4FV8A

Crystal structure of the erk2 complexed with e63
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
350
structure length
333
Chain Sequence
GAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVAVATRWYRAPEIMLNYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with E63
rcsb
source organism Homo sapiens
total genus 111
structure length 333
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv8A01
4BIEA 5EFQA 3AMYA 4S2ZA 3KVXA 4DEGA 3D5XA 3K3JA 4IZ7A 4K18A 4IX6A 1ZYLA 3EH9A 3LZBA 4AT5A 2JDVA 5J1WA 4FTKA 4CKRA 3QQJA 3SW7A 3C1XA 4ORKA 4FKLA 3TIYA 1FGIA 3F88A 4QMPA 3TZ9A 1APME 3R71A 3C5IA 1UWHA 5DNRA 2WNTA 4FSRA 3W2RA 1UKHA 3NYXA 3ZO1A 4AU8A 5AX9A 5HICA 3ORMA 4XHKB 3UIUA 4PP7A 1H25A 3RK7A 4U97A 3DDQA 2F9GA 2J0LA 2YABA 4M84A 3VS0A 4EQCA 4O0RA 5JFVA 5EQPA 4QMTA 4ERWA 3R00A 3ZFMA 4EZ3A 4ENXA 1IG1A 5EHYA 5F9EA 2F7ZE 4E5WA 4ZSJA 2BKKA 2R4BA 2WEVA 3Q2MA 4EK8A 4UN0C 3LFCA 3MJ1A 2X4FA 4I4EA 4ONAA 5E8WA 4EK3A 5FDXA 3QU0A 4XV3A 4XV1A 4LOPA 4ZTNA 3GXLA 3VJOA 1JSTA 5CAQA 4XLIA 1ZXEA 3IDBA 3MFTA 4KIQA 5AV1A 1O6YA 2J5EA 4BBMA 4QMVA 2X0GA 4RT7A 4XG2A 4X6RA 2I40A 3QQUA 4RJ3A 1SMHA 4PNKA 2UUEA 3UPXA 4HNFA 4R1VA 4JX7A 4E93A 2DS1A 4RFZA 2W1FA 2O8YA 2BAKA 3CQWA 4X3FB 4G3DA 4FT9A 4YJQA 3FXZA 4C8BA 3E7VA 4WG5A 4ZSLA 4D0XA 4DG0E 2DUVA 3NUNA 4V0GA 4ANOA 4EH6A 4EH9A 5K4IA 3QQGA 2VTOA 5AUVA 3UG2A 4NFNA 3G33A 5CAPA 4O1OA 1SVGA 4IAIA 3CS9A 4GYGA 4M0ZA 4OUCA 4CMUA 5EM6A 3KN6A 4UALA 2OK1A 2XB7A 3AT3A 3BRBA 4YURA 3U55A 2HIWA 2VTHA 5KMJA 4OBOA 4Z7HA 3QFVA 3ENHA 2HELA 3KCFA 2JEDA 5T3QA 4HGTA 2ZB0A 4TT7A 4ZS0A 3IW8A 3OFMA 3FKLA 4LI5A 4EWQA 4XBRA 5L2WA 2OH4A 4M14A 3SG8A 5BVEA 4AT4A 4DEIA 4NH1A 1YVJA 3P7CA 5DYJA 3MSSA 1FGKA 3LXPA 5F95A 3T3VA 4MD7E 3ZSGA 1V1KA 2BIKB 2R3HA 4CCUA 5HX8A 1P4FA 3GBZA 1GZNA 4NJDA 3VBXA 5LMKC 4C4FA 1YWVA 4UEUA 2RG5A 3C0HA 3IO7A 5IH4A 4KUJA 2HCKA 2OBJA 2PE2A 1H24A 1W0XC 4YHFA 1FVTA 1Q24A 2B9FA 2UZUE 2WMQA 2WMSA 4FMQA 4I24A 5AP2A 3D4QA 2HW6A 3ZUTA 4DEEA 4ZTRA 2XNPA 4ANLA 5HNIX 2YCRA 3ORNA 3MJ2A 3OZ6A 3DQXA 3UMWA 5AP7A 4MQ1A 4O7TA 2GTNA 4B9DA 2OXDA 1B6CB 2OKRA 5AV4A 5BYYA 3IS5A 4YJRA 3F6XA 5TKDA 4FNXA 4NM5A 3UOJA 5FTGA 2VO7A 4E6CA 5LMBA 2W5AA 4BYJA 3PP0A 3KN5A 4BZNA 2PZPA 1QPEA 1UU9A 3C4ZA 3VW8A 3NUYA 2IZRA 4DGGA 5AP6A 2HY81 2WTJA 4XNEA 4WG4A 3H9FA 4HYUA 5HE1A 3POOA 4JDIA 4L01A 3HL7A 4J96A 1T45A 5HTBA 3UIXA 3LLAA 1H1PA 5JT2A 3QYWA 3QZIA 4I92A 2Y8OA 3QTZA 3HEGA 3HRBA 4J95A 4AZVA 4PQNA 3MYGA 4W4XA 4BWKA 3WF6A 3RAKA 4FEXA 5HQ0A 3BQRA 5FG8A 3ET7A 3I79A 3KK9A 2CPKE 4U42A 4C0TA 2WTIA 1XBBA 3EFLA 3DKFA 3P0MA 4KBAA 3GU4A 4YC3A 3SW4A 2GNHA 3TI1A 3SX9A 1BI8A 3U87A 3A62A 4XRLA 3JVRA 4IZAA 1H8FA 1Y6BA 4I5PA 5AP3A 4L3PA 3OS3A 4RC4A 4BCIA 3MV5A 4BDEA 3FYJX 5K0KA 2GQSA 1PY5A 3TM0A 3NW7A 4QNYA 4EH8A 4RIWA 5C03A 3SXFA 4AGUA 4BDKA 1JQHA 2W1GA 1E1VA 1ZY4A 2O0UA 3KGAA 4L3LA 2WKMA 3AT4A 4WNOA 5KMKA 1FOTA 4MD9E 3IDCA 4H39A 2XCHA 2I0VA 2ZMDA 5HG7A 4FV3A 5E1SA 2WOUA 3NS9A 1OIQA 4V0GB 2VUWA 2X4ZA 4IB5A 4IWPA 4AZTA 3QZGA 2GNGA 4PMPA 3SLSA 5GIPE 2P2HA 2BZHB 2YJSA 3PPZA 3DBDA 4GFGA 4IC7A 4LRJA 4QMSA 3LFAA 3W2SA 3HAMA 1CKPA 5AFVA 4ALWA 4K9YA 3UYTA 4JOAA 3HP5A 2W7XA 1RE8A 2ZYBA 2ETKA 4F7SA 4FEWA 2VTPA 2R0UA 1A9UA 3UQGA 1PMEA 2UW0A 4O0UA 3Q4CA 4BCGA 4FG8A 1YDRE 5AR2A 3AD4A 4J7BA 3W16A 4MBJA 2ITQA 5DI1A 1VJYA 1QCFA 5CF8A 4YMJA 3THBA 3DGKA 3FQSA 2QLUA 4YLLA 3AXWA 4GJ2A 5C4KA 4DH3A 4O2PA 1JNKA 3GQIA 4DG3E 3UO5A 1KE9A 1PXIA 1IRKA 1M7QA 4YTHA 3TV7A 3CQUA 1WMKA 3F3WA 3PLSA 4FG9A 5L6PA 1JKTA 4G6LA 1Y8GA 5DR9A 1Z9XA 1Q8YA 1WBVA 1SYKA 2QNJA 3MVJA 3VS7A 4MVFA 2Y4PA 3U6IA 2Q0BA 4BCHA 1ZYJA 3HMNA 1BLXA 2PVRA 4FK6A 4FT0A 4Q2AA 3ORKA 4IWDA 4FV2A 4YBKA 3Q04A 4FYOA 5JQ8A 3D83A 3H9OA 3R28A 1P4OA 2FA2A 4GCJA 3FI8A 2W9ZB 3NCZA 3JUHA 2R3QA 4ZOGA 1YI6A 4CMTA 4KA3A 3D2IA 4X0MA 1R39A 2FYSA 4B99A 4E4LA 2Z7SA 3HRCA 1ZYSA 2YA9A 4YTFA 5C26A 2VWBA 3JS2A 4ZTQA 1Q4LA 2JDSA 3AQVA 2OF4A 2YHVA 1Q8WA 4NKAA 4U6RA 3PA4A 4O6EA 3RAWA 4IB1A 2HWOA 2C30A 3MW1A 4E3CA 2WTDA 2RSVA 5CYIA 4PPBA 3CD8A 3GVUA 1LEZA 5M08A 2R3MA 4FG7A 2VWIA 4GEOA 1WFCA 2X7FA 3W2PA 5CSVA 3NYOA 5FTQA 2XM8A 3CQEA 1DAWA 2RFDA 4FTMA 3P1AA 4QMZA 2C5OA 3ZXTA 2VZ6A 4WUNA 4YLJA 4C4JA 3ANRA 1PYEA 4IIRA 4FNYA 1Q62A 4ZXTA 3RZBA 3UO4A 3UVPA 4AT3A 3WF9A 3TKHA 3I5NA 3R21A 4J52A 2XH5A 2EVAA 1OBDA 4PMTA 5HU3A 1H28A 2OZAA 1ZZ2A 5HVKA 5KNJA 4NWMA 4DGOA 5KMMA 5L4QA 1LPUA 3MPTA 5E8YA 5EKNA 3QLFA 4WOVA 5HHWA 5DGZA 3PRIA 4RIWB 1FMKA 3E8NA 3WF7A 4E8AA 3ORLA 2F2CB 3DBFA 3MBLA 1BX6A 2UW4A 3GCPA 5LMAA 5IDNA 2UV2A 4ZTMA 4FICA 3DBCA 3FHIA 3R7YA 2BAQA 4LQMA 3RALA 4FKVA 4JDKA 3WYXA 1ZAOA 5L8LA 4GL9A 2HZ4A 4OTIA 4FSZA 4MXZA 4QT1A 3U51A 2ONLA 1OKWA 4FR4A 2C3IB 3G51A 3UP7A 3OUNB 3VF9A 1XO2B 4Z16A 2BALA 4J8NA 3KRXA 4JXFA 4UMQA 3ZRKA 4Y95A 1XHAA 4GKIA 2I0HA 3KF7A 5DG5A 2VTSA 4FV6A 4GUEA 4WBOA 3KL8A 4CNHA 2CMWA 3BIZA 4BCKA 1WBOA 4KWPA 4BYIA 1GIJA 2ZM1A 3KEXA 4FTOA 4GIIA 3ZLXA 2RFNA 1Q99A 1URCA 3BEAA 3DU8A 3VS4A 5IH5A 1VEBA 3NPCA 4E1ZA 3D5VA 3OTVA 5GIOE 3AMBA 3LLTA 1OM1A 5J8IA 2C6KA 2BDJA 2E9OA 3KXMA 1YHWA 3E62A 3W10A 4N4SA 4EZ5A 4OAUC 3P5KA 4FKWA 