4FV8A

Crystal structure of the erk2 complexed with e63
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
350
structure length
333
Chain Sequence
GAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVAVATRWYRAPEIMLNYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with E63
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 333
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv8A01
4GT4A 2FB8A 5AA9A 4B6LA 4JS8A 3HDNA 2WMXA 4YPSA 4AA0A 5CF8A 2PMLX 3C4ZA 4JQ7A 4BRXA 2J4ZA 4FUXA 2R3IA 4L46A 4BDHA 5BYYA 5F94A 5CI7A 4BBEA 3O96A 2C6DA 3GCSA 2CGUA 4IBMA 1JOWB 4M7IA 3UQGA 5EK7A 2E9VA 5AP1A 5K4JA 4KAOA 5KNJA 5CNNA 5DFPA 3CQUA 4BB4A 4MH7A 1YDRE 4WKQA 5J87A 3F3ZA 3R9DA 4CCUA 3ZRKA 4ZZMA 5DEWA 5IISA 5I9ZA 3TI1A 4YJOA 5HTIA 3TTJA 4PP7A 2W0JA 1OPKA 2Y9QA 1SVHA 3C0IA 4JBOA 4LRKA 3UNZA 3AC1A 2PUPA 3KMUA 4YJUA 4QMUA 3ALOA 4U97A 4MWIA 3TUBA 1P4FA 5FM3A 3D7ZA 3EN7A 2YCFA 4PMSA 2JKOA 1FVVA 4EOPA 3AT2A 4HVDA 3F88A 3E92A 4M69B 4BYJA 3DQWA 2C5VA 4OTHA 4XV2A 3T8OA 2ZDUA 5JFVA 4S2ZA 4ZTNA 3DAEA 3LHJA 3PA3A 5TF9A 2RFDA 4YLJA 5L8JA 2R3HA 2XA4A 2VTTA 1SM2A 4IEBA 4JX3A 4G5PA 4A9UA 4UV0A 4AZTA 4B7TA 1WBSA 3GCPA 2ITPA 1PW2A 3A7FA 3EZVA 3PPZA 3CBLA 3Q52A 3RM6A 4C36A 5DR2A 1LEWA 1XO2B 3P23A 4RIXB 4DGNA 1XKKA 3D5WA 4FT7A 4K11A 2OJGA 2BZIB 3VBWA 4QQTA 2IWIA 4AU8A 3COKA 4NT4A 2OJJA 3MJ1A 1QPDA 4MTAA 3IW4A 3KVWA 5FTQA 1BI7A 2QHMA 3E88A 5L2TA 3KRLA 3DBEA 3CS9A 3AXWA 3NPCA 4ZLZA 3UOKA 4ZSEA 2C69A 4OTRA 3RK5A 4Q5EA 4XP0A 4FYOA 1JVPP 4C02A 3BPRA 5BVWA 5LCJA 3V6SA 4Y95A 3R7IA 4AT3A 3O2MA 4M15A 4GJ3A 2BAQA 4IQ6A 4JBPA 3Q4TA 3PLAE 1OL2A 3D83A 1Z5MA 3A8XA 3ZLWA 4AAAA 2F7ZE 3S95A 1JQHA 1OGUA 2W4JA 4ACGA 4CNHA 4O83A 3CY2A 3DJ6A 3SAYA 2CPKE 1KSWA 3PVWA 1JSVA 1BKXA 2R4BA 4QP9A 3PY3A 4FEWA 4KBCA 3NEWA 2VTNA 3RZBA 3ZYAA 2BPMA 5TO8A 3KF4A 4WNOA 3MIAA 3W1FA 2Z7LA 3E87A 2Z60A 3SRVB 4AZEA 5KO1A 5ANEA 5CS6A 5IMXA 2C6MA 5AP6A 1MRYA 4PY1A 4K9YA 4FIFA 4U3ZA 2WMVA 4ITIA 2G2FA 2PVRA 5FXSA 5G6VA 3FKNA 5DG5A 2VO6A 4CYJA 3MN3A 4EJ7A 4EEVA 4RRVA 2WOUA 2RG6A 2YFXA 3OHTA 4HCUA 4PNIA 4IVBA 3EMGA 3E8DA 5L6OA 5KZIA 5AIKA 4F6SA 2C3KA 4P5ZA 2ITZA 3ZEPA 5CEQA 2C0TA 2WMAA 4YHTA 4FI1A 2XJ0A 3QXPA 2UVYA 1O9UA 2GU8A 3DDPA 5E92A 4QMTA 4OTPA 4YTFA 2GDOA 5HKMA 4A4XA 2UZVA 3FAAA 4ZK5A 3Q60A 4XV3A 1WVYA 4ZMFA 4I6QA 1MQ4A 3AT3A 4HYSA 4MK0A 1KV1A 5HVKA 2WO6A 4QQJA 4YLKA 2OWBA 2ZAZA 4Z7GA 1QMZA 5HTCA 3VBYA 3ETAA 3P86A 4IAZA 4IAKA 5BVKA 3I79A 2NRUA 1Y91A 2YM4A 4H36A 2XF0A 5CT7A 4RGJA 4RVKA 4L43A 5AP4A 2WTWA 4NZWB 4CFVA 3GB2A 5M51A 1APME 2C1AA 4E6QA 4MXXA 4X3JA 2JLDA 2G1TA 2WHBA 1F3MC 1PYXA 2J5EA 3EFLA 2JFLA 1OIUA 3KN6A 2X9EA 3O8PA 4K33A 4ZY4A 3NLBA 4GUEA 4CLJA 2QOQA 3MSSA 5HGIA 4J8MA 1J3HA 1O6LA 3BWJA 4C62A 2BDWA 4FZFB 3QWJA 3E5AA 4QP2A 4F9WA 5A6OA 4CFUA 4FK6A 4WG3A 3LFAA 3QC4A 4EH3A 4YSJA 2JIVA 3U87A 3AOXA 5HG7A 3UQFA 4FEXA 4AW0A 3NAXA 4I5MA 1JPAA 1T45A 3FMDA 4RSSA 3Q9ZA 1H1SA 1M7NA 2CJMA 2OH0E 3UC3A 4FSQA 3QAME 5HO7A 5T3QA 4O7SA 3OROA 3FLYA 4DEBA 2B52A 3UODA 2C1BA 4LMUA 3ULIA 5IA4A 5FTGA 3SC1A 4LI5A 5AR5A 2PZPA 2F7EE 3SW4A 1YXVA 2R3FA 3MH3A 3L8VA 4PDOA 3MY5A 4NM5A 3ZC5A 3TUDA 3OWPA 4G9CA 4GFMA 5ANJA 4ZS4A 1Z9XA 2BRNA 3PJCA 1U54A 2VWIA 3IPHA 2Z7QA 2GQGA 3GP0A 3OF0A 3QRKA 5CXHA 4DEAA 3LFEA 3DBCA 3SW7A 3QD3A 2QNJA 3UVPA 2CKOA 3I0QA 3TXOA 3LQ3A 4AN9A 3A4OX 4KBAA 4OW8A 4L44A 3BYSA 3MPAA 3ORMA 2BFYA 1RW8A 4GT5A 3ZDUA 2ERKA 1CMKE 4O27B 3ZLXA 5LVOA 3IW7A 3AC3A 4EOSA 2ITWA 4BVUA 4XG9A 2H34A 2W5AA 2IVSA 4OBOA 2GNJA 5EQPA 4FTAA 4U45A 4C4EA 5J9LA 4I6FA 4D2VA 3NNUA 3FC1X 3OY3A 3LCSA 4R3CA 2C47A 1Q4LA 2ITXA 2R7BA 3IG7A 4NWMA 4LMNA 5F1ZA 5CU0A 3OTUA 4U42A 5M4IA 3DPKA 3LMHA 5A6NA 4QNYA 4D4VA 4HGSA 4EQMA 3TNWA 1WBOA 4FTQA 2YEXA 4LGDA 4HNFA 2WD1A 4FKWA 5H3QA 2BUJA 4U3YA 4YR8A 5BVFA 3Q6UA 2I0EA 4YO6A 2VO7A 3BBWA 3OY1A 2QG5A 4W4VA 4MYGA 4HZSA 3UZTA 3HUCA 3FQSA 4DGLC 1JKKA 3HP2A 4RT7A 5KKRC 1V0PA 5JGAA 3DZOA 3LKMA 4RQKA 3GVUA 3SD0A 4V04A 1SZMA 2LGCA 4GYIA 3TEIA 3EN5A 2Y7JA 2BRGA 2IVTA 4EBVA 1ZY4A 3MVLA 3R8MA 3W10A 5GZAA 2C68A 3S00A 5AV3A 4H1JA 2YERA 3LM0A 5AP3A 3P08A 5EKNA 2PVFA 3KEXA 4HPUE 4BCOA 2YJRA 3C9WA 3BRBA 2CLXA 3HV7A 4H3QA 4JIKA 2FSLX 3DOGA 1YOLA 4JR7A 1OMWA 4AGCA 3G51A 3QTRA 3KN5A 3WOWA 5BUJA 4M3QA 4EZ7A 3ENHA 4PWNA 4QQ5A 2OZOA 5HBHA 4E6AA 2O63A 2W7XA 4FEUA 5CYIA 3E3BX 1FVRA 4LGGA 4M66A 2XKDA 5JK3A 2PVKA 3OT8A 4XBUA 5DLSA 4BCFA 4EKKA 4ZAUA 4I6BA 2I7QA 2O5KA 3NWWA 1REKA 3Q4UA 1NY3A 3HV6A 4Z55A 5AA8A 3K5VA 4EL9A 4EYMA 4ERKA 3PY1A 5HG5A 3U51A 2VZ6A 2REIA 3LFBA 4PMMA 4EH2A 2QOKA 3R28A 4I93A 4USEA 2XYNA 3DS6A 4GVAA 1U59A 3R2YA 3AT4A 3LPBA 2OH4A 1ZOEA 4DG2E 4FKSA 2VO3A 4FODA 4J95A 2ETMA 3FL5A 4KRDA 3W33A 3W8LA 1JKSA 4LGHA 4ZTHA 1M2QA 3IOKA 4BCHA 5DVRA 3RPRA 1GOLA 2QD9A 3HYHA 3M42A 4OBQA 4XG6A 2JC6A 3KRRA 3OG7A 2GFSA 2HK5A 2Z8CA 3C4WA 5IKWA 3MFSA 3GC0A 5M4UA 1OM1A 3I81A 3CGFA 5F4NA 2R3RA 4M84A 1ZYCA 2HY81 2XVDA 1ZMVA 2OG8A 3UIMA 4DFZE 4F9BA 2HCKA 4DHFA 5DRDA 3S4QA 3DAKA 3R8VA 3G9NA 3QHRA 3CLYA 3KXMA 5CQUA 5HCXA 5ETFA 1WCCA 3Q2MA 4FMQA 3ATTA 1FMOE 2UW5A 3ZU7A 3M2WA 2EWAA 1IASA 3F3TA 2EVAA 2ITTA 