4FV8A

Crystal structure of the erk2 complexed with e63
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
350
structure length
333
Chain Sequence
b'GAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVAVATRWYRAPEIMLNYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with E63
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 333
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv8A01
4YJNA 4EL9A 3MY0A 5I3RA 3DBDA 3PRIA 2O64A 2VX1A 2W1CA 3L8SA 2QONA 4EOOA 2Q0BA 2O5KA 2FB8A 3PA4A 4AF3A 2HXLA 4RJ4A 2Z7SA 4LRKA 4FTJA 5D41A 4FYNA 3UNJA 2E9VA 4C59A 2XVDA 5EYDA 4PX6A 3PXRA 5CXZA 2GHLA 2YIXA 3JY9A 3HECA 2BDJA 3GCVA 4D4YA 2PWLA 3LOKA 4ACCA 3D5XA 3U6IA 2RFSA 2VX0A 3KULA 3R8LA 3TNQB 3U55A 5HLPA 4KSQA 4DT9A 4ZTLA 2X8IA 4C57A 1IAHA 2BILB 2C47A 2ZB0A 4NZWB 3L1SA 2PMLX 2ZOQA 1VYWA 2EXMA 4H3BA 5JMSA 1AGWA 2JDRA 4UMQA 4LOQA 3RPVA 4NKAA 3VUKA 4OTIA 3HV5A 1QMZA 3BEGA 3DB6A 4YMJA 2WTVA 5AR2A 3AGMA 4FK6A 4M69B 2HENA 3U9NA 3DDPA 2NRUA 4OR5A 2VU3A 1BKXA 4KS7A 4XV9A 5TE0A 2YN8A 2Z7RA 3FMDA 4OTFA 3BYOA 4CV8A 1CKIA 4E6DA 4FTAA 4I5CA 4CLJA 3OT8A 2BTRA 3PUPA 5BUEA 1W82A 5EYCA 2YWPA 5L6PA 4GT5A 3FV8A 2PVNA 2XIKA 4HGSA 1REKA 4C2WA 2F2CB 5AV4A 5EW3A 4B8MA 3DT1A 1UV5A 2C1BA 4E6QA 2VZ6A 2AUHA 4Y8DA 3UOLA 4FSWA 4C3RA 5C26A 4JQ8A 4MYGA 5AV0A 4Z7GA 3U6HA 1W98A 1ZWSA 5AX9A 3H9RA 5EHYA 4AQCA 4DAWA 3DCVA 2C5VA 3EFKA 2F7XE 5HG5A 1J7IA 2BFXA 4DTAA 3R7GA 4QMYA 3D0EA 4JOAA 3F3ZA 4G2FA 4L53A 4BI0A 5AADA 1YXVA 5I9UA 3ORZA 2CDZA 4EOPA 3F5GA 2PHKA 3A2CA 1OI9A 2E9OA 4JQEA 4QPSA 4RLLA 4WO5A 5DFPA 5EH0A 4PTEA 2F7EE 4I6HA 1LEWA 2C0OA 4BBEA 1A9UA 4EH7A 4LGHA 1Y8YA 4B8LA 2R3LA 2R3RA 4IVBA 3EQFA 4APPA 4E4NA 4F7NA 4BWKA 2QC6A 4EK6A 1NW1A 4U9AA 5KBQA 2CKPA 4HVGA 3VBWA 3KRJA 4K0YA 4OTPA 3SXFA 3D94A 4AGDA 2G01A 2G2HA 3BYUA 3QYZA 4MWIA 3DKCA 1RQQA 1YI6A 3WF7A 3CGFA 1YI3A 1YDSE 4XBUA 4NFMA 4CNHA 5AX3A 4PWNA 5HCYA 3I7CA 3UVPA 2REIA 3EKKA 4EQUA 4F0GA 4BY9E 4JJRA 3W2OA 4LYNA 4Y46A 4TZRA 3N9XA 1MQBA 4C8BA 4YGAA 2GTNA 2XUUA 4AP7A 2B0QA 2GQGA 4KBKA 4YURA 2OIQA 3QRUA 5A4LA 2Y4IC 3CS9A 4YZCA 4I4FA 4PP7A 4O27B 4F70A 4HVHA 3VQHA 4HVDA 5FUTA 4DGNA 2O65A 4R7IA 3S4QA 4TNDA 4A9RA 4MAOA 2DWBA 1PXJA 2WTIA 3PSDA 4G1WA 5M57A 4LMUA 2BAQA 3VQUA 3DBFA 2J0IA 5BNJA 2W1HA 2PU8A 1F5QA 4UWBA 1U5QA 4ZZNA 3FC1X 3E63A 4L6QA 2NRYA 4Y5HA 1Y6AA 4MNEA 4BCMA 4RVMA 5EM8A 4F1MA 3MJ1A 1Q99A 2YDJA 4IZYA 3B8RA 3FLQA 3QUDA 3UGCA 4BDBA 3CD8A 3D5WA 2YERA 3RNYA 3EL8A 3ZFXA 3MVHA 2PY3A 4GRBA 2R7IA 3P0MA 3R9HA 1XH6A 2CMWA 3WF6A 3EIDA 3PPJA 4FTIA 4QQJA 5CEPA 5FM3A 5F1ZA 2XK4A 1JQHA 1Q62A 2W9ZB 5A6OA 5IA2A 4IXPA 4BICA 3GU7A 2OGVA 3ROCA 1P4OA 3CP9A 3FI2A 5HG7A 3VJNA 5B2MA 3C7QA 2QOIA 3QU0A 3SW7A 4DEHA 4G3EA 4GMYA 3D14A 1V0BA 3Q52A 3LFBA 4O7RA 3NVKI 3BCEA 4BCGA 2ONLA 1H1SA 4TXCA 3FL5A 3UQFA 2YM6A 3RPRA 5CEIA 1T46A 4RG0A 4RWIA 5M44A 4LGDA 4MXYA 3PY0A 4DTKA 3EKNA 2XF0A 4BRXA 2XKDA 3OBJA 4H58A 1KWPA 2OXXA 5DA3A 2VGOA 5DLSA 2YCSA 3HRCA 3IW8A 4GIHA 4L68A 5B2LA 3R22A 2QHMA 1H01A 1JKSA 5JZNA 4V0GB 5A4TA 5HVYA 4G5JA 1OM1A 2JITA 4LL5A 1Y8GA 3C0GA 3BHYA 2HW6A 5L8JA 4FTUA 