4KSQA 3Q4UA 4Y85A 4LOOA 2BRBA 3FMHA 2Z7QA 3G2FA 3ZS5A 4DTAA 3MTLA 3BU5A 4U0IA 2GQGA 4OTHA 4I6QA 4W4VA 2QOLA 3PVWA 2GQRA 2R7IA 4CFMA 3O50A 3D14A 4IWOA 4WIHA 4OTDA 3QX4A 4AACA 4CD0A 2X7OA 1CMKE 5BX0A 3EWHA 3QCSA 4IJ9A 3R7OA 3OTUA 3MFUA 3UQCA 2XM9A 3UG1A 2P0CA 2C6IA 2H96A 3NUSA 4AQCA 3FDNA 3LFFA 4TYGA 4TWPA 3BE2A 1JKLA 5AR4A 2GMXA 4EOSA 3FL4A 4AW0A 4XX9A 3PJ1A 3GC9A 4FUXA 1PKDA 4ACCA 4K8AA 3HUBA 1SNUA 3D2KA 3S1HA 5I9WA 3BLQA 3ZDIA 4GJ3A 3UGCA 4RVKA 3SXRA 4FSUA 3ZO2A 3PE2A 4Q9SA 5A4QA 4ZJVA 1DI8A 3HKOA 3CKWA 4TNBA 5AP5A 4WG3A 5FP6A 4FKUA 1U54B 5B0XA 3F7ZA 5FD2A 3Q4TA 3V3VA 3UODA 4QTBA 4R7IA 3L9PA 2XNEA 3FE3A 4M12A 2ITPA 4L46A 3OC1A 1KUTA 4KIOA 4M8TA 1ZLTA 3MFRA 2V7OA 3V5WA 3KY2A 4L53A 2R3OA 3DAEA 1OGUA 2YDJA 4NU1A 2PPQA 1FPUA 3G0FA 4J71A 4DFYA 2PVHA 2XVDA 3Q9YA 5FWKK 4G1WA 2QO2A 2XK4A 3S0OA 2WQMA 1O9UA 5C9CA 3T8OA 3AC1A 2W96B 5DIAA 3Q60A 2XNGA 3JY0A 5E8TA 4DT8A 4IM2A 3ORTA 2FSTX 3F2AA 5AEPA 2CLQA 5HX6A 4ZEGA 5FM3A 2OZAB 3LQ5A 1M2PA 5A6NA 4HPTE 2PVJA 4FSMA 4AGWA 4FSQA 4UWCA 2XYUA 4C2WA 2PUPA 3R83A 4IM0A 3FMJA 3TN8A 4XG8A 2ZB1A 5BNJA 4WKQA 3ZMMA 2UZEA 5LVPA 4BIDA 3QQFA 2JKKA 5DVRA 2NNWB 3A7FA 1IAJA 3CIKA 4EOQA 3NNUA 3L9LA 5B2KA 5FP5A 1J7IA 2VNWA 4MBIA 4ENYA 1NT2A 1FQ1B 3DB8A 4OTRA 3HAVA 4HVHA 1PXNA 3BYSA 1YWNA 4YBJA 4EC9A 3O8PA 3C0GA 3PVGA 3EQRA 3TV4A 3ETAA 4C37A 5D9HA 4OGRA 5H2UA 1ZMWA 4FIGA 4JLCA 4O0XA 4YHTA 3WILA 2R3JA 2X8EA 1KE6A 4N6ZA 4CRLA 2W1DA 3ZCLA 5DEYA 3AC5A 3SOAA 5DT0A 4LV5A 4O7NA 2W1HA 4MQ2A 4NK9A 4EH4A 5LVLA 3MGYA 3RJCA 4JVGA 4CT1A 4C34A 3HV5A 4XMOA 3I6UA 4C35A 3QRUA 4G2FA 5TO8A 5DHJA 3LHJA 4Y46A 4HCUA 3ZO4A 4RJ4A 3VS6A 2X9EA 5CAVA 4TW9A 3QL8A 3RAIA 5GZ8A 1I44A 4DH5A 1H1WA 1YXUA 3OOMA 4F6SA 2VRXA 4P4CA 4Y5QA 4FTLA 3FV8A 3GENA 4O0WA 5E9EA 3EFJA 4FEQA 3OVVA 4A9RA 2PMNX 2WAJA 2ZV9A 3FYKX 4UMUA 5DT4A 2IW9A 3GB2A 5AADA 2W05A 3CGFA 2J9MA 4FIJA 1PJKA 3M11A 4R7BA 5IA0A 5L3AA 2O3PA 3B8QA 5BMMA 3HYHA 1KOBA 2WZJA 4G6OA 3FMMA 5K5XA 2CDZA 3JR1A 2NP8A 4LGDA 2YAKA 2I0EA 1WAKA 3HGKA 3IOPA 1ZZLA 3AC3A 2PTKA 3EQIA 4QOXA 3FEGA 5IQIA 5CI6A 2WMUA 3C0IA 3QKKA 2JDOA 1U5RA 3A99A 2VWVA 3EZVA 5DRDA 2XBJA 4IVBA 5ANJA 5ETCA 5LARA 3VUIA 3BGPA 2C3KA 3V8TA 4R1YA 4HVSA 5J9ZA 4F1TA 3AC8A 3NUUA 4KINA 2VWZA 4BDDA 2W5BA 3QYZA 4EJ7A 3DJ6A 3ACJA 3FKNA 3BLHA 3DBEA 2VU3A 2X81A 4KNBA 4RJ7A 3OCSA 4UV0A 4WRGA 2YN8A 4L00A 3ZRLA 5HIEA 4U41A 5LVMA 3EL8A 3PG1A 4I41A 2H8HA 3TTJA 1OKZA 3TNWA 3O71A 1URWA 1UV5A 4JBOA 4QD6A 1H1SA 2XEYA 5CSWA 3EJ1A 4MNFA 4O7LA 3MVMA 3TIZA 4UZDA 4K2RA 3CTJA 2PULA 3SC1A 1HCLA 1QPDA 5CLPA 3CGOA 3A8WA 3G9LX 3O8TA 4FL2A 4F0FA 2PY3A 2V22A 3V5PA 4EH7A 4W9WA 4F0IA 3LCTA 4I0SA 2V7AA 3ULZA 3UZPA 3BHTA 4FA2A 4IVDA 2G01A 2RGPA 3CY2A 3GC8A 4QP3A 2J90A 5HD7A 5IA1A 2AC3A 4EHZA 5LQFA 5K3YA 3VS3A 3DB6A 3VF8A 2GS2A 3ELJA 3DLZA 3P86A 1YXSA 4CYJA 2Z60A 3F5XA 3DTWA 2YCSA 4G9RA 3KXNA 3I7BA 2GTMA 3PY0A 1UNGA 3AG9A 2FH9A 2GS7A 4EK6A 2EU9A 4XP2A 3Q5IA 3WE8A 4BCJA 4IHPA 3CR0A 3VVHA 3D5UA 4JIAA 4W9XA 4HGLA 4EJNA 5JK3A 4I94A 1BUHA 4OT6A 4OTPA 3ZLWA 2I7QA 2RIOA 1KE8A 1F0QA 2Z8CA 4FIFA 1NVRA 5CS6A 3KMUA 3EQDA 2OJFE 2AYPA 5LCKA 3VUMA 1JLUE 3II5A 4GU9A 3R7UA 3JXWA 2OLCA 1BI7A 5TE0A 4YZCA 3PXKA 2YZLA 5DOSA 4EORA 1V0OA 4O7YA 5J1VA 4C33A 3P08A 3LJ0A 4ZZMA 4U7ZA 1DS5A 3ZC5A 5AIRA 3MY5A 3ORIA 1W84A 2F7XE 5EDRA 5HG5A 2H9VA 4ASEA 4JG6A 4TY1A 2HAKA 4QMUA 3JVSA 4E26A 3FBVA 3FLWA 3MB6A 3R9DA 3E3BX 3TZ7A 4JS8A 3QTSA 3BPRA 4UWYA 3BU6A 4FKJA 4QMMA 2QLQA 5JRQA 3TNIA 2C1AA 1H1RA 2QC6A 1Q5KA 2J7TA 4KS8A 3R9HA 1H27A 4JDJA 4IAZA 3PP1A 4D5KA 2NO3A 5CTPA 4MEDA 2OXYA 4AA0A 2J4ZA 3SOCA 2WMVA 2OJGA 4DEBA 5A6OA 4JBQA 4MYGA 4BCNA 3L8XA 5HVYA 3HECA 5CQWA 1IA8A 2A2AA 4EEVA 3NVMB 3S3IA 3LMHA 1I09A 3RPOA 2BMCA 1FVVA 3GT8A 1IA9A 3KRRA 3BHVA 1GJOA 2C4GA 2PK9A 1Q8TA 4FZAB 4LOQA 3CXWA 4H1MA 4OW8A 4XOYA 3NEWA 5CU2A 3SDJA 4E4NA 4IMYA 5CZHA 5KKRC 2PSQA 3UC4A 3FLYA 3FMLA 5CVFA 1XH4A 5D41A 2ERKA 2ZM3A 3R1QA 4QTCA 4M69A 5EM5A 5ACKA 5LOHA 3MESA 3QCXA 4FSWA 4A4LA 2XK7A 4U81A 4TZRA 4C4EA 5DE2A 3OBJA 4TWNA 3LKMA 1BYGA 5A4LA 5F20A 2WMTA 1ZY5A 2C3JA 4EOMA 3KK8A 2XIKA 3DTCA 2WTCA 4H05A 3VBYA 4USFA 2O5KA 1OITA 4FK3A 4KRCA 1ZMUA 3IONA 4PDOA 4WHZA 5IUIA 4GG7A 4QYFA 2VTLA 3WBLA 3BWFA 4HYHA 3DNEA 3H0YA 5AX3A 5DFPA 2PE1A 5HE3A 2JAMA 4W8DA 5I9XA 4ZTLA 3FY0A 2XIYA 4XH6A 3WZEA 4WUAA 1H26A 5JRSA 5TR6A 1IAHA 2UVZA 2BVAA 2BAJA 4NM7A 3FI2A 1M2RA 5HLWA 4JI9A 4EI4A 4ANNA 3C9WA 4EHGA 2Y4IC 2IJMA 4FV0A 5ANKA 2B55A 3Q32A 4RJ8A 4BI1A 3UQFA 4EH2A 4XG7A 4FEVA 4X21A 3SKCA 1PXPA 3W18A 5HZNA 5A4EA 5M4UA 4FTRA 5BUEA 3Q52A 4GSBA 4FTTA 3FMKA 5AR3A 1H4LA 3PJ3A 3QWJA 3QTIA 3FLNC 2J2IB 1UVRA 4OTFA 4J97A 2CN8A 2YM7A 3PTGA 1KE7A 1R3CA 2QO9A 2HZNA 1RJBA 5AUXA 4KB8A 4FTNA 4QYEA 4U44A 1ZMVA 2W1IA 3CP9A 3PG3A 3MIAA 4ERKA 2VX3A 2WHBA 5AV0A 3UO6A 5IEVA 3I0QA 4EH5A 3ZDUA 4GUBA 4RIYA 4ASDA 3ZLSA 4XG4A 3F61A 4X2NA 3DZQA 1IASA 3QUPA 2QO7A 2HWPA 2J50A 2BKZA 4RX7A 3ZRMA 4EZ7A 3NW6A 4AZSA 2QURA 3TZMA 4BDBA 1OI9A 2C6TA 3KXGA 2XKFA 4FSNA 2AC5A 4C57A 2XA4A 5BVFA 2JIVA 2UZNA 1K9AA 1YWRA 1ZWSA 2OJ9A 3AGMA 3P78A 3QUDA 4L43A 4CGAA 4ZMEA 2A1AB 2BFXA 