4CLIA 4AZWA 2QI8A 2XZSA 4G3CA 4J71A 2E9NA 3N4TA 1J7IA 3FYJX 5AV1A 3KMWA 3QF9A 4YP8A 3U8WA 3UYSA 3BGQA 4I20A 4C8BA 5FTOA 4QYEA 4X2GA 3FHRA 3VIDA 5K0KA 4EI4A 3BHVA 5F95A 4E4LA 2C3LA 1YXUA 2HZ0A 2I1MA 3OC1A 2DQ7X 2JDTA 5E7RA 4AS0A 2WTKC 4WUNA 5CU4A 1BI8A 3BYUA 3PRIA 4K2RA 4AF3A 2XMYA 4ZY5A 3OWJA 4NW5A 1YRPA 2C30A 2OJIA 2WMWA 3GFEA 2BVAA 3ZH8A 3FLZA 1STCE 4EOLA 5CTPA 1UWJA 4M14A 3RNIA 4QMZA 5LOHA 2VTSA 2GNHA 1A9UA 5IQHA 5GHVA 2R3QA 5BQ0A 4V0GB 2AUHA 2RL5A 4K18A 5GZ9A 4F0GA 3F69A 4JR3A 4RWJA 2W06A 2BZHB 5HHWA 3O8UA 2PK9A 4M68A 4XUFA 2PWLA 4GIHA 4PDPA 5HE1A 3IKAA 2B1PA 1G8SA 2W1CA 5IEVA 1OI9A 5KBQA 3W2SA 4YJVA 3TIZA 3PXYA 2R3PA 3KVXA 2XBJA 2XS0A 1Q8WA 1Q8TA 2W9ZB 1XWSA 1G5SA 1ZY5A 4LRJA 4WIHA 5DPVA 5AX3A 5HX6A 1MRUA 3OCTA 2PU8A 1E1VA 4IZAA 4AZFA 4CFNA 4LFIA 1S9IA 4F4PA 2UZEA 3ZTXA 1PKGA 2OU7A 2YLEA 5E1SA 4F0FA 3CGOA 2HWPA 4X6QC 5EDPA 1UWHA 3AD5A 4FK3A 4E1ZA 1UNGA 4FV8A 4ZMEA 5LVLA 4TYGA 4DEDA 2NPQA 4BDIA 3QQUA 5IUGA 2OFVA 3HL7A 3RP9A 2Y4IB 2V62A 1J7UA 4R6VA 3ZLSA 2WU7A 3TUCA 5B0XA 2WQMA 4K77A 3EQGA 3DXQA 5CX9A 2VRXA 3EQDA 3W32A 3C7QA 4GH2A 3W2OA 5IA1A 2YCRA 4AZSA 1IAJA 4DA5A 4ANQA 4FNXA 4KD1A 4AZVA 1CKPA 4FE2A 3U6JA 3PA5A 2PYWA 3VUIA 1W0XC 1P5EA 2NP8A 2H8HA 3DK3A 4MHAA 3RINA 3IQ7A 3EQFA 1VYWA 5K4IA 3DNDA 5IH4A 3HRCA 4YC3A 4ZTSA 4DLJA 5IUHA 3GENA 4C3RA 3H9RA 4NSTA 5HQ0A 1YXTA 3R1QA 2X8IA 4B4LA 2Q0NA 3HECA 5J1VA 4YJSA 3LZBA 3ET7A 5ANDA 1ZXEA 4ZJJA 5EYKA 3EIDA 3KCKA 3V5TA 3BLQA 3FHIA 4NIFB 4QP7A 4QYYA 2OBJA 4RLLA 4FG8A 3EKNA 2UUEA 4YBJA 2JBOA 3FMNA 5EG3A 3AMAA 3UPZA 4GG5A 2C3IB 3PVUA 4E5BA 2GS6A 3KU2A 2XNNA 3V6RA 3UNKA 4GFOA 2QO7A 4Q9ZA 2VWXA 2GFCA 2ZV8A 3G0EA 3QQKA 4R7IA 2PE1A 2PMNX 5A4TA 4O0WA 3RGFA 3DK7A 3OW3A 5J79A 2OW3A 1OL5A 2WEIA 3EJ1A 3LXPA 4BHZA 3FLSA 3EFWA 2E9PA 2EB3A 4XYFA 5J5TA 2W5BA 1L8TA 3JY0A 3TV7A 4E7WA 5HE3A 4UMPA 3A61A 3QTSA 4QO9A 4YMJA 4Z7HA 4YNOA 4EBWA 2CCIA 1XQZA 2C6IA 1PXNA 5D41A 3MY0A 5IQFA 2PVYA 2X2KA 4JQ8A 3VW8A 2O65A 4CQGA 5ANGA 2OFUA 3CIKA 3LAUA 1WFCA 4CKIA 4EH4A 1XH6A 4FKQA 2XNMA 5CANA 2VTPA 5F20A 4HOKA 5I9UA 2XIKA 3HUBA 4I5PA 3DFAA 3S2PA 4I0RA 1IR3A 2PVJA 2DYLA 1V0BA 3T3UA 3K3IA 4DFNA 3SV0A 2X39A 5BUEA 4CVAA 1ZOHA 3DCVA 4FKUA 3RPOA 2RG5A 2OZAA 4L68A 2H6DA 5J1WA 4JBQA 4BZNA 2XKEA 5E8TA 3P79A 4C58A 3PRFA 3GGFA 3E64A 4EOIA 4BDFA 5EW8A 1VJYA 3EQHA 3B8RA 1PKDA 4FNZA 4BIBA 4G31A 2G01A 4IANA 2XCKA 3COMA 5L2QA 2NRYA 4MD9E 4AOJA 4WO5A 1RDQE 5EYMA 4OTGA 5HNBA 2WEVA 4Y83A 2RFEA 4BI0A 4CFWA 5HNIX 1Q62A 4I5CA 4O38A 5D1JA 4CTBA 3TZ8A 5I9XA 4GK4A 4O7WA 2IZUA 1ZZ2A 3COIA 3FKLA 4FV9A 4N6YA 4BCGA 1H1RA 2ITVA 3QBNA 5IQEA 5EDRA 1DI8A 3E7VA 2P33A 3MA3A 2QKRA 1PXJA 4PTCA 3NR9A 3PVBA 4BTMA 3V5WA 3KREA 4FL2A 5M56A 3U55A 2BFXA 2R3JA 3AD4A 3E8NA 5G1XA 4I92A 1V1KA 4IH8A 4FT3A 4WOVA 5A3XA 4L53A 2LAVA 5CSHA 1BMKA 4PL3A 1J7LA 4EJNA 3HEGA 5JGDA 4UZDA 2SRCA 3LMIA 2F7XE 3BKBA 3GNIB 4GU6A 1Q8UA 2QONA 2VD5A 5IH5A 3EQIA 2QURA 4DBNA 3QXOA 4ZTQA 3FZSA 4FA2A 4QRCA 4WBBB 1UKIA 2CSNA 1BX6A 3FXXA 3KRWA 4RJ5A 4I24A 2EUFB 3CC6A 2BKZA 4FV4A 5FEQA 2UZBA 4QD6A 5DIAA 3TDWA 2R3LA 2QO9A 2Q83A 1R0EA 3TV6A 4EOJA 4YO4A 1FVTA 4ACCA 3GU5A 3C0HA 1WAKA 1BLXA 2IVUA 3M11A 3HRBA 4X21A 2R3NA 3WARA 4GEOA 2E2BA 3RBWA 4IB3A 1JNKA 3PUPA 3BE9A 3O71A 4FV5A 3PSCA 3CXWA 2XIRA 2GMXA 4WNPA 3HMPA 3EH9A 3EFJA 3FQHA 5HX8A 1Y57A 1VZOA 3Q4ZA 4XLVA 1KOBA 3CCNA 5GJFA 3NVMB 3LVPA 2JFMA 2J5FA 3F6XA 4AP7A 3WYYA 2OF2A 3D7TA 2AC3A 5AM6A 2QOCA 3ITZA 3ORTA 4PX6A 3IDCA 3ODYX 4EWHA 2ZV7A 5AAEA 2GS7A 4CSVA 1NVSA 3MPTA 3PVGA 5CSPA 2VTRA 2BALA 2BDFA 3BX5A 5FD2A 4L52A 4TNDA 4L3PA 3IW6A 4YC6A 3TT0A 5LMBA 2IG7A 3Q5IA 1YXSA 3P0MA 3LJ2A 2YIRA 2R3KA 4MAOA 3VBTA 4QTEA 2X4FA 4EHZA 3M1SA 2P2IA 5JFSA 1ATPE 5JKGA 4PUZA 2V7AA 1YXXA 3ACKA 3IGGA 3PXQA 4UXLA 4AFEA 5B2MA 4DGMA 5ETIA 5JFXA 1JKLA 4CGAA 5ACKA 5DBXA 5HESA 4ZSAA 4IWQA 3R1NA 5GIOE 4AW2A 4BIEA 3FLQA 2QOOA 4R1YA 4KWPA 2J0KA 3QZIA 4JDKA 2AC5A 5AUTA 4YC8A 4RC3A 4PTEA 3KRXA 5J95A 3UVQA 3BEGA 5AWMA 3LOKA 4HZRA 4O0TA 3ORNA 3H3CA 4MXOA 3HV4A 5KZ0A 4EK5A 3OXTA 4O82A 2WTDA 3C51A 4EHGA 5AR3A 4LG4A 3VUKA 3SOAA 3Q9WA 1PXLA 5AR2A 4CV9A 3N4UA 2J0MB 2X0GA 4BDGA 2BIYA 5A54A 2C0IA 3EL7A 4S33A 4A06A 5IA3A 3ROCA 5H8GA 3VJOA 4PDYA 2W4OA 3KY2A 1PMUA 4IE9A 2PSQA 4BZOA 4F6WA 4AN3A 5EM5A 3DY7A 4R7BA 5CSXA 4L67A 4O86A 1JSUA 2WOTA 2P2HA 2YWPA 2JAMA 2OICA 2QG7A 5B7VA 3CP9A 4EH8A 5LWMA 2W05A 2C4GA 3DTWA 4MD8E 4BFMA 4ENXA 1WVWA 5LMAA 5LJJA 1R39A 4O22A 4TYHA 4FSRA 3D15A 3HNGA 3VUGA 5EYDA 2J9MA 4KKHA 3R8UA 4ACDA 5E8SA 3DKCA 5CZHA 1OKVA 1R0PA 5EQEA 1I44A 3HV3A 4F7NA 2XNBA 4D5KA 4L45A 5BMSA 4QOXA 1OITA 4KS8A 5E90A 4BC6A 5A46A 2UV2A 2UW6A 5IQDA 4UEUA 2ETRA 3ORPA 4GRBA 3B2TA 3F5XA 1BL6A 1VYZA 4IAIA 5AV0A 3WBLA 1BL7A 4HVIA 3U54A 2X9FA 3P4KA 2XNOA 4FTMA 2WPAA 4F7JA 3PJ8A 4IDVA 3V8SA 4ZJIA 3WILA 4NJ3A 5CVFA 2R3GA 4XG8A 4U41A 4FTJA 3BIZA 3FXWA 2CNVA 2I40A 1W84A 3SXFA 3KA0A 1XJDA 3VBQA 4DEHA 2HZNA 5DGZA 2B9IA 2QHNA 1KE9A 4O0YA 4Y72A 2YDIA 3V8TA 3U6IA 1PXOA 5CI6A 5DWRA 5JZNA 2PL0A 3VUMA 2JIUA 3OWKA 3HKOA 2UZLA 1ZWSA 4YZCA 3OVVA 1Q97A 5LCKA 5AAGA 5ICPA 3TKIA 4PTGA 4CT1A 4QP1A 