4M15A 4D9UA 2ZJWA 4NW6A 3F9NA 5EKNA 3NUSA 3RZBA 4BDGA 2YIRA 3ZRMA 4FODA 4C4GA 1Q8ZA 2P55A 4I5PA 4QTEA 4GUBA 3DK3A 3DXNA 2WHBA 3PVUA 3ZRLA 4QMVA 3RAKA 3GU6A 2XK9A 4JBQA 3CGOA 4QD6A 3SA0A 3PLSA 4PDSA 5TKDA 3F5UA 3CQUA 1W0XC 3HGKA 2XK7A 3BI6A 4A9YA 4C4FA 1ZYJA 2PE0A 4W4XA 2A2AA 5IQIA 4GV1A 5AUXA 3GU4A 2YCRA 3FC2A 2JIIA 4X2GA 1UVRA 1G8AA 1Q97A 2GHMA 3EZRA 1JWHA 5CLPA 1J91A 5FDPA 4KIKA 1JPAA 1XH7A 4A7CA 4UEUA 4G6OA 3H0ZA 4U7ZA 2J0JA 5T68A 3BBTB 5C4LA 3ZBXA 4FBXA 3I60A 3MFRA 4D5KA 2VWBA 3NAXA 1URWA 2B54A 2XNOA 5DH3A 4A4OA 2PSQA 3FDNA 1OIUA 2B9IA 5K4JA 2HCKA 2XBJA 1XWSA 1WMKA 2YJRA 3JVRA 2GNFA 3OOMA 3ORMA 4G3CA 1P5EA 2JAMA 4JX7A 2Y0AA 4YLJA 3W2QA 5HICA 3ZEWA 4FT0A 5LWNA 4BR3A 4FKIA 4F6UA 1OIQA 5EI2A 2C3JA 2OI4X 3UO4A 2QURA 4FTTA 4FK3A 3QQHA 3O17A 1DM2A 3GGFA 2HZNA 3HNGA 3NDMA 5BVNA 3P78A 4R5YA 3DOGA 3TZ8A 4U42A 3T9IA 4U3ZA 3R8VA 3FHRA 4TWOA 2VWXA 4U97A 4BVUA 4DEIA 5JK3A 4BWPA 2B4SB 2I0HA 4AAAA 4BTMA 5EW9A 2BALA 3HMIA 3AC3A 1CTPE 2XS0A 2Y6OA 5HO8A 3GCUA 4Z16A 3OCBA 3VW8A 2H96A 3LXKA 4XV1A 2R3KA 3A7HA 2GHGA 4EJ7A 3FY2A 3PA5A 4AGCA 4O0SA 3MIAA 4DYMA 3QTQA 2W1EA 2X2LA 5ANIA 3RK7A 4BTKA 2W4OA 1YKRA 4YZ9A 3EQDA 5D7AA 3F3TA 3DY7A 3PY3A 5EFQA 4BIDA 4AN2A 5A4CA 5A4EA 2IVUA 4JAIA 4O38A 3EFLA 3QZHA 2XCHA 4WBOA 4GCJA 1F0QA 5AV1A 4K77A 4USDA 2W9FB 4WNOA 5JKGA 3FZPA 5J8IA 3Q4UA 3R83A 4MQ1A 4ALWA 2QOKA 1E1XA 4RX7A 1PMEA 4ERWA 3R30A 3RI1A 4BYIA 1U4DA 4E3CA 5L4QA 4ORKA 3WF9A 2Q0NA 2J6MA 2VWYA 4KRDA 3PJ3A 4LGGA 4YC3A 4EOQA 5J7HA 2VTHA 2E9UA 2C6DA 4ZY5A 1YOLA 4I5HA 1OKZA 4ZSEA 3COKA 4ZAUA 4FKVA 5KBRA 2H8HA 2WELA 1FINA 2B53A 1W84A 3Q9YA 4XV2A 3V01A 4GG7A 1IA8A 3QTUA 4C62A 2Y8OA 4IJPA 2OJ9A 3SG8A 2XKFA 3KRWA 3H10A 3ROYA 4X21A 4BCJA 3OXTA 1ZOHA 5K0XA 3D7TB 3KXGA 4OTRA 2X4FA 4M8TA 3T3VA 4FT3A 2ZV9A 3FPMA 4RIWB 4C35A 1NVRA 2WTCA 3FPQA 3QA8A 3LZBA 1O6LA 4OAVB 3ZOSA 3K54A 5DYJA 2W7XA 3WYYA 3QTSA 4PMTA 4BHNA 3LMGA 4NFNA 2XRWA 4FVRA 3IG7A 3NYXA 5KX8A 4XX9A 4KB8A 3BLQA 5HBHA 3IGGA 3SRVB 2YM3A 5BYYA 4UWYA 4TRLA 5FQDC 2W5HA 5K3YA 1IEPA 3BEAA 3VAPA 1MP8A 2ONLC 2IW8A 3DGKA 3C0IA 4XEYA 3BLHA 4U80A 3EB0A 4C38A 3KVWA 2Z02A 4NK9A 2PMIA 5ETCA 2V55A 2BFYA 3VUGA 5HE2A 3RP9A 1J1BA 1GNGA 1XH8A 2GFCA 3D9VA 3E8CA 4DT8A 4DINA 5E91A 4J52A 3QC4A 3PPKA 3BU3A 4DLIA 1QCFA 4BZNA 5IQDA 3GEQA 4AZEA 5J9YA 2OJFE 2VO3A 1O6YA 4XUFA 3U9CA 3NZ0A 5E4HA 3L8XA 4NTSA 4TPTA 3BWFA 3VUDA 3IGOA 3QQKA 3EFJA 4FIHA 3MVJA 4KBCA 3OCTA 4AG8A 5LVNA 4MNFA 4ZJIA 4PPBA 1SVEA 5HBEA 5HCZA 4XOZA 4RC3A 3B2WA 4EC8A 2WMWA 4I41A 5KMJA 3CKWA 3Q9ZA 3FQSA 4EOMA 3BV2A 2XK6A 4FEXA 4DCEA 4FIGA 4AW5A 2RF9A 4XG8A 4BN1A 4MXAA 4ZZOA 1YI4A 4FICA 2BKKA 4LRMA 1WVXA 3P86A 3R9RA 5HHWA 2UW6A 3TV6A 4NIFB 5BVEA 3V5QA 4TNBA 3NW5A 3RPSA 3MS9A 3P5KA 4YSMA 4BCQA 2QLUA 4QP1A 4TWCA 4I93A 4AOIA 5HG8A 4L9IA 3M42A 3RVGA 4DGLC 4HYIA 3AMYA 1UU9A 4DC2A 2IVSA 2CNUA 3FMEA 2R3IA 2PVKA 3T3UA 4AXAA 2VAGA 3QKLA 1LP4A 2BRMA 4F9WA 4QOXA 1OL5A 4FV6A 5GIPE 1YQJA 4DFXE 3UNZA 2C5NA 4FV3A 4YJOA 3TWJA 3VULA 1OUKA 2OJIA 3BQRA 4IH8A 2JC6A 1KUTA 2RSVA 4YPDA 2VUWA 2CCHA 4EOLA 4OAUC 4GK4A 1H25A 5IQFA 