4RIXA 3KMWA 4H58A 3FPQA 4QMOA 5L2QA 2OIDA 4MKCA 4RWLA 2ZJWA 1WVYA 2YEXA 3F2NA 4DINA 5M57A 3OXZA 2FB8A 2VNYA 2QOOA 2R7BA 2OG8A 1W7HA 3DAJA 2UZTA 4OBQA 4HOKA 1UU8A 2IPXA 4BTFA 3A7HA 4GK2A 1YDSE 4I3ZA 3RTPA 3R9RA 3A61A 5AUTA 2YAAA 1FINA 2HYYA 3V8WA 4AW5A 3UE4A 4UMPA 2IWIA 2V62A 2ZV8A 4D2TA 5EOLA 5IUGA 1R1WA 2C3LA 3FZTA 5GHVA 3FMNA 4DT9A 4ZJIA 3C7QA 5D11A 4U80A 3QTWA 2ITXA 5HE0A 4ACGA 4BGHA 1AQ1A 2H34A 4K77A 3V04A 4FTJA 3HUCA 3PIXA 4YC6A 4H3BA 2VV9A 4QPAA 2Y9QA 4D58A 2OZOA 2PVYA 3EQPA 3ORXA 3QGWA 4R3RA 4X2GA 3DXNA 5GJGA 3A7JA 1NVQA 2X6EA 5CENA 5AUZA 4TL0A 1SNXA 3HRFA 3PXZA 2Y6MA 1OUKA 3MI9A 1G5SA 4M13A 3KC3A 4F6UA 2NPQA 2OW3A 2X2MA 2VGPA 4I4FA 4RSSA 3TWJA 3VBQA 4BL1A 2Q0NA 3IECA 2VTMA 4CZTA 2GHGA 5HCXA 1CDKA 1OL5A 1MRUA 2OH0E 2QOFA 2VO6A 3ZUUA 2PYWA 3OY1A 4OBPA 4APCA 2PUIA 4RGJA 1DI9A 1S9JA 1DM2A 4XCUA 3UVQA 3FZOA 3DS6A 4QQ5A 2R0IA 3N9XA 2JIUA 1M14A 5EI2A 5IKWA 2Q83A 3CSVA 3A4PA 4FEUA 5H9BA 4YZBA 5HCYA 4F65A 4PTEA 4EK4A 4IX4A 1OB3A 3QXPA 3RCDA 4D1ZA 2GSFA 2RFEA 5HI2A 1PKGA 4YJTA 4F08A 4UX9A 1G3NA 3QA8A 4BY9E 2HZ0A 1YXTA 4LMNA 4CXAA 4FTIA 4L7SA 4RPVA 5E91A 2GS6A 4F9BA 3EB0A 4QP4A 4C62A 3EYHA 2OFVA 4YO6A 3F5PA 3TTIA 3W8QA 4IW0A 2QKWB 2YLFA 4HJOA 2BHEA 3GEQA 3FC1X 4NEUA 4WNMA 4YJOA 4C4HA 5ITAA 3UPZA 3DAKA 3LJ1A 3EKKA 4E20A 4MNEA 2QG5A 3TKIA 3PVUA 1A06A 3RMFA 2PVNA 2PVFA 4CQEA 2WQNA 3ENMA 3MH3A 5IA3A 3DJ7A 1KV2A 1M7NA 3Q9ZA 3BZ3A 3IQ7A 4JAJA 4DFZE 4NYEA 1ZOEA 3I1AA 4DCEA 3KXZA 4NCTC 3OP5A 4QMLA 1LP4A 4XYFA 1OL6A 3EOCA 3VIDA 2VTAA 3P7AA 4L7FA 5L2TA 3UIMA 1CKIA 3NAXA 3IW6A 5I9YA 3UC3A 4WA9A 3PFQA 4S30A 5M4CA 3ZTXA 4CCBA 3LAUA 2WTWA 2OI4X 3BHHA 5IQDA 2WIPA 2YIYA 2QU5A 3FJQE 4YJSA 5C8KA 3C4FA 4TYHA 4X2JA 1LUFA 2FO0A 3SRVA 5DMZA 2OU7A 4ZZNA 4I0TA 2WO6A 4QMYA 4HGEA 1CSNA 1YOJA 3HV6A 3COMA 3M42A 3VBVA 3U9NA 3TACA 1H01A 4E7WA 3JPVA 3ZM9A 3DKOA 4LGHA 2JD5A 4DGLC 5HKMA 4IAKA 1UU7A 3PE1A 4WNPA 4DFNA 4H3QA 5JEBA 5IQHA 5JMSA 2YIWA 3GCQA 1GZKA 3SV0A 2WU6A 3LMGA 5I5ZA 3O7LB 2GCDA 3G9NA 4YU2A 1BMKA 2CCIA 5IUHA 1VR2A 2YM5A 3UOHA 1UU3A 3ORPA 3QD2B 4IH8A 4XS2A 4AP7A 3MN3A 4DLIA 5KMOA 3ATTA 2C5XA 2HOGA 4FV5A 4JAIA 4BHNA 2JGZA 1R0EA 4R77A 5E8XA 1J7LA 2X8IA 4EOJA 5CT0A 2EUFB 5AUYA 5JFSA 3IK3A 3DFAA 3KULA 4AOJA 3OROA 2R9SA 5M53A 3DK6A 3LIJA 3PY3A 4V05A 4BVUA 2OJIA 1PXJA 2WQBA 4FOBA 5ANOA 3EQGA 3FPMA 4U5JA 4G3EA 5JZJA 3DV3A 2VO0A 3I5ZA 4IACA 2YFXA 3LCSA 4B0GA 5IQAA 3NUXA 4TRLA 3UIBA 4IVCA 4F1MA 2X1NA 4E5AX 2XF0A 3PUPA 1CM8A 4U43A 4GIHA 2IO6A 1Y91A 4J98A 2ZDUA 4KKHA 3KF4A 4FODA 3HMMA 4IZYA 3R0TA 4JT3A 3PA5A 2JKOA 3RPVA 4CZYB 5CXZA 1BKXA 3F5UA 3NWWA 3IPHA 1OL7A 4C7TA 1UWJA 4HVIA 4Q9ZA 4PTGA 3LM5A 2Z7LA 3HLLA 4U9AA 4GVJA 3VRZA 2B0QA 5BVWA 2PUNA 4HVGA 3GU5A 4P5ZA 4W8EA 3U4WA 3LXKA 3T9IA 4F63A 3C50A 3D0EA 2UVXA 3NAYA 3ZXZA 4C3RA 4D28A 2BZJA 4KBKA 4KS7A 4C02A 4CFVA 2GNLA 3R8ZA 5TOZA 4MNEB 3ACKA 4RZVA 2XYNA 1H0WA 4QMWA 2EB3A 3PJCA 4FVRA 5ETAA 4A9SA 2UZLA 3Q6UA 3N4UA 1OKYA 1Q3WA 4O84A 4XOZA 3QZFA 2QVSE 4ZLZA 4XLVA 4IX3A 4PUZA 5HESA 1UA2A 1XH9A 3SD0A 4CT2A 2CKEA 2JAVA 3GGFA 4RVTA 5F1ZA 2BRNA 3KRWA 1DAYA 3N51A 4GKHA 5CASA 4D1XA 2QHNA 4FI1A 4AW2A 1UNLA 4MF0A 4GMYA 5HNBA 3ZEPA 2XCKA 4DBXA 2FSOX 2R3LA 2WTKC 2VTRA 3OT8A 4M97A 4EUTA 4FE2A 1PXOA 3SRVB 3DNDA 4O96A 2PZYA 3F5GA 4LGGA 3ZOSA 5HNGA 2EB2A 2YLEA 3FQHA 2C69A 2GHLA 3LFQA 3MPAA 2A4LA 2BRGA 4ZSEA 5LMKA 3ZC6A 4P7EA 3D7TA 3HMPA 2NRUA 4TWOA 4YTCA 5LWNA 4FYNA 2UZVA 2YCQA 3OF0A 2W4KA 5FQDC 4FV4A 4ASZA 4D4YA 4AOTA 4BTMA 3WARA 3V51A 1F5QA 3ULIA 2PMLX 2J5FA 1JOWB 4OTGA 4M3QA 4IAAA 4O83A 3LXNA 3COIA 4G6NA 3GU6A 1RW8A 3QXOA 1J1BA 2R5TA 3HMIA 1B39A 2QOQA 5AM6A 3GOKA 1ZYCA 2W0JA 4UXQA 2XNBA 2JDRA 1GAGA 2ERZE 4D1SA 3D94A 5HLPA 5KO1A 4AS0A 3QLGA 5L8KA 4XEYA 3KXHA 3NLBA 4DYMA 3NYVA 2BUJA 3GNIB 3FQEA 1G8AA 3CC6A 2X39A 1HCKA 4AA4A 3KULB 4J1RA 3NX8A 4TYJA 3KRLA 5CF5A 5A46A 4R6VA 4D55A 5JKGA 2VN9A 3RI1A 3LFEA 4QQCA 3MVLA 3UNZA 3V6SA 2GNIA 3MY0A 3NNWA 3BYVA 4O0YA 5EKOA 2WEIA 3IW4A 4IADA 5FTOA 3BV3A 1EH4A 3KU2A 5FBNC 2VWWA 2BRHA 3BLRA 4ASXA 2O64A 3BV2A 1W82A 3EN7A 4RRVA 4OT5A 4E4MA 4ALVA 3H30A 4L67A 3HV3A 2OGVA 3EFKA 4D5HA 2WGJA 4XUFA 4WT6A 4FZFB 1WBPA 3TJCA 2XUUA 4NKSA 3GCVA 5CQUA 4CLIA 5AR7A 2IW6A 4AGCA 1O6LA 3UZRA 2HXQA 2YISA 4AX8A 4DFBA 5L2SA 3A60A 4YO4A 4FKOA 1MP8A 3R8UA 3CPCA 3FZRA 5FRIA 5IQFA 2BIYA 3R04A 4X2KA 3LFDA 4DEDA 3R7GA 4YSMA 4JJRA 4LUEA 2ITOA 4AZWA 4D2RA 5HG9A 4X3FC 4ACDA 4DA5A 2CN5A 5KE0A 1WVXA 4EWHA 5EOBA 2HY0A 2PL0A 4LYNA 2EXEA 5KMNA 3SXSA 1TVOA 3B2WA 2UW3A 3EZRA 4HYIA 5LJJA 4O7ZA 2E9PA 4Y73A 4EC8A 4HPUE 3D15A 1YOMA 4YJPA 4F1OA 4ZMFA 1XQZA 4G3GA 4RQVA 4AE9A 3ZUVA 1NVSA 4O6LA 2C6MA 4QYHA 5CXHA 1QL6A 3U8WA 3PJ2A 3BYOA 4E6AA 3COKA 3OOGA 4C59A 1PXMA 3EN5A 4DFUA 4Q5HA 3TNHA 3VRYA 5HBJA 4B4LA 2GNFA 1E9HA 4QMXA 5TF9A 3FSKA 4U3YA 4XP3A 1M2QA 4RFYA 3PY1A 5KBQA 4HGSA 3DY7A 4GYIA 1CTPE 4PL3A 3Q9XA 4TKSA 4JQEA 1OMWA 2W9FB 3A7GA 1TQMA 3NGAA 4NTTA 3IOKA 4ZY4A 3P4KA 1Q8ZA 4L3JA 5FEDA 4X2FA 3V5LA 3D7TB 3D7ZA 4W4YA 3K5VA 4ITIA 3O96A 3PIZA 4JNWA 5G6VA 4FNWA 5HCZA 1WBSA 4HNIA 4AW1A 1J7UA 3CTQA 5DRBA 5C01A 3RVGA 4FIHA 4RWIA 