3LIJA 3GQLA 3CJFA 3ODZX 5AP7A 2OSCA 2UZOA 2F9GA 4D0XA 3TNHA 1KE6A 4R5SA 3UYTA 3A7JA 3EOCA 3QX4A 3TIYA 4DT9A 3EKKA 3REPA 5KKRB 5C4LA 3MV5A 4DLIA 3JUHA 4UYAA 3RCJA 1PY5A 4F09A 4L8MA 4D58A 4ZLYA 1MUOA 2YM8A 3ENMA 4DINA 5JH6A 2R9SA 4FV1A 1U46A 2PY3A 1OL1A 3QQLA 5FP5A 4A4OA 3WZKA 4NM3A 5IDNA 3V5QA 3FXZA 3LW0A 3BZ3A 3BU3A 4BY9E 3HA8A 3QD4A 3ZZWA 2OKRA 2WMRA 4U81A 2GSFA 3ZFMA 4TWCA 4ZSGA 3EN6A 3NIEA 3R9RA 3NGAA 4LL5A 4RIWA 4EOKA 2QQ7A 2F49A 1QL6A 3K54A 5KX8A 4EKLA 1LUFA 2QOIA 2PPQA 2UZDA 2VX0A 5BNJA 3QQFA 3N9XA 3R02A 4EOOA 2O0UA 3IS5A 2JKMA 4FKJA 4ZP5A 3S3IA 3KFAA 5I5ZA 2R2PA 3KXNA 2G2IA 5IMEA 5CWZA 3CR0A 2C5XA 4D2WA 2JDRA 3F9NA 3UO5A 3UZRA 4KIOA 4FV0A 1GIJA 1HOWA 2WQBA 4BWXA 4CEGA 4YZDA 5LMKC 2OI4X 4G9RA 1GZOA 3KULA 4L01A 4EORA 2B55A 2BIKB 5AUWA 2RIOA 3DGKA 4G34A 5FDXA 3BV3A 2WB8A 1QPEA 4L42A 3P5KA 3UC4A 3VRYA 3D5XA 3FZRA 3LFNA 3MTFA 4D2RA 3A7GA 4O7LA 4KIKB 4DFYA 2OZAB 4J97A 4FSMA 3W2RA 4HGLA 4UMUA 3CD8A 3ELJA 2WQNA 5EI8A 5FEEA 4BCKA 2BR1A 4C4IA 4D55A 1F0QA 4TYJA 4C2WA 3OS3A 3PIZA 5M57A 4PP9A 5BPYA 4O1PA 3R22A 4JRNA 4EHEA 2WMSA 2J0IA 4P2KA 5ANKA 3C5IA 2X1NA 4RWLA 4CFFA 4KBKA 3TZ7A 2YM7A 1MRVA 4IXPA 3ZS5A 4OAUC 4WNKA 3TZMA 4ZOGA 3E93A 1OPJA 2P4IA 1WBNA 3I6UA 3V04A 4V01A 2W1IA 4E20A 2IZTA 1GY3A 1OKYA 4FX3A 4RA5A 4O2ZA 2XM8A 4BL1A 4IVAA 3DJ7A 1S9JA 3WF9A 3ZRMA 4C4HA 1P4OA 2X4ZA 2BILB 1XR1A 2HAKA 3FQEA 3NUNA 4C34A 4E6CA 5AV4A 4JNWA 2I0VA 3LLAA 1UU8A 5J8IA 5CAQA 4I21A 4EYJA 1JSTA 4RJ8A 3ZRLA 1FINA 4CFMA 1WBTA 3HA6A 4FKRA 4I5HA 4ASEA 2C6EA 3NW7A 5CLPA 5DR6A 5HEZA 2Y4PA 4XS2A 4CMTA 3QQGA 3AGMA 3BI6A 2HZIA 3FSKA 4N6ZA 3KK8A 1A06A 3CY3A 4D4RA 2QOBA 5EYCA 3OBGA 4JBVA 1PMVA 3FI4A 3K5UA 2XIYA 3N51A 3PXFA 3ERKA 4AE9A 3SLSA 5HBJA 4U6RA 3FI2A 5CU2A 5AX9A 4O21A 3JR1A 3LCTA 2ZJWA 3RPYA 2ZVAA 5CAVA 1U4DA 4D4SA 4RJ7A 1OL6A 3MBLA 4QTBA 3UGCA 2VTIA 3CTJA 5I0BA 2QODA 2B54A 2YA9A 3NYVA 5FWKK 3GU7A 3FL4A 4KA3A 5AUZA 3MH2A 3EHAA 4WRSA 3FY2A 2Z7SA 5IUIA 3EQPA 5HVYA 5E8UA 1YQJA 3BYOA 1ZYLA 3CKXA 4UY9A 4DCAA 3IO7A 4IX5A 4CG8A 4D2SA 3ORXA 4Z9LA 2O2UA 3V5JA 3QL8A 2WU6A 3QX2A 4AWIA 2UW4A 4GW8A 3FPMA 5FLFA 3VWAA 4BCNA 3PXZA 2ACXA 1ZYJA 3FI8A 3D7TB 2XJ1A 4PV0A 2BCJA 5IG1A 3SKCA 4RFMA 1PF8A 3R2BA 3VW6A 3TACA 5M4FA 2AYPA 4KS7A 2E9OA 4D1ZA 1CSNA 1VEBA 4XOZA 1EH4A 5LWNA 3F66A 2JBPA 5FM2A 4QMSA 3GUBA 1DS5A 4Y5HA 4BCIA 3SVVA 5EQYA 2B4SB 3UJGA 3B2WA 5EHYA 4GS6A 1H08A 1B38A 4QMMA 3A2CA 4G5JA 3F5UA 3QTXA 3R00A 4P7EA 4O6EA 3RKBA 3UBDA 4F9CA 3ID6C 4YGAA 3BHTA 4YLLA 3ZOSA 1RQQA 4FSYA 3FYKX 4IHPA 3PPJA 4RLKA 4O81A 3AMBA 5HVJA 2CMWA 4MF0A 5CVHA 5HU9A 2XNEA 4ANSA 4LUDA 4O7YA 3QZGA 4BTFA 3VBXA 3PIXA 3V3VA 4EWQA 1KWPA 5C8KA 2X6EA 2OK1A 5CY3A 3A62A 4C57A 2XK3A 2IVVA 5AEPA 3VQUA 4NFNA 4QP6A 1J91A 4ANMA 3PLSA 3CE3A 4BKZA 2OLCA 3FUPA 5E8YA 4GMYA 3FKOA 1PHKA 3KQ7A 5LQFA 4JG7A 4BHNA 1Y6BA 3G5DA 1H24A 4IB5A 4LOOA 5EI2A 3ORLA 2FYSA 4DGOA 3SXRA 5K9IA 5E4HA 4IWDA 3V5PA 1UVRA 2FH9A 2A0CX 2ERZE 3KK9A 3PJ1A 3A7HA 4MQ1A 2EU9A 4UWYA 3KF7A 5LVNA 3JY9A 3ZSGA 3GC8A 3O7LD 4TYHB 5CSWA 1W8CA 2YJSA 2ZDTA 3NDMA 1ZAOA 2ZM3A 2HY0A 4QPSA 4A07A 4F6UA 4EC8A 3RHXA 3CTQA 3BHYA 3MPMA 4RX9A 1SNXA 4X2KA 3KC3A 2PULA 2VTOA 3PSDA 5BVEA 1W82A 4F99A 1TQIA 4BDBA 4J52A 1SYKA 1UNHA 3R21A 4BDDA 5E8ZA 2YZAA 4IADA 5AAFA 3Q32A 3H0ZA 2J90A 5H2UA 3R83A 3HX4A 2XP2A 4GUBA 4C38A 3L9MA 4RG0A 1XBCA 4YJQA 3AC2A 4IAAA 1Q3WA 3QGWA 3R9NA 1KE5A 3TWJA 3W8QA 3PE1A 4A9RA 3LXNA 4DC2A 5E1EA 5LMKA 4QNAA 2J7TA 2J6MA 2G15A 2ZMDA 3FZTA 4J7BA 3RVGA 2X8DA 3RAWA 5L2IA 3DV3A 5L8LA 3AQVA 2UW7A 4JG6A 5HE0A 5F9EA 4EC9A 2V55A 3FMMA 3TNPC 2XNGA 4C4JA 4TZRA 2QR7A 5HLPA 3ZEWA 5AR7A 2BTRA 2J0JA 2XK8A 4LV8A 2CN5A 4DH1A 2IZRA 4NKAA 4DH3A 3HRFA 4YZMA 1GZ8A 3QYZA 4AA5A 4PPBA 2ZB1A 4UMQA 5JSMA 2Y0AA 3FZOA 4ASXA 4EH9A 4FKGA 3NX8A 3UQCA 2EXEA 2R7IA 3ROYA 3WZUA 3BGZA 1Q24A 4AE6A 1JWHA 4WBOA 2BDJA 5TOZA 4S31A 4S30A 1XH8A 3VULA 4J53A 5AIRA 3VQHA 3SQQA 3FPQA 2GTMA 2PVMA 4KB8A 2O64A 4IC7A 4DN5A 3KXXA 4APCA 3BE2A 4FVQA 4HW7A 3BEAA 4XHKB 5C01A 4IFCA 5CT0A 2CKPA 2WTJA 3EWHA 3NNWA 5EOLA 1IA9A 3VRZA 2W1HA 4E5WA 4F9AA 4FGRA 3AG9A 4JXFA 4E6DA 5HLWA 4IJPA 3P7BA 3ZC6A 3QTWA 4I23A 1KOAA 3R04A 2VTAA 3LQ5A 4JDIA 3FE3A 3Q3BA 1DM2A 2J0LA 1KE8A 5KMJA 5IF1A 5KMIA 3PY0A 4PQNA 5BVNA 3LLTA 4FOCA 5M53A 5IQGA 1UNLA 3F2NA 1SNUA 3ANRA 1GZNA 1FMKA 1HCLA 3QLFA 1QCFA 4AG8A 4Z16A 5IH6A 1TQPA 5JQ5A 4JDHA 4CXAA 5BVDA 4LYNA 5FQDC 2R3OA 4DFBA 3KULB 4FNYA 3I0OA 1R78A 3ZXTA 2Z02A 1K9AA 2R5TA 3I4BA 2HZ4A 3MESA 2FSMX 3G6GA 3COHA 4X6RA 1ZRZA 2YABA 4J1RA 4W4XA 1O6KA 4G6LA 4J8NA 5EM7A 3C4CA 3EFKA 3GXLA 1NA7A 2GNLA 2GHMA 3Q9XA 4H39A 3S0OA 3O23A 2VWUA 5AP0A 4R78A 4AOIA 5CEOA 1OUYA 4K8AA 2IW8A 1CM8A 4XJ0A 3NS9A 5KHWA 2V0DA 3OZ6A 1YOJA 5FXQA 1PRYA 1P14A 4QPMA 2GNFA 3QZFA 4BWPA 5GIPE 4DH5A 2FGIA 3QTZA 4UB7A 4M0YA 2EB2A 4JI9A 1Q3DA 5KCVA 4OUCA 5JZJA 3RNYA 4XG3A 4KIQA 3ZM9A 4IVCA 2IW6A 4RVMA 3SOCA 5L3AA 2W1FA 4KKEA 4G6OA 3ALNA 3RAIA 2GHLA 2CGWA 3C0GA 4FVRA 1YHSA 4EH6A 5AP2A 2XB7A 3HZTA 4IFGA 5C27A 3ZO1A 4ZLOA 4C33A 3KXZA 4HNIA 3JYAA 4RIYA 3IDBA 3VAPA 4FT5A 3WF6A 3CSVA 3R30A 4RIXA 4ACHA 3CEKA 4WSQA 