4XOZA

Crystal structure of erk2 in complex with an inhibitor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
347
structure length
341
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Combining `dry' co-crystallization and in situ diffraction to facilitate ligand screening by X-ray crystallography.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 114
structure length 341
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xozA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xozA01
5GINE 4J53A 2CLQA 2RFEA 4RRVA 3OZ6A 4WKQA 5TR6A 5KMMA 4KKGA 3OXTA 4FT3A 3QHRA 3FC1X 4ENYA 4Y8DA 4W8EA 2Z7RA 4I5PA 2ETRA 4FT0A 3KK9A 4BDHA 1J7UA 2Z02A 3R1SA 3V6RA 4RJ3A 2XKEA 3W2PA 4IB1A 3WZDA 2WXVA 3OD6X 4O7YA 3FJQE 5FXSA 5IU2A 2C1AA 2RFSA 4QPMA 1CKIA 2BRHA 4FTUA 4NCTA 4L42A 4C4GA 3FAAA 3H9OA 1VJYA 2W1CA 3GB2A 3UIMA 4NSTA 3F3VA 5IQAA 1CSNA 4IW0A 3R22A 5IZFA 3LFCA 3RMFA 3O23A 2BUJA 3ORPA 3F61A 4TYHB 5D1JA 2A2AA 3OVVA 2RG5A 3ZUUA 2CKQA 4AE9A 2YEXA 4USFA 1GY3A 4G2FA 1U5QA 4JJRA 3OHTA 3F5PA 4Q9SA 3MVMA 5FXQA 4FSMA 3G2FA 5IEYA 4XH6A 4MX9A 3HUBA 4MXZA 3AC4A 3G6GA 3IECA 3ZCLA 3S2PA 1Q61A 3RPVA 2DS1A 4PDSA 3D9VA 5J7HA 3OTUA 4G1WA 2BZKB 4PPCA 4WG4A 3R8LA 4ZLYA 4M97A 5FWKK 2GSFA 2R4BA 2W1FA 4M15A 3P4KA 4X2FA 4A9TA 5M55A 4EZ5A 5BVEA 4C0TA 4Z7HA 4FSQA 2CGVA 2QURA 4A4XA 4TNDA 3V5PA 3II5A 2OXYA 4PL5A 3EFWA 5AV1A 5EYCA 2JBOA 3D2KA 1F0QA 3ENHA 3K5VA 3DGKA 3MVHA 4IAAA 3SVVA 1LUFA 3PSDA 2V55A 2ERZE 4FG8A 5EOBA 2V7OA 5AR8A 1E1XA 5IA3A 3THBA 4X3FB 5IPJA 5DBXA 5KX8A 3WARA 4YNEA 3UO5A 2J90A 5K5XA 5HBJA 2ZV2A 2X7GA 4FYNA 2QONA 4XV3A 3U9NA 3KRRA 4C61A 4EQUA 2R7IA 3HEGA 2BFXA 3H4JA 3PSBA 3MFSA 5AMNA 4CMUA 4QMYA 4LOOA 5CY3A 3NAYA 4O6EA 4NYEA 2NRYA 4BDCA 3FLZA 3UNKA 3PRIA 4IVCA 2HK5A 5C8NA 2WTIA 4P5QA 4F6UA 2R0UA 2R3NA 4F9WA 4BICA 2E2BA 3NYNA 1OVEA 1ZYDA 3G51A 5CZHA 5AV4A 1ZYJA 2PVRA 4NJDA 5EHYA 3PVBA 4FKTA 5CENA 4B99A 3QQUA 3ZLSA 1ERKA 2VTRA 3CE3A 3KRJA 4PMTA 3MSSA 1P2AA 3QZHA 4QOXA 5HO6A 4FNZA 4YPSA 5H8EA 1PMNA 1JPAA 3MY0A 2PVFA 3GC8A 3HA6A 3G5DA 4MQ2A 5IH4A 3DBQA 3UOLA 4O84A 5HNIX 2XYNA 2C6EA 2DQ7X 4RC4A 2YISA 2JIUA 4FTNA 1XH6A 3A7JA 4QTCA 4YLLA 4YR8A 3WZJA 1V0BA 1YXVA 4AA4A 1H1WA 4RIWB 4AZVA 1JSVA 3Q9WA 4BTJA 2C6DA 4NWMA 3CD8A 1KE5A 4FNYA 4MD9E 1KV1A 4D2TA 3DDQA 5IUGA 1Y6AA 2J0JA 3GOPA 2BZJA 3LFSA 3FYKX 3OXIA 4LUDA 2ZDTA 4P7EA 4ZXTA 2VNWA 5HZNA 4M67A 3OWPA 2QO7A 4E4NA 5M4CA 5E8WA 1GIHA 4NM3A 3QUPA 4IVDA 3EH9A 1PXMA 4R7IA 4U40A 4E8AA 4FGRA 4IC8A 3V3VA 4JIKA 3ETAA 3KU2A 4FT5A 4JX7A 2O3PA 5EDQA 4APCA 5LMKA 5FD2A 4M66A 1YDRE 2QG7A 2XJ1A 3BHTA 3UODA 4U6RA 4OT6A 2H34A 4UMTA 2HCKA 4BY9E 4F99A 3CQWA 4KA3A 3PXKA 4FUXA 2G2FA 4XCUA 3DAKA 1JWHA 2C1BA 4FF8A 4XG8A 5KMNA 4O7LA 3Q60A 5FM3A 3QTWA 2J0MB 2XNBA 3P1AA 5BMMA 3KVWA 2VTIA 2H96A 3HRFA 3PY3A 4S2ZA 4Z16A 2X2KA 4AP7A 4KRDA 1YI4A 1S9JA 3QYZA 4WUAA 4HVIA 3TJDA 3AMYA 5CEPA 3ZUTA 3B8QA 3A99A 1NA7A 3IO7A 5AX3A 4N6YA 3OEZA 5AADA 3F3UA 3UBDA 3LCKA 4HVSA 3VUHA 3LMIA 4BDFA 4AZEA 4DGOA 5HO7A 4ANOA 4D58A 2F7ZE 5HLPA 4U79A 4JDIA 5TO8A 3PE2A 4FI1A 3TUBA 1JVPP 3WIGA 3MW1A 1H24A 4E73A 3EMGA 5AR3A 5ANDA 1NVRA 4CZTA 3C1XA 1UU3A 5IQEA 4FKJA 4X2NA 3KMWA 4FZ6A 1OUYA 2O8YA 3TNQB 3R73A 1FBNA 3Q2JA 2FSTX 4O0VA 3E8EA 1OZ1A 4HJOA 4FSRA 5LWNA 2GNJA 3WBLA 2ITQA 5CU6A 2WMUA 5AP3A 5CASA 1LR4A 3OCBA 4BCIA 3ZSIA 3ZYAA 1L8TA 2YIQA 1CM8A 1H01A 3E5AA 4PQNA 4K77A 1OL1A 3LM0A 4TYEA 4WNKA 4AN3A 2VO0A 4UN0C 1UU8A 4M0ZA 3MFRA 3HKOA 4FKVA 3OTVA 4OBOA 4MWHA 3FI2A 3NW5A 4K6ZA 2UW3A 3GU7A 3E3BX 3I5ZA 2V62A 3N4TA 4EI4A 3JPVA 4PMSA 3Q9ZA 5LVPA 2B54A 4CFNA 1KOAA 3H9FA 3EYHA 3Q9YA 3ORKA 5DLSA 4KWPA 4TNBA 5DR2A 2FO0A 4E26A 3AT2A 3TNIA 4QQ5A 3W2CA 5DG5A 4UV0A 4JQ7A 1B6CB 2A19B 3OWLA 3IKAA 5HU9A 4FV3A 4EHEA 5CVHA 4J71A 3TI1A 4R5YA 4FK3A 2WMAA 5GZAA 2J51A 4Q5HA 1O6KA 4CRSA 1YWVA 4P5ZA 4RIYB 3DS6A 3U9CA 4U45A 4DG2E 3AMBA 4D4RA 5BMSA 4CZUA 4JLCA 3RCJA 3UIBA 2RIOA 4H1MA 4JRVA 4QQJA 1Q4LA 1FQ1B 2WTDA 4MXCA 3LFFA 5H2UA 4J99A 3TZ9A 1WVWA 5CNNA 4K8AA 3PRFA 3M11A 4RPVA 4C4IA 3BLRA 4E4MA 2B0QA 5I9YA 4I21A 1KSWA 4YZMA 5DIAA 4AT5A 4O7SA 5EQYA 2OH4A 4RGJA 5EW8A 1UWHA 4LMNA 4NT4A 4XP2A 2UVZA 4FG7A 4ZTRA 3D94A 1UNLA 5CS6A 4ACMA 1GZNA 5L6OA 3LKMA 3T8OA 3LQ5A 3OEFX 4C62A 5JMSA 5CAUA 2X4ZA 4I6FA 5AV0A 2JDTA 2VWWA 2WU6A 4AG8A 2OXXA 5I9WA 3CCNA 1OIUA 4IIRA 3I7BA 3PYYA 3V5LA 5LJJA 4ASZA 1Q8TA 2C0OA 2YZLA 3H0ZA 3KKVA 4XMOA 3H9RA 2BDFA 2UZWE 4OW8A 3QF9A 5HE2A 4BDGA 3TV6A 5CU4A 4IM0A 2VGOA 2XH5A 5HCYA 1FINA 4FEQA 2GS6A 3BBTB 5FTGA 2I1MA 3CSVA 4YBJA 3WF8A 5IA2A 2BMCA 4LGDA 5M51A 3VS1A 5J9LA 3CJGA 3N51A 1ZWSA 2W99B 3QA0A 4UYAA 3SOCA 4ZS0A 2E9UA 4C8BA 2RFNA 3G9LX 1ZOEA 2ZB1A 3HA8A 4UY9A 2GHMA 4LV8A 4JS8A 4HCVA 4OGRA 5BVWA 3LFEA 3DAJA 3TZ7A 3WILA 4EONA 5KHWA 3FZPA 4YZNA 3SKCA 2E9PA 3ZS5A 5JFWA 4JX3A 5HCXA 3QUEA 2WQEA 5LCKA 4X2JA 2P33A 3MY1A 4J96A 4LI5A 3LFBA 4UB7A 4YJNA 3QXOA 5HIBA 3R8MA 2R3OA 3P0MA 4TYIA 3ZBFA 2QNJA 3NAXA 3R8ZA 3A8WA 1Z9XA 5HG8A 2B9FA 2WMRA 5CF8A 5J5SA 3RTPA 2XM9A 4O2ZA 2W1DA 3VS3A 4L43A 4ZMEA 5CSPA 3EKNA 4DEIA 4MNEB 4NKAA 3DAEA 3OFMA 3G90X 2FGIA 2X0GA 4U8ZA 4JG6A 3AQVA 