4I22A 4EONA 3GVUA 1P14A 5B0XA 4FOBA 4BB4A 5EHLA 4CXAA 2QKWB 5AV2A 5LJJA 5M09A 4O96A 5JFSA 2BIKB 3TJCA 2VTQA 5CVHA 3PTGA 4CZTA 3TV7A 3JY0A 1H24A 4E4LA 3QXOA 3MPMA 2GS7A 4YHTA 3RCJA 4JBOA 4LOPA 3LMIA 3OWPA 3O7LD 4C4EA 3A60A 5IZFA 2QOBA 2R2PA 3OTUA 4IVCA 2B1PA 5HTIA 4MD7E 4R3CA 5B2KA 4IB0A 3HLLA 3CY2A 2C6TA 5AAFA 4H39A 4RA4A 5FGKA 3EYGA 3W8LA 4BDIA 3KCKA 4IX4A 4TY1A 5G1XA 2OU7A 4IADA 1G5SA 2UW7A 2AC5A 2VWVA 3MFUA 1UNGA 3IQ7A 4L42A 4ANLA 2HW7A 3UNKA 4BCIA 3ZC6A 1PYEA 4P7EA 5AR7A 3QCYA 4IEBA 2IN6A 3HA6A 4B9DA 3QZFA 5JSMA 4ZY6A 3Q53A 4DF3A 3HMMA 5FXSA 1CDKA 2JD5A 3EQBA 3ORIA 3DAKA 5LARA 2A0CX 5F20A 1GZNA 3PIYA 2HOGA 3NWWA 4OGRA 4U45A 2WQMA 3KXMA 4RMZA 4TYHB 4FOCA 2WQNA 5CEOA 3IK3A 1H0VA 1VEBA 2QD9A 5A6NA 3PVBA 3R8ZA 5F94A 2EXEA 4S34A 5CY3A 1SM2A 4EWHA 5EHOA 1KV2A 4FV7A 3MH1A 4I6FA 3EH9A 4K2RA 2C3LA 4KABA 3ZLYA 4ZJVA 2VD5A 4EC9A 5I9VA 3POOA 2XIRA 3VS0A 2IZSA 4GFMA 5HNBA 4GG5A 4IAYA 4QPMA 2C6KA 3BHVA 4RQKA 3GU8A 4MTAA 5LWMA 2QR8A 5AUVA 2OBJA 4CKIA 5KE0A 1PKDA 4H05A 5M51A 3QX2A 1BI7A 4JG7A 5HE1A 3FQEA 4B99A 5BMSA 5DWRA 4XMOA 5A54A 4KUJA 4FKRA 4MCVA 3KRLA 1AD5A 4WNKA 5FTQA 1PRYA 4ZSLA 4Q9ZA 2YDKA 4FSYA 2Z7LA 2YA9A 1J7UA 4BC6A 3UOHA 5EQEA 4QTBA 2JBPA 4GYIA 3PVGA 4PL5A 3F69A 4AW1A 5GHVA 4EZ3A 1DAYA 5BVOA 3C4CA 1YOMA 2CN8A 3PE2A 3LFQA 2RL5A 2UW8A 3COHA 2YABA 4G9CA 4JLCA 4RIYB 5LXMA 5CU2A 1WBNA 2GU8A 4IX6A 4G16A 3UPXA 2CGXA 5C8KA 3DJ7A 3A8XA 2KTYA 3LCKA 2OWBA 3LFSA 4RJ8A 3UZPA 3KN6A 2FSLX 3BGPA 3PE1A 4J98A 3FYJX 1KE6A 3WF5A 4RIXB 3QQGA 5IG1A 3O71A 4I1ZA 5BPYA 3OC1A 4XHKB 1VR2A 2W5AA 2E2BA 4RX9A 3OW3A 5D11A 4FSMA 3AMAA 3DAJA 2Y4IB 4NEUA 2WD1A 1XH5A 4GH2A 4DH3A 1IG1A 4LG4A 4RVTA 3ZLXA 5I9XA 4WIHA 3V5JA 3P79A 4IAKA 3TUDA 3DPKA 5D12A 2OO8X 5GJFA 2WXVA 2YFXA 3VF9A 1M2PA 4IM3A 1ZARA 2RKUA 4FKJA 3SOAA 3FZOA 3ZO4A 5IPJA 2BMCA 4WT6A 2RGPA 3RMFA 5C8MA 1OIRA 5IDPA 1LEZA 3NCZA 5CX9A 3H0YA 2R3FA 3KN5A 3GCPA 5ANEA 1ZYLA 3G90X 4IC8A 2OK1A 3A7FA 4WOVA 4ZZMA 5IA3A 3RPOA 4S2ZA 5A46A 2OW3A 3ALOA 3IPHA 4DH1A 2YAKA 3BQCA 3O2MA 1YHSA 1YRPA 3OOGA 4OBQA 3RKBA 1ND4A 4AW2A 5J87A 4D4SA 1HCLA 4CLIA 3L9PA 4XYFA 4ACGA 4GEOA 2IW6A 4G17A 3OHTA 4X3JA 5J5SA 3N4UA 4ZS4A 4I21A 3GQLA 4KWPA 4ANMA 2BR1A 4LMNA 2XBAA 3WZUA 5HU9A 5KMIA 3SG9A 5IQEA 2O3PA 1WBPA 4M12A 4CV9A 1OIYA 2HELA 4L67A 5IQHA 4FSQA 5E8SA 1I44A 4YC6A 3FJQE 5A9UA 2UVXA 4BF2A 2WGJA 1H1WA 1OKYA 5CXHA 4A9SA 2I1MA 4PPAA 5FM2A 3D5VA 2XNNA 3QRKA 4MWHA 3FLYA 1NA7A 4E5BA 4CMOA 2ITTA 3TJDA 5CSVA 1TVOA 4FV5A 3FXWA 5J1VA 3DKOA 3P08A 3R63A 4EJNA 4HGTA 4GIIA 3O51A 3W16A 4ACDA 1OITA 3C4WA 3MI9A 4YNEA 1GIHA 1V0OA 4EKKA 4BCOA 2YISA 3I7BA 1MRYA 2VTLA 3LCOA 5IEXA 4IDVA 3A4OX 3Q2MA 4K8AA 5AP2A 2C6OA 2JDSA 2DUVA 3R9OA 3UDBA 1JBPE 5HESA 2GNJA 4GJ2A 2EVAA 3KK9A 4UXLA 3V04A 3UO5A 3GI3A 3KULB 4O83A 3DKFA 5KKRC 2I0VA 3NAYA 3II5A 2OH0E 4HOKA 4FKOA 1SNXA 2CSNA 2OIBA 3Q4TA 5E8XA 3RNIA 1M2QA 3DK7A 2A1AB 3R7EA 1KE7A 5L2TA 4XCUA 5ITAA 5LQFA 1GJOA 5E90A 4YR8A 4EK3A 4ITIA 4O21A 2YIWA 4M97A 4I4EA 1PYXA 5J9ZA 5AP3A 1P2AA 2C6MA 5TOZA 4DHFA 2BAKA 3FLWA 4R6VA 4I3ZA 4F09A 1UWHA 1WAKA 1BL6A 4OUCA 