1H27A 2YIXA 5FXRA 2Y6OA 3LJ1A 4FIIA 3QYWA 4RVTA 5HO6A 1JKTA 1OBGA 2OF4A 2GNIA 4EHVA 2YITA 3ZSHA 2YLFA 3DKOA 2ZOQA 3UP2A 4UZHA 4E3CA 3CPBA 1ND4A 5J7BA 4P5QA 2QOHA 3RZFA 5EW3A 4N57A 2QLQA 1H1PA 3PP0A 3OT3A 1AGWA 4MCVA 4TKSA 5K0XA 5DT0A 3ZZEA 1U54B 4QMOA 4W4WA 2CGXA 5T6KA 4FV3A 3DTCA 4DFUA 5C8MA 3ORKA 2OIQA 5TE0A 2JKQA 3MA6A 3OEZA 4D28A 5K5NA 3PPKA 5AMNA 3BELA 4L9IA 4O84A 4L7SA 4MNFA 5TR6A 3RTPA 5ETCA 3A99A 4HYUA 5E8WA 2CHLA 3II5A 2VTJA 1TKIA 2WQEA 4C0TA 5DN3A 2RFNA 3DU8A 4GK3A 2RKUA 4D5HA 3K2LA 2X6DA 4JDJA 4QMNA 1XBAA 2YCSA 4IX6A 1G8AA 3LFQA 2P3GX 3POOA 3QHWA 4YSMA 5FBOA 1WZYA 1CKIA 4ZTLA 5JRQA 4AA4A 4EZ5A 3BU6A 4ORKA 3H9FA 1XH4A 2VV9A 4MF1A 3D94A 3DDQA 5DNRA 4RX5A 3DQXA 1IRKA 4FZ6A 1O6YA 1OL7A 5E8XA 4L3JA 4USFA 4NEUA 4WG5A 4NU1A 3N4VA 1YWRA 3ZLYA 2FUMA 1OPLA 3B8QA 4M13A 2B7AA 3DXNA 4GU9A 2G2HA 2W1EA 4USDA 5DR9A 5J5SA 4FTOA 2WIPA 4CKRA 3RALA 5HTBA 2JD5A 2YIWA 4AT4A 3NRMA 4M12A 4CCBA 4FZAB 3S1HA 3LM5A 3RPSA 5CAUA 4DH8A 4HVSA 4FUYA 4AT5A 4GFGA 4OAVB 4MD7E 2OJ9A 3OD6X 4R5YA 5B2LA 3LE6A 3FZPA 1UV5A 2VGPA 4BTKA 1DAWA 3PZEA 1M14A 4QQCA 2GTNA 4E93A 2WMUA 4MEDA 4OTFA 5C26A 3HAMA 4TNBA 1XBBA 2Z7RA 3MS9A 5J7HA 2NO3A 5AP5A 2XK7A 1Q61A 1B6CB 2WMQA 3RK9A 3UZPA 4Y73A 3O17A 4PDSA 4LM5A 4BCPA 1PXKA 5FEDA 4ZZNA 5L2SA 1UU3A 3QALE 3R71A 4G17A 4AX8A 3RAHA 3QRTA 2CGVA 5HLNA 4ARKA 1TVOA 2B9HA 3JXWA 4JJRA 3KRJA 4G1WA 4YTIA 3ZBFA 4O0VA 2H96A 3R7EA 4CV8A 1XH9A 3GC9A 1ZYDA 3Q04A 3QFVA 2QOFA 3VS4A 4MXYA 3QLGA 4F7LA 4CKJA 3V8WA 3ZSIA 3QKMA 3NUPA 2VN9A 5EFQA 1TQMA 1R3CA 4FKIA 4C7TA 3BCEA 2YISA 3MIYA 4FIEA 3ZO3A 4CT2A 3EZRA 3KCFA 3A4PA 5JRSA 4OTIA 3U9CA 4F63A 4BGQA 4BDCA 4O7RA 4QYHA 2VTLA 1IA8A 3UMWA 3VN9A 3PG3A 4UMTA 2QLUA 3DA6A 4WHZA 3I7BA 1PXMA 2X7OA 4AQCA 4C4GA 2OGVA 3OTVA 3UP7A 4HVHA 5IEXA 4E26A 2YM3A 4FSUA 4D9TA 5J9YA 1H07A 4OLIA 4ALWA 2Y6MA 5M09A 2OJFE 2YCQA 4RWKA 4DH7A 5K3YA 4JT3A 4RVLA 4EH5A 4XV1A 4C3PA 4XG4A 2HYYA 5DI1A 3BQRA 3IECA 4IAFA 2JGZA 3A8WA 4G6NA 3ZXZA 3U4UA 3H0YA 3FDNA 3PYYA 3OOMA 5CVGA 4RC2A 5EHLA 5HOAA 4BKJA 4JAJA 4CZYB 4DFLA 4OGRA 2HIWA 3R7OA 4DCEA 2B53A 5J9ZA 4FEQA 3NW5A 5DA3A 4YURA 2CN8A 4YNEA 2VNYA 3MB7A 3MTLA 2R64A 4E4NA 3EL8A 1CTPE 4NTTA 3R7YA 3TKUA 4AACA 3NVKI 3PSBA 3I7CA 1ZMUA 3OXZA 5ETAA 3O51A 3OMVA 3W16A 4YTHA 4AN2A 2BZKB 3OOGA 5A4QA 4FKVA 4I6HA 4RPVA 5H8EA 1OKWA 3RAKA 5KMMA 5FBNC 4I4FA 2A4LA 3F61A 3ORIA 2HENA 2VTMA 2UW8A 3KXHA 5BX0A 5HNGA 1BYGA 2P0CA 3OW4A 4F1MA 2HXQA 4PPAA 4BGHA 4CMUA 3EB0A 3RCDA 4L7FA 5BVOA 3DJ5A 4AGWA 2FSOX 2I6LA 2KTYA 3NNVA 4O0UA 5CF4A 4ID7A 3SA0A 2VUWA 4EK8A 1RE8A 4I94A 4O96A 4L00A 2PUUA 5AR4A 3OFMA 4IB0A 4CQEA 5CALA 2ZM1A 4HGEA 5HIBA 3CTHA 2IN6A 2BKKA 2EXCX 3MVJA 4NTSA 1YKRA 3NZ0A 4QMPA 4DT8A 4LRMA 3PXRA 3MFUA 4FV7A 3UE4A 3SXSA 3RHKA 4FTTA 1U5RA 4LOQA 3E8CA 4HJOA 5HCYA 2XM9A 5IA5A 4H3PA 4GIIA 4RFZA 4XV9A 4NL0A 2CKQA 3FLNC 3F3VA 4JQEA 4OTWA 4B8MA 3MWUA 2BTSA 1OKZA 3BGPA 3D5UA 3MI9A 2W5HA 4FTUA 3DKGA 4YTCA 4FG9A 3C4EA 2IJMA 3F5PA 4RJ3A 5E91A 4EZ3A 3LMGA 3QD0A 5CEKA 4S32A 5GINE 3I5NA 4RC4A 2BZJA 2VU3A 3ZCLA 3NUYA 4GCJA 3NYXA 5CF6A 4J99A 3WZEA 1X8BA 4MBIA 3GEQA 4EH7A 2RSVA 4WD5A 1M17A 4F0IA 5C9CA 1IAHA 2J51A 4DG3E 5IQIA 5ANIA 4BZDA 3QZHA 2X2LA 4WA9A 5DH3A 4JVGA 2GS2A 4FG7A 3VHKA 5LXMA 4W9WA 1NT2A 2I0YA 3I60A 4C35A 5DT3A 1CDKA 1LP4A 5L2WA 3IONA 4JIAA 1XH5A 3D2KA 4MXCA 4PL5A 4XOYA 3G0FA 3DB8A 5FP6A 4CRLA 4FSNA 3PP1A 4W9XA 2ZV9A 3VUDA 2GQSA 1YI6A 2XKCA 4X3FC 4XBRA 2WNTA 4XMOA 1H01A 4FV2A 4U0IA 5KMLA 2PTKA 3MB6A 4V05A 4G2FA 4YJRA 5IU2A 2ZM4A 1UKHA 1W7HA 3G6HA 3OEFX 3CD3A 3QTUA 3FMHA 4MBLA 2F2UA 1XHAA 4TYIA 3ZUTA 3RM7A 1GNGA 5T68A 2DWBA 2X7GA 3ZONA 3FEGA 1HCKA 4GG7A 5IA0A 1QPJA 3LFCA 3PTGA 4FC0A 5EH0A 3UO6A 3O8TA 5ANOA 3R9OA 4E5AX 4TN6A 3QRIA 4F9YA 3VS3A 4X7QA 3PIYA 2UZUE 2OXXA 4EOQA 2V22A 2C6LA 3DT1A 3FWQA 4RIYB 3OUNB 1PMNA 1JLUE 2VTHA 1OIYA 2W4KA 3WZDA 3AD6A 4LL0A 4QT1A 3VNTA 2OIDA 4QP3A 5BMMA 3GU8A 2VAGA 3R0TA 3WF8A 3GC7A 4B99A 3D14A 4FKOA 2GHGA 4TTHB 4UXQA 2PE2A 4JG8A 3VS5A 3V5LA 2PMIA 3F2AA 1H0WA 3GBZA 1NVQA 3NIZA 4FKTA 2YM5A 2YM6A 3W2CA 4CRSA 3QA8A 5FG8A 3AC4A 3P7AA 1FOTA 3UIUA 3POZA 3R7UA 4ZEGA 5IEYA 3LQ8A 2V5QA 4IZ5A 3F82A 5HORA 5IPJA 3EN9A 4QMWA 4MNEA 3BWFA 2VX1A 3EQRA 2FVDA 4NKSA 3LCDA 3JVRA 3DBFA 4I4EA 2PZRA 3SX9A 3I6WA 5DYJA 3D5VA 1UU7A 3R1SA 4PPCA 4U80A 3E63A 4XNEA 3TG1A 3GCUA 3D0EA 4V0GA 4ASZA 3E3PA 4FR4A 3T3VA 3UTOA 3KB7A 5E8VA 5HG8A 4WUAA 2VX3A 1V0OA 3BYMA 4XG7A 5CSVA 5I9VA 4ASDA 5I4NA 2I0HA 4IX3A 3U4WA 4ERWA 4BI1A 3C13A 4CD0A 3AC5A 4M8TA 4DE4A 3PZHA 5DMZA 2R3MA 5AUYA 5HO8A 1IG1A 2PZYA 3IGOA 4CMOA 4IM3A 3P1AA 4X2NA 5JMSA 4KRCA 4TXCA 1OB3A 5H9BA 3SGCA 4C2VA 2FSTX 2YZLA 3CPCA 5JFWA 4RJ6A 3RMFA 1E9HA 1Q8ZA 3MH1A 2Y8OA 4YZNA 2O8YA 3Q9YA 5DT4A 2UW0A 3EN4A 3DZQA 5HE2A 3ZMMA 3CKWA 4AGUA 4FL1A 2ETKA 5GJDA 3P78A 3G33A 3NUSA 2C0OA 4A9TA 4IM2A 2J2IB 3GCQA 1KV2A 3HMNA 5AV2A 4FTRA 4IJ9A 4JLCA 3NYNA 4NM0A 5C03A 4FV6A 4I1ZA 1Z57A 3L9LA 4YHFA 4ANLA 4EUTA 2X81A 1P2AA 1KUTA 4IB1A 5C4KA 3QCXA 3G90X 4A4LA 3QRUA 4UWCA 4BIDA 2WIHA 4ZS0A 2HELA 3EQBA 4HPTE 1H4LA 3ZDIA 1FPUA 2UZWE 4QTAA 4H1MA 2BAKA 3ZHPC 