3T3VA 2PVJA 2ZM4A 5CU3A 2QQ7A 5I9ZA 1REKA 5KO1A 3IW4A 3MBLA 4W4YA 3SLSA 2YFXA 5HU3A 5L2WA 3PG3A 3OF0A 4ZTNA 4BIDA 5IISA 3PA5A 4ZY5A 4BI1A 4CMTA 5L8KA 4RX7A 4IJ9A 3UG1A 4QTAA 4NFNA 2QKRA 3U54A 1Y8YA 4MYGA 2GCDA 2X8DA 5J5TA 1BI8A 5EI6A 4CV8A 3A7FA 5IUIA 3ID6C 2W0JA 3A60A 4FTRA 3MVLA 4XHKB 3MIAA 3PIYA 1ZY5A 4O81A 4G17A 3OCSA 2REIA 4LM5A 3CQUA 1M2PA 3FKNA 4CXAA 4TYGA 5JN2A 4TW9A 5BUIA 2WNTA 3EB0A 4FSYA 3DJ5A 3ZO4A 5HQ0A 4IFGA 4MCVA 3C4WA 3QCYA 4KBCA 4B4LA 4FTCA 3QTIA 3DJ6A 4DG0E 4F9AA 4FKQA 3NIEA 4ACDA 1ZOGA 4O96A 2R3GA 2W9FB 2YM3A 3QQFA 3AD4A 5CZIA 3CD3A 4AFEA 4DGMA 4FTIA 3SG9A 5AR2A 2UZVA 5BYLA 5C4KA 4YO6A 3EHAA 4J1RA 4EHVA 4FSTA 3E88A 3HV7A 3V01A 4N70A 4G16A 3ZM9A 4U5JA 2QO2A 2NP8A 4E5BA 4O0TA 1URWA 4HGTA 5EOLA 4Z3VA 2UZTA 4X6RA 5CT7A 3RINA 2QG5A 2O65A 4QD6A 5T6KA 3RGFA 4JAIA 2PL0A 3ZSHA 4LOQA 1YI3A 3WOWA 3CPCA 4BRXA 4EJ7A 3PPZA 5TF9A 4AZSA 3F3WA 3KN6A 4NCTC 1JOWB 3LCDA 1OPJA 3Q4CA 5BUEA 4QMNA 3HGKA 4USDA 2ZMDA 4E4LA 1X8BA 4FOCA 4TWPA 3SOAA 5I9XA 3ZC6A 4CRLA 3V51A 1PXOA 4FK6A 2F2CB 3KCKA 4YZBA 3R7OA 4FUYA 2ZV7A 4LRJA 4D5KA 3LXPA 3T9TA 2W17A 2R2PA 3QD2B 2X2LA 1H0VA 2BHHA 2DUVA 3ZMMA 4YGAA 2GS7A 2BROA 1FVVA 4BTKA 3VBTA 2C69A 4L68A 4CFWA 3R28A 4DFUA 4ANMA 4C4JA 3ANRA 5EQPA 4EK4A 4CGAA 2JIVA 2OKRA 3RVGA 1ZOHA 5BYYA 3ULZA 1DM2A 5FLFA 4B7TA 4EUUA 4CG8A 3BYUA 3E92A 3Q6WA 4YHFA 3C51A 4YC3A 3NVMB 3VBYA 5B0XA 4BF2A 4YLKA 3T9IA 2B9JA 4U43A 2KULA 5HO8A 2PPQA 1K3AA 1NXKA 2FSLX 3PA4A 1AD5A 2WQMA 4KD1A 5CSWA 3VJOA 4QYFA 4YPDA 2WTKB 4ASXA 4F7LA 2XNGA 3EWHA 1DS5A 3QRIA 5AP7A 3OUNB 1YWRA 3RPOA 1SNXA 4CQGA 3QAME 3UDBA 4LGHA 1SYKA 3ZRKA 5CEKA 3SW7A 3F5UA 4GFMA 2UW7A 4UXQA 5IA5A 3Q53A 4OBQA 4F1OA 3MB6A 3ORLA 4ZY4A 2X1NA 1PKDA 5FP6A 5HCZA 5CQUA 4PP7A 5DYJA 2Q83A 4GJ2A 5DI1A 4FVQA 4DLJA 3BE9A 5E90A 3QL8A 3L8PA 3UZPA 4MXXA 3UJGA 4EL9A 5K0XA 2UW8A 3GC7A 5A54A 1FMOE 4KIOA 2G9XA 4IWQA 4AOIA 3G0EA 4MH7A 5E92A 2IVUA 3KXGA 3DNEA 3TUCA 3PWDA 3KREA 4MKCA 3BI6A 4R5SA 1ZAOA 4U9AA 3QTRA 2GS2A 3RAKA 3NR9A 3RAIA 2WQBA 4KIPA 3JR1A 1MP8A 5J8IA 3O96A 3WI6A 2QU6A 4RVLA 4EH4A 5HKMA 3PJ3A 5HX6A 3HMMA 4F70A 2B53A 4PDYA 2VTLA 3LXLA 4EH7A 4ERKA 3D15A 1RW8A 2SRCA 4YHJA 3NUUA 2JEDA 1DAYA 2X6EA 4WIHA 1JSUA 2AC3A 2IZSA 3M2WA 4DH8A 5EM5A 5JK3A 3FZSA 3GCQA 1ZMVA 4KKHA 5EM7A 3DCVA 4UMUA 4C33A 5HBHA 4QYEA 2C5XA 5CQWA 2XNPA 5CANA 4PDPA 2I40A 3GVUA 3AMAA 3GCPA 2YA9A 2R3QA 2HZIA 3VBXA 4RC3A 4IMYA 4IB5A 2HXLA 2ZM1A 1CDKA 2HWPA 2IJMA 3ERKA 3NUSA 5EM8A 3O2MA 4CLJA 5IMXA 3N4VA 4FZ7A 4XV2A 5AFVA 4II5A 4MD7E 4N6ZA 5DHJA 2G01A 2B9HA 3TNWA 4IQ6A 4JI9A 4D9TA 5AUZA 5LMKC 2GQSA 4HGEA 2WHBA 5EK7A 4ZSEA 5EYMA 2Y6MA 2J50A 1YW2A 2YLEA 3R1QA 4IADA 4AGCA 2VWXA 1R39A 3FLQA 3IPHA 4XBRA 2WMQA 4BCPA 2O63A 2Q0NA 5ANIA 3NEWA 3VS2A 4B8MA 1Q3WA 4BL1A 3FQEA 2OIDA 4GG7A 3LJ2A 4AX8A 1OKVA 2H8HA 3MH0A 3RJCA 4BDBA 4EK8A 2E9OA 1XBAA 2Q0BA 2Z7QA 2Z7LA 4GW8A 4BI0A 4D0WA 3OCGA 4MTAA 1DI9A 2YHVA 5G1XA 2YCFA 5A14A 1IA9A 1GZ8A 3I1AA 4HYIA 4QQTA 4TT7A 4BCMA 4X3JA 4ANSA 4BDKA 2PUPA 5CEQA 3IGGA 3VRZA 4FTMA 3QX2A 2R7BA 4FV4A 4TKSA 4XUFA 4D1ZA 3RP9A 4FT9A 4DC2A 1HCLA 3E8DA 5CEOA 3R7VA 4OLIA 1XH9A 4KB8A 3R8VA 4N57A 4WO5A 2GDOA 2XKDA 1J7LA 3PUPA 5JH6A 1WBNA 3NUNA 3R21A 4LUEA 2ITWA 3DY7A 4U42A 3DXNA 2X39A 2IO6A 2W1GA 3MH1A 2CKOA 5HBEA 4QP9A 3OT8A 4NK9A 4RVKA 5JRSA 4NTSA 3FKOA 2B55A 3W8LA 2C6MA 1OIQA 2R3JA 5AR7A 4DFNA 4F09A 3BYOA 4I41A 1HCKA 3KMMA 5HTIA 2QCSA 3PSCA 4FIFA 4JIAA 3ODYX 4YHTA 4FTJA 3VJNA 4AWIA 5LWMA 5JRQA 3U6HA 2UV2A 4O0UA 4DFBA 2NRUA 4CTCA 2W5AA 1Y57A 3QTSA 3TIYA 2ITYA 2PYWA 2BKKA 2ERKA 3DK3A 3BEGA 1J1CA 3K3IA 3UC4A 2GPHA 3SRVA 2ESMA 3L9LA 3NCGA 3FZOA 5ACKA 5HNBA 4CFXA 3EN9A 3ET7A 2UVYA 4AW2A 2OJGA 1QPDA 2X8EA 5HTBA 4C02A 4MHAA 5DR6A 4ZTLA 5IQGA 3K2LA 2VN9A 1RDQE 4RBLA 4TL0A 4UMQA 1Y8GA 4S33A 2VTAA 4ERWA 3FXZA 1JNKA 3FMEA 4BWXA 1QPJA 4DT9A 5H8GA 3V8SA 3ALOA 2VO6A 3MH3A 3ITZA 5KBRA 1FVRA 4IHPA 3F9NA 3GFEA 1MQ4A 1ZYCA 3KF7A 2PTKA 4FIIA 4FOBA 5IQBA 3Q9XA 5FEEA 3IDCA 2JGZA 5JGDA 4WT6A 3VNTA 2ZM3A 3EL7A 2CPKE 2OIQA 4G6OA 5M4FA 3QC4A 3S1HA 1U54A 2J2IB 3OW4A 5L2QA 5FRIA 3GXLA 1YVJA 3KCFA 4F08A 4F64A 5CEMA 4OR5A 3KFAA 1F3MC 5DE2A 1OBDA 1Q97A 3AOXA 3F6XA 2IZRA 3A4PA 3PXQA 5A3XA 2ITNA 1H1SA 3G33A 3JY0A 4RVMA 3KRLA 3ZO3A 5K9IA 4BYIA 2IZTA 2YAAA 3EQFA 4OTPA 4C4EA 5T68A 4AQCA 3BLHA 3PXFA 4I5HA 5CX9A 1QPCA 4XG6A 4O7WA 2A4LA 4G6NA 3DFAA 1IA8A 1VYZA 4XV9A 5DA3A 3SG8A 2HENA 4E6AA 3W8QA 4BCJA 1UNGA 4Q9ZA 4EOKA 3AC5A 1KE8A 2UZEA 5AAGA 2ITPA 4RFYA 1T46A 2VWVA 4LOPA 5HX8A 2OFUA 4JVGA 3RZFA 3V5QA 3WF9A 2VU3A 4RWIA 5HD4A 2YABA 4FBXA 4KRCA 2EVAA 2XZSA 3W18A 5AAFA 1YI6A 2VO7A 5JFSA 4JR3A 2YWPA 3VBQA 3PXRA 5LMBA 3DOGA 3MI9A 2BR1A 2XK4A 2ZV8A 3G6HA 2UZDA 3IDPA 2YDIA 4DFXE 5A4CA 1H0WA 3NVKI 4TY1A 2Y7JA 2Y4PA 3QQJA 2H9VA 4V0GB 2OH0E 2QO9A 3QX4A 4RIXB 3C5IA 2R64A 3R1NA 1CMKE 3R6XA 3CY2A 1JKKA 3CS9A 2ITOA 2E9VA 4FL1A 4H3BA 3HMIA 1OUKA 3L9NA 4YJVA 3TNPC 5H9BA 4F9YA 4E6DA 2BFYA 5LVNA 3I6UA 3Q6UA 3UO6A 1FVTA 1KE6A 3W2QA 1V1KA 3E3PA 3PIZA 2VTHA 2HAKA 2OBJA 3CBLA 3NNUA 2VV9A 5L8JA 2X2MA 2XBJA 2R3RA 2XK9A 3DQXA 1M2RA 3HRBA 4I0SA 1ATPE 3PVUA 