3WE4A 4ASXA 4JIAA 2F7ZE 3VUTA 2PVYA 3BV3A 3ZRKA 4C36A 2YIQA 3FMLA 2YITA 5FXQA 4DEBA 5CAUA 4LV8A 3UZTA 4EK5A 2ZB1A 3DJ6A 3EN6A 4ZTMA 4R5SA 4EOJA 1NY3A 1PXPA 2HWOA 2VTJA 2G2FA 2C6LA 2F4JA 1Q3DA 3LVPA 4RC2A 5CS6A 3SDJA 4CQEA 2RG5A 4F7SA 4ARKA 2WPAA 5KMKA 4L8MA 3F2RA 2HYYA 1B39A 4AZTA 2JLDA 4FKWA 3ORXA 4TKSA 3R02A 2PMOX 5C03A 4YUQA 4MK0A 4W8EA 3R2BA 3G51A 5K0KA 4O0RA 3EQIA 4YZMA 4TYEA 2OH4A 4HYHA 3UQGA 3OCGA 4PNKA 3I0OA 3VS1A 4O0WA 3PA3A 2VGPA 1R39A 3RPYA 4C02A 2HAKA 4QTCA 4Y5QA 2XIYA 5CYIA 5BYLA 3FZRA 1GY3A 3HRBA 2X1NA 3MB7A 2A4LA 3FXXA 3R73A 3RAWA 3W32A 1YXSA 3Q32A 3F2AA 3EN9A 4X2NA 2QHNA 2WFYA 1P4FA 2ITXA 4CRLA 2EWAA 2WTJA 1H26A 5DRDA 5L2WA 3TT0A 5FEQA 4QRCA 2J50A 3ACJA 5CZIA 4EH2A 3RK9A 3VRYA 4O0XA 4JDKA 3GENA 4FNYA 5BVKA 5IA1A 2QO7A 4BCFA 3OMVA 3BGZA 3AC2A 3G33A 2C0TA 1CSNA 4HYUA 5AP0A 4ZTSA 3N4TA 3Q5ZA 2QO2A 5IEYA 1GZ8A 5HVKA 4OBPA 2EB2A 3UVRA 4OBOA 3QCXA 4BBMA 4XG9A 1BUHA 4RQVA 3HYHA 3Q6WA 3NNXA 4X3FA 4RX5A 3ET7A 4FG9A 3CCNA 3O96A 4FSUA 4RWJA 3CBLA 1W7HA 3PY1A 3UP2A 2VWIA 4BFMA 1G8SA 3EN5A 3I6WA 5I4NA 2PZYA 5E8WA 1GIIA 4PNIA 4PY1A 3H30A 4ZSGA 3ZSHA 1M7NA 3E87A 3K3JA 4B4LA 2PUPA 4FEWA 2AC3A 3C51A 2XB7A 3ENHA 3FMKA 1IRKA 2WMUA 5CNNA 4J71A 4CCUA 4LUEA 3F5PA 4FSRA 4PQNA 2W99B 5IH6A 4DEEA 5HX8A 4O7VA 4DH8A 5E7RA 3ZXZA 3NIEA 3BYMA 3NS9A 5IQGA 4O0VA 1UNHA 3P7AA 4DFYA 3DNEA 3LQ8A 3TCPA 4O7ZA 3KXZA 5EI8A 1XH4A 3ATTA 4ZK5A 4RFZA 3FEGA 3C4ZA 3SV0A 2ETMA 1YWRA 4IZ5A 4NM7A 5HOAA 3SGCA 3AD4A 5KCVA 2WEIA 3SQQA 2WTKC 3TIZA 2QR7A 3CIKA 4HNFA 3C4EA 1NXKA 3LAUA 1R0PA 3OBGA 3G9NA 1DI8A 4NJ3A 4S30A 5JGDA 2PUNA 4U81A 5CF8A 5JN2A 3G15A 3DDQA 1M52A 2ETRA 2GTMA 3AD5A 5CTPA 4Z3VA 3QCQA 4AZFA 3SW4A 4KIPA 3SD0A 5ANKA 4NM0A 2QVSE 2NP8A 3W18A 3RHKA 1GZKA 5ETAA 2WU6A 5M4IA 4CMUA 5KZ0A 4CD0A 3UMWA 3S1HA 2VNYA 3L9NA 3ENMA 3I79A 1XR1A 4D4RA 5LVOA 3VUIA 1VJYA 3E7OA 2IJMA 3O50A 4FIFA 2IWIA 3MH0A 3H3CA 4ALVA 3W10A 3KU2A 4W4VA 4I6BA 3DU8A 4BIBA 3G6HA 5CNOA 4D1ZA 4BGGA 4G3GA 5DR9A 2IVVA 4YJVA 3R04A 1B6CB 5BMMA 4IBMA 3KEXA 4P2KA 1MQ4A 1Z57A 4WUAA 5DHJA 3ANRA 3TKUA 1FMOE 2C30A 3HRFA 4FV8A 1TKIA 4M0YA 5IMXA 4HCTA 4R7BA 4FKLA 1PMVA 3QKKA 1R78A 2YAAA 4QYEA 4AS0A 3RTPA 3C50A 3A8WA 3MPAA 3R7IA 1ZZLA 4WRSA 1PXMA 1O6KA 3FE3A 3UODA 3GNIB 2XKCA 3WIKA 4O7WA 2JFLA 2X9FA 3AC4A 4FTOA 4U8ZA 4ZLOA 5JFXA 2WZJA 4BDFA 4EHGA 2HY81 4FV9A 5E8ZA 5KUPA 4FZFB 2ZV8A 4F1OA 2OJJA 3IW7A 3I5ZA 4KIKB 4IDTA 2R64A 2B55A 2YIYA 2KULA 4IB3A 3DLZA 3TACA 4XP0A 5DOSA 2YZAA 4RVKA 4BCPA 5IF1A 2BKZA 2JGZA 2OG8A 4ZTHA 4O7NA 4TW9A 2BCJA 3KRXA 1ZAOA 1UU7A 2JDOA 3OEZA 4EQCA 1E1VA 5FTGA 2GNIA 4FZ6A 1UKHA 4J8MA 4L00A 5HX6A 3G9LX 2R3GA 1KE9A 4RLKA 4FIEA 4O81A 3Q9XA 5HKMA 3EQGA 5JRSA 4FGRA 5CU4A 5CSWA 4I24A 1KSWA 1YXTA 2Z7QA 4XRJA 3DS6A 3ZFYA 5EYKA 4BWXA 4BDEA 3QQFA 2X8DA 3UIMA 1YHVA 2JIUA 3COMA 3OZ6A 4C4IA 2B9HA 1ZMWA 3E8EA 5IQCA 4EYJA 3GOPA 3QD2B 4JIKA 5J5TA 3WZEA 3C5UA 3GCQA 3QF9A 3LIJA 2YM8A 4NCTA 4YTIA 4QMQA 1KOAA 5IUIA 5CU0A 3POZA 5ANOA 2WQOA 3DBCA 2QI8A 4QQ5A 1PY5A 4KBAA 3VUMA 3EZVA 4MQ2A 5C27A 5A4QA 4AN9A 1OPLA 2JFMA 5CQUA 5BX0A 2CKOA 2GS6A 4FT5A 