2GPHA 3ZUUA 5EW9A 3HMMA 3MVMA 4FIJA 2WTKB 5I9WA 5D10A 4W8DA 3HP5A 4IWOA 5IQBA 2VWWA 2F4JA 2ITNA 3RI1A 4RWIA 4F1OA 4OTDA 5EOBA 3W2PA 1WBVA 4O91A 3MFTA 2JAVA 4NIFA 4TWOA 5EM8A 4FIGA 3ZFXA 3FMJA 3G15A 3MFRA 3WF7A 5GJGA 5HD4A 4JL9A 4WSYA 1AD5A 2WELA 4QTDA 4OBPA 3NMUF 4F65A 1KE7A 4UMRA 3A7IA 4YUQA 1Q99A 2VWZA 4QMYA 3MY1A 4YJTA 3O50A 3NUXA 4OR5A 3GT8A 5DE2A 3BBTB 3O0GA 3NCGA 3PA4A 3OCBA 5HCZA 4IDTA 3OUKA 5B2KA 2UW3A 4NCTC 4PF4A 1W98A 4M97A 4XG2A 1OVEA 1LPUA 4IMYA 4ANBA 3R1YA 4Y46A 4BDEA 2C6OA 1OBDA 4FIHA 4D0WA 5HD7A 2JEDA 2KULA 4JRVA 4IWPA 3I5ZA 4YBKA 2C6KA 4NUSA 5CU6A 4RJ4A 3AMYA 3UOHA 4NFMA 5BYLA 4FTCA 3BQCA 3NCZA 2P55A 3C4XA 4R3PA 4CYIA 4C3FA 5CEMA 4YZBA 5ITAA 4ZZOA 3R63A 2BHEA 1JBPE 3L9NA 3O7LB 5M07A 2RFSA 3TCPA 3TZ9A 5CAOA 3WF5A 2W1ZA 3FLWA 1ZOGA 2HOGA 3MW1A 5A4CA 4L3LA 2GCDA 5CZIA 2XUUA 2B9JA 1E1XA 3R9HA 3WI6A 4FZ7A 3R8LA 4ZJVA 2CNUA 4D1SA 5KMOA 5I3OA 3IW5A 5TKDA 4ZSJA 3VS0A 2ITUA 3GQIA 3ZFYA 2QU5A 4ANOA 4F08A 2YACA 4A9SA 1YW2A 3UNJA 3V51A 4X3FA 3RPVA 3QRJA 3LCKA 5D12A 4MXZA 2PMOX 2VTQA 2XRWA 3HLLA 4U40A 5GNKA 4AOTA 3L8PA 5IDPA 5M4CA 2JITA 3H4JA 4O1OA 5IQAA 3OCSA 1YHVA 2BHHA 4G3EA 4HCTA 1M2RA 5AJQA 2XRUA 4MVFA 2EXMA 2WQOA 4ZSLA 1Y8YA 2UVZA 4IW0A 4NM7A 4TPTA 4ALUA 2CCHA 2XNPA 3MVHA 2UW9A 3KL8A 1M2PA 2FO0A 2RGPA 4S34A 4O7NA 4UWBA 4LUEA 3TNQB 1Q41A 4BBMA 3IK3A 2ITQA 3K3JA 1MP8A 1R1WA 3Q2JA 1B39A 4FSZA 1ZYSA 4FVPA 5ACBC 3EYHA 2FA2A 2JDVA 3RJCA 2XJ2A 4BCJA 4WT6A 5IQCA 4DF3A 4TY1A 4R8QA 4DFXE 4KNBA 1YWVA 3QD2B 4GVJA 5JT2A 1LEZA 3QCSA 4OT6A 1WBWA 4XH6A 1BUHA 2IZSA 4GK2A 4N0SA 4DAWA 3VVHA 4TL0A 4X2FA 5DRBA 5CXZA 2F2CB 1UU9A 4ITHA 4W8EA 2X2MA 4RX8A 3UOJA 4IX4A 3VHEA 3ZUVA 3VUTA 2G9XA 4B8LA 3VS1A 1ZZLA 4EQCA 2PZIA 4L6QA 3PWDA 4MX9A 1PXPA 2YIQA 5A14A 4C37A 2HXLA 1A48A 5AUVA 5HBEA 4Q9SA 4RFYA 4YHJA 2XK4A 3Q4CA 2VNWA 4P4CA 1JAMA 1XH7A 1Y6AA 5CU3A 4C61A 1G3NA 3DAJA 4EK3A 1GJOA 5E9EA 3NNXA 2YN8A 4BWKA 2CKEA 3R8ZA 1SVGA 2BRMA 3ZM4A 3R73A 1NXKA 2ESMA 3D2IA 5AM7A 3HMIA 3JS2A 4NK9A 3QQHA 4XRJA 3IOPA 3SHEA 4DBXA 5EHOA 3UIBA 4O7ZA 3H10A 4F70A 3IDPA 3OP5A 3TNIA 4D1XA 3NUAA 4HCVA 4LQMA 4IM0A 1CKJA 4CFXA 1H1QA 3GOKA 4QPAA 5L4QA 4KKGA 3DLZA 4NJDA 3DBDA 5AUXA 3VS2A 4F64A 2PUIA 4BGGA 3GFWA 2OXYA 5CAPA 4W4YA 3F7WA 2BRHA 4HYIA 5BYZA 3ZO2A 5C1QB 5HI2A 3PJ3A 5HIEA 2WFYA 4U7ZA 5FUTA 3RK7A 2QCSA 4FKLA 3BLRA 4RMZA 1FGIA 3C50A 2PZ5A 4IC8A 1M52A 2W99B 3WZJA 4BICA 4EOMA 5K5XA 4E8AA 5HG9A 3Q6WA 4IVDA 4KSQA 4U43A 3VF9A 3QUPA 1ZMWA 3CQWA 4FSWA 5I3RA 3Q5ZA 4GJ2A 4BR3A 4BDAA 3FMKA 4FBXA 4GV1A 4TW9A 4BCMA 4E73A 3UG2A 4A9YA 4RIWB 5BUIA 3W55A 4F7SA 3QA0A 4CZTA 3OWLA 5LARA 5I9YA 3A60A 3I1AA 5IZFA 5JEBA 3QTIA 4DTKA 2XEYA 4XLIA 2ZYBA 3GU6A 1I09A 3VUHA 5TT7A 1ZLTA 2H9VA 2WTVA 3P7CA 2IW9A 3VF8A 2YAKA 4X0MA 3DXPA 2XIZA 3BV2A 4MNEB 4H58A 3KGAA 2W17A 3ACJA 5CQWA 3PDTA 4CZUA 3QC9A 3PXKA 3FI3A 4GSBA 3MGYA 2O3PA 3QUDA 4IZYA 4GKHA 2ONLC 2GNGA 5A9UA 2WTIA 4E4XA 1K2PA 3R01A 3SDJA 4ZTRA 1YI4A 2QR8A 2RF9A 3PFQA 3VO3A 4C4FA 2QU6A 2YDKA 1WBPA 3MJ2A 4UBAA 5LVMA 3UPXA 2XYUA 3EQCA 3QU0A 4A7CA 1DI9A 4UX9A 5FRIA 3F7ZA 4LV5A 3MH0A 4M67A 4K0YA 3QKLA 4GL9A 2IPXA 5JN2A 4D9UA 4NCTA 5D7AA 1H0VA 4FNWA 3GOPA 4K1BA 2DUVA 3PJ2A 2OO8X 5EI6A 1ZARA 4LOPA 4RZVA 4TWPA 4R3RA 4PNKA 5L8KA 1YVJA 2BMCA 5D9HA 3PE2A 3DNEA 4IIRA 4O0SA 4TT7A 3TN8A 3FJQE 5KMKA 5CENA 2VWVA 2YAAA 2QVSE 4C59A 4QMQA 1OIRA 4U5JA 3TM0A 2X7FA 2W96B 2XK9A 3FSFA 4FICA 3F2RA 1H26A 3AGLA 3HGKA 4OT5A 4WG4A 3KKVA 4M69A 5HIDA 4FOBA 5C8NA 3DB6A 4H05A 4NH1A 4PRJA 4X2JA 4GT3A 4EONA 3PWYA 2ZV2A 3V01A 4TRLA 4XEYA 2PUNA 2QKWB 3ANQA 3HMOA 3HV5A 2WMBA 3MYGA 4Y85A 5KMNA 1M7QA 3FBVA 3LCOA 4DTAA 2VO0A 1ERKA 3F3WA 4WRGA 2QC6A 3OXIA 3WE4A 4O7TA 3VS6A 1VR2A 2XKFA 4ACMA 4DITA 4XCUA 1YI3A 4G3GA 4QMLA 4FEVA 3H30A 4NW6A 5A4LA 1FGKA 3C4FA 2XCHA 4Y8DA 3FZ1A 4G3DA 5CF5A 4I3ZA 4BI2A 4ZIMA 1OZ1A 3U6HA 3EYGA 2WMTA 3OBJA 4U8ZA 2B0QA 1J1CA 1K3AA 4KUJA 1YHWA 2BRBA 3D9VA 3OCGA 4Y5QA 1PXIA 4QMXA 3HAVA 4HVGA 1Y8GA 4QYGA 5CEIA 4BF2A 1AQ1A 1YWNA 2J50A 4U44A 1WVXA 4Q2AA 3L8XA 3ORZA 4DEEA 3QKKA 3WIGA 4AUAA 3FV8A 2YIYA 3GCVA 1URCA 3LXKA 3TJDA 4B0GA 4MKCA 3E7OA 1FBNA 3SG9A 2JDOA 4I41A 4FL3A 4R7HA 5IA2A 5JGBA 5CEPA 2R0IA 2A27A 1YOMA 5AR8A 2A19B 2R0UA 3SRVA 4BTJA 3TTIA 1NW1A 3UG1A 2Q0BA 4UYNA 5EKOA 5GZ8A 4CTCA 2BAJA 4QYFA 2W9FB 3VC4A 3KXGA 3NYOA 5AUUA 3BHHA 2PE0A 4I0TA 3DLSA 3THBA 2IO6A 2WXVA 4O6LA 4E4MA 3PG1A 3IW8A 4AW5A 3G9LX 2HW6A 4MWHA 4RIOA 4J98A 4I0SA 3JVSA 5DHJA 3ZO4A 4FZDB 1OIQA 5M55A 4FYNA 4D2PA 4PL4A 3CJGA 4RQVA 4EK6A 3AC8A 5FGKA 4KABA 4YJPA 5KUPA 4KSPA 4KIKA 4UALA 1GIIA 4HYHA 4CG9A 1WMKA 1PYEA 3QQJA 4M0ZA 3UO4A 1DAYA 4OTQA 4DEGA 3TL8A 4EQUA 5AADA 1PMEA 2CLQA 2UZTA 4RX7A 3G2FA 1RJBA 4X3FB 1U5QA 3TKHA 3C5UA 4K6ZA 4BBFA 4I22A 5KE0A 3CQEA 1URWA 2PVHA 4FTKA 4N70A 2XK6A 2HWOA 5D7VA 2PVLA 3UOLA 5LVPA 3BHUA 2JIIA 2XIXA 3RWPA 3DKFA 3E8EA 4D2TA 4FT9A 4O2PA 4Q5HA 1REJA 3W18A 5CASA 1LR4A 3P9JA 3UVRA 2ITOA 4ONAA 3KMMA 4XP3A 2CDZA 3LXLA 5KHXA 2PVNA 4O0XA 5KBRA 3MDYA 4J96A 5L6WL 2X8EA 3RWQA 2GQRA 3BLHA 3QUEA 4P90A 3HDMA 3L1SA 5DEYA 4AW1A 4ENYA 2WTCA 3NW6A 4APPA 2C5NA 2UZNA 