4NM0A 3Q32A 5FDXA 2BTSA 5H8BA 4M69A 3DJ7A 4BHZA 2XEYA 2XS0A 5L8LA 4UEUA 2UZOA 2PHKA 3I81A 3LVPA 4ACCA 1BL7A 4L01A 4IACA 4O0XA 3RCDA 4BDIA 4RIOA 2J4ZA 3UNZA 3IONA 4EHGA 4TRLA 2X9FA 2QOIA 1FGKA 5CU0A 3NYOA 4EKLA 3RBWA 2X7OA 2YIRA 4Y85A 3HV5A 3C4ZA 4D4YA 1GIJA 4XG3A 4F9BA 4D2WA 5GIPE 2B4SB 3QGWA 4L3PA 4FG9A 4JQ8A 4U80A 4C36A 3QCXA 4MWIA 4U3YA 4I5CA 1O9UA 3P5KA 4WOVA 4RQKA 2I0EA 1PXNA 5J95A 4I22A 5HG7A 4ANLA 5LVOA 3QYWA 5K4JA 2JD5A 3QKKA 3CR0A 3QQKA 4NKSA 5E1EA 4CCUA 5IA1A 4A9SA 4HPTE 2GFSA 2YJRA 2YN8A 3ORMA 3PA3A 4FVPA 3SD0A 3UNJA 1PXPA 4QMLA 4BDDA 3LQ3A 3FV8A 5HIDA 1K9AA 2WTVA 4E3CA 2I0HA 1B38A 2HY81 3HMNA 4H05A 2J7TA 2QODA 1BLXA 5L4QA 5K3YA 3ODZX 1WVYA 5IH5A 5AM6A 4UZHA 4X0MA 3BCEA 4NH1A 2BALA 3DV3A 4IC7A 4MNFA 1OPKA 5FUTA 4GMYA 4XNEA 1UWJA 3V5JA 4D1XA 2OW3A 3QCQA 3KXXA 5FTOA 2VGPA 2F2UA 1V0PA 4PTEA 4FSUA 3LFDA 3VF9A 1AGWA 3DZOA 4L45A 1NVQA 4RX8A 4BR3A 3BV2A 4FSNA 3SA0A 1FMKA 4QTBA 5E8SA 4PUZA 5E8YA 4JDHA 1OB3A 4JG7A 1W83A 3LLAA 4TYHA 4DN5A 4E7WA 1Q8YA 2JKOA 4PMMA 3CKXA 4EOQA 3HUCA 4HVHA 4KSQA 4AGWA 2EB3A 2YACA 1IASA 3GU8A 4JRNA 5HHWA 5J9ZA 4XBUA 5KMLA 3P78A 1LEZA 3QRJA 4UBAA 2HXQA 2CSNA 4XS2A 3BHYA 4QPAA 4NEUA 1EH4A 4K33A 3TT0A 4HYHA 4CYJA 3D0EA 2FVDA 4J97A 2CKEA 4RVTA 4QMQA 3FBVA 2BDWA 4BDJA 1JAMA 2YZAA 5LVLA 3MFUA 4RT7A 4ACHA 2WMWA 4RIXA 4GUBA 3LLTA 2BDJA 5JQ8A 3O71A 1Z57A 4D9UA 3FY0A 4ZS4A 5IDPA 4LYNA 2PZRA 3BBWA 3HYHA 2PE0A 4GK4A 2VD5A 3SQQA 4GH2A 4O1PA 4EZ7A 1DI8A 2ETMA 3KULB 1ZXEA 2X81A 3B8RA 3FMMA 3MPTA 1REJA 4QO9A 5CVFA 5CT0A 2R9SA 5HIEA 3V5TA 3MYGA 3EIDA 3ZFMA 3OBJA 2JDRA 1SVEA 5KZIA 3ZUVA 3F88A 3OOMA 4X3FA 4ZZMA 1ZMWA 3V5WA 3W32A 1P4FA 3O0GA 4LL5A 3AGLA 3UMWA 3QZFA 2F7EE 4O27B 1WBVA 4QNAA 4GCJA 3HMOA 5ANKA 4E20A 4OTQA 1YDSE 2BZHB 2ITVA 3HX4A 2CCIA 4EEVA 3MA6A 4EQCA 4XG9A 3KQ7A 3TZ8A 1A06A 4J95A 2XIKA 2RG6A 2ZVAA 3I0OA 4FEUA 4YSMA 2VTMA 2YITA 3MTFA 2QOQA 5AA8A 3GEQA 2GQGA 5CI6A 5LARA 3AXWA 1UNHA 4S34A 2X8IA 3HNGA 3TIZA 3DK6A 2QOHA 5M09A 5EI8A 3DBCA 5C27A 3ALNA 3PXZA 4FMQA 5C8MA 3AG9A 3DKCA 3MGYA 3TM0A 5M08A 4WA9A 5FGKA 3E8NA 4I20A 1KE9A 3UOJA 3R00A 5G6VA 3QALE 2WQNA 2HW6A 3VS5A 3TNHA 5F9EA 4PX6A 4QYYA 4C57A 4D2VA 5I3RA 4EH2A 2C3JA 5FEDA 4MVFA 4ANNA 2V7AA 1A9UA 3EQRA 3D2IA 1QCFA 2XJ2A 3REPA 3V04A 3ZZEA 2RKUA 4K0YA 4N0SA 4RJ7A 1PHKA 3TTIA 2XK6A 2EU9A 4RIWA 5HG9A 2XEZA 4W4WA 2CNUA 4O7RA 2CGWA 2JKMA 5EFQA 3CIKA 1MRYA 1NVSA 5B2KA 4QNYA 4XLIA 1KE7A 2WIHA 5FQDC 2LGCA 3IK3A 4XG4A 4CKRA 3I60A 4AT4A 5HLWA 3B2WA 2AYPA 4MXOA 4JT3A 3CTHA 3R7UA 4BZNA 4LG4A 5J7BA 1W7HA 2OIBA 4R7HA 4YNOA 4HZSA 3HVCA 3JVRA 5EYDA 4DAWA 3COIA 1U5RA 4DFZE 1DAWA 1H1QA 3S4QA 3VVHA 4FTTA 2KTYA 3DPKA 2QI8A 3C50A 1W82A 5KNJA 4CVAA 3BZ3A 4BYJA 3ZFXA 3N4UA 4WG3A 3EJ1A 2Y8OA 2YCQA 5D41A 3F2RA 3S0OA 5EH0A 5AR4A 4ZZOA 3ZSGA 4PY1A 2XA4A 3ORXA 1P5EA 3R7GA 4G3GA 3DA6A 4LL0A 3QD3A 4FTLA 4S32A 3KXZA 4XRLA 4F1MA 5JSMA 4X6QC 3I6WA 1JKTA 3L9PA 4QP7A 4IZAA 5DGZA 1M7QA 1E9HA 2RFDA 4IAZA 2XVDA 3VUMA 4UALA 4ZTMA 1Q8WA 4WUNA 4YZCA 1KV2A 4JAJA 2XB7A 4U7ZA 3RK9A 3ZRMA 4D2PA 1GIIA 4QMWA 5C9CA 2HZNA 2OWBA 1A48A 2YERA 5F20A 2JC6A 2XNEA 1JKLA 3KRXA 1J3HA 2C68A 2C5VA 3FLNC 4A9YA 3P79A 5JKGA 3R9OA 2XBAA 2OFVA 4U0IA 3OW3A 4OTIA 2VTQA 3ATTA 2CCHA 3TEIA 5IEVA 4FODA 5DT0A 3EFKA 3PZEA 1Q8UA 4O21A 3I5NA 4B0GA 3FUPA 3MB7A 4ZAUA 2OLCA 3BGZA 4CG9A 5ICPA 4G9RA 3POOA 2O2UA 2JBPA 4OTWA 4ZEGA 5ETAA 2ITUA 4X2GA 4BCQA 1R0PA 4PF4A 2C4GA 3BE2A 4TWOA 4EBVA 3HP5A 2GNGA 5AUVA 4I24A 2CGXA 4AE6A 4M13A 4DTBA 4RJ4A 3Q96A 4PPAA 4FL3A 4Q5EA 3DFCB 5KE0A 3IDBA 3ZHPC 4R78A 4QP8A 3VS4A 5EDRA 5KKRB 3QKMA 3C4FA 4ZSJA 3EN7A 3WE4A 2C3KA 4GYIA 4IANA 3SX9A 3AC1A 3FLSA 1FGIA 3G0FA 4FT7A 3I4BA 3JY9A 1U4DA 4KIKB 4YJUA 3OWKA 3TACA 5AIKA 3RAHA 4BGQA 5KMKA 1FPUA 4ANBA 5ETFA 3ACJA 3NUXA 1GJOA 3CPBA 4O91A 3NDMA 3F7WA 2PMLX 3MV5A 5E91A 1TKIA 2FH9A 1H1PA 4R6VA 4ZSLA 1GNGA 4D5HA 3POZA 2XIXA 4ONAA 4A06A 1XKKA 4EOIA 3E87A 4GU6A 3QLFA 2C3LA 3FQSA 1ZMUA 3VIDA 3C4XA 4FTAA 1OBGA 4PTGA 3RHXA 4BIBA 4FKLA 4D55A 2QOBA 1MRVA 4RIYA 2YLFA 2IVVA 4D1SA 4M8TA 5IQFA 2NO3A 3IG7A 2XMYA 5BVDA 4BBEA 5CF6A 2GTNA 1P14A 2OI4X 4ZTQA 5HE0A 3L8VA 1UU9A 3TN8A 3ZFYA 3CLYA 2FA2A 3VUDA 3ZONA 5HVYA 4C4HA 5DH3A 2XUUA 1WFCA 3EQGA 4DFLA 3N9XA 4DG3E 3NNVA 5EKNA 2JKQA 3C9WA 3FSKA 3P23A 4P90A 5EKOA 5IA0A 3IW5A 1IAHA 2NNWB 5CYIA 4TXCA 5BVOA 2W1EA 4GL9A 4FX3A 4W9XA 2UVXA 4X2KA 5A4TA 4I6HA 4C38A 4CFFA 1ZYLA 2ONLA 2CHLA 2GHLA 5C03A 3FLWA 3GU6A 2G1TA 3Q3BA 4WRSA 4CT1A 2BIKB 1APME 2OZAB 3CTJA 5HG5A 3C7QA 2J0KA 2UW5A 1G3NA 2F9GA 1L3RE 2CN5A 2VWUA 5FXRA 4FZDB 3TJCA 1LP4A 3COHA 4EQMA 2QR7A 2WEIA 4IB3A 3IW8A 3ORIA 4KBKA 2PVYA 4UWBA 4UXLA 4YTIA 2PMNX 2XIRA 4I3ZA 3CGOA 5FG8A 4IWPA 4BHNA 4V05A 4YTCA 1UKIA 2A0CX 2Z7SA 2QKWB 3OWJA 3DK7A 3O17A 2AUHA 4PP9A 1Q41A 3MA3A 4IJPA 3O8UA 4OTRA 4L7SA 4N4SA 3VWAA 3LMGA 3GP0A 4QP4A 5IG1A 2XCHA 5IA4A 4EK6A 4MAOA 4BGGA 3OP5A 3OOGA 1OKZA 3LW0A 2EXMA 3M1SA 4QMMA 5LOHA 2VTOA 4BDEA 2WMVA 4YO4A 3LZBA 2XK7A 3R9DA 4IVBA 4DEGA 4GT4A 4RZVA 2PUIA 4IFCA 1Q5KA 4C3FA 2RGPA 4U3ZA 2WD1A 4DH3A 2WMBA 3QBNA 5IEXA 4KKEA 1SVHA 3O51A 4XG7A 2H6DA 4YUQA 3I0QA 4CYIA 