3KVWA 5LVOA 5IA3A 4XH6A 4FKPA 5L2TA 3JS2A 2EXEA 1OL5A 3EFJA 3S0OA 3RPYA 4FKTA 3EQBA 2BDWA 3PZHA 3MVHA 3LM5A 1WAKA 5I3OA 1UNGA 3F5PA 2X8IA 4FUXA 5A9UA 5HO7A 4BJJB 3RBWA 4RIOA 4R6VA 5DR9A 5KKRB 1REJA 3PP1A 4X3FB 1JKSA 3WF9A 2PTKA 3KMUA 5FDPA 4AXCA 4FTCA 4ORKA 2REIA 3OD6X 1WBSA 2C3IB 5D12A 3U6HA 5FLFA 3E63A 3N4UA 4ASDA 3IECA 1Y57A 3D0EA 3NCGA 3KULB 1OGUA 1YXVA 4J53A 3AT3A 4BZOA 1KOAA 3UZPA 5DT3A 2R3GA 3QRTA 3OY1A 1X8BA 4BBMA 2VO0A 3VQUA 2V0DA 1YHVA 2X2MA 2PVKA 2JFLA 3QX2A 3D5VA 3NAXA 3MBLA 4HVHA 3SVVA 3UQFA 3DA6A 3FYKX 1STCE 4C8BA 3PTGA 5JFWA 2UW4A 3GQIA 1FBNA 3MFTA 2ZOQA 2PULA 5BVFA 1W98A 2WMTA 4OTHA 2I1MA 2IVSA 5LCJA 2X81A 5JSMA 4AP7A 2C5NA 3MJ1A 5E8ZA 2Y0AA 3OHTA 1OI9A 3AC5A 2QOFA 5HE1A 3WARA 4D58A 2HAKA 2WMVA 3GU5A 2OBJA 2VO7A 2VUWA 4FR4A 3T3VA 3V04A 4LMNA 3WF6A 2GNGA 1R78A 3FDNA 4JT3A 5K4IA 4O7TA 4O83A 5AR2A 2CHLA 3CSVA 2XAOA 4UYNA 3BQRA 3NFGB 4FYNA 5IA4A 2XNOA 1Z57A 5AV4A 2H96A 2W1DA 2Q0BA 3POZA 4PY1A 1OPLA 3BLHA 4LM5A 5DRDA 3ZLXA 4RA5A 4D4SA 4ASZA 4DEIA 5EQEA 3R9RA 2X0PA 1H07A 2X4ZA 3CCNA 3HMNA 5HD4A 4LGGA 3OXZA 3RPOA 3ZLSA 3COIA 2WZJA 5AP5A 4C61A 4X2FA 4EQUA 5EW9A 4NCTC 3ML1A 3FQHA 3FY2A 4I0RA 4IC8A 4JBOA 4FIJA 3Q96A 3FLZA 2WB8A 4PL5A 4F1TA 2RKUA 3AMYA 3KRRA 4YSMA 4MUQA 3SGCA 2NPQA 2QG5A 2X2LA 3DBQA 2C6LA 3KMMA 3KY2A 3GCPA 3FZRA 3QWKA 4MQ1A 4R7IA 3RCJA 5HBJA 5JGDA 4XP2A 3ODZX 4OTGA 5CLPA 1Q3WA 4YMJA 3U54A 1REKA 5AP3A 3LW0A 3W55A 4D9TA 2G15A 3D14A 4RT7A 4V05A 4Y95A 4QPSA 3QLFA 1NW1A 3VF8A 5CEKA 2XMYA 4X2KA 3W10A 2VNYA 3HV5A 1ZY5A 2SRCA 3LJ1A 4ZOGA 2JEDA 3GC0A 4U80A 2G01A 5KMOA 3W2OA 4FZ7A 5EYKA 3NVKI 2F2CB 2VTSA 3WF8A 4UMPA 4EH6A 4WSQA 2GFSA 1ZAOA 3ZO3A 2FYSA 2F7ZE 3H0ZA 5AAEA 3LFNA 4DCAA 3I0QA 3R8LA 3NUAA 3C4FA 3R02A 3OT3A 4CQEA 4QTEA 1GOLA 2F57A 3HDNA 3V6RA 5C4LA 3BZ3A 5IKWA 4EZ7A 5EFQA 5AR7A 1JSVA 1Y91A 4O4DA 5CU2A 2QKWB 2OLCA 4MD7E 1QCFA 2NP8A 3DTWA 3WZKA 4DF3A 3HYHA 3HZTA 4M67A 4F7SA 3O5AA 2DYLA 3BPRA 4IADA 4D1SA 2VTAA 3EWHA 3ENHA 3RK9A 3ZDUA 3BHUA 4QNYA 4XV1A 5CEMA 2HXQA 2HYYA 2OJIA 4ZY6A 3W16A 2GNLA 