4IAYA 3DK6A 3QWKA 3F5GA 2WKMA 4XX9A 4BDJA 1W83A 5CNOA 3VJNA 1H28A 1NVRA 3DBQA 3R6XA 4D4YA 4ANNA 2C5OA 3TV4A 3NAYA 4FGBA 3H9OA 4O0RA 2PHKA 3LFSA 3NSZA 4FF8A 3GI3A 4PMPA 4FT0A 2WGJA 2XBAA 4NYEA 4O7VA 3SG8A 3VBVA 1IEPA 5FDPA 5L6PA 4KIPA 4TWNA 4JAIA 3HVCA 3QCYA 4AFJA 1YDSE 5M08A 4DEIA 5H8BA 3UMXA 4JX7A 5HU3A 3LFFA 3QGYA 2WZJA 5HICA 4B9DA 2NNWB 3QTQA 2V7OA 3QCQA 3R7VA 2W1DA 1T46A 1H25A 3GU4A 2YWVA 3W2QA 2OXDA 3FMEA 2CNQA 2Z2WA 3F3UA 4MQ2A 2A2AA 2ITYA 2XH5A 2ONLA 3D4QA 2A1AB 2VWBA 1GIHA 4PMTA 4BKYA 4YJNA 5AFVA 3NUUA 2UVXA 4DGGA 2BROA 4FKPA 4ZY6A 1MQBA 2W1GA 4F1TA 4R77A 4ZXTA 4MBJA 4YPDA 3VS7A 2ZMCA 4FTNA 4XRLA 1GZKA 4JOAA 1YDTE 2ZB0A 3Q96A 4QP8A 3T9IA 3L9PA 4AXAA 4QMVA 3FMLA 2Y4IC 3JPVA 2YHVA 3WYXA 4EUUA 4H3BA 3U9NA 3TDVA 2JKKA 1OUKA 4GKIA 4ITJA 4QTCA 4U79A 3WIKA 4DG0E 2F57A 1PJKA 4WNMA 5M06A 3LFDA 3LJ0A 1Q5KA 4N4SA 3ATSA 4HGTA 1SMHA 2DS1A 1H00A 2WAJA 4FSTA 4G3FA 5EDQA 3ZBXA 4UN0C 1UA2A 3E62A 4R1VA 2C5YA 2OIBA 1OECA 5DOSA 4GYGA 3C1XA 3FY0A 4TYEA 3L8SA 1H8FA 4IACA 3UIXA 4ZTMA 2VWYA 1L3RE 4RBLA 4XP2A 4EK4A 4II5A 4AGDA 4FTLA 5A4EA 1FQ1B 3FC2A 3BU5A 2B9FA 2VGOA 3TJCA 4BCQA 4DYMA 2E9UA 4YU2A 2C3JA 1Q8YA 1F5QA 4DTBA 1SVEA 3DFCB 4RA4A 4MXAA 5EM6A 2YDJA 3WE8A 3R8PA 3ULZA 3Q53A 3T9TA 4ALVA 2QO2A 4YZ9A 1QPCA 1GAGA 4Z3VA 4RZWA 2HW7A 2JDSA 1J1BA 5D11A 4QP4A 4KINA 3UDBA 5HZNA 4BN1A 5JQ8A 4FTIA 4G16A 4IZ7A 4BDKA 3BYVA 4U9AA 5M44A 2XEZA 1H1WA 2QOLA 3R7GA 2C6TA 4BYIA
chains in the Genus database with same CATH superfamily
4GT4A 2FB8A 5AA9A 4B6LA 4JS8A 3HDNA 2WMXA 4YPSA 4AA0A 5CF8A 2PMLX 3C4ZA 4JQ7A 4BRXA 2J4ZA 4FUXA 2R3IA 4L46A 4BDHA 5BYYA 5F94A 5CI7A 4BBEA 3O96A 2C6DA 3GCSA 2CGUA 4IBMA 1JOWB 4M7IA 3UQGA 5EK7A 2E9VA 5AP1A 5K4JA 4KAOA 5KNJA 5CNNA 5DFPA 3CQUA 4BB4A 4MH7A 1YDRE 4WKQA 5J87A 3F3ZA 3R9DA 4CCUA 3ZRKA 4ZZMA 5DEWA 5IISA 5I9ZA 3TI1A 4YJOA 5HTIA 3TTJA 4PP7A 4JMQA 2W0JA 1OPKA 2Y9QA 1SVHA 3C0IA 4JBOA 4LRKA 3UNZA 3AC1A 2PUPA 3KMUA 4YJUA 4QMUA 3ALOA 4U97A 4MWIA 3TUBA 1P4FA 5FM3A 3D7ZA 3EN7A 2YCFA 4PMSA 2JKOA 1FVVA 4EOPA 3AT2A 4HVDA 3F88A 3E92A 4M69B 4BYJA 3DQWA 2C5VA 4OTHA 4XV2A 3T8OA 2ZDUA 5JFVA 4S2ZA 4ZTNA 3DAEA 3LHJA 3PA3A 5TF9A 2RFDA 4YLJA 5L8JA 2R3HA 2XA4A 2VTTA 1SM2A 4IEBA 4JX3A 4G5PA 4A9UA 4UV0A 4AZTA 4B7TA 1WBSA 3GCPA 2ITPA 1PW2A 3A7FA 3EZVA 3PPZA 3CBLA 3Q52A 3RM6A 4C36A 5DR2A 5BV3A 1LEWA 1XO2B 3P23A 4RIXB 4DGNA 1XKKA 3D5WA 4FT7A 4K11A 2OJGA 2BZIB 3VBWA 4QQTA 2IWIA 4AU8A 3COKA 4NT4A 2OJJA 3MJ1A 1QPDA 4MTAA 3IW4A 3KVWA 5FTQA 1BI7A 2QHMA 3E88A 5L2TA 3KRLA 3DBEA 3CS9A 3AXWA 3NPCA 4ZLZA 3UOKA 4ZSEA 2C69A 4OTRA 3RK5A 4Q5EA 4XP0A 4FYOA 1JVPP 4C02A 3BPRA 5BVWA 5LCJA 3V6SA 4Y95A 3R7IA 4AT3A 3O2MA 4M15A 4GJ3A 2BAQA 4IQ6A 4JBPA 3Q4TA 3PLAE 1OL2A 3D83A 1Z5MA 3A8XA 3ZLWA 4AAAA 2F7ZE 3S95A 1JQHA 1OGUA 2W4JA 4ACGA 4CNHA 4O83A 3CY2A 3DJ6A 3SAYA 2CPKE 1KSWA 3PVWA 1JSVA 1BKXA 2R4BA 4QP9A 3PY3A 4FEWA 4KBCA 3NEWA 2VTNA 3RZBA 3ZYAA 2BPMA 5TO8A 3KF4A 4WNOA 3MIAA 3W1FA 2Z7LA 3E87A 2Z60A 3SRVB 4AZEA 5KO1A 5ANEA 5CS6A 5IMXA 2C6MA 5AP6A 1MRYA 4PY1A 4K9YA 4FIFA 4U3ZA 2WMVA 4ITIA 2G2FA 2PVRA 5FXSA 5G6VA 3FKNA 5DG5A 3W0MA 2VO6A 4CYJA 3MN3A 4EJ7A 4EEVA 4RRVA 2WOUA 2RG6A 2YFXA 3OHTA 4HCUA 4PNIA 4IVBA 3EMGA 3E8DA 5L6OA 5KZIA 5AIKA 4F6SA 2C3KA 4P5ZA 2ITZA 3ZEPA 5CEQA 2C0TA 2WMAA 4YHTA 4FI1A 2XJ0A 3QXPA 2UVYA 1O9UA 2GU8A 3DDPA 5E92A 4QMTA 4OTPA 4YTFA 2GDOA 5HKMA 4A4XA 2UZVA 3FAAA 4ZK5A 3Q60A 4XV3A 1WVYA 4ZMFA 4I6QA 1MQ4A 3AT3A 4HYSA 4MK0A 3NFGB 1KV1A 5HVKA 2WO6A 4QQJA 4YLKA 2OWBA 2ZAZA 4Z7GA 1QMZA 5HTCA 3VBYA 3ETAA 3P86A 4IAZA 4IAKA 5BVKA 3I79A 2NRUA 1Y91A 2YM4A 4H36A 2XF0A 5CT7A 4RGJA 4RVKA 4L43A 5AP4A 2WTWA 4NZWB 4CFVA 3GB2A 5M51A 1APME 2C1AA 4E6QA 4MXXA 4X3JA 2JLDA 2G1TA 2WHBA 1F3MC 1PYXA 2J5EA 3EFLA 2JFLA 1OIUA 4O4FA 3KN6A 2X9EA 3O8PA 4K33A 4ZY4A 3NLBA 4GUEA 4CLJA 2QOQA 3MSSA 5HGIA 4J8MA 1J3HA 1O6LA 3BWJA 4C62A 2BDWA 4FZFB 3QWJA 3E5AA 4QP2A 4F9WA 5A6OA 4CFUA 4FK6A 4WG3A 3LFAA 3QC4A 4EH3A 4YSJA 2JIVA 3U87A 3AOXA 5HG7A 3UQFA 4FEXA 4AW0A 3NAXA 4I5MA 1JPAA 1T45A 3FMDA 4RSSA 3Q9ZA 1H1SA 1M7NA 2CJMA 2OH0E 3UC3A 4FSQA 3QAME 5HO7A 5T3QA 4O7SA 3OROA 1TZDA 3FLYA 1G8JA 4DEBA 2B52A 3UODA 2C1BA 4LMUA 3ULIA 5IA4A 1ST4A 3SC1A 5FTGA 4LI5A 5AR5A 2PZPA 3AKKA 2F7EE 3SW4A 1YXVA 2R3FA 3MH3A 3AKLA 3L8VA 4PDOA 3MY5A 4NM5A 3ZC5A 3TUDA 3OWPA 4G9CA 4GFMA 5ANJA 4ZS4A 1Z9XA 2BRNA 3PJCA 1U54A 2VWIA 3IPHA 2Z7QA 2GQGA 3GP0A 3OF0A 3QRKA 5CXHA 4DEAA 3LFEA 3DBCA 3SW7A 3QD3A 2QNJA 3UVPA 2CKOA 3I0QA 3TXOA 3LQ3A 4AN9A 3A4OX 4KBAA 4OW8A 4L44A 3BYSA 3MPAA 3ORMA 2BFYA 1RW8A 4GT5A 3ZDUA 2ERKA 1CMKE 4O27B 3ZLXA 5LVOA 3IW7A 3AC3A 4AXCA 4EOSA 2ITWA 4BVUA 4XG9A 2H34A 2W5AA 2IVSA 4OBOA 2GNJA 5EQPA 4FTAA 4U45A 4C4EA 5J9LA 4I6FA 4D2VA 3NNUA 3FC1X 3OY3A 3LCSA 4R3CA 2C47A 1Q4LA 2ITXA 2R7BA 3IG7A 4NWMA 4LMNA 5F1ZA 5CU0A 3OTUA 4U42A 5M4IA 3DPKA 3LMHA 5A6NA 4QNYA 4D4VA 4HGSA 4EQMA 3TNWA 1WBOA 4FTQA 2YEXA 4LGDA 4HNFA 2WD1A 4FKWA 5H3QA 2BUJA 4U3YA 4YR8A 5BVFA 3Q6UA 2I0EA 4YO6A 2VO7A 3BBWA 3OY1A 2QG5A 4W4VA 4MYGA 4HZSA 4LV7A 3UZTA 4F78A 3HUCA 3FQSA 4DGLC 1JKKA 3HP2A 4RT7A 5KKRC 1V0PA 5JGAA 3DZOA 3LKMA 