5BUJA 2C30A 4MBLA 3QD4A 4E1ZA 1J91A 1YHVA 3EQIA 4RLLA 5DEYA 1RQQA 3S00A 4AS0A 2XJ0A 4YLJA 4FTKA 4JQEA 4KBAA 5LMAA 3TCPA 3RNYA 5M53A 3ZU7A 3RM7A 3LOKA 3UG2A 1YRPA 2VX0A 3ZEPA 4DLIA 1H26A 1KOBA 5AWMA 3ZXTA 4AW0A 3I79A 4BKZA 4MNEA 3WIKA 2GFCA 5AM7A 5A6OA 4ZY6A 2GTMA 5GJDA 2I0VA 1PXIA 4LRMA 4Y72A 3RZBA 3TTJA 5CALA 3PLSA 4FZFB 2Y9QA 1TQMA 4YJQA 5CNOA 5D7VA 2BRMA 2C6TA 3MY5A 5CSHA 5T3QA 5AUXA 2WEVA 3IS5A 4LRKA 4YURA 4ZTHA 3W33A 2HWOA 1LPUA 2YM5A 2WPAA 4R1VA 1PRYA 3WZEA 1WBOA 2JDVA 2VRXA 2ZOQA 4MBJA 4V01A 1H08A 1OKYA 3CC6A 3VQUA 3CTQA 4RSSA 4J8MA 2ZDUA 4Z55A 1VYWA 1WAKA 1MUOA 5KMOA 5C26A 4WG5A 4OTGA 3KF4A 3LJ0A 4ITIA 5B2MA 3DTWA 4LGGA 3VHKA 4EOOA 4G3CA 4JOAA 1SNUA 2P55A 2J5EA 2WTJA 3F5XA 3ZEWA 2PU8A 2O0UA 3LQ8A 4OTDA 4EK5A 4YU2A 4AN2A 4FNXA 4YMJA 4JNWA 3ORZA 3MIYA 3GU5A 3ANQA 3P7CA 4HVGA 4XP0A 2QHNA 4FEXA 1K2PA 2PUNA 3BLQA 5CEIA 4FIGA 5A9UA 4GK2A 3BYVA 3IOPA 4EK3A 4R1YA 3RPRA 4M68A 3KN5A 1CKPA 4GFGA 3UQCA 4H39A 3H3CA 1YOMA 4LV5A 4CKJA 2BRBA 3R63A 5D11A 3TL8A 3DBEA 2UW0A 1YWNA 1YOLA 2IZUA 3HECA 4FIEA 4GIIA 4FV8A 5BVFA 2C0TA 4D28A 1WZYA 2DWBA 2OU7A 2WMSA 3LFNA 1ZY4A 5LQFA 3O8TA 3SW4A 3HDMA 3DQWA 2JIIA 5GZ9A 4W8DA 3MJ1A 4GU9A 1H8FA 2VNYA 4P4CA 4DEDA 2W06A 3D83A 2ZB0A 4QP1A 2QU5A 4DTKA 4F65A 2VTJA 3QQHA 1M17A 1B39A 3GCUA 3UOHA 2Y4IB 4JDKA 4QMOA 3L1SA 3VUIA 3U4WA 4DEEA 3ELJA 3GQIA 3OUKA 3RAWA 4DGGA 3MH2A 4R3PA 3BU5A 2IWIA 3GUBA 3PJ1A 4QMVA 4RLKA 3D5UA 4YJRA 4ZP5A 3VRYA 3ZO2A 3PLAE 3F69A 2WFYA 3EN4A 4UWCA 4GIHA 1OL2A 3W10A 2F4JA 3CGFA 3NNWA 4ANQA 4M84A 5EHLA 2XKCA 1FOTA 4EOJA 3R1YA 5E8VA 2Y6OA 5FDPA 3GC9A 1BL6A 2GU8A 3HMPA 5F1ZA 3RPSA 5HD7A 4X21A 2W96B 5D9HA 3W2RA 4WSQA 4ZSGA 3PP0A 1BUHA 2IN6A 3EQHA 3SXRA 4UMPA 2Z60A 4NFMA 4USEA 5L3AA 1YXTA 5CAQA 2QOLA 3QC9A 4H58A 3MPAA 1YXXA 3OROA 2WTCA 3OCTA 4L3LA 4RJ8A 4IE9A 2W1IA 4FICA 4L44A 4MBIA 2OK1A 3HV6A 3KXMA 3ZLXA 3RNIA 3CEKA 2PK9A 2QOKA 2R3HA 2R3KA 3BV3A 2HOGA 1P4OA 2HY0A 4CD0A 3FYJX 4FV7A 5DVRA 4BTFA 5M56A 2UZLA 1XO2B 4X3FC 5C1QB 3VQHA 3GGFA 3U6IA 2FYSA 5HI2A 2PE2A 4YJOA 3F2AA 1GZOA 1J7IA 1GAGA 3LMHA 2YCSA 3MWUA 4YZDA 3R9HA 3UIUA 4EOPA 3EYGA 3IW6A 3BWJA 3DLZA 3PXYA 4BDAA 4H36A 1CKJA 3EZVA 2PVHA 3VS0A 4AOTA 4CMOA 1BYGA 4OTHA 2XRUA 3WE8A 4PNKA 1BMKA 4ZIMA 5LCJA 4AZFA 4BI2A 3E62A 2PMOX 4FKSA 4KINA 4O2PA 3UC3A 4CTBA 2XIZA 3DT1A 2V5QA 2PVMA 4BC6A 4DITA 1PKGA 3ZBXA 3D4QA 5HEZA 1R3CA 5LVMA 4UMRA 5E4HA 4J98A 1UU7A 2WOTA 3GOKA 3FLYA 2CMWA 1PMVA 1VZOA 1I09A 4UWYA 5L2IA 4GRBA 2QOFA 3Q4TA 4ZTSA 2R3FA 1G8AA 3LM5A 4HYSA 3E7OA 3TXOA 3UVPA 3DXQA 1TVOA 3MN3A 1ZZLA 2EXEA 5M44A 3HAVA 1H07A 4X7QA 5AP2A 4F7NA 4IZ7A 4EH9A 5GIOE 4DH1A 3QFVA 3UPZA 3FI4A 5E9EA 4RJ5A 2WQOA 3F66A 1O6YA 4CKIA 2WB8A 1IAJA 4L6QA 3F3ZA 3A7IA 2C6LA 3R02A 3P9JA 4E6CA 5IQHA 2HELA 4IX5A 3QQLA 3VW8A 5BYZA 3NWWA 2PVKA 5CF5A 3DLSA 3C0GA 4P2KA 2HIWA 5CVGA 1JQHA 3F3TA 4QP3A 3TKHA 4A9RA 2OF2A 4K9YA 4YTFA 1PXKA 1UA2A 3ZM4A 2GHGA 4C3RA 3OT3A 3R04A 4QP2A 1SZMA 1QPEA 1XWSA 2I6LA 4U41A 5BNJA 3M42A 3FZTA 3FPMA 4C2VA 2OO8X 2QLUA 4R8QA 3ZLWA 3V8TA 4D0XA 2JITA 3KK8A 4NTTA 2OJIA 3MJ2A 4I0RA 5JGAA 2B52A 2OSCA 4ITJA 4PWNA 4CNHA 5GNKA 4F7SA 3TWJA 4ASDA 3ZLYA 4CFMA 4CEGA 3NUAA 3TDWA 3LHJA 3QZIA 3QWJA 5CAOA 5C8KA 5I0BA 1G8SA 2VO3A 2WOUA 3KY2A 3UMXA 3WF6A 1ZYSA 4APPA 4CFVA 4ID7A 3PVGA 2ZV9A 3CP9A 5LXMA 2F57A 3LFAA 4KABA 5HE1A 3GBZA 4G31A 5AP0A 4DINA 1OKWA 1I44A 3SV0A 4F0IA 3E8CA 5AEPA 5B7VA 1MRUA 4G5JA 5F4NA 2W4KA 4YSJA 3EN6A 4TN6A 4DGLC 2VX1A 4XP3A 2BTRA 3VN9A 3SGCA 3W2SA 5TKDA 5KHXA 4IVAA 4I1ZA 4YP8A 3A7GA 3COMA 4TZRA 3WF5A 3EQDA 4RX5A 4E4XA 4XYFA 1RJBA 1ZARA 1OITA 5JFVA 4QMUA 2ITTA 3MESA 3QTQA 3TUDA 3ZDIA 4FL2A 4A4OA 1TQPA 4GVJA 4K18A 4IX3A 5EHOA 4G3EA 2OG8A 2LAVA 2C6IA 3QA8A 3U8WA 4WHZA 5CAVA 3D5XA 2VX3A 5GJFA 4XLVA 3RK5A 4L53A 3FY2A 2XNOA 1Q3DA 3FE3A 4RWKA 2C5OA 3DBDA 3UQFA 2YAKA 2PZPA 4R3RA 5K4IA 3R7IA 4O82A 4B8LA 4QTDA 4FV9A 1Q62A 5A4EA 2GQRA 3QTZA 4FC0A 4QPSA 4L67A 1W98A 2QLQA 5FP5A 4O83A 2JDSA 5ETIA 3ROCA 5HVKA 3RALA 1ZRZA 2PSQA 4I23A 4FE2A 1WVXA 3U51A 3PG1A 4I92A 4FZAB 1IG1A 4BKYA 1WBSA 4RZWA 1WBTA 4C37A 3EFLA 4EZ3A 3OY3A 2YJSA 3G15A 3ULIA 1VR2A 5AUUA 3TG1A 4GG5A 1NW1A 3LPBA 3U6JA 4IZ5A 5HLNA 2XIYA 2J5FA 1JKSA 2WMTA 3BWFA 3O7LD 2XRWA 3AC3A 3PWYA 4GJ3A 4BTMA 4DCEA 4U97A 4MF0A 3VW6A 4G34A 5JT2A 2GNHA 1QMZA 2HZ4A 4FSZA 4F1TA 3UIXA 4ZZNA 2HW7A 5ANEA 5DMZA 5E8ZA 4RA4A 4BBMA 4F4PA 4QTEA 2A1AB 3R71A 4GYGA 4NUSA 4O0SA 3OG7A 2GNIA 4G3DA 2PUUA 3R8UA 5DWRA 3R7EA 2OF4A 2BZIB 2R3IA 4QYGA 4ZJJA 4EOMA 4EHZA 3VUTA 3CY3A 2ZYBA 2BPMA 2ZJWA 3NMUF 1H27A 3LAUA 4PL4A 3TKIA 2YM7A 4CQEA 3MPMA 4K1BA 2JLDA 3RI1A 3NNXA 3L9MA 5L6WL 1OIYA 4BWKA 5L2SA 5C4LA 5M07A 4FTOA 1OL5A 4IM3A 4DTAA 5FEQA 3FPQA 2IW6A 1NY3A 1J1BA 3BRBA 5HE3A 3FMKA 3DB6A 4FYOA 1YXSA 2YIWA 3KA0A 3FHRA 4HPUE 3ZTXA 2J0LA 3FHIA 2W7XA 3PY0A 4FKWA 5AP4A 3FXWA 4GKIA 4WNOA 5IUHA 3KL8A 4XEYA 5FM2A 3UVQA 5AAEA 5J1VA 4Y73A 3TDVA 3LJ1A 3JVSA 3AT4A 2QR8A 1H00A 4NW5A 4PRJA 1XBBA 2J0IA 5GHVA 5KCVA 1WCCA 3RHKA 3CQEA 4FV2A 2PWLA 4QRCA 5DT3A 4RJ6A 1OL7A 3L8SA 3NX8A 2ONLC 4MK0A 4ALWA 4UZDA 1XQZA 3BGPA 2JFMA 5AP6A 3JUHA 3SXSA 3V6SA 