3ET7A 3GEQA 1AD5A 3TJCA 1OIYA 2I0EA 3H0YA 5DEYA 3V8WA 3IS5A 3DTCA 3Q4UA 5I9YA 2XANA 4ZS0A 5JFSA 3EQHA 4FEWA 1P5EA 5FBNC 4MX9A 3UDSA 2C1AA 3VRYA 1CKPA 2P4IA 4UBAA 4FV8A 4ZTHA 3W2RA 3ZO1A 2OK1A 3QRJA 4TWNA 3NAYA 4AOIA 5JRQA 4O86A 3K54A 5HNGA 4JQ8A 5JZNA 4D55A 3BGPA 1PXOA 4I92A 5DPVA 2OH4A 2YFXA 5IUHA 2Y6MA 3AC1A 1H28A 2YWVA 1W8CA 4LUEA 5FBOA 2UV2A 2WQNA 2B9IA 2XRUA 4Q5HA 4XV9A 4CRSA 3HV6A 5HLPA 1Q61A 3R7UA 4E5BA 4ZMEA 1H8FA 3QA0A 3LOKA 3NUYA 4FGBA 4U3ZA 2QOHA 1YXXA 3DOGA 4JR3A 5HIBA 3MA3A 2W0JA 3LM0A 4PNKA 5H2UA 1E1XA 3UMWA 2WU6A 2GS7A 3CS9A 3DB6A 3MH0A 4ZTLA 2DS1A 4G3GA 3CC6A 1H1PA 4XLIA 4ID7A 2UW9A 4PRJA 3QZIA 4L00A 2UZNA 4HVGA 3PA4A 4EHVA 4XBUA 4C2WA 5J95A 5CF4A 5CSPA 3EJ1A 2VO3A 4NFMA 2F4JA 1MQBA 4BCKA 4F1MA 4K18A 1UKIA 4RX7A 3G90X 3SLSA 4RMZA 4L3PA 5BUEA 5KZ0A 4I41A 3C9WA 3LFDA 3VUTA 1O6KA 2P2HA 5L2QA 4F99A 2ITXA 3RAHA 5CAVA 4NTSA 4ZSEA 2JIUA 4AOJA 3DKFA 4NFNA 3NNXA 4FT0A 3TZ9A 3FHRA 1PKDA 4OBPA 4ZLOA 1BLXA 5J7HA 2C6EA 3UC4A 4DFXE 3Q9ZA 4D1ZA 4XP3A 1W0XC 4HGEA 4CKRA 3KXMA 3SOCA 1M2QA 4FKOA 4XLVA 3T9IA 4F6SA 5E8TA 5I0BA 4O7WA 3QTIA 5C4KA 4JS8A 3FEGA 4FTAA 3A7JA 1FVTA 3OFMA 4FTRA 5JN2A 5IH4A 3HAMA 1Y8GA 4R7BA 3BU6A 2WMSA 2UZUE 3C4ZA 2IN6A 2XA4A 4PPBA 4AT4A 4BDKA 5GZ8A 5HCZA 5I4NA 1PMNA 3NNUA 3E8CA 3CD3A 3BLAA 5T3QA 3MPAA 4XG2A 3FZSA 3IDPA 4EKLA 3PG3A 3QUDA 3MA6A 5IDPA 3V5QA 5GIPE 2VGOA 3LXKA 1UNHA 4UY9A 4FKUA 4NKAA 3QYWA 3IDCA 4QEBA 3AT4A 1G8KA 5B2KA 4DH1A 3PRIA 5CEIA 4DHJA 3ALNA 3QKLA 4M69B 2XS0A 4RJ7A 5BVDA 4HYIA 2B4SB 3FMEA 2BZIB 3AGLA 3OWJA 4G6OA 1JOWB 2HW7A 4NL0A 3ZC5A 1YOLA 3SRVA 4BCOA 2UW5A 3DBFA 5C01A 4ACHA 4F63A 5CENA 3PE2A 3L8XA 5IG1A 3L8VA 4WHZA 4V01A 3HP2A 5FTGA 3NS9A 4ACDA 2XK4A 4W4XA 4BYJA 5H3QA 5AP0A 3VUHA 5CEPA 5A6OA 3R63A 4AW0A 4CZYB 3U51A 4E1ZA 2A98A 1ZYJA 5AR4A 4S31A 4P5QA 3VUMA 1ZARA 3MESA 3SAYA 3HA6A 2E9PA 3MY5A 3RM7A 5KHWA 4KKEA 4MVFA 4QP3A 4BCQA 4BI2A 3F5GA 3TV6A 3ZLYA 2HOGA 4BDHA 4OTDA 1YDRE 4ZK5A 4GT3A 1JVPP 1GIHA 5EOBA 4L52A 3V51A 3O0GA 3M1SA 2YEXA 3MVMA 3VRZA 2G1TA 2BCJA 3VBYA 4RQVA 4NK9A