5A9UA 1FVRA 4EOLA 2IVUA 3LFNA 5AMNA 1ZOGA 2IVVA 4HZRA 4LL0A 2XZSA 3AMAA 4N70A 3HDNA 1U59A 1Z5MA 3LFSA 4UY9A 1T46A 4IFCA 4EBVA 4AUAA 5IPJA 5HIBA 2BFYA 3A8XA 3Q2JA 1BL7A 2GHMA 3I60A 3PXFA 4FTQA 4NUSA 5EW9A 2ITUA 3BBTB 3R01A 4TTHB 1XH7A 1M17A 2C6OA 2J6MA 4YC8A 4AOIA 3UZTA 3AC2A 3R1YA 5HO6A 4YUQA 3R1SA 4QTDA 3LQ8A 4YZNA 3PPJA 5CT7A 5EI6A 3PSCA 1L8TA 2CLXA 5DBXA 4QMQA 3U54A 3R1NA 4FKSA 4IC8A 4YP8A 3Q96A 1OPJA 4P90A 5ANIA 5KBRA 1GY3A 2YZAA 4QP8A 3QAME 2X2KA 4ZSAA 3KVWA 3VS5A 4PDYA 3RWPA 4PP9A 4HVDA 4NSTA 5HGIA 3WYYA 3O0GA 4RA5A 5KX8A 2VD5A 4MBLA 3BEGA 3KQ7A 3H4JA 4KIKA 5CEMA 3FXWA 5IQBA 1XH8A 4BGGA 4FTCA 2HK5A 4RVLA 2G2FA 4WRSA 4JBVA 1WBTA 2XIZA 1WVWA 3AT2A 4QQJA 5GJFA 5BYLA 3QCQA 4AN3A 3TDVA 1ATPE 5ANDA 2B9HA 2VTIA 5FEEA 4EONA 4ACHA 2JKMA 2IW8A 2C6LA 4M15A 4II5A 4F0GA 5CF6A 2BDFA 2CGXA 4HZSA 4FT3A 3RNIA 5J95A 3VUKA 4E6QA 4JIKA 1XWSA 5EW3A 4EBWA 4DC2A 4ID7A 4FV9A 3C4EA 3OW3A 3HA8A 5DN3A 3AD6A 4RWJA 3QF9A 4K33A 4ZK5A 3ZBXA 3QD4A 3RZFA 4USEA 3ZFYA 5LWMA 3EMGA 5KHXA 4KRDA 3Q5ZA 4XG3A 4F9WA 5CU4A 5AWMA 4CZUA 2R3NA 4MK0A 4B6LA 4USDA 4R5YA 4QP9A 5LXMA 2UZDA 3F3UA 3V5TA 1OKVA 2A19B 3FHRA 2ACXA 3ROCA 3JYAA 3TV6A 3Q6WA 4WSYA 2GFCA 4NW6A 3E7OA 4RIOA 3E8EA 5JQ5A 3O17A 3ORZA 5AUUA 4FKGA 4L9IA 5I4NA 1JWHA 5CEIA 5IG1A 3DXPA 5F4NA 4YHJA 5EK7A 3RPYA 2XBAA 3KRJA 4FSTA 4MXOA 4H3PA 2GDOA 3RK5A 3ZSHA 3WI6A 3L8VA 1WBWA 2ZAZA 4BTKA 5J9LA 3B8RA 3H10A 2O63A 1AGWA 3MB7A 3S00A 1XH5A 3V5QA 4E5BA 3W8LA 4TXCA 2BTSA 5JGBA 3H3CA 3KMMA 3FSFA 3G15A 3HNGA 4O7VA 3PIYA 4GG5A 4IFGA 3DOGA 2ZMCA 4DH1A 4JQ8A 4IANA 4FF8A 4TWCA 2IZUA 4XRJA 2W4OA 2RKUA 4A06A 2J0IA 4DHFA 1GOLA 4DG2E 3NUAA 5LVOA 3QRKA 3F82A 4M66A 5EYCA 2W1EA 4P2KA 3TEIA 1W98A 1XJDA 3H9RA 5M56A 5AAFA 5B2MA 3NIZA 3O2MA 1OIRA 3FLSA 2BZKB 4ZSGA 5A14A 3PLAE 2ZDTA 1SVHA 3NCGA 3GQLA 4QYGA 2I1MA 3GU8A 3FI4A 4OTQA 1FMOE 4S34A 1JVPP 3OMVA 5EDPA 1MRVA 5FM2A 2C47A 3PDTA 3ERKA 3CBLA 1STCE 2XEZA 5EYKA 3FUPA 2C6EA 5AV3A 5AAGA 4A4OA 2ITNA 4IBMA 5L8JA 4BDHA 3E8CA 1Q61A 2VAGA 2DWBA 3MS9A 3PJ8A 1PYXA 2CGWA 4QRCA 5DPVA 3K2LA 4TNDA 5CNOA 3C4XA 4BGQA 5M44A 1TQPA 3I0OA 3R7VA 5HORA 4N0SA 4FOCA 2CNVA 3VHKA 3JY9A 3NSZA 4FSYA 5A4CA 1V0BA 4X3FA 3VAPA 4I6HA 3CTHA 4IB3A 3VBTA 4A7CA 3FC2A 1W8CA 4YGAA 4CG9A 2QR7A 2YWVA 4BDCA 3RKBA 3PXRA 4BKJA 3BX5A 4AG8A 4F70A 5E8ZA 1KSWA 4CVAA 3DXQA 3NZ0A 2CCHA 5CSHA 4NM0A 3R8VA 4AGDA 4KIKB 3IW5A 3FY2A 3O23A 4DTKA 4L52A 2W4JA 3V01A 3TNQB 3V5JA 4RA4A 5EHLA 5GZ9A 3U6JA 2QOCA 2YDIA 4O38A 4PMSA 2ITWA 5CU3A 2BZIB 5BPYA 3QBNA 2QD9A 5H3QA 3FXXA 4YJNA 2XNNA 2UW6A 5AV2A 4BBEA 5DR6A 4UMRA 3DFCB 4CV8A 3NVKI 1VYWA 3EKNA 2JBOA 3OUKA 5K5NA 1UKIA 3A4OX 3DKCA 3VHEA 4CFUA 1G8SA 3UNKA 4MWHA 4O0VA 3NW5A 2VGOA 3QTRA 4FGRA 3I81A 1OUYA 5IQEA 3SG9A 5E8UA 4ANSA 3RCJA 2CGVA 3POZA 4G3FA 1MQ4A 5T68A 5CEOA 4G5JA 4OTWA 5CWZA 3EN9A 5CF4A 2WIHA 3K54A 4DAWA 3QHWA 3TKUA 5GJDA 2OSCA 2JFLA 2IVSA 4CEGA 3E88A 2C0OA 5BVOA 2JIIA 4QP2A 4WO5A 4EH3A 5M4FA 4O91A 4D2WA 5EDQA 4ANBA 5L6OA 2ITZA 4JQ7A 4XJ0A 4S31A 4ARKA 3RP9A 3ZONA 1U5QA 4BRXA 2XK6A 4J99A 2RFSA 2SRCA 5IQCA 3ZH8A 3NR9A 4PL5A 4IDTA 2UZWE 3GI3A 1LR4A 2WTVA 4L6QA 4CYIA 2C1BA 3ZZWA 3UDBA 4C3PA 3O7LD 3OCGA 3OBGA 3F3TA 3FZ1A 4MXXA 2W17A 1WCCA 4QTAA 4U3ZA 2HXLA 2Y6OA 4FZ6A 4RG0A 4Y8DA 3UYSA 1A48A 3MH2A 5D10A 4FKIA 1FBNA 4J53A 2C0TA 3OG7A 2YM3A 2WMWA 4AWIA 4BR3A 4Z7GA 3OY3A 4GFMA 4QPMA 4CG8A 3LW0A 4F9YA 3FWQA 2YIRA 4FT5A 4YZ9A 2CSNA 3W2OA 2C5YA 3OCBA 5C27A 4IB0A 5JFWA 1VYZA 4UYAA 5I0BA 2ITVA 1KOAA 2B9JA 1Y57A 3W1FA 2XS0A 5DLSA 4I22A 3IW7A 5D7VA 3EQBA 3TCPA 4F9CA 3UTOA 3RWQA 3UBDA 5BVKA 3GC7A 3MY1A 3HZTA 4P5QA 2V0DA 4L8MA 3DPKA 3GC0A 3PXYA 3FAAA 4ITHA 2ITTA 2E2BA 5D1JA 3RNYA 1OBGA 4JR7A 2R2PA 3L8SA 3DK3A 4I0RA 4K11A 4CMOA 2B54A 2P3GX 2X7GA 3E8DA 4CTBA 5IA4A 5AUWA 3DT1A 1P14A 4D2SA 2P2IA 3HV7A 4FNZA 3TT0A 4FVQA 2CKPA 3P79A 5G1XA 3QQLA 2UW8A 4FV8A 4CV9A 4YLKA 4YZMA 1YHVA 2B4SB 4CFNA 4GW8A 5GNKA 3OXIA 4MX9A 3L9MA 3VC4A 4XG6A 4AAAA 4ALUA 3VUDA 1JSVA 2B9IA 2BTRA 4RQKA 3RAHA 4YSJA 3KKVA 4APPA 1REKA 3BU3A 4UXLA 5C4LA 3BYMA 1YXVA 3DBQA 1IEPA 4GS6A 1YQJA 2R3IA 4FGBA 5EW8A 3WZUA 4IAYA 5CAUA 3RM6A 5HU9A 3QQHA 2PVMA 2PVLA 1P2AA 2JKQA 4UBAA 2QHMA 4UYNA 5CY3A 5HEZA 3DLSA 5KZIA 3MTFA 4D0WA 4O86A 5LCJA 3F3ZA 3W33A 1OPKA 3OT3A 5HIDA 3TZ8A 2BCJA 5A4TA 2Y0AA 5CEKA 2QG7A 3VQUA 3HX4A 4G34A 5E8SA 4M69B 4RLLA 4DE4A 4YZDA 2Z7RA 3E3PA 2P4IA 4C4GA 4G17A 5IA2A 1OVEA 4BCQA 1M52A 4F64A 3BHYA 3QTUA 5A54A 5M06A 2YM8A 3FMDA 4JX3A 3BHUA 2WMBA 3OWLA 1CKJA 4BICA 4GU6A 3TUBA 2WU7A 4RX9A 4JG8A 4RFMA 3ZU7A 4BWPA 2PZIA 3CD3A 3BCEA 2YITA 4LG4A 4WBBB 2IZTA 2ONLC 4BDGA 1XKKA 3NIEA 5JH6A 2X6DA 2HW7A 5HVJA 4A07A 2EXCX 2YIXA 3S95A 2VO3A 4R8QA 4AFJA 2QI8A 2QU6A 2B1PA 4GFOA 3R7EA 5BMSA 1NXKA 2QODA 3EN4A 1NW1A 3IDPA 3ZYAA 4YTIA 2W1CA 1PMUA 4OR5A 4Z55A 2JC6A 2QOHA 5CSPA 4U8ZA 2IG7A 4XV9A 3NNVA 4I6FA 3LJ2A 4CSVA 2J51A 1ERKA 4AN2A 3SGCA 2W99B 5BVNA 2QOIA 3NMUF 5M09A 4EOOA 4YNOA 5I9UA 1REJA 3I7CA 2CNUA 3LXLA 3F69A 1JBPE 3C13A 3DDPA 4CTCA 4V01A 3TUDA 5J5TA 1PXLA 4L44A 5IISA 4S33A 4ZAUA 1NY3A 1SM2A 5D12A 4IJPA 3QHRA 3LMIA 2ZV2A 3AC4A 5JN2A 