3TTJA 5J9LA 2E9PA 4DG0E 2OZAB 4PPCA 3WE8A 3B8QA 3KXXA 3MVMA 1H08A 2BUJA 5HTBA 3EMGA 4QMOA 1TQPA 4RGJA 3F61A 1AQ1A 2NNWB 4ZTRA 4QYGA 2IZUA 4EOIA 1Q8YA 4D2WA 3PVWA 2XNPA 4W9WA 3O0GA 3C1XA 4X3FC 5IUHA 3KMUA 4OW8A 2VNWA 2XMYA 3ANQA 4GSBA 5JEBA 4FKUA 3PRFA 4G5PA 4IX5A 5JZJA 1KE8A 3QXPA 4LL0A 4N70A 4XP2A 3DJ5A 3KFAA 4KSPA 4NT4A 1H0WA 3DA6A 2GSFA 4IFCA 5CAPA 3TUBA 4HW7A 3ULZA 2SRCA 2RFNA 3LKMA 4HVSA 4BKYA 5JQ5A 1Y6BA 3H9OA 3PJ2A 4YJSA 1UWJA 3FMHA 1YHWA 4O2PA 4ANSA 4AZWA 4OT5A 2R3HA 1OL1A 4YLKA 5AEPA 4N57A 2VTNA 5EG3A 4EBVA 4H36A 5M4CA 3U54A 4HPTE 5FEEA 2P3GX 4FNWA 4M7IA 3JXWA 4GS6A 3IONA 1ZRZA 3ZDIA 2V5QA 3MFSA 3WARA 5HD4A 4RFMA 3VS6A 2VO6A 5DRBA 5K9IA 3DFCB 2XYUA 2O8YA 2UZUE 1KV1A 3WZKA 3PG1A 2W4KA 3RWPA 4QP6A 4LRJA 4AUAA 2YM7A 2OZOA 3HV7A 2X6EA 4E93A 2W4JA 1BMKA 1UNLA 1ZXEA 3ZO2A 2X0GA 3DXPA 3FI8A 3W2RA 4HVIA 1O9UA 5IU2A 4TL0A 3E8NA 1SNUA 1BYGA 1FVTA 5F4NA 3ID6C 4YJUA 5HTCA 4I0TA 5DIAA 2R5TA 3REPA 4FMQA 4R78A 4QMNA 3F66A 3A7GA 4AACA 4FZ7A 4AOTA 1TQMA 5K4IA 4GT3A 4LI5A 5J7BA 4IM0A 2WB8A 2HWPA 2LAVA 5LVMA 4PDYA 5IUGA 2QOHA 2Y9QA 5AUTA 3RM7A 4YHJA 2GPHA 4QMPA 4IACA 4FGBA 4M67A 1CM8A 2QU6A 4C0TA 3R00A 3LFFA 3VS7A 1S9JA 5GJDA 3W55A 2O0UA 3LLTA 3MB6A 4XOYA 3QRJA 4BDHA 4F64A 2IG7A 2QNJA 4Q9SA 4TYJA 4WKQA 3QZGA 4D2RA 4C34A 4MXCA 5DT0A 3TKHA 4UZHA 3UC3A 4R8QA 3Q2JA 3KQ7A 4DFUA 4XLVA 4AGUA 5EOLA 3UZRA 3KL8A 3ZS5A 3TDWA 2V7AA 3KC3A 2W1GA 5FEDA 1XBCA 2V7OA 3L8VA 3TTIA 1K9AA 1OVEA 2J5FA 1OB3A 3QYWA 3IO7A 2QODA 4BDDA 3VS2A 4X2FA 3LFDA 4FVQA 4GFGA 1R1WA 1PMNA 2CGUA 5DEWA 5CI6A 2V0DA 2XIZA 3CD3A 3RJCA 2UZOA 1L3RE 4IJ9A 4ANNA 3WYXA 4JQ7A 4R3PA 3MYGA 3TM0A 4FV0A 4D0WA 4FF8A 2Z2WA 2PK9A 5CWZA 5CENA 2BHHA 4QYHA 3SX9A 4IWOA 4GK3A 2CKEA 1L8TA 4RJ5A 3ELJA 3V3VA 3MESA 1JSTA 4KNBA 5DR6A 4FI1A 2C3IB 2OKRA 2BRGA 4I0RA 2J51A 5DR2A 3LLAA 4XRLA 3GOKA 1CKJA 3V5TA 2HXQA 3LHJA 3QWJA 5BVWA 3ZLSA 4CFFA 2YCQA 3FSFA 3QTXA 5GIOE 1STCE 4RT7A 3NX8A 2DQ7X 3FQHA 1QPJA 2J4ZA 4DG3E 3AQVA 4MXOA 3F3UA 3FY0A 4KKHA 5IQBA 4BIEA 5LCKA 4XG7A 4AFEA 4UYAA 2PULA 4DFBA 2R9SA 4WUNA 1XJDA 4I6QA 5HNIX 3NMUF 4EH9A 3RAHA 3SRVA 3RBWA 3B2TA 4FTKA 4NCTC 4RRVA 1ZYCA 3Q9WA 3CLYA 2BHEA 3E62A 3NR9A 3ALNA 5HIDA 3HL7A 5FXRA 3EOCA 1UU8A 4MHAA 4YJPA 3DK6A 3FMJA 2I0EA 2OICA 4FV1A 4BYJA 3SXSA 1DAWA 4M84A 3R8PA 4PMMA 2X39A 5M4FA 2XNBA 5HIBA 5FRIA 2LGCA 4HJOA 3E93A 3QLGA 4A07A 4ENXA 4ZLYA 4GUEA 3TXOA 4DN5A 1T45A 3LFCA 4GW8A 4F9YA 3PPZA 4Q5HA 2GQRA 2XNEA 1FVVA 3CQEA 5EK7A 4X0MA 4BGQA 5E1EA 4EEVA 3NGAA 3ZSIA 2PZRA 3OWKA 4QMXA 4AWIA 4EH4A 5AAEA 4IFGA 1QL6A 3UYTA 5LMAA 4EZ7A 5KKRB 3AGLA 3IOKA 5LMKA 3S3IA 3OWJA 3GP0A 2ZMDA 5DNRA 2XH5A 4D2VA 2WKMA 4W4YA 3IOPA 5DN3A 3MW1A 4MH7A 3GUBA 5DG5A 4OTWA 3RINA 2WAJA 4NM5A 3MH3A 2P2IA 4UN0C 5CASA 3O7LB 5AR3A 4CFXA 5M08A 3TZ9A 4Z7HA 5GNKA 3IW6A 1LR4A 1XHAA 1OBGA 3V5LA 2H6DA 2EUFB 4E6CA 3AOXA 1PF8A 1PW2A 4JBPA 5GZ8A 2UW4A 3PYYA 4F99A 4R7HA 3KREA 3VS4A 4HZRA 2VTTA 4P90A 2ERZE 3EQPA 4DCAA 3ORTA 4FUXA 5L6WL 1QPDA 3PSCA 3K5VA 2C1AA 4YTCA 1YXXA 2XP2A 2YACA 2GNGA 2BZIB 4JS8A 4QMSA 4U43A 3UQCA 3LJ0A 1GOLA 3ZHPC 2WMQA 1Q24A 