4RQKA 3GVUA 3SD0A 4V04A 1SZMA 2LGCA 4GYIA 3TEIA 3EN5A 2Y7JA 2BRGA 2IVTA 4EBVA 1ZY4A 3MVLA 3R8MA 3W10A 5GZAA 2C68A 3S00A 5AV3A 4H1JA 2YERA 3LM0A 5AP3A 3P08A 5EKNA 2PVFA 3KEXA 4HPUE 4BCOA 2YJRA 3C9WA 3BRBA 2CLXA 3HV7A 4H3QA 4JIKA 2FSLX 3DOGA 1YOLA 4JR7A 1OMWA 4AGCA 3G51A 3QTRA 3KN5A 3WOWA 5BUJA 4M3QA 4EZ7A 3ENHA 4PWNA 4QQ5A 2OZOA 5HBHA 4E6AA 2O63A 2W7XA 4FEUA 5CYIA 3E3BX 1FVRA 4LGGA 4M66A 2XKDA 5JK3A 2PVKA 3OT8A 4XBUA 5DLSA 4BCFA 4EKKA 4ZAUA 4I6BA 2I7QA 2O5KA 3NWWA 1REKA 3Q4UA 1NY3A 3HV6A 4Z55A 5AA8A 3K5VA 4EL9A 4EYMA 4ERKA 2X0PA 3PY1A 5HG5A 3U51A 2VZ6A 2REIA 3LFBA 4PMMA 4EH2A 2QOKA 3R28A 4I93A 4USEA 2XYNA 3DS6A 4GVAA 1U59A 3R2YA 3AT4A 3LPBA 2OH4A 1ZOEA 4DG2E 4FKSA 2VO3A 4FODA 4J95A 2ETMA 3FL5A 4KRDA 3W33A 3W8LA 1JKSA 4LGHA 4ZTHA 1M2QA 3IOKA 4BCHA 5DVRA 3RPRA 1GOLA 2QD9A 3HYHA 3M42A 4OBQA 4XG6A 2JC6A 3KRRA 3OG7A 2GFSA 2HK5A 2Z8CA 3C4WA 5IKWA 3MFSA 3GC0A 5M4UA 1OM1A 3I81A 3CGFA 5F4NA 2R3RA 4M84A 1ZYCA 2HY81 2XVDA 1ZMVA 2OG8A 3UIMA 4DFZE 4F9BA 2HCKA 4DHFA 5DRDA 3S4QA 3DAKA 3R8VA 3G9NA 3QHRA 3CLYA 3KXMA 5CQUA 5HCXA 5ETFA 1WCCA 3Q2MA 4FMQA 3ATTA 1FMOE 2UW5A 3ZU7A 3M2WA 2EWAA 1IASA 3F3TA 2EVAA 2ITTA 4CLIA 4AZWA 2QI8A 2XZSA 4G3CA 4J71A 2E9NA 3N4TA 1J7IA 3FYJX 5AV1A 3KMWA 3QF9A 4YP8A 3U8WA 3UYSA 3BGQA 4I20A 4C8BA 3W0QA 5FTOA 4QYEA 4X2GA 3FHRA 4O4EA 5K0KA 3VIDA 4EI4A 3BHVA 5F95A 4E4LA 1G8KA 2C3LA 1YXUA 2HZ0A 2I1MA 3OC1A 2DQ7X 2JDTA 5E7RA 4AS0A 2WTKC 4WUNA 5CU4A 1BI8A 3BYUA 3PRIA 4K2RA 4AF3A 2XMYA 4ZY5A 3OWJA 4NW5A 1YRPA 2XAMA 2C30A 2OJIA 2WMWA 3GFEA 2BVAA 3ZH8A 3FLZA 1STCE 4EOLA 5CTPA 1UWJA 4M14A 3RNIA 4QMZA 5LOHA 2VTSA 2GNHA 1A9UA 5IQHA 5GHVA 2R3QA 5BQ0A 4V0GB 2AUHA 2RL5A 4K18A 5GZ9A 4F0GA 3F69A 4JR3A 4RWJA 2W06A 2BZHB 5HHWA 3O8UA 2PK9A 4M68A 4XUFA 2PWLA 4GIHA 4PDPA 5HE1A 3IKAA 2B1PA 1G8SA 2W1CA 5IEVA 1OI9A 5KBQA 3W2SA 4YJVA 3TIZA 3PXYA 2R3PA 3KVXA 2XBJA 2XS0A 1Q8WA 1Q8TA 2W9ZB 1XWSA 1G5SA 1ZY5A 4LRJA 4WIHA 5DPVA 5AX3A 5HX6A 1MRUA 3OCTA 2PU8A 1E1VA 4IZAA 4AZFA 4CFNA 4LFIA 1S9IA 4F4PA 2UZEA 3ZTXA 1PKGA 2OU7A 2YLEA 5E1SA 4F0FA 3CGOA 2HWPA 4X6QC 5EDPA 1UWHA 3AD5A 4FK3A 4E1ZA 1UNGA 4FV8A 4ZMEA 5LVLA 4TYGA 4DEDA 2NPQA 4BDIA 3QQUA 5IUGA 2OFVA 3HL7A 3RP9A 2Y4IB 2V62A 1J7UA 4R6VA 3ZLSA 2WU7A 3TUCA 5B0XA 2WQMA 4K77A 3EQGA 3DXQA 5CX9A 2VRXA 3EQDA 3W32A 3C7QA 4GH2A 3W2OA 5IA1A 2YCRA 4AZSA 1IAJA 4DA5A 4ANQA 4FNXA 4KD1A 4AZVA 1CKPA 4FE2A 3U6JA 3PA5A 2PYWA 3VUIA 1W0XC 1P5EA 2NP8A 2H8HA 3DK3A 4MHAA 3RINA 3IQ7A 3EQFA 1VYWA 5K4IA 3DNDA 5IH4A 3AKJA 3HRCA 4YC3A 4ZTSA 4DLJA 5IUHA 3GENA 4C3RA 3H9RA 4NSTA 5HQ0A 1YXTA 3R1QA 2X8IA 4B4LA 2Q0NA 3HECA 5J1VA 4YJSA 3LZBA 3ET7A 5ANDA 1ZXEA 4ZJJA 5EYKA 3EIDA 3KCKA 3V5TA 3BLQA 3FHIA 4NIFB 4QP7A 4QYYA 2OBJA 4RLLA 4FG8A 3EKNA 2UUEA 4YBJA 2JBOA 3FMNA 5EG3A 3AMAA 3UPZA 4GG5A 2C3IB 3PVUA 4E5BA 2GS6A 3KU2A 2XNNA 3V6RA 3UNKA 4GFOA 2QO7A 4Q9ZA 2VWXA 2GFCA 2ZV8A 3G0EA 3QQKA 3O5AA 4R7IA 2PE1A 2PMNX 5A4TA 4O0WA 3RGFA 3DK7A 3OW3A 5J79A 2OW3A 1OL5A 2WEIA 3EJ1A 3LXPA 4BHZA 3FLSA 3EFWA 2E9PA 2EB3A 4XYFA 5J5TA 2W5BA 1L8TA 3JY0A 3TV7A 4E7WA 5HE3A 4UMPA 3A61A 3QTSA 4QO9A 4YMJA 4Z7HA 4YNOA 4EBWA 2CCIA 1XQZA 2C6IA 1PXNA 5D41A 3MY0A 5IQFA 2PVYA 2X2KA 4JQ8A 3VW8A 2O65A 4CQGA 2IEWA 5ANGA 2OFUA 3CIKA 3LAUA 1WFCA 4CKIA 4EH4A 1XH6A 4FKQA 2XNMA 5CANA 2VTPA 5F20A 4HOKA 5I9UA 2XIKA 3HUBA 4I5PA 3DFAA 3S2PA 4I0RA 1IR3A 2PVJA 2DYLA 1V0BA 3T3UA 3K3IA 4DFNA 3SV0A 2X39A 5BUEA 4CVAA 1ZOHA 3DCVA 4FKUA 3RPOA 2RG5A 2OZAA 4L68A 2H6DA 5J1WA 4JBQA 4BZNA 2XKEA 5E8TA 3P79A 4C58A 3PRFA 3GGFA 3E64A 4EOIA 4BDFA 5EW8A 1VJYA 3EQHA 3B8RA 1PKDA 4FNZA 4BIBA 4G31A 2G01A 4IANA 2XCKA 3COMA 5L2QA 2NRYA 4MD9E 4AOJA 4WO5A 1RDQE 5EYMA 4OTGA 5HNBA 2WEVA 4Y83A 2RFEA 4BI0A 4CFWA 5HNIX 1Q62A 4I5CA 4O38A 5D1JA 4CTBA 3TZ8A 5I9XA 4GK4A 4O7WA 2IZUA 1ZZ2A 3COIA 3FKLA 4FV9A 4N6YA 4BCGA 1H1RA 2ITVA 3QBNA 5IQEA 5EDRA 1DI8A 3E7VA 2P33A 3MA3A 2QKRA 1PXJA 4PTCA 3NR9A 3PVBA 4BTMA 3V5WA 3KREA 4FL2A 5M56A 3U55A 2BFXA 2R3JA 3AD4A 3E8NA 5G1XA 4O4DA 4I92A 1V1KA 3W0NA 4IH8A 4FT3A 4WOVA 5A3XA 4L53A 2LAVA 5CSHA 1BMKA 4PL3A 1J7LA 4EJNA 3HEGA 5JGDA 4UZDA 2SRCA 3LMIA 2F7XE 3BKBA 3GNIB 4GU6A 1Q8UA 2QONA 2VD5A 5IH5A 3EQIA 2QURA 4DBNA 3QXOA 4ZTQA 3FZSA 4FA2A 4QRCA 4WBBB 1UKIA 2CSNA 1BX6A 3ML1A 3FXXA 3KRWA 4RJ5A 4I24A 2EUFB 3CC6A 2BKZA 4FV4A 5FEQA 2UZBA 4QD6A 2XAOA 5DIAA 3TDWA 2R3LA 2QO9A 2Q83A 1R0EA 3TV6A 4EOJA 4YO4A 1FVTA 4ACCA 3GU5A 3C0HA 1WAKA 1BLXA 2IVUA 3M11A 3HRBA 4X21A 2R3NA 3WARA 4GEOA 2E2BA 3RBWA 4IB3A 1JNKA 3PUPA 3BE9A 2XARA 3O71A 4FV5A 3PSCA 3CXWA 4O4CA 2XIRA 2GMXA 4WNPA 3HMPA 3EH9A 3EFJA 3FQHA 5HX8A 1Y57A 1VZOA 3Q4ZA 4XLVA 1KOBA 3CCNA 5GJFA 3NVMB 3LVPA 2JFMA 2J5FA 3F6XA 1XMMA 4AP7A 3WYYA 2OF2A 3D7TA 2AC3A 5AM6A 2QOCA 3ITZA 3ORTA 4PX6A 3IDCA 3ODYX 4EWHA 2ZV7A 5AAEA 2GS7A 4CSVA 1NVSA 3MPTA 3PVGA 5CSPA 2VTRA 2BALA 2BDFA 3BX5A 5FD2A 4L52A 4TNDA 4L3PA 3IW6A 4YC6A 3TT0A 5LMBA 2IG7A 3Q5IA 1YXSA 3P0MA 3LJ2A 2YIRA 2R3KA 4MAOA 3VBTA 4QTEA 2X4FA 4EHZA 3M1SA 2P2IA 5JFSA 1ATPE 5JKGA 4PUZA 2V7AA 1YXXA 3ACKA 3IGGA 3PXQA 4UXLA 4AFEA 5B2MA 2XALA 4DGMA 5ETIA 5JFXA 1JKLA 4CGAA 5ACKA 5DBXA 5HESA 