2BRMA 4WD5A 3SHEA 1XR1A 3FL5A 4C3FA 3WZJA 3ANQA 4GRBA 4JRVA 3MA3A 4AZFA 5I3RA 3UJGA 3I4BA 3KFAA 4TPTA 3EQCA 5AA9A 2JITA 2F2UA 1H00A 2J0MB 2VX0A 3IGGA 3QA0A 2XRWA 4QO9A 4RIYB 5CU0A 1YOLA 3TDWA 3C4WA 4FZ7A 3PYYA 4L45A 3RK9A 4CFFA 1Q97A 1U4DA 3ALNA 3W2QA 4D2VA 3EHAA 4FIIA 5AAEA 1Q8UA 3LCKA 3P7BA 4KKEA 4IEBA 4F7LA 2ZM4A 4QP6A 4F4PA 1OPLA 5IH6A 2Y7JA 5C8MA 3VWAA 3R8PA 3M2WA 4RIXB 3IG7A 4D4RA 5HLNA 3BGZA 4U79A 4IDVA 1WZYA 5HE2A 2PVKA 3W55A 4UZHA 4O81A 3CEKA 3LPBA 1OL2A 1GZ8A 4JRNA 1YDTE 4KIPA 3S2PA 2X8DA 5I9VA 2GFSA 5EG3A 5C1QB 3QQKA 2QONA 2QQ7A 3FLZA 3QALE 2ETMA 4NIFA 3LQ3A 2A0CX 3QX2A 5JGAA 3E87A 3MA6A 4K0YA 1OL1A 2CKQA 1SZMA 5IDPA 2C68A 2JLDA 2O65A 2YJRA 2PZ5A 4C4IA 4PWNA 5TT7A 4DFLA 2CJMA 2FSLX 4EOKA 5B2LA 4YJVA 3U6HA 1PMNA 4PRJA 4BTJA 3VUHA 2UW7A 2OIQA 4NW5A 2IZSA 5A3XA 5CEPA 3UNJA 3FMEA 2QOKA 2E9UA 3FI3A 4LRKA 3TG1A 4TYEA 1GNGA 1XH6A 2WMXA 3LCOA 5FLFA 4RBLA 3ZFXA 4ZLOA 4RC2A 3R22A 2G1TA 4G5PA 3E5AA 3VS2A 5HOAA 3QC4A 4D4SA 4F09A 3HDMA 3ZSIA 3OWKA 3V6RA 2VTQA 5BUJA 2OWBA 2XK8A 4EYJA 2QOBA 1Q3DA 2E9NA 1WBNA 4FC0A 3HV4A 3U9CA 5FBOA 3R9OA 2CNQA 4BWXA 2C6DA 2ZV7A 3E64A 3VQHA 3VS1A 3WIKA 5JGDA 2WOTA 4EQUA 4C58A 3OHTA 3EL7A 2YACA 3ALOA 3GFWA 5D7AA 4L68A 3TL8A 4ANMA 4I21A 5E8VA 3HP2A 4RWKA 4XBUA 4NT4A 2G2IA 4BCOA 3EN6A 3H0ZA 2UW5A 4MWIA 2W5HA 3GU7A 4K6ZA 5HO8A 5IU2A 3Q53A 4PNIA 4DEAA 3K5UA 2XIRA 3PWDA 2F4JA 2ETRA 3PPKA 4LFIA 2Z2WA 3LM0A 1QPJA 4DCAA 3G6HA 4F9AA 3C4CA 4FBXA 4M67A 5ETFA 3W32A 3FLQA 2UZBA 2F49A 3QRTA 5K9IA 4QP1A 2KULA 3WF8A 1YHSA 2GPHA 4LV8A 2VWUA 4GV1A 4QNAA 1H08A 2QKRA 4BFMA 5IA5A 5CAOA 4L42A 1U54A 2OJJA 4R3CA 1KWPA 1PXKA 2UZOA 4M7IA 5H8BA 4D4VA 5KMLA 1PRYA 5AR5A 4UMTA 4XV2A 1YRPA 3NRMA 4GVAA 4D2PA 4I1ZA 3CE3A 4AFEA 5K0XA 2YWPA 4IVAA 3LOKA 3UP2A 3W2CA 3EQHA 3MFSA 5J87A 2QR8A 5JZNA 2XNOA 3CPBA 3PA3A 1SVEA 4TYHB 2XKCA 3TUCA 2R3FA 3LVPA 3PWYA 3PZHA 5CSXA 2UVYA 3LFBA 1IR3A 1S9IA 5EM7A 4AE6A 1YW2A 4A9TA 4C36A 2OIBA 4C61A 5C8NA 2XJ0A 1H1QA 3QGYA 3G6GA 2VTNA 4Y83A 4Y72A 5EM8A 4E4XA 3BKBA 3MIYA 3EQFA 1JKSA 4BDFA 2PMOX 3RPSA 5BUIA 5KKRB 4FUYA 1R78A 3L1SA 1L3RE 2OXXA 5ANEA 2I0YA 4FKPA 4X3JA 3WZKA 4BKYA 1ZOHA 1QMZA 4KD1A 1ND4A 2CKOA 3OXTA 4O2ZA 3UMXA 4CKJA 5J9YA 2R64A 2W1ZA 4QTEA 3ATSA 2CGUA 4F6WA 4FX3A 4J8MA 1K3AA 1KE5A 2YM4A 3HVCA 5H8GA 4RX8A 2XJ1A 3R9NA 4JBPA 4MH7A 4NIFB 3REPA 3O51A 3DCVA 3Q9WA 4GT5A 4JG7A 5IEYA 5HBEA 4EOIA 1GZOA 4JR3A 4LL5A 5EYDA 2VWXA 3K3IA 2X2LA 4M0YA 3A2CA 4O82A 4FKRA 4PPCA 4I23A 5HD4A 4DN5A 2BHHA 4HW7A 1YI3A 4GK4A 5CZIA 1TKIA 2JBPA 2PZRA 3NDMA 5E92A 1AD5A 3BWJA 4RZWA 4BC6A 3G0EA 3UVRA 2FSMX 2HENA 2VX1A 4QPSA 5I3OA 3A7IA 4DITA 3Q4ZA 2Y4IB 4EKKA 4R5SA 4IE9A 4DEHA 3D5WA 1QPCA 1GIHA 2LGCA 2RG6A 1U46A 2EXMA 2P33A 3AOXA 3PZEA 2R3KA 3MVHA 3QC9A 2BR1A 2E9VA 3R8MA 4H1JA 3VJNA 3L9NA 4F99A 2BDWA 3M1SA 3OWPA 1K2PA 2WXVA 3CY3A 4FKTA 3KREA 3E93A 4BDAA 2V5QA 4EOPA 4I5CA 4HCVA 1OZ1A 4B7TA 3GUBA 4UWBA 3ITZA 4BCFA 3F2RA 4G3CA 4RJ5A 3DA6A 4NCTA 3NYNA 2LAVA 4IM3A 3QRIA 3LCDA 4MXAA 3DZOA 3FKOA 2W06A 3E63A 3TXOA 2XNMA 5AR8A 4JDHA 4K1BA 1ZARA 3MH1A 3TNPC 1F3MC 2WPAA 3F66A 3R2YA 4Y5HA 4RLKA 5LVNA 3R30A 2B53A 4NL0A 3ZEWA 5M51A 4KABA 4G31A 4DH7A 5K4JA 4FL3A 3IKAA 3DKGA 5DWRA 5GZAA 4O1PA 3V8SA 5DEWA 4I6BA 5HBHA 2HZIA 2WELA 4DH8A 3BBWA 1PHKA 4I5MA 1Y8YA 2FUMA 4BDJA 2PE0A 1OIYA 4EYMA 5GINE 4R7HA 4X6QC 2QCSA 3QUEA 4NFMA 4FZDB 4QQTA 3CLYA 4BHZA 1PW2A 3SVVA 4A9YA 2R3RA 5CX9A 2WFYA 2BROA 4QYYA 5J5SA 3UOKA 3MWUA 2FGIA 4XG9A 4OLIA 5HG8A 3UOLA 1XBCA 4KBCA 4W4WA 4EHEA 1E1XA 3GP0A 4PPAA 5EYMA 4UB7A 5DR2A 3D9VA 4YPDA 2GU8A 4C2VA 2F7EE 4BZOA 4IZ5A 4G9CA 3T9TA 3VNTA 3IGOA 2OICA 4RVMA 3NNXA 5ICPA 2YIQA 3VN9A 4IQ6A 1GIIA 4LRMA 4BF2A 5AP4A 5CU6A 4BN1A 3R6XA 4RMZA 1OECA 3KB7A 1LEWA 1OIUA 2ITYA 4BCPA 4IXPA 3NUPA 3CCNA 4E6DA 3KCKA 5EQEA 2RF9A 4BZDA 2XKEA 3GFEA 4PV0A 3QD3A 4R78A 3WE4A 3ZM4A 2B7AA 3I6WA 3ZLYA 3OW4A 3ZZEA 4U45A 1W83A 4PDSA 3ZBFA 4ZJJA 4O7RA 4GT3A 2YM6A 5JSMA 3PXQA 4X7QA 3R7IA 5CI7A 4BCMA 2O2UA 4HYSA 3PVBA 1PMVA 2GNJA 5IMEA 4O0TA 4PY1A 3OWJA 5FEQA 3C51A 5CEQA 4FTAA 2OF2A 3PSDA 5IF1A 1MQBA 3EIDA 3MPMA 3ODZX 3QRJA 1YKRA 4QP7A 3BE9A 2IN6A 4YJUA 5BQ0A 3VUGA 4MCVA 3BGQA 4O22A 3VULA 3KXXA 3SAYA 4EQMA 5EI8A 4O27B 1JPAA 5CVGA 2PWLA 4FT7A 3F9NA 3CKXA 2P55A 2PMIA 5IEXA 4ZIMA 4GT4A 3B2TA 2YERA 1YI4A 4I93A 3FZPA 2DQ7X 4CKIA 1ZYDA 3MH0A 5ETIA 4BB4A 2WD1A 3SQQA 1ZRZA 4O7WA 4KKGA 4KSPA 4AN9A 2UW9A 2R3GA 1B38A 1PF8A 4PTCA 3HA6A 5E1EA 1J91A 4EL9A 4IX5A 5L2IA 3ID6C 4DLJA 3EFWA 3OEFX 3AGLA 2A27A 2NRYA 5CALA 4B8LA 4BI2A 1NA7A 3OEZA 3QWKA 4YPSA 5ANGA 2WQEA 3RPRA 2V55A 5CNNA 4DFXE 5CVHA 4CLJA 3U4UA 5J7HA 3RGFA 4ZY6A 2G15A 2XIXA 1MRYA 4MF1A 2PU8A 4CFWA 1Z57A 2CHLA 1Q41A 4ZLYA 2PUUA 2F57A 4FV1A 4DBNA 3KA0A 3QTXA 4EHVA 1VZOA 3QTQA 3R73A 2YDKA 4BIBA 3C5UA 4PDPA 2XJ2A 5AJQA 2XMYA 3OD6X 5DT3A 3T3UA 4FL1A 4PL4A 4ZY5A 3P23A 1YXXA 4H36A 4MTAA 5DA3A 4LM5A 4V04A 3F7WA 3TJDA 5BYZA 4I20A 2J0KA 4Z9LA 3Q3BA 3QCYA 4RX5A 2XK9A 3VW6A 1V0PA 5JFXA 4WNKA 5ACBC 5KUPA 3G5DA 4DGNA 2OFUA 4BI0A 1UNHA 4A9UA 5F94A 4QMNA 4AF3A 2AUHA 4BDIA 4DGMA 3BELA 3GCUA 4R3PA 3BQCA 3AD5A 