5FG8A 5JRQA 3QWKA 1UKIA 3EL7A 5T3QA 4C7TA 4R77A 4R1VA 4XJ0A 5H9BA 3AD6A 3ZXTA 5IDNA 2UVYA 4FTRA 5G6VA 3RALA 4IWDA 5ANGA 3DAEA 3SXRA 2X2KA 4ONAA 2OF4A 3I1AA 1GIJA 1S9IA 4UALA 2W1IA 3H4JA 5CEKA 3FXZA 2F57A 3R9NA 3BU5A 4U79A 3CC6A 3AC5A 2WQEA 4CFNA 3SVVA 5I3OA 3ZO3A 2RFEA 4UX9A 3A62A 3QLFA 3FWQA 4IB5A 4AT5A 2VTSA 3DLSA 4F6SA 4YU2A 5JGBA 1ATPE 2BROA 2UZTA 3BWJA 4I5MA 3PLAE 4C3PA 3C4XA 4G6LA 3S95A 3QHRA 1Q61A 3NUYA 4C3FA 2G2IA 1BX6A 1OL7A 2XZSA 3IDCA 3KGAA 3R01A 3PIZA 4FEQA 5BUJA 3QD0A 4V04A 5FBOA 2I40A 3KMMA 1ZYDA 3E92A 4RSSA 4GU9A 5LOHA 4CFWA 3TDVA 2H34A 2J9MA 1H28A 1NVQA 3D83A 4F1TA 1DI9A 4RWLA 4DFZE 4CKRA 2I7QA 4FZDB 1Q8UA 4NM3A 4B0GA 4U6RA 4CFMA 4MXXA 5CT7A 3VVHA 3GB2A 2YEXA 2XNGA 4IQ6A 4CG9A 4FKTA 5M55A 4BGHA 3SHEA 5L8LA 2YDIA 3DZOA 4IMYA 4ITJA 2QOCA 4EH3A 2WMSA 4DLJA 5EQYA 4BDKA 4F9CA 4O0TA 2XJ0A 3R21A 4JDHA 1PXNA 4PDPA 2PZPA 1JOWB 3CPCA 2UW5A 3ETAA 2QCSA 2PVLA 2QOOA 1H8FA 4FV2A 4YP8A 1REJA 5EM7A 1GZOA 1RJBA 4J7BA 4DEAA 4EI4A 2C68A 2XM8A 3TNWA 2E9NA 4A4LA 3AXWA 2UVZA 5ANJA 2BAJA 3BBWA 2J0LA 3C0HA 2VWWA 5AP4A 3WIGA 4AA4A 3DBEA 4AN3A 3WF8A 5CVFA 5JH6A 3LPBA 4HCVA 2WMVA 2RG6A 3R0TA 1OBDA 1ZYSA 2A19B 3OXIA 3QQLA 4J97A 2IW9A 3VW6A 1U54A 1K2PA 4Z9LA 2F9GA 2FSTX 4IWPA 4W8DA 4FG8A 4LUDA 4A9TA 4UMUA 4NH1A 3NCGA 3CSVA 3NW7A 2HZIA 3QD3A 2ERKA 4D1XA 4EH5A 1YDRE 2WTKB 3P4KA 4WHZA 3NNWA 3QALE 2O63A 2UZBA 4QO9A 3C5IA 4ASEA 5EDRA 4UXQA 5IH5A 3D15A 4V05A 1RE8A 5FP5A 3FHIA 5ETIA 3VBQA 4AW0A 3GFEA 3CTJA 4RIOA 4BDJA 4N4SA 1WBSA 4M14A 2BDFA 4W9XA 4FTCA 4O1OA 2CKQA 3ORKA 2R7BA 2BZKB 3NNVA 4CSVA 4BKZA 4D58A 1YW2A 3OUKA 4XG4A 3W2SA 4EQMA 2PPQA 5AP1A 3ZM9A 2W1DA 4ACMA 4L7SA 3IW4A 4ERKA 2VTRA 3LJ2A 3HUCA 3ZLWA 4JG6A 2GDOA 2ITPA 4MXZA 4X2KA 3PXYA 2HZ0A 3QX4A 4NYEA 2ITNA 2RFDA 3OCSA 4P5QA 3P7CA 3VBTA 2FUMA 4LQMA 4TWPA 1XO2B 4AU8A 4F7LA 3ZZEA 3MN3A 1U59A 5LMKC 4BI1A 2Z60A 4QPAA 4DH7A 3OXZA 4PP9A 5JFVA 4BTJA 4E4MA 2XA4A 4FIJA 3HMPA 4ANOA 4O7YA 4ZEGA 4F63A 2YJSA 4XG2A 4AGWA 4JRNA 3VUHA 2ITUA 4QYFA 5D10A 5AUUA 3R8UA 2QG7A 4D28A 4WD5A 3NUNA 3OW4A 3AC1A 4CYIA 2FA2A 1QPEA 3QAME 1URCA 3FKLA 4CFUA 2ZM3A 1R3CA 1Z5MA 4JT3A 4YPSA 3FZ1A 4H3PA 4IZAA 4ZP5A 4S32A 2OXYA 5DBXA 1WZYA 4L46A 3F88A 3U4UA 2JEDA 2VTPA 3EFWA 2YWVA 3V5PA 1ZOEA 1WBOA 4C33A 2UZVA 4PTCA 5BQ0A 2UW0A 4WA9A 5D1JA 4U44A 4C4JA 5KHXA 4B6LA 1FVRA 5M4UA 1XBBA 4A9UA 4ZLZA 4PV0A 5HE0A 1WFCA 1VYZA 4AFJA 3V8SA 4GU6A 4GK2A 2C5XA 2R3QA 4QQCA 4U3YA 4CVAA 5GZAA 2PYWA 3QRTA 3PXZA 4M3QA 4Y85A 4KRCA 3A7IA 4IVDA 4YZBA 3GU5A 3HV4A 5CF6A 5DGZA 2QU5A 3JYAA 2BDWA 3PSBA 4Q2AA 4HGEA 5HQ0A 5HI2A 4QMZA 4R1YA 3JUHA 4IZ7A 4JR7A 4KAOA 4F0IA 5DEYA 4KINA 4BI2A 3HP5A 3V8WA 5IKWA 4XNEA 3NPCA 5E9EA 3KY2A 1UU3A 4ID7A 1PXKA 5I0BA 1M14A 3VRZA 3PXFA 4HZSA 2EXCX 5IEVA 3CEKA 4D1SA 3GC8A 4IIRA 3TL8A 5HVJA 3W1FA 4UMPA 2G1TA 3MSSA 2XJ1A 3MA6A 5E8TA 2C6EA 3CR0A 5AR8A 4BDCA 5C4KA 3WZJA 5C1QB 3EWHA 5TR6A 3HVCA 5KMMA 5DE2A 5FP6A 3EJ1A 4KIQA 3T8OA 1WCCA 4II5A 1SMHA 5CEMA 3LCDA 2OXDA 3NUPA 2XJ2A 3PZEA 5DT3A 3WI6A 3OWLA 4L7FA 4L43A 3PFQA 4X3FB 2ZV2A 2ZM1A 3OT3A 4HCUA 3LQ3A 2JDTA 4ZJJA 3D7ZA 