4HYUA 3PY1A 4GK3A 4H3QA 4NM7A 4V0GA 4BFMA 4GSBA 4BCGA 3WZUA 3PE1A 5HESA 3UTOA 4LFIA 4DT8A 3RWQA 3K54A 3H30A 5M06A 5AP1A 2VWZA 4PDOA 3OBGA 2V0DA 3ZOSA 1O6LA 2YCRA 4FKPA 3U87A 5KBQA 4HCUA 1PMEA 1IR3A 1YQJA 4FV1A 3EQBA 4GV1A 4DH7A 4MEDA 4EH6A 3FMNA 4A7CA 3C13A 2VUWA 4J52A 4TPTA 4GEOA 1YKRA 2I0YA 4HCTA 1H25A 4PNIA 4XG2A 3P7BA 5BVKA 1GOLA 1YXUA 2VTPA 4J7BA 4KS7A 2BAKA 4OBPA 3OY1A 2OJ9A 3D5VA 4DH5A 4K11A 3PPKA 4C7TA 4ZMFA 2P2HA 5EW3A 2CGUA 4EH5A 1ZZ2A 4BGHA 2OJJA 4B9DA 2X4FA 4MQ1A 5EW9A 4BZDA 1W0XC 2R0IA 4ITHA 3PP1A 3PTGA 4WD5A 2CLXA 4OAUC 3GQLA 2XNNA 3KRWA 4GS6A 2B1PA 2QHMA 4IBMA 4ARKA 5DRBA 1PJKA 5KKRC 2VAGA 5EG3A 2RL5A 4D4VA 5KUPA 4M3QA 3O7LB 5IKWA 4DHFA 5KMJA 1XR1A 3KMUA 4F0GA 3E93A 5AX9A 4JG8A 1YDTE 3GT8A 4F6SA 5ETCA 2BILB 4GVAA 2QC6A 3DKGA 4GFOA 5M4IA 2YIXA 1LEWA 4AU8A 4XOZA 4YJPA 4A4LA 5HNGA 5ANOA 3IQ7A 3TV4A 3U55A 3RPYA 2OXDA 4FKIA 3QXPA 4EYJA 3AD6A 5BX0A 1U59A 1HOWA 3VS7A 2YM6A 4CV9A 5CWZA 3VBWA 4FKOA 3SAYA 3UP7A 1Y6BA 4E5WA 4QYHA 5AP5A 5L6PA 3BU6A 4M0YA 3BYSA 3Q04A 4IWDA 3K5UA 1NT2A 4AF3A 4BCKA 3DXPA 1Q99A 5IQCA 4NL0A 2BAJA 3HZTA 2PZ5A 3ZDUA 3GCVA 4G9CA 3JXWA 4EH3A 2Z2WA 2ITZA 4O0YA 4EYMA 5BQ0A 3K3JA 2F49A 5A6NA 3DNDA 5HOAA 5C01A 2VTSA 4IZYA 4R3CA 4C3PA 2OZOA 3EL8A 3AD5A 5D12A 5I9VA 2FB8A 4I6QA 3BELA 4AGDA 2WIPA 5DEWA 3A8XA 4Y5HA 5I4NA 3HAMA 3LCSA 4BBFA 2XNMA 2B7AA 4WBBB 3PDTA 1PYXA 1RE8A 3BGQA 3HV4A 2VWIA 1F5QA 4DBNA 5B2LA 4GKHA 4TWCA 4EC9A 2ETKA 4YBKA 4ZSAA 3E64A 3T3UA 3WZKA 3P08A 4G5PA 3OMVA 2W9ZB 1M7NA 1OIRA 4IAIA 4KS8A 1URCA 4RWLA 5JEBA 5IQDA 1UVRA 5DN3A 4XV1A 3R7YA 2JAMA 3QWKA 4G6LA 4EORA 4LQMA 2UW4A 3FMHA 2V22A 3NS9A 4QQCA 3DKOA 4JBOA 4XRJA 3A7HA 3Q2MA 2IVTA 3GU4A 3DZQA 4JBQA 4UYNA 1SM2A 2XK3A 4DEHA 1Q8ZA 4Q2AA 4NJ3A 2WU7A 5HTCA 2XCKA 4XJ0A 3BYMA 2YDJA 3KULA 3FI3A 4KNBA 4BB4A 1XH7A 3LXKA 3EN5A 3LXNA 2JAVA 4R77A 2C3IB 4AFJA 4CZYB 5EI2A 5AR5A 4TYJA 4BIEA 1UV5A 4IAKA 3EQCA 4WNPA 3ZZWA 4O7ZA 5AUWA 4Z7GA 5A46A 3R8PA 5IQIA 2XK8A 3Q5ZA 1Y91A 3Q4ZA 4FIJA 2BAQA 4B6LA 3DTCA 3HP2A 3BHVA 5ACBC 3FDNA 3D5WA 1YHWA 3R83A 3EFJA 4EBWA 3D14A 2BRGA 4FKGA 5H3QA 3WYYA 1W84A 2Y0AA 4I4EA 2UZNA 5IH6A 4GT5A 4HGSA 2AC5A 5J87A 3UO4A 4KUJA 4FEVA 3BKBA 3R9NA 2UUEA 3EZRA 3I7CA 4FV5A 5GJGA 3D7TB 4IAYA 5AUYA 4L52A 2IG7A 2FSOX 1M52A 4Y83A 2PVLA 3D7ZA 4PV0A 4CSVA 1R1WA 4OUCA 4FVRA 3FQHA 3G9NA 3IOKA 2WTKC 4ZJVA 4Z9LA 4F0FA 3GENA 4F7JA 3FZRA 5I5ZA 3UYTA 4HW7A 2QOOA 2W5HA 2WO6A 2YM4A 4Y5QA 5K5NA 2IPXA 4EKKA 4BVUA 3PVWA 1WMKA 4U44A 4A07A 1MQBA 4HZRA 4RC2A 4NM5A 4V04A 2HZ0A 3RKBA 4DEBA 2C5NA 1S9IA 1JLUE 4W9WA 3Q5IA 1BI7A 4MXYA 3B2TA 3F5GA 3UYSA 2NPQA 4QT1A 5JGBA 4XOYA 4A9UA 2RSVA 3VAPA 4BCOA 3BU3A 5CF4A 5CSVA 3KB7A 2PULA 3FMLA 3NYXA 1PY5A 2XF0A 4FKRA 3FI8A 4O6LA 3FL4A 2G2IA 4O7NA 4O86A 5JZNA 3ZO1A 3MTLA 2YIYA 3NUYA 4R7BA 5E1SA 3FC2A 4YJTA 4IH8A 3L8XA 2P2IA 3FWQA 4RMZA 4PTCA 3ROYA 3W16A 2W05A 4WSYA 2P4IA 3AC8A 4D2RA 4FEWA 2UW9A 4HVDA 2W5BA 3NGAA 3NPCA 2QVSE 2C6OA 3QRUA 3NW6A 2W4JA 3F7ZA 5EM6A 4FTQA 5IDNA 2PE1A 4ZK5A 3A61A 5AJQA 3BEAA 3R2BA 4Y95A 1OM1A 2OJFE 2R5TA 2RF9A 3NYVA 3S3IA 3ORTA 4JR7A 5E8TA 3MS9A 2I7QA 2ACXA 4O7TA 3ACKA 3COKA 4ASEA 1OMWA 3FZ1A 3MFTA 4AGUA 3E7VA 5I3OA 5DNRA 3PFQA 2C47A 1BKXA 2Y4IC 4RX9A 2EUFB 3CKWA 1BX6A 2B9IA 2EB2A 2JFLA 2WAJA 3LIJA 2ITXA 3KXNA 3A4OX 5EDPA 4CT2A 1KUTA 4EC8A 3C0IA 3HDNA 4NW6A 5CSXA 4YC8A 4ALVA 2A27A 2Z8CA 5CXZA 1PMUA 1CTPE 2R3MA 2ZMCA 3QRTA 5DR9A 4BZOA 2WZJA 1QL6A 1XH4A 4QP6A 3QGYA 5AUTA 2VZ6A 4IX4A 4OAVB 4DGNA 2WTWA 1H1RA 3S95A 1IEPA 1G5SA 3KGAA 3VBVA 1PW2A 2CDZA 3C4CA 3HLLA 5M57A 3C4EA 4O22A 4YZ9A 2FUMA 2BKZA 4IDTA 4BWPA 4C4FA 5A4LA 3D7TA 4I6BA 3O50A 4S30A 1T45A 5KZ0A 1H4LA 4FV0A 4IM2A 3HV3A 5DPVA 4CLIA 3BHUA 3PZHA 3FXXA 4AAAA 2WKMA 3TKUA 4FGBA 4I93A 4IEBA 3AT3A 2GNFA 3FL5A 4J8NA 4NU1A 3LCOA 2QOCA 3BQRA 2EWAA 3PJ8A 1VEBA 2PZIA 3R30A 5D10A 3ZXZA 2CNVA 5CTPA 4RFZA 1UKHA 3HL7A 4KIKA 4NIFB 4ORKA 4HOKA 4L9IA 2XKFA 2EXCX 4D4SA 2CNQA 3EOCA 3R0TA 3IW7A 4I5MA 5A4QA 3RM6A 3CXWA 3NZ0A 4WRGA 3TV7A 4AW1A 2VTNA 4IB0A 1R78A 2W1ZA 4D2SA 1PYEA 4L8MA 3JYAA 3LCTA 4QMXA 4RWJA 3UGCA 2BCJA 4FSWA 5CU2A 2R3LA 3NSZA 4QMTA 4CFUA 1SMHA 4AW5A 3TZMA 1ZLTA 1IRKA 3VULA 3A2CA 4CCBA 2C5YA 3KVXA 3LE6A 5AA9A 4RFMA 4AUAA 3FEGA 4FIHA 4DE4A 1JSTA 4EWQA 3VF8A 2J9MA 5J79A 4AN9A 5DFPA 3A62A 2DYLA 3BPRA 4EH8A 3BIZA 3QRKA 3MDYA 5JQ5A 4W4XA 3LFQA 2G2HA 3DB8A 3QD0A 5HGIA 3R01A 3RK7A 5FBOA 1Z5MA 4WBOA 2XYUA 4AZWA 3KXHA 4EOLA 5E8UA 3W55A 4FKUA 4C35A 1XH5A 5EQEA 2PMIA 5D7AA 4F9CA 4AZTA 3NIZA 2JDOA 4IX6A 2C6KA 5ANJA 2VWBA 4PL3A 5DT4A 3W1FA 4JDJA 4MD8E 4ACGA 3P7AA 3UQGA 3GC0A 3SRVB 4DBXA 2VWYA 4O1OA 3GFWA 2IW8A 4QMSA 2CKPA 5AV2A 3QTXA 4E6QA 3C5UA 4RQVA 4L7FA 3DDPA 2IW9A 4KIQA 3DKFA 4F6WA 3SHEA 4FNWA 3W2OA 1PF8A 1XBCA 4PPBA 3GI3A 5E7RA 3BX5A 4ZJIA 1OI9A 5KMIA 2OZAA 2P0CA 1JBPE 2OICA 4FV6A 5F95A 4H1JA 2IVSA 3KEXA 2YWVA 3FMDA 4HGLA 2F7XE 3HRCA 2BRNA 3FSFA 5I9UA 5TT7A 4AT3A 2XP2A 4C58A 4DYMA 3AC2A 4M14A 4BN1A 4BKJA 5HORA 4JBVA 4Y46A 3EQPA 1OL6A 3F2NA 5CXHA 1OGUA 2PVNA 4IWOA 2JKKA 2X7FA 4QMPA 3C0HA 4IAFA 4ALUA 5L2TA 2XM8A 5ANGA 2WMXA 2E9NA 3BQCA 3H0YA 1PXLA 