3LE6A 4ZP5A 4ANQA 4N6YA 5FDPA 3R2BA 2VWYA 2IVTA 3QZHA 3FZSA 2WMRA 5M55A 4O0SA 3WZDA 3GOPA 2DYLA 4KAOA 2C5NA 4WSQA 3RBWA 2I6LA 3P9JA 4AA5A 5AM7A 4B8MA 1JKKA 4FV7A 4CRSA 4MXCA 2B52A 2H6DA 1XBAA 4NM3A 5E7RA 4MXYA 5J79A 4I5HA 3RHXA 4NZWB 4S32A 5BVDA 1Y6AA 2R3PA 4TN6A 3QKLA 3ZO3A 1RQQA 4BBFA 4GH2A 2G9XA 1BL6A 4O21A 4AZEA 2JDTA 4IWQA 1H07A 5I9ZA 3SA0A 4LMUA 2WQOA 2XRUA 4PF4A 4DF3A 2VTJA 4G16A 5KCVA 2C0IA 4NTSA 4O7SA 1JAMA 3R02A 4NJ3A 4A4XA 2BPMA 3N4TA 5E90A 3ROYA 5EHOA 4ZZOA 4EK5A 4Z3VA 5L6WL 3RM7A 2VTTA 4D9TA 4FKQA 3R63A 2ZVAA 5H8EA 4OAVB 4F7JA 4MHAA 3WIGA 5KHWA 5B7VA 3O8UA 1JSUA 2RL5A 2EWAA 4CFXA 1TQIA 2XKDA 4LUDA 4C38A 4DTBA 3VUTA 1J1CA 3R8LA 3RINA 3BI6A 4RJ6A 3BYUA 4ZTSA 1MUOA 3OCTA 1J3HA 3QD0A 5FXSA 3E92A 4E73A 4MD8E 2ESMA 4EKLA 4TYIA 5HTIA 5FGKA 3DQWA 3HMOA 2XP2A 5DH3A 3ZHPC 5FXRA 5EQYA 3DJ5A 1O6KA 3L8PA 4FIEA 5HTCA 2JFMA 5KZ0A 2C5VA 4HCTA 3WOWA 2X9FA 5T6KA 3VO3A 3VBWA 2PHKA 1X8BA 2WTKB 4ITJA 2ZOQA 4YNEA 5IQGA 5M4IA 2OO8X 4XP0A 3CJGA 5AP1A 4GK3A 3COHA 4MAOA 1R0PA 3WF5A 4EUUA 2G2HA 4ACMA 5CANA 2XK3A 4F7NA 5AP0A 2WMAA 4YR8A 5AA8A 1P5EA 1HOWA 4PX6A 3GCSA 3MDYA 3PRFA 5EH0A 4IAFA 4AXAA 3ODYX 2J0JA 2KTYA 5M07A 5IMXA 1RDQE 5HO7A 5KMIA 4ZTHA 3QKMA 4RC3A 4Q5EA 5FXQA 4D9UA 4FTUA 3DK7A 4FVPA 3G90X 3PSBA 4U40A 5AIKA 4BKZA 4M68A 2YCFA 3CJFA 5IZFA 3S4QA 5E4HA 1H0VA 2FVDA 3RHKA 4CQGA 2BILB 2Z02A 5J7BA 5FUTA 2WB8A 3N4VA 1KV1A 4JL9A 2REIA 4PMMA 4ZS4A 4N57A 3EYGA 3F3VA
chains in the Genus database with same CATH superfamily
4BIEA 5EFQA 3AMYA 4S2ZA 3KVXA 4DEGA 3D5XA 3K3JA 4IZ7A 4K18A 4IX6A 1ZYLA 3EH9A 3LZBA 4AT5A 2JDVA 5J1WA 4FTKA 4CKRA 3QQJA 3SW7A 3C1XA 4ORKA 4FKLA 3TIYA 1FGIA 3F88A 4QMPA 3TZ9A 1APME 3R71A 3C5IA 1UWHA 5DNRA 2WNTA 4FSRA 3W2RA 1UKHA 3NYXA 3ZO1A 4AU8A 5AX9A 5HICA 3ORMA 4XHKB 3UIUA 4PP7A 1H25A 3RK7A 4U97A 3DDQA 2F9GA 2J0LA 2YABA 4M84A 3VS0A 4EQCA 4O0RA 5JFVA 5EQPA 4QMTA 4ERWA 3R00A 3ZFMA 4EZ3A 4ENXA 1IG1A 5EHYA 5F9EA 2F7ZE 4E5WA 4ZSJA 2BKKA 2R4BA 4LDTA 2WEVA 3Q2MA 4EK8A 4UN0C 3LFCA 3MJ1A 2X4FA 4I4EA 4ONAA 5E8WA 4EK3A 5FDXA 3QU0A 4MUQA 4XV3A 4XV1A 4LOPA 4ZTNA 3GXLA 3VJOA 1JSTA 5CAQA 4XLIA 1ZXEA 3IDBA 3MFTA 4KIQA 5AV1A 1O6YA 2J5EA 4BBMA 4QMVA 2X0GA 4RT7A 4XG2A 4X6RA 2I40A 3QQUA 4RJ3A 1SMHA 4PNKA 2UUEA 3UPXA 4HNFA 4R1VA 4JX7A 4E93A 2DS1A 4RFZA 2W1FA 2O8YA 2BAKA 3CQWA 4X3FB 4G3DA 4FT9A 4YJQA 3FXZA 4C8BA 3E7VA 4WG5A 4ZSLA 4D0XA 4DG0E 2DUVA 3NUNA 4V0GA 4ANOA 4EH6A 4EH9A 5K4IA 3QQGA 2VTOA 5AUVA 3UG2A 4NFNA 3G33A 5CAPA 4O1OA 1SVGA 4IAIA 3CS9A 4GYGA 4M0ZA 4OUCA 4CMUA 5EM6A 3KN6A 4UALA 2OK1A 2XB7A 3AT3A 3BRBA 4YURA 3U55A 2HIWA 2VTHA 5KMJA 4OBOA 4Z7HA 3QFVA 3ENHA 2HELA 3KCFA 2JEDA 5T3QA 4HGTA 2ZB0A 4TT7A 4ZS0A 3IW8A 3OFMA 3FKLA 4LI5A 4EWQA 4XBRA 5L2WA 2OH4A 4M14A 3SG8A 5BVEA 4AT4A 4DEIA 4NH1A 1YVJA 3P7CA 5DYJA 3MSSA 1FGKA 3LXPA 5F95A 3T3VA 4MD7E 3ZSGA 1V1KA 2BIKB 2R3HA 4CCUA 5HX8A 1P4FA 3GBZA 1GZNA 4NJDA 3VBXA 5LMKC 4C4FA 1YWVA 4UEUA 2RG5A 3C0HA 3IO7A 5IH4A 4KUJA 2HCKA 2OBJA 2PE2A 1H24A 1W0XC 4YHFA 1FVTA 1Q24A 2B9FA 2UZUE 2WMQA 2WMSA 4FMQA 4I24A 5AP2A 3D4QA 2HW6A 3ZUTA 4DEEA 4ZTRA 2XNPA 4ANLA 5HNIX 2YCRA 3ORNA 3MJ2A 3OZ6A 3DQXA 3UMWA 5AP7A 4MQ1A 4O7TA 2GTNA 4B9DA 2OXDA 3W0OA 1B6CB 2OKRA 5AV4A 5BYYA 3IS5A 4YJRA 3F6XA 5TKDA 4FNXA 4NM5A 3UOJA 5FTGA 2VO7A 4E6CA 5LMBA 4O4FA 2W5AA 4BYJA 3PP0A 3KN5A 4O4CA 4BZNA 2PZPA 1QPEA 1UU9A 3C4ZA 3VW8A 3NUYA 2IZRA 4DGGA 5AP6A 2HY81 2WTJA 4XNEA 4WG4A 3H9FA 4HYUA 5HE1A 3POOA 4JDIA 4L01A 3HL7A 4BJJA 4J96A 1T45A 5HTBA 3UIXA 3LLAA 1H1PA 5JT2A 3QYWA 3QZIA 4I92A 2Y8OA 3QTZA 3HEGA 3HRBA 4J95A 4AZVA 4PQNA 3MYGA 4W4XA 4BWKA 3WF6A 3RAKA 4FEXA 5HQ0A 3BQRA 5FG8A 3ET7A 3I79A 3KK9A 2CPKE 4U42A 4C0TA 2WTIA 1XBBA 3EFLA 3DKFA 3P0MA 4KBAA 3GU4A 4YC3A 3SW4A 2GNHA 3TI1A 3SX9A 1BI8A 3U87A 3A62A 4XRLA 3JVRA 4IZAA 1H8FA 1Y6BA 2AEGA 4I5PA 5AP3A 4L3PA 3OS3A 4RC4A 4BCIA 3MV5A 4BDEA 3FYJX 5K0KA 2GQSA 1PY5A 3TM0A 3NW7A 4QNYA 4EH8A 4RIWA 5C03A 3SXFA 4AGUA 4BDKA 1JQHA 2W1GA 1E1VA 1ZY4A 2O0UA 3KGAA 4L3LA 2WKMA 3AT4A 4WNOA 5KMKA 1FOTA 4MD9E 3IDCA 4H39A 2XCHA 2I0VA 2ZMDA 5HG7A 4FV3A 5E1SA 2WOUA 3NS9A 1OIQA 4V0GB 2VUWA 2X4ZA 4IB5A 4IWPA 4AZTA 3QZGA 2GNGA 4PMPA 3SLSA 5GIPE 2P2HA 2BZHB 2YJSA 3PPZA 3DBDA 4GFGA 4IC7A 4LRJA 4QMSA 3LFAA 3W2SA 3HAMA 1CKPA 5AFVA 4ALWA 4K9YA 3UYTA 4JOAA 3HP5A 2W7XA 1RE8A 2ZYBA 2ETKA 4F7SA 4FEWA 2VTPA 2R0UA 1A9UA 3UQGA 1PMEA 2UW0A 4O0UA 3Q4CA 4BCGA 4FG8A 1YDRE 5AR2A 3AD4A 4J7BA 3W16A 4MBJA 2ITQA 5DI1A 1VJYA 1QCFA 5CF8A 4YMJA 3THBA 3DGKA 3FQSA 2QLUA 4YLLA 3AXWA 4GJ2A 5C4KA 4DH3A 4O2PA 1JNKA 3GQIA 4DG3E 3UO5A 1KE9A 1PXIA 1IRKA 1M7QA 4YTHA 3TV7A 3CQUA 1WMKA 3F3WA 3PLSA 4FG9A 5L6PA 1JKTA 4G6LA 1Y8GA 5DR9A 1Z9XA 1Q8YA 1WBVA 1SYKA 2QNJA 3MVJA 3VS7A 4MVFA 2Y4PA 3U6IA 2Q0BA 4BCHA 1ZYJA 3HMNA 1BLXA 2PVRA 4FK6A 4FT0A 4Q2AA 3ORKA 4IWDA 4FV2A 4YBKA 3Q04A 4FYOA 5JQ8A 3D83A 3H9OA 3R28A 1P4OA 2FA2A 4GCJA 3FI8A 2W9ZB 3NCZA 3JUHA 2R3QA 4ZOGA 1YI6A 2XAOA 4CMTA 4KA3A 3D2IA 4X0MA 1R39A 2FYSA 4B99A 4E4LA 2Z7SA 3HRCA 1ZYSA 2YA9A 4YTFA 5C26A 2VWBA 3JS2A 3W0MA 4ZTQA 1Q4LA 2JDSA 3AQVA 2OF4A 2YHVA 1Q8WA 4NKAA 4U6RA 3PA4A 4O6EA 3RAWA 