2PVMA 3QD4A 3FZSA 2G9XA 3N51A 2ITVA 3Q96A 4BCNA 1YVJA 4CMTA 1H1RA 3KXNA 4CT1A 1JAMA 4ANBA 2PMNX 4KD1A 4YO6A 3ZUUA 4QTAA 3GC7A 4QP3A 1FBNA 3TN8A 4EZ5A 5HE3A 3CJGA 1ERKA 3I5NA 5EW8A 5AV3A 3TUCA 4USFA 3QQJA 3T9TA 3FI3A 1PXLA 4J1RA 3KK8A 2ZMCA 3MTLA 2BRBA 2X81A 4Y95A 5CU6A 5C9CA 4CKJA 3EN4A 2JBOA 5DT4A 3MV5A 4PF4A 3DZQA 5K5XA 3HDNA 4RJ3A 2R3MA 1NT2A 2R3NA 1FGIA 2HZ4A 5JT2A 2WEVA 2XCKA 5TO8A 2R4BA 3OUNB 5D7VA 4EWQA 4CGAA 1HCKA 4JDIA 4K11A 5AUZA 3ATSA 1WVYA 5FTOA 4DH5A 5JQ8A 3THBA 2UW3A 4QNYA 3HV6A 3R7YA 3KCFA 2IPXA 3V5WA 3HA8A 3DTCA 1Y57A 3ZONA 2C0IA 4BHZA 2EB3A 4MNEB 3QKMA 3QUPA 3U4WA 5F9EA 3O8TA 5C8NA 4LOOA 4G9RA 4JRVA 5AA8A 1LUFA 2C4GA 2UZWE 3BE9A 3QGWA 4M69A 2PVJA 4WBBB 2WMBA 3P23A 5HCXA 4DBXA 2BTSA 3FMMA 3C13A 5EI6A 4AA5A 3BZ3A 5M06A 3W33A 2C69A 5FLFA 3F2NA 4ASDA 2FVDA 3K3IA 4FUYA 4MBJA 4AOJA 4BCKA 4UY9A 4DFNA 5HORA 5IISA 3JR1A 4FR4A 3HP2A 5CT0A 2QLQA 3QCSA 1UA2A 2OF2A 3CPBA 1JKTA 4V01A 4ZTQA 2ZM4A 3ITZA 4R3RA 2NO3A 3QQUA 2ZYBA 4FTMA 3MTFA 4FL3A 4UMTA 2CGVA 2ZDUA 3F5XA 4RBLA 1OL2A 4YJRA 5IA5A 1GAGA 2W06A 3QTRA 2XK8A 3WBLA 4YSJA 4FNXA 4AZSA 3FSKA 5KMNA 5EDPA 5M07A 3RWQA 2UV2A 3HZTA 4ZTNA 2PVRA 3VJOA 4EK4A 4E73A 4JX3A 2W1ZA 4I0SA 4QQTA 5LVLA 4IAIA 4ZOGA 4FTNA 4D2SA 4JBVA 5ACBC 1OGUA 2BVAA 2YCFA 2GFSA 2ETKA 3LXPA 3QRIA 5KO1A 1PMUA 4A06A 4X2JA 4EKLA 1Q8TA 4UZDA 2VX3A 4IAZA 5EYMA 1JVPP 3SLSA 5AR5A 3ZBFA 3E7VA 3HMOA 4FYOA 4I23A 5AMNA 3I81A 4I94A 4BZOA 3F7ZA 3OS3A 3RAIA 3KMWA 1JLUE 4DA5A 4E20A 3BIZA 3NEWA 4IB1A 2R0UA 5AIRA 1IASA 3AT4A 2PUIA 5K5NA 4IM2A 4YBKA 4J53A 4Y83A 1IR3A 2JKMA 5LCJA 3MA3A 5H2UA 1J3HA 4YZDA 4GVAA 5AAGA 2CHLA 2CNVA 4RFYA 3QZIA 5AIKA 3TG1A 2G15A 4CZYB 3UIXA 3AMBA 3KRRA 3BHTA 5AP7A 5L8KA 5AJQA 4CEGA 1LPUA 3HX4A 1WBTA 2AYPA 4I20A 1A06A 4DBNA 2YM4A 4XP3A 5H8EA 4JVGA 2OIDA 3UG1A 4EHVA 3WZDA 4O0UA 2F2UA 4IANA 3LFAA 3LM0A 5CVGA 5D9HA 3JS2A 1W8CA 3H9FA 3UP7A 4ACHA 3TNHA 4IE9A 1SVGA 3HDMA 3R1NA 2VO0A 4IAFA 2ITZA 4L52A 3UIUA 2A27A 1FQ1B 3LCSA 4GFOA 3AT2A 4FKQA 4XLIA 3V51A 2PVFA 3KKVA 3MFTA 3VO3A 2IZRA 4CQGA 4F08A 4MEDA 3Q6UA 4MBLA 4JR3A 4EORA 4WNMA 2P4IA 3HAMA 4P5ZA 4YTHA 4IW0A 4RZVA 5H8BA 3FUPA 3SC1A 4DTBA 4BKJA 4HNIA 3F3VA 5KMOA 4N6ZA 4FKPA 1IA9A 5CEQA 4L3LA 4FZAB 3MY5A 3UTOA 3FKOA 4FIIA 4F6WA 4QMWA 5JFWA 2V62A 1XQZA 2B7AA 2YM5A 2ZVAA 4P4CA 4OT6A 2P2HA 3QHWA 3D4QA 1Z9XA 2WMRA 3OEFX 5EOBA 2IZTA 4XV3A 4D55A 1H07A 2R3OA 4IAAA 5F95A 4PRJA 3KF4A 2JKKA 5CSPA 3OTVA 3LQ5A 4M0ZA 1ZY4A 2JDVA 2PZ5A 3ZMMA 3OD6X 4C61A 4TYIA 4TN6A 2FSOX 4FL1A 2YLFA 3NYNA 3TNPC 3DXQA 4J95A 5E92A 5L6OA 2P33A 2VTMA 5LMBA 4C37A 4FA2A 1RW8A 2J0MB 4O1PA 2R0IA 4O7TA 3GFWA 4V0GA 4O86A 1Q4LA 5BYZA 4JI9A 3TZ7A 3LM5A 2VWUA 5J1WA 3IS5A 2DYLA 2WMAA 3OF0A 3OROA 4XG6A 3UE4A 4CTCA 3S2PA 4FNZA 5E8YA 4RJ6A 4EHZA 3CQWA 3FLNC 4TT7A 3NW6A 5CAQA 5IMEA 1JSUA 3G0FA 2CN5A 5HNGA 4GVJA 5EDQA 3UVQA 4ZSAA 5CAVA 5H8GA 3K5UA 4QT1A 1PJKA 2UZNA 4O6EA 3V8TA 3NIZA 4Q5EA 3IDPA 5CU3A 3IECA 5H3QA 4FX3A 5A3XA 4ALUA 4D0XA 2HY0A 1B38A 1U46A 3CTHA 4YJTA 2UW9A 3NUXA 4M13A 3V6SA 2F49A 3P1AA 3SAYA 4NKSA 1V0PA 3VF8A 4DITA 1FOTA 4FL2A 