1U54B 4S31A 5K0KA 3UZRA 4I0TA 4L3JA 3BHHA 3QTUA 4WNMA 1E1VA 3VUGA 3GNIB 4ENXA 5TE0A 5IMEA 3OXZA 2CN8A 3F82A 4HNFA 3OS3A 4H3PA 4TWNA 1KWPA 2WELA 4XX9A 5FTQA 1WBWA 1SVGA 3R9RA 4BCNA 2R3PA 3IGOA 4M12A 3Q4UA 4JBPA 5CLPA 4OTFA 3VS6A 4JXFA 4EWHA 3OC1A 5JFXA 1OPLA 4LMUA 3QCSA 2FSMX 2CJMA 4AA5A 1TQIA 1OECA 3E63A 3NRMA 2GMXA 1U46A 3NW7A 1PXJA 3DBFA 4MXAA 4NIFA 3V8WA 4O7VA 1XHAA 2O64A 2X9EA 3PIXA 4AOJA 3VC4A 1H28A 1WBPA 2W1HA 4MF1A 3UVRA 2PZYA 4O0WA 4U81A 5GZ8A 1R0EA 2HYYA 5AV3A 2OGVA 4AACA 2BHEA 3KC3A 4F63A 3O8PA 4DF3A 4K2RA 4HNIA 4KSPA 4TTHB 4EUTA 5AIRA 5HVJA 1STCE 3CJFA 4DCAA 4AA0A 3Q52A 2X6DA 2P3GX 4GUEA 1YHSA 5BVNA 1GZKA 4E93A 3UE4A 5CI7A 5J9YA 3ATSA 4RG0A 3VO3A 1ND4A 4ZLZA 4C2WA 4FR4A 3UP2A 4L46A 1V0OA 3PJ2A 4C34A 4DEAA 3QQGA 3UPXA 3R2YA 1XH8A 4OT5A 3WF7A 5JZJA 2G15A 2J6MA 3SC1A 1W8CA 2GNLA 2VTTA 4EOSA 3EKKA 3QKLA 3AGMA 4C59A 3GCSA 4FA2A 1M2QA 3RWPA 4BCHA 3QLGA 3ZH8A 3DU8A 2UZUE 5BPYA 5ITAA 3QU0A 3PJCA 4ZOGA 5J1WA 2UZBA 4I94A 4O0RA 2ZAZA 4ZLOA 4DFYA 3P86A 2YM8A 4M69B 3QUDA 2O5KA 5E8XA 5DRDA 4RA5A 3WYXA 4PMPA 4GT3A 3QHWA 4YJSA 3ORNA 2PY3A 4M7IA 5HICA 3ENMA 4YC6A 1AQ1A 3PPJA 5TOZA 4W4VA 2W4OA 4IDVA 5DOSA 3ZRLA 2C0IA 3MVJA 3U4UA 3VUKA 1YOJA 3SXFA 3NLBA 5IF1A 4DA5A 2WGJA 3FMJA 3QZGA 2YDKA 3VHEA 2QD9A 3NCZA 5FBNC 1M14A 3UOKA 1Q24A 4BCFA 4EJNA 4IXPA 4G3FA 4L00A 5EYKA 4NZWB 3ZC5A 5CAPA 4KAOA 3SDJA 1XJDA 5F94A 4AXAA 3FKLA 2BIYA 3H10A 3JS2A 4YTHA 3UZTA 5M4UA 4QMZA 4JL9A 2BVAA 2UW6A 4I4FA 3NUPA 4UX9A 4O38A 4E5AX
chains in the Genus database with same CATH superfamily
1W2DA 5GINE 4J53A 2CLQA 2RFEA 4RRVA 3OZ6A 4WKQA 5TR6A 5KMMA 4KKGA 3OXTA 4FT3A 3QHRA 3FC1X 4ENYA 4Y8DA 4W8EA 2Z7RA 4I5PA 2ETRA 4FT0A 3KK9A 4BDHA 1J7UA 2Z02A 3R1SA 3V6RA 4RJ3A 2XKEA 3W2PA 4IB1A 3WZDA 2WXVA 3OD6X 4O7YA 3FJQE 5FXSA 5IU2A 2C1AA 2RFSA 4QPMA 1CKIA 2BRHA 4FTUA 4NCTA 4L42A 4C4GA 3FAAA 3H9OA 1VJYA 2W1CA 3GB2A 3UIMA 4NSTA 3F3VA 5IQAA 1CSNA 4IW0A 3R22A 5IZFA 3LFCA 3RMFA 3O23A 2BUJA 3ORPA 3F61A 4TYHB 5D1JA 2A2AA 3OVVA 2RG5A 3ZUUA 2CKQA 4AE9A 2YEXA 4USFA 1GY3A 4G2FA 1U5QA 4JJRA 3OHTA 3F5PA 4Q9SA 3MVMA 5FXQA 4FSMA 3G2FA 5IEYA 4XH6A 4MX9A 3HUBA 4MXZA 3AC4A 3G6GA 3IECA 3ZCLA 3S2PA 1Q61A 3RPVA 2DS1A 4PDSA 3D9VA 5J7HA 3NFGB 3OTUA 4G1WA 2BZKB 4AXCA 4PPCA 4WG4A 3R8LA 4ZLYA 4M97A 5FWKK 2GSFA 2R4BA 2W1FA 4M15A 3P4KA 4X2FA 4A9TA 5M55A 4EZ5A 5BVEA 4C0TA 4Z7HA 4FSQA 2CGVA 2QURA 4A4XA 4TNDA 2XAMA 1VLRA 3V5PA 4DHZA 3II5A 3TYKA 2OXYA 4PL5A 3EFWA 5AV1A 5EYCA 2JBOA 3D2KA 1F0QA 3ENHA 3K5VA 3DGKA 3MVHA 4IAAA 3SVVA 1LUFA 3PSDA 2V55A 2ERZE 4FG8A 5EOBA 2V7OA 5AR8A 1E1XA 5IA3A 3THBA 4X3FB 5IPJA 5DBXA 5KX8A 3WARA 4YNEA 3UO5A 2J90A 5K5XA 5HBJA 2ZV2A 2X7GA 4FYNA 2QONA 4O4CA 4XV3A 3KRRA 3U9NA 4C61A 4EQUA 2R7IA 3HEGA 2BFXA 3H4JA 3PSBA 3MFSA 5AMNA 4CMUA 4QMYA 4LOOA 5CY3A 3NAYA 4O6EA 4NYEA 2NRYA 4BDCA 3FLZA 3UNKA 3PRIA 4IVCA 2HK5A 5C8NA 2WTIA 4P5QA 4F6UA 3PUFC 2R0UA 2R3NA 4F9WA 4BICA 2E2BA 3NYNA 1OVEA 1ZYDA 3G51A 5CZHA 5AV4A 1ZYJA 2PVRA 4NJDA 5EHYA 3PVBA 4FKTA 5CENA 4B99A 3QQUA 3ZLSA 1ERKA 2VTRA 3CE3A 3KRJA 4PMTA 3MSSA 1P2AA 3QZHA 4QOXA 5HO6A 4FNZA 4YPSA 5H8EA 1PMNA 1JPAA 3MY0A 2PVFA 3GC8A 3HA6A 3G5DA 4MQ2A 5IH4A 3DBQA 3UOLA 4O84A 5HNIX 2XYNA 2C6EA 2DQ7X 4RC4A 2YISA 2JIUA 4FTNA 1XH6A 3A7JA 4QTCA 4YLLA 4YR8A 3WZJA 1V0BA 1YXVA 4AA4A 1H1WA 4RIWB 4AZVA 1JSVA 3Q9WA 4BTJA 2C6DA 4NWMA 3CD8A 1KE5A 4FNYA 4MD9E 1KV1A 4D2TA 3DDQA 5IUGA 1Y6AA 2J0JA 3GOPA 2BZJA 3LFSA 3FYKX 3OXIA 4LUDA 2ZDTA 4P7EA 4ZXTA 2VNWA 5HZNA 4M67A 3OWPA 2QO7A 4E4NA 5M4CA 5E8WA 1GIHA 4NM3A 3QUPA 4IVDA 3EH9A 1PXMA 4R7IA 4U40A 4E8AA 4FGRA 4IC8A 3V3VA 4JIKA 3ETAA 2ZFYA 3KU2A 4FT5A 4JX7A 2O3PA 5EDQA 4APCA 5LMKA 5FD2A 4M66A 1YDRE 2QG7A 2XJ1A 3BHTA 3UODA 4U6RA 4OT6A 2H34A 4UMTA 2HCKA 4BY9E 4F99A 3CQWA 4KA3A 3PXKA 4FUXA 2G2FA 4XCUA 3DAKA 1JWHA 2C1BA 4FF8A 4XG8A 5KMNA 4O7LA 3Q60A 5FM3A 3QTWA 4MUQA 2J0MB 2XNBA 3P1AA 5BMMA 3KVWA 2VTIA 2H96A 3HRFA 3PY3A 4S2ZA 4Z16A 2X2KA 4AP7A 4KRDA 1YI4A 1S9JA 3QYZA 4WUAA 4HVIA 3TJDA 3AMYA 5CEPA 3ZUTA 3B8QA 3A99A 1NA7A 3IO7A 5AX3A 4N6YA 3OEZA 5AADA 3F3UA 3UBDA 3LCKA 4HVSA 3VUHA 3LMIA 4BDFA 4AZEA 4DGOA 5HO7A 4ANOA 4D58A 2F7ZE 5HLPA 4U79A 4JDIA 5TO8A 3PE2A 4FI1A 3TUBA 1JVPP 3WIGA 3MW1A 1H24A 4E73A 3EMGA 5AR3A 5ANDA 1NVRA 4CZTA 3C1XA 1UU3A 5IQEA 4FKJA 4X2NA 3KMWA 4FZ6A 1OUYA 2O8YA 3TNQB 3R73A 1FBNA 3Q2JA 2FSTX 4O0VA 3E8EA 1OZ1A 4HJOA 4FSRA 5LWNA 2GNJA 3WBLA 2ITQA 5CU6A 2WMUA 5AP3A 5CASA 1LR4A 3OCBA 4BCIA 3ZSIA 3ZYAA 1L8TA 2YIQA 1CM8A 1H01A 3E5AA 4PQNA 4K77A 1OL1A 3LM0A 4TYEA 4WNKA 4AN3A 2VO0A 4UN0C 1UU8A 4M0ZA 3MFRA 3HKOA 4FKVA 3OTVA 4OBOA 4MWHA 3FI2A 3NW5A 4K6ZA 2UW3A 3GU7A 3E3BX 3I5ZA 2V62A 3N4TA 4EI4A 3JPVA 4PMSA 3Q9ZA 5LVPA 2B54A 4CFNA 1KOAA 3H9FA 3EYHA 3Q9YA 3ORKA 5DLSA 4KWPA 4TNBA 5DR2A 2FO0A 4E26A 3AT2A 3TNIA 4QQ5A 3W2CA 5DG5A 4UV0A 4JQ7A 1B6CB 2A19B 3OWLA 3IKAA 5HU9A 4FV3A 4EHEA 1G8JA 5CVHA 4J71A 3TI1A 4R5YA 4FK3A 2WMAA 5GZAA 2J51A 4Q5HA 1O6KA 4CRSA 1YWVA 4P5ZA 4RIYB 3DS6A 3U9CA 4U45A 4DG2E 3AMBA 4D4RA 5BMSA 4CZUA 4JLCA 3RCJA 3UIBA 2RIOA 4H1MA 4JRVA 4QQJA 1Q4LA 1FQ1B 2WTDA 4MXCA 3LFFA 5H2UA 4J99A 3TZ9A 1WVWA 5CNNA 