4IB1A 2HWOA 2C30A 3MW1A 4E3CA 2WTDA 2RSVA 5CYIA 4PPBA 3CD8A 3GVUA 1LEZA 5M08A 2R3MA 4FG7A 2VWIA 4GEOA 1WFCA 2X7FA 3W2PA 5CSVA 3NYOA 5FTQA 2XM8A 3CQEA 1DAWA 2RFDA 4FTMA 3P1AA 4QMZA 2C5OA 3ZXTA 2VZ6A 4WUNA 4YLJA 4C4JA 3ANRA 1PYEA 4IIRA 4FNYA 1Q62A 4ZXTA 3RZBA 3UO4A 3UVPA 4AT3A 3WF9A 3TKHA 3I5NA 3R21A 4J52A 2XH5A 2EVAA 1OBDA 4PMTA 5HU3A 1H28A 2OZAA 1ZZ2A 5HVKA 5KNJA 4NWMA 4DGOA 5KMMA 5L4QA 1LPUA 3MPTA 5E8YA 5EKNA 3QLFA 4WOVA 5HHWA 5DGZA 3PRIA 4RIWB 1FMKA 3E8NA 3WF7A 4E8AA 3ORLA 2F2CB 4QEBA 3DBFA 3MBLA 1BX6A 2UW4A 3TYKA 3GCPA 5LMAA 5IDNA 2UV2A 4ZTMA 4FICA 3DBCA 3FHIA 3R7YA 2BAQA 4LQMA 3RALA 4FKVA 4JDKA 3WYXA 1ZAOA 5L8LA 4GL9A 2HZ4A 4OTIA 4FSZA 4MXZA 4QT1A 3U51A 2ONLA 1OKWA 4FR4A 2C3IB 3G51A 3UP7A 3OUNB 3VF9A 1XO2B 4Z16A 2BALA 4J8NA 3KRXA 4JXFA 4UMQA 3ZRKA 4Y95A 1XHAA 4GKIA 2I0HA 3KF7A 5DG5A 2VTSA 4FV6A 4GUEA 4WBOA 3KL8A 4CNHA 2CMWA 3BIZA 4BCKA 1WBOA 4KWPA 4BYIA 1GIJA 2ZM1A 3KEXA 4FTOA 4GIIA 3ZLXA 2RFNA 1Q99A 1URCA 3BEAA 3DU8A 3VS4A 5IH5A 1VEBA 3NPCA 4E1ZA 3D5VA 3OTVA 5GIOE 3AMBA 3LLTA 1OM1A 5J8IA 2C6KA 2BDJA 2E9OA 3KXMA 1YHWA 3E62A 3W10A 4N4SA 4EZ5A 4OAUC 3P5KA 4FKWA 4KSQA 3Q4UA 4Y85A 4LOOA 2BRBA 3FMHA 2Z7QA 3G2FA 3ZS5A 4DTAA 3MTLA 3BU5A 4U0IA 2GQGA 4OTHA 4I6QA 4W4VA 2QOLA 3PVWA 2GQRA 2R7IA 4CFMA 3O50A 3D14A 4IWOA 4WIHA 4OTDA 3QX4A 4AACA 4CD0A 2X7OA 1CMKE 5BX0A 3EWHA 3QCSA 4IJ9A 3R7OA 3OTUA 3MFUA 3UQCA 2XM9A 3UG1A 2P0CA 2C6IA 2H96A 3NUSA 4AQCA 3FDNA 3LFFA 4TYGA 4TWPA 3BE2A 1JKLA 5AR4A 2GMXA 4EOSA 3FL4A 4AW0A 4XX9A 3PJ1A 3GC9A 4FUXA 1PKDA 4ACCA 4K8AA 3HUBA 1SNUA 3D2KA 3S1HA 5I9WA 3BLQA 3ZDIA 4GJ3A 3UGCA 4RVKA 1ST0A 3AKJA 3SXRA 4FSUA 3ZO2A 3PE2A 4Q9SA 5A4QA 4ZJVA 1DI8A 3HKOA 3CKWA 4TNBA 5AP5A 4WG3A 5FP6A 4FKUA 1U54B 5B0XA 3F7ZA 5FD2A 4AXDA 3Q4TA 3V3VA 3UODA 4QTBA 4R7IA 3L9PA 2XNEA 3FE3A 4M12A 2ITPA 4L46A 3OC1A 1KUTA 4KIOA 4M8TA 1ZLTA 3MFRA 2V7OA 3V5WA 3KY2A 4L53A 2R3OA 3DAEA 1OGUA 2YDJA 4NU1A 2PPQA 1FPUA 3G0FA 4J71A 4DFYA 2PVHA 2XVDA 3Q9YA 5FWKK 4G1WA 2QO2A 2XK4A 3S0OA 2WQMA 1O9UA 5C9CA 3T8OA 3AC1A 2W96B 5DIAA 3Q60A 2XNGA 3JY0A 5E8TA 4DT8A 4IM2A 3ORTA 2FSTX 3F2AA 5AEPA 2CLQA 5HX6A 4ZEGA 5FM3A 2OZAB 3LQ5A 1M2PA 5A6NA 4HPTE 2PVJA 4FSMA 4AGWA 4FSQA 4UWCA 2XYUA 4C2WA 2PUPA 3W0PA 3R83A 4IM0A 3FMJA 3TN8A 4XG8A 2ZB1A 5BNJA 4WKQA 3ZMMA 2UZEA 5LVPA 4BIDA 3QQFA 2JKKA 5DVRA 2NNWB 3A7FA 1IAJA 3CIKA 4EOQA 3NNUA 3L9LA 5B2KA 5FP5A 1J7IA 2VNWA 4MBIA 4ENYA 1NT2A 1FQ1B 3DB8A 4OTRA 3HAVA 4HVHA 1PXNA 3BYSA 1YWNA 4YBJA 4EC9A 3O8PA 3C0GA 3PVGA 3EQRA 3TV4A 3ETAA 4C37A 5D9HA 2AQXA 4OGRA 5H2UA 1ZMWA 4FIGA 4JLCA 4O0XA 4YHTA 3WILA 2R3JA 2X8EA 2X0PA 1KE6A 4N6ZA 4CRLA 2W1DA 3ZCLA 5DEYA 3AC5A 3SOAA 5DT0A 4LV5A 4O7NA 2W1HA 4MQ2A 4NK9A 4EH4A 5LVLA 3MGYA 3RJCA 4JVGA 4CT1A 4C34A 3HV5A 4XMOA 3I6UA 4C35A 3QRUA 4G2FA 5TO8A 5DHJA 3LHJA 4Y46A 4HCUA 3ZO4A 4RJ4A 3VS6A 2X9EA 5CAVA 4TW9A 3QL8A 3RAIA 5GZ8A 1I44A 4DH5A 1H1WA 1YXUA 3OOMA 4F6SA 2VRXA 4P4CA 4Y5QA 4FTLA 3FV8A 3GENA 4O0WA 5E9EA 3EFJA 4FEQA 3OVVA 4A9RA 2PMNX 2WAJA 2ZV9A 3FYKX 4UMUA 5DT4A 2IW9A 3GB2A 5AADA 2W05A 3CGFA 2J9MA 4FIJA 1PJKA 3M11A 4R7BA 5IA0A 5L3AA 2O3PA 3B8QA 5BMMA 3HYHA 1KOBA 2WZJA 4G6OA 3FMMA 5K5XA 2CDZA 3JR1A 2NP8A 4LGDA 2YAKA 2I0EA 1WAKA 3HGKA 3IOPA 1ZZLA 3AC3A 2PTKA 3EQIA 4QOXA 3FEGA 5IQIA 5CI6A 2WMUA 3C0IA 3VONA 3QKKA 2JDOA 1U5RA 3A99A 2VWVA 3EZVA 5DRDA 2XBJA 4IVBA 5ANJA 5ETCA 5LARA 3VUIA 3BGPA 2C3KA 3V8TA 4R1YA 4HVSA 5J9ZA 4F1TA 3AC8A 3NUUA 4KINA 2VWZA 4BDDA 2W5BA 3QYZA 4EJ7A 3DJ6A 3ACJA 3FKNA 3BLHA 3DBEA 2VU3A 2X81A 4KNBA 4RJ7A 3OCSA 4UV0A 4WRGA 2YN8A 4L00A 3ZRLA 5HIEA 4U41A 5LVMA 3EL8A 3PG1A 4I41A 2H8HA 3TTJA 1OKZA 3TNWA 3O71A 1URWA 1UV5A 4JBOA 4QD6A 1H1SA 2XEYA 5CSWA 3EJ1A 4MNFA 2XARA 4O7LA 3MVMA 3TIZA 4UZDA 4K2RA 3CTJA 2PULA 3SC1A 1HCLA 1QPDA 5CLPA 3CGOA 3A8WA 3G9LX 3O8TA 4FL2A 4F0FA 2PY3A 2V22A 3V5PA 4EH7A 4W9WA 4F0IA 3LCTA 4I0SA 2V7AA 3ULZA 3UZPA 3BHTA 4FA2A 4IVDA 2G01A 2RGPA 3CY2A 3GC8A 4QP3A 2J90A 5HD7A 5IA1A 2AC3A 4EHZA 3W0QA 5LQFA 5K3YA 3VS3A 3DB6A 3VF8A 2GS2A 3ELJA 3DLZA 3P86A 1YXSA 4CYJA 2Z60A 3F5XA 3DTWA 2YCSA 4G9RA 3KXNA 3I7BA 2GTMA 3PY0A 1UNGA 3AG9A 2FH9A 2GS7A 4AXFA 4EK6A 2EU9A 4XP2A 3Q5IA 3WE8A 4BCJA 4IHPA 3CR0A 3VVHA 3D5UA 4JIAA 4W9XA 4HGLA 4EJNA 5JK3A 4I94A 1BUHA 4OT6A 4OTPA 3ZLWA 2I7QA 2RIOA 1KE8A 1F0QA 2Z8CA 4FIFA 1NVRA 5CS6A 3KMUA 3EQDA 2OJFE 2AYPA 5LCKA 3VUMA 1JLUE 3II5A 4GU9A 3R7UA 3JXWA 2OLCA 1BI7A 5TE0A 4YZCA 3PXKA 4O4EA 2YZLA 5DOSA 4EORA 1V0OA 4O7YA 5J1VA 4C33A 3P08A 3LJ0A 4ZZMA 4U7ZA 1DS5A 3ZC5A 5AIRA 3MY5A 3ORIA 1W84A 2F7XE 5EDRA 5HG5A 2H9VA 4ASEA 4JG6A 4TY1A 2HAKA 4QMUA 3W0RA 3JVSA 4E26A 3FBVA 3FLWA 3MB6A 3R9DA 3E3BX 3TZ7A 4JS8A 3QTSA 3BPRA 4UWYA 3BU6A 4FKJA 4QMMA 2QLQA 5JRQA 3TNIA 2C1AA 1H1RA 2QC6A 1Q5KA 2J7TA 4KS8A 3R9HA 1H27A 4JDJA 4IAZA 3PP1A 4D5KA 2NO3A 5CTPA 4MEDA 2OXYA 4AA0A 2J4ZA 3SOCA 2WMVA 2OJGA 4DEBA 5A6OA 4JBQA 4MYGA 4BCNA 3L8XA 5HVYA 3HECA 5CQWA 1IA8A 2A2AA 4EEVA 3NVMB 3S3IA 3LMHA 1I09A 3RPOA 2BMCA 1FVVA 3GT8A 1IA9A 3KRRA 3BHVA 1GJOA 2C4GA 2PK9A 1Q8TA 4FZAB 4LOQA 3CXWA 4H1MA 4OW8A 4XOYA 3NEWA 5CU2A 3SDJA 4E4NA 4IMYA 5CZHA 5KKRC 2PSQA 3UC4A 