4ZSAA 4IWQA 3R1NA 5GIOE 4AW2A 4BIEA 3FLQA 2A98A 2QOOA 4KWPA 4R1YA 2J0KA 3QZIA 4JDKA 2AC5A 5AUTA 4YC8A 4RC3A 4PTEA 3KRXA 5J95A 3UVQA 3BEGA 5AWMA 3LOKA 4HZRA 4O0TA 3ORNA 3H3CA 4MXOA 3HV4A 5KZ0A 4EK5A 3OXTA 4O82A 4FRFA 2WTDA 3C51A 4EHGA 5AR3A 4LG4A 3VUKA 3SOAA 3Q9WA 1PXLA 5AR2A 4CV9A 3N4UA 2J0MB 2X0GA 4BDGA 2BIYA 5A54A 2C0IA 3EL7A 4S33A 4A06A 5IA3A 3ROCA 5H8GA 3VJOA 4PDYA 2W4OA 3KY2A 1PMUA 4IE9A 2PSQA 4BZOA 4F6WA 4DDIA 4AN3A 5EM5A 3DY7A 4R7BA 5CSXA 4L67A 4O86A 1JSUA 2WOTA 2P2HA 2YWPA 2JAMA 2OICA 2QG7A 5B7VA 3CP9A 4EH8A 5LWMA 2W05A 2C4GA 2X0OA 3DTWA 4MD8E 4BFMA 1WVWA 5LMAA 4ENXA 5LJJA 1R39A 4O22A 4TYHA 4FSRA 3D15A 3HNGA 3VUGA 5EYDA 2J9MA 4KKHA 3R8UA 4ACDA 5E8SA 3DKCA 5CZHA 2ZFYA 1OKVA 1R0PA 5EQEA 1I44A 3HV3A 4F7NA 2XNBA 4D5KA 4L45A 5BMSA 4QOXA 1OITA 4KS8A 5E90A 4BC6A 5A46A 2UV2A 2UW6A 5IQDA 4AXFA 4UEUA 2ETRA 3ORPA 4GRBA 3B2TA 3F5XA 1BL6A 1VYZA 4IAIA 5AV0A 3WBLA 1BL7A 4HVIA 3U54A 2X9FA 3P4KA 2XNOA 4FTMA 2WPAA 4F7JA 4MUQA 3PJ8A 4IDVA 3V8SA 4ZJIA 3WILA 4NJ3A 5CVFA 2R3GA 4XG8A 4U41A 4FTJA 3BIZA 3FXWA 2CNVA 2I40A 1W84A 3SXFA 3KA0A 1XJDA 3VBQA 4DEHA 2HZNA 5DGZA 2B9IA 2QHNA 1KE9A 4O0YA 4Y72A 2YDIA 3V8TA 3U6IA 1PXOA 5CI6A 5DWRA 5JZNA 2PL0A 3VUMA 2JIUA 3OWKA 3HKOA 2UZLA 1ZWSA 4YZCA 3OVVA 1Q97A 5LCKA 5AAGA 5ICPA 3TKIA 4PTGA 4CT1A 4QP1A 3LIJA 3GQLA 3CJFA 3ODZX 5AP7A 2OSCA 2UZOA 2F9GA 4AAYA 4D0XA 3TNHA 1KE6A 4R5SA 3UYTA 3A7JA 3EOCA 3QX4A 3TIYA 4DT9A 3EKKA 3REPA 5KKRB 5C4LA 3MV5A 4DLIA 3JUHA 4UYAA 3RCJA 1PY5A 4F09A 4L8MA 4D58A 4ZLYA 1MUOA 2YM8A 3ENMA 4DINA 5JH6A 2R9SA 4FV1A 1U46A 2PY3A 1OL1A 3QQLA 5FP5A 4A4OA 3WZKA 1W2DA 4NM3A 5IDNA 3V5QA 3FXZA 3LW0A 3BZ3A 3BU3A 4BY9E 3HA8A 3QD4A 3ZZWA 2OKRA 2WMRA 4U81A 2GSFA 3ZFMA 4TWCA 4ZSGA 3EN6A 3NIEA 3R9RA 3NGAA 4LL5A 4RIWA 4EOKA 2QQ7A 2F49A 1QL6A 3K54A 5KX8A 4EKLA 1LUFA 2QOIA 2PPQA 3PUFC 2UZDA 2VX0A 5BNJA 3QQFA 3W0SA 3N9XA 3R02A 4EOOA 2O0UA 3IS5A 2JKMA 4FKJA 4ZP5A 3S3IA 3KFAA 5I5ZA 2R2PA 3KXNA 2G2IA 5IMEA 5CWZA 3CR0A 2C5XA 4D2WA 2JDRA 3F9NA 3UO5A 3UZRA 4KIOA 4FV0A 1GIJA 1HOWA 2WQBA 4BWXA 4CEGA 4YZDA 5LMKC 2OI4X 4G9RA 1GZOA 3KULA 4L01A 4EORA 2B55A 2BIKB 5AUWA 2RIOA 3DGKA 4G34A 5FDXA 3BV3A 2WB8A 1QPEA 4L42A 3P5KA 3UC4A 3VRYA 3D5XA 3FZRA 3LFNA 3MTFA 4D2RA 3A7GA 4O7LA 4KIKB 4DFYA 2OZAB 4J97A 4FSMA 3W2RA 4HGLA 4UMUA 3CD8A 3ELJA 2WQNA 5EI8A 5FEEA 4BCKA 2BR1A 4C4IA 4D55A 1F0QA 4TYJA 4C2WA 3OS3A 3PIZA 5M57A 4PP9A 5BPYA 4O1PA 3R22A 4JRNA 3TYKA 4EHEA 2WMSA 2J0IA 4P2KA 5ANKA 3C5IA 2X1NA 4RWLA 4QDVA 4CFFA 4KBKA 3TZ7A 2YM7A 1MRVA 4IXPA 3ZS5A 4OAUC 4WNKA 3TZMA 4ZOGA 3E93A 1OPJA 2P4IA 1WBNA 3I6UA 3V04A 4V01A 2W1IA 4E20A 2IZTA 1GY3A 1OKYA 4FX3A 4RA5A 4O2ZA 2XM8A 4BL1A 4IVAA 3DJ7A 1S9JA 3WF9A 3ZRMA 4C4HA 1P4OA 2X4ZA 2BILB 1XR1A 2HAKA 3FQEA 3NUNA 4C34A 4E6CA 5AV4A 4JNWA 2I0VA 3LLAA 1UU8A 5J8IA 5CAQA 4I21A 4EYJA 1JSTA 4RJ8A 3ZRLA 1FINA 4CFMA 1WBTA 3HA6A 4FKRA 4I5HA 4ASEA 2C6EA 3NW7A 5CLPA 5DR6A 5HEZA 2Y4PA 4XS2A 4CMTA 3QQGA 3AGMA 3BI6A 2HZIA 3FSKA 4N6ZA 3KK8A 1A06A 3CY3A 4D4RA 2QOBA 5EYCA 3OBGA 4JBVA 1PMVA 3FI4A 3K5UA 3PFYA 2XIYA 3N51A 3PXFA 3ERKA 4AE9A 3SLSA 5HBJA 4U6RA 3FI2A 5CU2A 5AX9A 4O21A 3JR1A 3LCTA 2ZJWA 3RPYA 2ZVAA 5CAVA 1U4DA 4D4SA 4RJ7A 1OL6A 3MBLA 4QTBA 3UGCA 2VTIA 3CTJA 5I0BA 2QODA 2B54A 2YA9A 3NYVA 5FWKK 3GU7A 3FL4A 4KA3A 5AUZA 3MH2A 3EHAA 4WRSA 3FY2A 2Z7SA 5IUIA 3EQPA 5HVYA 5E8UA 1YQJA 3BYOA 1ZYLA 3CKXA 4UY9A 4DCAA 3IO7A 4IX5A 4CG8A 4D2SA 3ORXA 4Z9LA 2O2UA 3V5JA 3QL8A 2WU6A 3QX2A 4AWIA 2UW4A 4GW8A 3FPMA 5FLFA 3VWAA 4BCNA 3PXZA 2ACXA 1ZYJA 3FI8A 3D7TB 2XJ1A 4PV0A 2BCJA 5IG1A 3SKCA 4RFMA 1PF8A 3R2BA 3VW6A 3TACA 5M4FA 2AYPA 4KS7A 2E9OA 4D1ZA 1CSNA 1VEBA 4XOZA 1EH4A 5LWNA 3F66A 2JBPA 5FM2A 4QMSA 3GUBA 1DS5A 4Y5HA 4BCIA 3SVVA 5EQYA 2B4SB 3UJGA 3B2WA 5EHYA 4GS6A 1H08A 1B38A 4QMMA 3A2CA 4G5JA 3F5UA 3QTXA 3R00A 4P7EA 4O6EA 3RKBA 3UBDA 4F9CA 3ID6C 4YGAA 3BHTA 4YLLA 3ZOSA 1RQQA 4FSYA 3FYKX 4IHPA 3PPJA 4RLKA 4O81A 3AMBA 5HVJA 2CMWA 4MF0A 5CVHA 5HU9A 2XNEA 4ANSA 4LUDA 4O7YA 3QZGA 4BTFA 3VBXA 3PIXA 3V3VA 4EWQA 1KWPA 5C8KA 2X6EA 2OK1A 5CY3A 3A62A 4C57A 2XK3A 2IVVA 5AEPA 3VQUA 4NFNA 4QP6A 1J91A 4ANMA 3PLSA 3CE3A 4BKZA 2OLCA 3FUPA 5E8YA 4GMYA 3FKOA 1PHKA 3KQ7A 5LQFA 4JG7A 4BHNA 1Y6BA 3G5DA 1H24A 4IB5A 4LOOA 5EI2A 3ORLA 2FYSA 4DGOA 3SXRA 5K9IA 5E4HA 4IWDA 3V5PA 1UVRA 2FH9A 2X0QA 2A0CX 2ERZE 3KK9A 3PJ1A 3A7HA 4MQ1A 2EU9A 4UWYA 3KF7A 5LVNA 3JY9A 3ZSGA 3GC8A 3O7LD 4TYHB 5CSWA 1W8CA 2YJSA 2ZDTA 3NDMA 1ZAOA 2ZM3A 2HY0A 4QPSA 4A07A 4F6UA 4EC8A 3RHXA 3CTQA 3BHYA 3MPMA 4RX9A 1SNXA 4X2KA 3KC3A 2PULA 2VTOA 3PSDA 5BVEA 1W82A 4F99A 1TQIA 4BDBA 3W0PA 4J52A 1SYKA 1UNHA 3R21A 4BDDA 5E8ZA 2YZAA 4IADA 5AAFA 3Q32A 3H0ZA 2J90A 5H2UA 3R83A 3HX4A 2XP2A 4GUBA 4C38A 3L9MA 4RG0A 2NYAA 1XBCA 4YJQA 3AC2A 4IAAA 1Q3WA 3QGWA 3R9NA 1KE5A 3TWJA 3W8QA 3PE1A 4A9RA 3LXNA 4DC2A 5E1EA 5LMKA 4QNAA 2J7TA 2J6MA 2G15A 2ZMDA 3FZTA 4J7BA 3RVGA 2X8DA 3RAWA 5L2IA 3DV3A 5L8LA 3AQVA 2UW7A 4JG6A 5HE0A 5F9EA 4EC9A 2V55A 3FMMA 3TNPC 2XNGA 4C4JA 4TZRA 2QR7A 5HLPA 3ZEWA 5AR7A 2BTRA 2J0JA 2XK8A 4LV8A 2CN5A 4DH1A 2IZRA 4NKAA 4DH3A 3HRFA 4YZMA 1GZ8A 3QYZA 4AA5A