4K8AA 3PRFA 3M11A 4RPVA 4C4IA 3BLRA 4E4MA 2B0QA 5I9YA 4I21A 1KSWA 4YZMA 5DIAA 4AT5A 4O7SA 5EQYA 2OH4A 4RGJA 5EW8A 1UWHA 4LMNA 4NT4A 4XP2A 2UVZA 4FG7A 4ZTRA 3D94A 1UNLA 5CS6A 4ACMA 1GZNA 5L6OA 3LKMA 3T8OA 3LQ5A 3OEFX 4C62A 5JMSA 5CAUA 2X4ZA 4I6FA 5AV0A 2JDTA 2VWWA 2WU6A 4AG8A 2OXXA 5I9WA 3CCNA 1OIUA 4IIRA 3I7BA 3PYYA 3V5LA 5LJJA 4ASZA 1Q8TA 2C0OA 2YZLA 3H0ZA 3KKVA 4XMOA 3H9RA 2BDFA 2UZWE 4OW8A 3QF9A 5HE2A 4BDGA 3TV6A 5CU4A 4IM0A 2VGOA 2XH5A 5HCYA 1FINA 4FEQA 2GS6A 3BBTB 5FTGA 2I1MA 3CSVA 4YBJA 3WF8A 5IA2A 2BMCA 4LGDA 5M51A 3VS1A 5J9LA 3CJGA 3N51A 3UDTA 1ZWSA 2W99B 3QA0A 4UYAA 3SOCA 4ZS0A 2E9UA 4C8BA 2RFNA 3G9LX 1ZOEA 2ZB1A 3HA8A 4UY9A 2GHMA 4LV8A 4JS8A 4HCVA 4OGRA 5BVWA 3LFEA 3DAJA 3TZ7A 3WILA 4EONA 5KHWA 3FZPA 4YZNA 3SKCA 2E9PA 3ZS5A 5JFWA 4JX3A 5HCXA 3QUEA 2WQEA 5LCKA 4X2JA 2P33A 3MY1A 4J96A 4LI5A 3LFBA 4UB7A 4YJNA 3QXOA 5HIBA 3R8MA 2R3OA 3P0MA 4TYIA 3ZBFA 3W0PA 2QNJA 3NAXA 3R8ZA 3A8WA 1Z9XA 5HG8A 2B9FA 2WMRA 5CF8A 5J5SA 3RTPA 2XM9A 4O2ZA 2W1DA 3VS3A 4L43A 4ZMEA 5CSPA 3EKNA 4DEIA 4MNEB 4NKAA 3DAEA 3OFMA 3G90X 2FGIA 2X0GA 4U8ZA 3BLAA 4JG6A 3AQVA 3T3VA 2PVJA 2ZM4A 5CU3A 2QQ7A 5I9ZA 1REKA 5KO1A 3IW4A 3MBLA 4W4YA 3SLSA 2YFXA 5HU3A 5L2WA 3PG3A 3OF0A 4ZTNA 4BIDA 5IISA 3PA5A 4ZY5A 4BI1A 4CMTA 5L8KA 4RX7A 4IJ9A 3UG1A 4QTAA 4NFNA 2QKRA 3U54A 1Y8YA 4MYGA 2GCDA 2X8DA 5J5TA 1BI8A 5EI6A 4CV8A 3A7FA 5IUIA 3ID6C 2W0JA 3A60A 4FTRA 3MVLA 4XHKB 3MIAA 3PIYA 1ZY5A 4O81A 4G17A 3OCSA 2REIA 4LM5A 3CQUA 1M2PA 3FKNA 4CXAA 4TYGA 5JN2A 4TW9A 5BUIA 2WNTA 3EB0A 4FSYA 3DJ5A 3ZO4A 5HQ0A 4IFGA 4MCVA 3C4WA 3QCYA 4KBCA 4B4LA 4FTCA 3QTIA 3DJ6A 4DG0E 4F9AA 4FKQA 3NIEA 4ACDA 1ZOGA 4O96A 4FRFA 2R3GA 2W9FB 2YM3A 3QQFA 3AD4A 5CZIA 3W0QA 3CD3A 4AFEA 4DGMA 4FTIA 3SG9A 5AR2A 2UZVA 5BYLA 5C4KA 4YO6A 3EHAA 4J1RA 4EHVA 4FSTA 3E88A 3HV7A 3V01A 4N70A 4G16A 3ZM9A 4U5JA 2QO2A 2NP8A 4E5BA 4O0TA 1URWA 4HGTA 5EOLA 4Z3VA 2UZTA 4X6RA 5CT7A 3RINA 2QG5A 2O65A 4QD6A 5T6KA 3RGFA 4JAIA 2PL0A 3ZSHA 4LOQA 1YI3A 3WOWA 3CPCA 4BRXA 4EJ7A 3PPZA 5TF9A 4AZSA 3F3WA 3KN6A 4NCTC 1JOWB 3LCDA 1OPJA 3Q4CA 5BUEA 4QMNA 3HGKA 4USDA 2ZMDA 4E4LA 1X8BA 4FOCA 4TWPA 3SOAA 5I9XA 3ZC6A 4CRLA 3V51A 1PXOA 4FK6A 2F2CB 2IF8A 3KCKA 4YZBA 3R7OA 4FUYA 2ZV7A 4LRJA 4D5KA 3LXPA 3T9TA 2W17A 2R2PA 3QD2B 2X2LA 1H0VA 2BHHA 2DUVA 3ZMMA 4YGAA 2GS7A 2BROA 1FVVA 4BTKA 3VBTA 2C69A 4L68A 4CFWA 3R28A 4DFUA 4ANMA 4C4JA 3ANRA 5EQPA 4EK4A 4CGAA 2JIVA 2OKRA 3RVGA 1ZOHA 5BYYA 3ULZA 1DM2A 5FLFA 4B7TA 4EUUA 4CG8A 3BYUA 3E92A 3Q6WA 4YHFA 3C51A 4YC3A 3NVMB 3VBYA 5B0XA 4BF2A 4YLKA 3T9IA 2B9JA 4U43A 2KULA 5HO8A 2PPQA 1K3AA 1NXKA 2FSLX 3PA4A 1AD5A 2WQMA 4KD1A 5CSWA 3VJOA 4QYFA 4YPDA 2WTKB 4ASXA 4F7LA 2XNGA 3EWHA 1DS5A 3QRIA 5AP7A 3OUNB 1YWRA 3RPOA 1SNXA 4CQGA 3QAME 3UDBA 4LGHA 1SYKA 3ZRKA 5CEKA 3SW7A 3F5UA 4GFMA 2UW7A 4UXQA 5IA5A 3Q53A 4OBQA 4F1OA 3MB6A 3ORLA 4ZY4A 2X1NA 1PKDA 5FP6A 5HCZA 5CQUA 4PP7A 5DYJA 4DHIB 2Q83A 3W0NA 4GJ2A 5DI1A 4FVQA 4DLJA 3BE9A 5E90A 3QL8A 3L8PA 3UZPA 4MXXA 3UJGA 4EL9A 5K0XA 2UW8A 3GC7A 5A54A 1FMOE 4KIOA 2G9XA 4IWQA 4AOIA 3G0EA 4MH7A 5E92A 2IVUA 3KXGA 3DNEA 3TUCA 3PWDA 3KREA 4MKCA 3BI6A 4R5SA 1ZAOA 5BV3A 4U9AA 3QTRA 2GS2A 3RAKA 3NR9A 3RAIA 2WQBA 4KIPA 3JR1A 1MP8A 5J8IA 3O96A 3WI6A 2QU6A 4RVLA 4EH4A 5HKMA 3PJ3A 5HX6A 3HMMA 4F70A 2B53A 4PDYA 2VTLA 3LXLA 4EH7A 4ERKA 3D15A 1RW8A 2SRCA 4YHJA 3NUUA 2JEDA 4DHJA 1DAYA 2X6EA 4WIHA 1JSUA 2AC3A 2IZSA 3M2WA 4DH8A 5EM5A 5JK3A 3FZSA 3GCQA 1ZMVA 4KKHA 5EM7A 3DCVA 4UMUA 4C33A 5HBHA 4QYEA 2C5XA 5CQWA 2XNPA 5CANA 4PDPA 2I40A 3GVUA 3AMAA 3GCPA 2YA9A 2R3QA 2HZIA 3VBXA 4RC3A 4IMYA 4IB5A 2HXLA 2ZM1A 1CDKA 2HWPA 2IJMA 3ERKA 3NUSA 5EM8A 3O2MA 4CLJA 5IMXA 3N4VA 4FZ7A 4XV2A 5AFVA 4II5A 4MD7E 4N6ZA 5DHJA 2G01A 2B9HA 3TNWA 4IQ6A 4JI9A 4D9TA 5AUZA 5LMKC 2GQSA 4HGEA 2WHBA 5EK7A 4ZSEA 5EYMA 2Y6MA 2J50A 1YW2A 2YLEA 3R1QA 4IADA 4AGCA 2VWXA 1R39A 3FLQA 3IPHA 4XBRA 2WMQA 4BCPA 2O63A 2Q0NA 5ANIA 2X0QA 3NEWA 3VS2A 4B8MA 1Q3WA 4BL1A 3FQEA 2OIDA 4GG7A 3LJ2A 4AX8A 1OKVA 2H8HA 3MH0A 3RJCA 4BDBA 4EK8A 2E9OA 1XBAA 2Q0BA 2Z7QA 2Z7LA 4GW8A 4BI0A 4D0WA 3OCGA 4DDIA 4MTAA 2AQXA 1DI9A 2YHVA 5G1XA 2YCFA 5A14A 1IA9A 1GZ8A 2A98A 3I1AA 4HYIA 4QQTA 4TT7A 4BCMA 4X3JA 4ANSA 4BDKA 1W2FA 2PUPA 5CEQA 3IGGA 3VRZA 4FTMA 3QX2A 2R7BA 4FV4A 4TKSA 4XUFA 4D1ZA 3RP9A 4FT9A 4DC2A 1HCLA 2AEGA 3E8DA 5CEOA 3R7VA 4OLIA 1XH9A 4KB8A 3R8VA 4N57A 4WO5A 2GDOA 2XKDA 1J7LA 3PUPA 4DDGA 5JH6A 1WBNA 3NUNA 3R21A 4LUEA 2ITWA 3DY7A 4U42A 3DXNA 2X39A 2IO6A 2W1GA 3MH1A 2CKOA 5HBEA 4QP9A 3OT8A 4NK9A 4RVKA 5JRSA 4NTSA 3FKOA 2B55A 3W8LA 2C6MA 1OIQA 2R3JA 5AR7A 4DFNA 4F09A 3BYOA 4I41A 1HCKA 3KMMA 5HTIA 2QCSA 3PSCA 4FIFA 4JIAA 3ODYX 4YHTA 4FTJA 3VJNA 4AWIA 5LWMA 5JRQA 3U6HA 2UV2A 4O0UA 4DFBA 2NRUA 4CTCA 2W5AA 1Y57A 3QTSA 3TIYA 2ITYA 2PYWA 2BKKA 2ERKA 3DK3A 3BEGA 1J1CA 3K3IA 3UC4A 2GPHA 3SRVA 2ESMA 3L9LA 3NCGA 3FZOA 5ACKA 5HNBA 4CFXA 3EN9A 3ET7A 2UVYA 4AW2A 2OJGA 1QPDA 2X8EA 5HTBA 4C02A 4MHAA 5DR6A 4ZTLA 5IQGA 3K2LA 2VN9A 1RDQE 4RBLA 4TL0A 4UMQA 1Y8GA 4S33A 2VTAA 4ERWA 3FXZA 1JNKA 3FMEA 4BWXA 1QPJA 4DT9A 5H8GA 3V8SA 3ALOA 2VO6A 3MH3A 3ITZA 5KBRA 