3FLYA 3FMLA 5CVFA 1XH4A 5D41A 2ERKA 2ZM3A 3R1QA 4QTCA 4M69A 5EM5A 5ACKA 5LOHA 3MESA 3QCXA 4FSWA 4A4LA 2XK7A 4U81A 4TZRA 4C4EA 5DE2A 3OBJA 4TWNA 3LKMA 1BYGA 5A4LA 5F20A 2WMTA 1ZY5A 2C3JA 4EOMA 3KK8A 2XIKA 3DTCA 2WTCA 4H05A 3VBYA 4USFA 2O5KA 1OITA 4FK3A 4KRCA 1ZMUA 3IONA 4PDOA 4WHZA 5IUIA 4GG7A 4QYFA 2VTLA 3WBLA 3BWFA 4HYHA 3DNEA 3H0YA 5AX3A 5DFPA 2PE1A 5HE3A 2JAMA 4W8DA 5I9XA 4ZTLA 3FY0A 2XIYA 4XH6A 3WZEA 4WUAA 1H26A 5JRSA 5TR6A 1IAHA 2UVZA 2BVAA 2BAJA 4NM7A 3FI2A 1M2RA 5HLWA 3P5JC 4JI9A 4EI4A 4ANNA 3C9WA 4EHGA 2Y4IC 2IJMA 4FV0A 5ANKA 2B55A 3Q32A 4RJ8A 4BI1A 3UQFA 4EH2A 4XG7A 4FEVA 4X21A 3SKCA 1PXPA 3W18A 5HZNA 5A4EA 5M4UA 4FTRA 5BUEA 3Q52A 4GSBA 4FTTA 3FMKA 5AR3A 1H4LA 3PJ3A 3QWJA 3QTIA 3FLNC 2J2IB 1UVRA 4OTFA 4J97A 2CN8A 2YM7A 3PTGA 1KE7A 1R3CA 2QO9A 2HZNA 1RJBA 5AUXA 4KB8A 4FTNA 4QYEA 4U44A 1ZMVA 2W1IA 3CP9A 3PG3A 3MIAA 4ERKA 2VX3A 2WHBA 5AV0A 3UO6A 5IEVA 3I0QA 4EH5A 3ZDUA 4GUBA 4RIYA 4ASDA 3ZLSA 4XG4A 3F61A 4X2NA 3DZQA 1IASA 3QUPA 2QO7A 2HWPA 2J50A 2BKZA 4RX7A 3ZRMA 4EZ7A 3NW6A 4AZSA 2QURA 3TZMA 4BDBA 1OI9A 2C6TA 3KXGA 2XKFA 4FSNA 2AC5A 4C57A 2XA4A 5BVFA 2JIVA 2UZNA 1K9AA 1YWRA 1ZWSA 2OJ9A 3AGMA 3P78A 3QUDA 4L43A 4CGAA 4ZMEA 2A1AB 2BFXA 4RIXA 3KMWA 4H58A 3FPQA 4QMOA 5L2QA 2OIDA 4MKCA 4RWLA 2ZJWA 1WVYA 2YEXA 3F2NA 4DINA 5M57A 4F78A 3OXZA 2FB8A 2VNYA 2QOOA 2R7BA 2OG8A 1W7HA 3DAJA 2UZTA 4OBQA 4HOKA 1UU8A 3BL7A 2IPXA 4BTFA 3A7HA 4GK2A 1YDSE 4I3ZA 3RTPA 3R9RA 3A61A 1OGYA 5AUTA 2YAAA 1FINA 2HYYA 3V8WA 4AW5A 3UE4A 4UMPA 2IWIA 2V62A 2ZV8A 4D2TA 5EOLA 3PFYA 5IUGA 1R1WA 2C3LA 3FZTA 5GHVA 3FMNA 4DT9A 4ZJIA 3C7QA 5D11A 4U80A 3QTWA 2ITXA 5HE0A 4ACGA 4BGHA 1AQ1A 2H34A 4K77A 3V04A 4FTJA 3HUCA 3PIXA 4YC6A 4H3BA 2VV9A 4QPAA 2Y9QA 4D58A 2OZOA 2PVYA 3EQPA 3ORXA 3QGWA 4R3RA 4X2GA 3DXNA 5GJGA 3A7JA 1NVQA 2X6EA 5CENA 5AUZA 4TL0A 1SNXA 3HRFA 3PXZA 2Y6MA 1OUKA 3MI9A 1G5SA 4M13A 3KC3A 4F6UA 2NPQA 2OW3A 2X2MA 2VGPA 4I4FA 4RSSA 3TWJA 3VBQA 4BL1A 2Q0NA 3IECA 2VTMA 4CZTA 2GHGA 5HCXA 1CDKA 1OL5A 1MRUA 2OH0E 2QOFA 2VO6A 3ZUUA 2PYWA 3OY1A 4OBPA 4APCA 2PUIA 4RGJA 1DI9A 1S9JA 1DM2A 4XCUA 3UVQA 3FZOA 3DS6A 4QQ5A 2R0IA 3N9XA 2JIUA 1M14A 5EI2A 5IKWA 2Q83A 3CSVA 3A4PA 4FEUA 5H9BA 4YZBA 5HCYA 4F65A 4PTEA 4EK4A 4IX4A 1OB3A 3QXPA 3RCDA 4D1ZA 2GSFA 2RFEA 5HI2A 1PKGA 4YJTA 4F08A 4UX9A 1G3NA 3QA8A 4BY9E 2HZ0A 1YXTA 4LMNA 4CXAA 4FTIA 4L7SA 4RPVA 5E91A 2GS6A 4F9BA 3EB0A 4QP4A 4C62A 3EYHA 2OFVA 4YO6A 3F5PA 3TTIA 3W8QA 4IW0A 2QKWB 2YLFA 4HJOA 2BHEA 3GEQA 3FC1X 4NEUA 4WNMA 4YJOA 4C4HA 5ITAA 3UPZA 3DAKA 3LJ1A 3EKKA 4E20A 4MNEA 2QG5A 3TKIA 3PVUA 1A06A 3RMFA 2PVNA 2PVFA 4CQEA 2WQNA 3ENMA 3MH3A 5IA3A 3DJ7A 1KV2A 1M7NA 3Q9ZA 3BZ3A 3IQ7A 4JAJA 4DFZE 4NYEA 1ZOEA 3I1AA 4DCEA 3KXZA 4NCTC 3OP5A 4QMLA 1LP4A 4FRFA 1OL6A 3EOCA 4XYFA 3VIDA 2VTAA 3P7AA 4L7FA 5L2TA 3UIMA 1CKIA 3NAXA 3IW6A 5I9YA 3UC3A 4WA9A 3PFQA 4S30A 5M4CA 3ZTXA 4CCBA 3LAUA 2WTWA 2OI4X 3BHHA 5IQDA 2WIPA 2YIYA 2QU5A 3FJQE 4YJSA 3BL9A 5C8KA 3C4FA 4TYHA 4X2JA 1LUFA 2FO0A 3SRVA 2XANA 5DMZA 2OU7A 4ZZNA 4I0TA 2WO6A 4QMYA 4HGEA 1CSNA 1YOJA 3HV6A 3COMA 3M42A 3VBVA 3U9NA 3TACA 1H01A 4E7WA 3JPVA 3ZM9A 3DKOA 4LGHA 2JD5A 4DGLC 5HKMA 4IAKA 1UU7A 3PE1A 4WNPA 4DFNA 4H3QA 5JEBA 5IQHA 5JMSA 2YIWA 3GCQA 1GZKA 3SV0A 2WU6A 2IF8A 3LMGA 5I5ZA 3O7LB 2GCDA 3G9NA 4YU2A 1BMKA 2CCIA 5IUHA 1VR2A 2YM5A 3UOHA 1UU3A 3ORPA 3QD2B 4IH8A 4XS2A 4AP7A 3MN3A 4DLIA 5KMOA 3ATTA 2C5XA 2HOGA 4FV5A 4JAIA 4BHNA 2JGZA 1R0EA 4R77A 5E8XA 1J7LA 2X8IA 4EOJA 5CT0A 2EUFB 5AUYA 5JFSA 2X0OA 3IK3A 3DFAA 3KULA 4AOJA 3OROA 2R9SA 1G8JA 5M53A 3DK6A 3LIJA 3PY3A 4V05A 4BVUA 2OJIA 1PXJA 2WQBA 4FOBA 5ANOA 3EQGA 3FPMA 4U5JA 1ST4A 4G3EA 5JZJA 3DV3A 2VO0A 3I5ZA 4IACA 2YFXA 3LCSA 4B0GA 4AQKA 5IQAA 3NUXA 4TRLA 3UIBA 4IVCA 4F1MA 2X1NA 4E5AX 2XF0A 3PUPA 1CM8A 4U43A 4GIHA 2ZFYA 2IO6A 1Y91A 4J98A 2ZDUA 4KKHA 3KF4A 4FODA 3HMMA 4IZYA 3R0TA 4JT3A 3PA5A 2JKOA 3RPVA 4CZYB 5CXZA 1BKXA 3F5UA 3NWWA 3IPHA 1OL7A 4C7TA 1UWJA 4HVIA 4Q9ZA 4PTGA 3LM5A 2Z7LA 3HLLA 4U9AA 4GVJA 3VRZA 2B0QA 5BVWA 2PUNA 4HVGA 3GU5A 4P5ZA 4W8EA 3U4WA 3LXKA 3T9IA 4F63A 3C50A 3D0EA 2UVXA 3NAYA 3ZXZA 4C3RA 4D28A 2BZJA 4KBKA 3W0SA 4KS7A 4C02A 4CFVA 2GNLA 3R8ZA 5TOZA 4MNEB 3ACKA 4RZVA 3KIOC 2XYNA 1H0WA 4QMWA 2EB3A 3PJCA 4FVRA 5ETAA 3ML1A 4A9SA 2UZLA 3Q6UA 3N4UA 1OKYA 1Q3WA 4O84A 4XOZA 3QZFA 2QVSE 4ZLZA 4XLVA 4IX3A 4PUZA 5HESA 1UA2A 1XH9A 3SD0A 4CT2A 2CKEA 2JAVA 3GGFA 4RVTA 5F1ZA 2BRNA 3KRWA 1DAYA 3N51A 4GKHA 5CASA 4D1XA 2QHNA 4FI1A 4AW2A 1UNLA 4MF0A 4GMYA 5HNBA 3ZEPA 2XCKA 4DBXA 2FSOX 2R3LA 2WTKC 2VTRA 3OT8A 4M97A 4EUTA 4FE2A 1PXOA 3SRVB 3DNDA 4O96A 2PZYA 3F5GA 4LGGA 3ZOSA 5HNGA 2EB2A 2YLEA 3FQHA 2C69A 2GHLA 3LFQA 3MPAA 2A4LA 2BRGA 4ZSEA 5LMKA 3ZC6A 4P7EA 3D7TA 3HMPA 2NRUA 4TWOA 4YTCA 5LWNA 4FYNA 2UZVA 2YCQA 3OF0A 2W4KA 5FQDC 4FV4A 4ASZA 4D4YA 4AOTA 4BTMA 3WARA 3V51A 1F5QA 3ULIA 2PMLX 2J5FA 1JOWB 4OTGA 4M3QA 4IAAA 4O83A 3LXNA 3COIA 4G6NA 3GU6A 1RW8A 3QXOA 1J1BA 2R5TA 3HMIA 1B39A 2QOQA 5AM6A 3GOKA 1ZYCA 2W0JA 4UXQA 2XNBA 2JDRA 1GAGA 2ERZE 4D1SA 3D94A 5HLPA 5KO1A 4AS0A 3QLGA 5L8KA 4XEYA 3KXHA 3NLBA 4DYMA 3NYVA 2BUJA