1FVRA 4IHPA 3F9NA 3GFEA 1MQ4A 1ZYCA 3KF7A 2PTKA 4FIIA 4FOBA 5IQBA 3Q9XA 5FEEA 3IDCA 2JGZA 5JGDA 4WT6A 1TFFA 3VNTA 2ZM3A 3EL7A 2CPKE 2OIQA 4G6OA 5M4FA 3QC4A 3S1HA 1U54A 2J2IB 3OW4A 5L2QA 5FRIA 3GXLA 1YVJA 3KCFA 4F08A 4F64A 5CEMA 4OR5A 3KFAA 1F3MC 5DE2A 1OBDA 1Q97A 3AOXA 3F6XA 2IZRA 3A4PA 3PXQA 5A3XA 2ITNA 1H1SA 3G33A 3JY0A 4RVMA 3KRLA 3ZO3A 5K9IA 4BYIA 2IZTA 2YAAA 3EQFA 4OTPA 4C4EA 5T68A 4AQCA 3BLHA 3PXFA 4I5HA 5CX9A 1QPCA 4XG6A 4O7WA 2A4LA 4G6NA 3DFAA 1IA8A 1VYZA 4XV9A 5DA3A 3SG8A 2HENA 4E6AA 3W8QA 4BCJA 1UNGA 4Q9ZA 4EOKA 3AC5A 1KE8A 2UZEA 1TZDA 5AAGA 2ITPA 4RFYA 1T46A 2VWVA 4LOPA 5HX8A 2OFUA 4JVGA 3RZFA 3V5QA 3WF9A 2VU3A 4RWIA 5HD4A 2YABA 4FBXA 4KRCA 2EVAA 2XZSA 3W18A 5AAFA 1YI6A 2VO7A 5JFSA 4JR3A 2YWPA 3VBQA 3PXRA 5LMBA 3DOGA 3MI9A 2BR1A 2XK4A 2ZV8A 3G6HA 2UZDA 3IDPA 2YDIA 4DFXE 5A4CA 1H0WA 3NVKI 4TY1A 2Y7JA 2Y4PA 3QQJA 2H9VA 4V0GB 2OH0E 2QO9A 3QX4A 4RIXB 3C5IA 2R64A 3R1NA 1CMKE 1ST4A 3R6XA 3CY2A 2NYAA 1JKKA 3CS9A 2ITOA 2E9VA 4FL1A 4H3BA 3HMIA 1OUKA 3L9NA 4YJVA 3TNPC 5H9BA 4F9YA 4E6DA 2BFYA 5LVNA 3I6UA 3Q6UA 3UO6A 1FVTA 1KE6A 3W2QA 1V1KA 3E3PA 3PIZA 2VTHA 2HAKA 2OBJA 3CBLA 3NNUA 2VV9A 5L8JA 2X2MA 2XBJA 2R3RA 2XK9A 3DQXA 1M2RA 3HRBA 4I0SA 1ATPE 3PVUA 4NM0A 3Q32A 5FDXA 2BTSA 5H8BA 4M69A 3DJ7A 4BHZA 2XEYA 2XS0A 5L8LA 4UEUA 2UZOA 2PHKA 3I81A 3LVPA 4ACCA 1BL7A 4L01A 4IACA 4O0XA 3RCDA 4BDIA 4RIOA 2J4ZA 3UNZA 3IONA 4EHGA 4TRLA 2X9FA 2QOIA 1FGKA 5CU0A 3NYOA 4EKLA 3RBWA 3ML1A 2X7OA 2YIRA 4Y85A 3HV5A 3C4ZA 4D4YA 1GIJA 4XG3A 4F9BA 4D2WA 5GIPE 2B4SB 3QGWA 4L3PA 4FG9A 4JQ8A 4U80A 4C36A 3QCXA 4MWIA 4U3YA 4I5CA 1O9UA 3P5KA 4WOVA 4RQKA 2I0EA 1PXNA 5J95A 4I22A 5HG7A 4ANLA 5LVOA 3QYWA 5K4JA 2JD5A 3AKJA 3QKKA 3CR0A 3QQKA 4NKSA 5E1EA 4CCUA 5IA1A 4A9SA 4HPTE 2GFSA 2YJRA 2YN8A 3ORMA 3PA3A 4FVPA 3SD0A 3UNJA 1PXPA 4QMLA 4BDDA 3LQ3A 3FV8A 5HIDA 1K9AA 2WTVA 4E3CA 2I0HA 1B38A 2HY81 3HMNA 4O4EA 4H05A 2J7TA 2QODA 1BLXA 5L4QA 5K3YA 3ODZX 1WVYA 5IH5A 5AM6A 4UZHA 4X0MA 3BCEA 4NH1A 2BALA 3DV3A 4IC7A 4MNFA 1OPKA 5FUTA 4GMYA 4XNEA 1UWJA 3V5JA 4D1XA 1ST0A 2OW3A 3QCQA 3KXXA 5FTOA 2VGPA 2F2UA 1V0PA 4PTEA 4FSUA 3LFDA 3VF9A 1AGWA 3DZOA 4L45A 1NVQA 4RX8A 4BR3A 3BV2A 4FSNA 3SA0A 1FMKA 4QTBA 5E8SA 4PUZA 5E8YA 4JDHA 1OB3A 4JG7A 1W83A 3LLAA 4TYHA 4DN5A 4E7WA 1Q8YA 2JKOA 4PMMA 3CKXA 4EOQA 3HUCA 4HVHA 4KSQA 4AGWA 2EB3A 2YACA 1IASA 3GU8A 4JRNA 5HHWA 5J9ZA 4XBUA 5KMLA 3P78A 1LEZA 3QRJA 4UBAA 2HXQA 2CSNA 4XS2A 3BHYA 4LV7A 4QPAA 4NEUA 1EH4A 4K33A 3TT0A 4HYHA 4CYJA 3D0EA 2FVDA 4J97A 2CKEA 4RVTA 4QMQA 3FBVA 2BDWA 4BDJA 1JAMA 2YZAA 5LVLA 3MFUA 4RT7A 4ACHA 2WMWA 4RIXA 4GUBA 3LLTA 2BDJA 5JQ8A 3O71A 1Z57A 4D9UA 3FY0A 4ZS4A 5IDPA 4LYNA 2PZRA 3BBWA 3HYHA 2PE0A 4GK4A 2VD5A 3SQQA 4GH2A 4O1PA 4EZ7A 1DI8A 2ETMA 3KULB 1ZXEA 2X81A 3B8RA 3FMMA 3MPTA 1REJA 4QO9A 5CVFA 5CT0A 2R9SA 5HIEA 3V5TA 3MYGA 3EIDA 3ZFMA 3OBJA 2JDRA 1SVEA 5KZIA 3ZUVA 3F88A 3OOMA 4X3FA 4ZZMA 1ZMWA 3V5WA 3W32A 1P4FA 3O0GA 4LL5A 3AGLA 3UMWA 3QZFA 2F7EE 4O27B 1WBVA 4QNAA 4GCJA 3HMOA 5ANKA 4E20A 4OTQA 1YDSE 2BZHB 2ITVA 3HX4A 2CCIA 4EEVA 3MA6A 4EQCA 4XG9A 3KQ7A 3TZ8A 1A06A 4J95A 2XIKA 2RG6A 2ZVAA 3I0OA 4FEUA 4YSMA 2VTMA 2YITA 3MTFA 2QOQA 5AA8A 3GEQA 2GQGA 5CI6A 5LARA 3AXWA 1UNHA 4S34A 2X8IA 3HNGA 3TIZA 3DK6A 2QOHA 5M09A 5EI8A 3DBCA 5C27A 3ALNA 3PXZA 4FMQA 5C8MA 3AG9A 3DKCA 3MGYA 3TM0A 5M08A 4WA9A 5FGKA 3E8NA 4I20A 1KE9A 3UOJA 3R00A 5G6VA 3QALE 2WQNA 2HW6A 3VS5A 3TNHA 5F9EA 4I6LA 4PX6A 4QYYA 4C57A 4D2VA 5I3RA 4EH2A 2C3JA 5FEDA 4MVFA 4ANNA 2V7AA 1A9UA 3EQRA 3O5AA 3D2IA 1QCFA 2XJ2A 3REPA 3V04A 3ZZEA 2RKUA 4K0YA 4N0SA 4RJ7A 1PHKA 3TTIA 2XK6A 2EU9A 4RIWA 5HG9A 2XEZA 4W4WA 2CNUA 4O7RA 2CGWA 4AAYA 2JKMA 5EFQA 3CIKA 1MRYA 1NVSA 5B2KA 4QNYA 4XLIA 1KE7A 2WIHA 5FQDC 2LGCA 3IK3A 4XG4A 4CKRA 3I60A 4AT4A 5HLWA 3B2WA 2AYPA 4MXOA 4JT3A 3CTHA 3R7UA 4BZNA 4LG4A 5J7BA 1W7HA 2OIBA 4R7HA 4YNOA 4HZSA 3HVCA 3JVRA 5EYDA 4DAWA 3COIA 1U5RA 4DFZE 1DAWA 1H1QA 3S4QA 3VVHA 4FTTA 2KTYA 3DPKA 2QI8A 3C50A 1W82A 5KNJA 3UDZA 4CVAA 3BZ3A 4BYJA 3ZFXA 3N4UA 4WG3A 3EJ1A 2Y8OA 2YCQA 5D41A 3F2RA 3S0OA 5EH0A 5AR4A 4ZZOA 3ZSGA 4PY1A 2XA4A 3ORXA 1P5EA 3R7GA 4G3GA 3DA6A 4LL0A 3QD3A 4FTLA 4S32A 3KXZA 4XRLA 4F1MA 5JSMA 4X6QC 3I6WA 1JKTA 3L9PA 4QP7A 4IZAA 5DGZA 1M7QA 1E9HA 2RFDA 4IAZA 2XVDA 3VUMA 4UALA 4ZTMA 1Q8WA 4WUNA 4YZCA 1KV2A 4JAJA 2XB7A 4U7ZA 3RK9A 3ZRMA 4D2PA 1GIIA 4QMWA 5C9CA 2HZNA 2OWBA 1A48A 2YERA 5F20A 2JC6A 2XNEA 1JKLA 3KRXA 1J3HA 2C68A 2C5VA 3FLNC 4A9YA 3P79A 5JKGA 3R9OA 2XBAA 2OFVA 4U0IA 3OW3A 4OTIA 2VTQA 3ATTA 2CCHA 3TEIA 5IEVA 4FODA 5DT0A 3EFKA 3PZEA 1Q8UA 4O21A 3I5NA 4B0GA 3FUPA 3MB7A 4ZAUA 2OLCA 3BGZA 4CG9A 5ICPA 4G9RA 3POOA 2O2UA 2JBPA 4OTWA 4ZEGA 5ETAA 2ITUA 3NFFB 4X2GA 4BCQA 1R0PA 4PF4A 2C4GA 3BE2A 4TWOA 4EBVA 3HP5A 2GNGA 5AUVA 4I24A 2CGXA 4AE6A 4M13A 4DTBA 4RJ4A 3Q96A 4PPAA 4FL3A 4Q5EA 3DFCB 5KE0A 3IDBA 3ZHPC 4R78A 4QP8A 3VS4A 4JMQA 5EDRA 5KKRB 3QKMA 3C4FA 4ZSJA 3EN7A 3WE4A 2C3KA 4GYIA 4IANA 3SX9A 3AC1A 3FLSA 1FGIA 3G0FA 4FT7A 3I4BA 3JY9A 1U4DA 4KIKB 4YJUA 3OWKA 3TACA 5AIKA 3RAHA 4BGQA 5KMKA 1FPUA 4ANBA 5ETFA 3ACJA 3NUXA 1GJOA 3CPBA 4O91A 3NDMA