4QP9A 1ZOGA 5AUWA 3ZEPA 4K9YA 4O84A 4YC8A 2CNQA 2Y7JA 4F4PA 2PUUA 3OVVA 4F9AA 3LFNA 3BGQA 2J5EA 3R6XA 2XRUA 2Y4PA 3MY1A 5CALA 4OTHA 3JVSA 3IDBA 3ORNA 4CCBA 4ENYA 3E3PA 4JNWA 3BYVA 3UMXA 4APCA 5L2SA 4IVAA 4JAJA 5BVFA 5GINE 2OFUA 5DMZA 2WO6A 5T6KA 2OZAA 2YHVA 3ZZWA 4BL1A 5FD2A 2B9JA 3QTWA 5CAOA 5I9ZA 4J8NA 3LW0A 3SOCA 5J95A 2RIOA 4NTTA 2VV9A 2YZLA 2IO6A 3U51A 5HBJA 2QQ7A 2H9VA 4U41A 3W8QA 4TWNA 3UPZA 4DGGA 3I0QA 4F65A 2R3PA 2GQSA 5HLNA 3HV3A 4N6YA 5J79A 3VS5A 1SVHA 3EQRA 5HLWA 4FEUA 3I6UA 4BZDA 5DPVA 3L9LA 1CKPA 4ANQA 1IAJA 3NVMB 1JNKA 4UWCA 3CJFA 3M2WA 5FBNC 4RZWA 2Q83A 4FKSA 2W5BA 3R28A 1WBWA 4WSYA 3TKIA 4AE9A 3KB7A 4YHFA 4F7JA 2PE2A 4K18A 3ZSGA 5IA0A 1OL6A 3GCSA 3C4FA 5KNJA 3ODYX 4UYNA 4MF0A 2X4ZA 3DQXA 3GBZA 5AM6A 3VIDA 2OLCA 3NYOA 3ZU7A 1SZMA 3BHHA 2VTOA 4YNOA 4ZMEA 1YXUA 3JPVA 4PDOA 3EN7A 1OPKA 3E5AA 5B7VA 4XS2A 5GJGA 4FTQA 2XEZA 3CTQA 3RZFA 2X9EA 2WTDA 2PVHA 4U5JA 3BYSA 2QKRA 1ZMVA 3BE2A 1FPUA 5E8UA 3ULIA 3S00A 3UOJA 4K1BA 4AA0A 4KKGA 4XG3A 2EU9A 2J2IB 4ZS0A 1MRUA 2ITYA 5HU3A 2WU7A 3E88A 3E8DA 1H4LA 4GYGA 4X6RA 1G3NA 2IVTA 4E1ZA 3HAVA 2CLXA 4XBRA 1M7QA 3CXWA 4K33A 3U6JA 3PG3A 5E1SA 3PWYA 2VWZA 4ZY4A 4DEGA 5L2QA 3RM6A 2I6LA 5M53A 3FI4A 1V1KA 2I0YA 2NPQA 4YBJA 3DB8A 3BX5A 3MGYA 4LFIA 4TYGA 5ANDA 3FL4A 1SYKA 2UZDA 2XIXA 3G0EA 4FV4A 4E26A 4FEVA 3D7TA 3EQCA 4MVFA 3R1SA 4FT7A 2QOLA 3GT8A 2X7GA 4RIWA 4O2ZA 3F6XA 3RHXA 4C4HA 4NU1A 3ZDUA 4EUTA 3EQHA 4QP7A 2J0KA 3Q4ZA 3KVXA 2PZIA 3G5DA 3L8PA 1Q3WA 2GMXA 4ZSJA 3FAAA 3MDYA 4ITHA 2VN9A 1PXOA 2CJMA 3A7JA 1Q8WA 4X6QC 2FSMX 5DVRA 4DG2E 4H1MA 3M1SA 2DS1A 5AP5A 3PXQA 5HZNA 4MX9A 4G34A 2BZHB 4H3QA 3PDTA 1PXIA 4IX3A 2X8EA 4KS8A 2C5OA 4HGLA 4OLIA 4RC4A 4Y73A 3MIYA 3K2LA 4NSTA 4U0IA 3TZMA 3LXNA 5L3AA 5CANA 3DTWA 2FYSA 5M56A 3MJ2A 4NJDA 3GC9A 3UJGA 4CT2A 5A14A 4RJ7A 4AE6A 1H1QA 1Y91A 5CQWA 4O7SA 3BRBA 2OSCA 2CLQA 3CKXA 4IC7A 5L2IA 2BRNA 2VTIA 4WG4A 4GKHA 3DBQA 4IWQA 3FKNA 4BTFA 3ERKA 2P0CA 3HEGA 3IKAA 2BIYA 5I9WA 2QOFA 2WIPA 3A4PA 4YZNA 3LCTA 3QTIA 4QMTA 4C58A 2XM9A 4DE4A 3GC0A 5AFVA 2VO7A 4DGMA 4D9TA 3ORLA 1H00A 4MKCA 5BUIA 4BDAA 5EM5A 4E7WA 3D2IA 3TI1A 4JXFA 3ZC5A 4NW5A 2FO0A 2GS2A 2BZJA 4KKEA 3U87A 1KE5A 3D5UA 3MH2A 4ZIMA 2B52A 4O0YA 3ZH8A 4NIFA 4N0SA 3R7OA 4USEA 3VN9A 2PTKA 1YWVA 4QNAA 4WNPA 4X7QA 4O22A 3O23A 3SKCA 4B7TA 4A4XA 4QMUA 1QPCA 3R8MA 5AWMA 1MRVA 4OTGA 4QP4A 3A99A 3F3WA 4D2TA 2OFVA 4FT9A 2CPKE 3PZHA 1DS5A 3FZTA 3PJ8A 3QBNA 4GT4A 4RX8A 4AX8A 4XH6A 3U8WA 1J1CA 4FSTA 2WNTA 1BI8A 1CMKE 1M2RA 3OFMA 2C6IA 3Q5IA 2VRXA 4RA5A 4EHEA 4BBFA 4JDJA 3FLSA 3NRMA 2XEYA 1XBAA 4GL9A 3DV3A 4KIOA 3ZM4A 3NYVA 1F3MC 3QC9A 5ICPA 3O8PA 4E5AX 1EH4A 3PP1A 4J96A 3AT3A 4E5WA 3UBDA 2C3KA 3QL8A 4D2PA 5EQPA 2HIWA 3UOKA 1X8BA 3PIXA 3UYSA 3VHEA 3Q3BA 5TT7A 3ZCLA 4QTDA 1VZOA 4LV5A 3UC4A 4NUSA 4OTQA 2UUEA 4NWMA 4WSQA 4WRGA 2Y6MA 3E3BX 2WTWA 3EHAA 3R2YA 4GKIA 2ACXA 2X7OA 3HKOA 1H27A 4L45A 5TF9A 4W4WA 2XNMA 4MD9E 3R71A 3I4BA 3ODZX 4CYJA 5I5ZA 2BPMA 2OJGA 1WBVA 4I92A 1PHKA 2WQBA 2CCIA 3VBYA 2O2UA 1RDQE 5AR4A 1U54B 3Q4CA 4AZVA 3ZTXA 3ZYAA 3OG7A 3MWUA 2QOQA 4H1JA 3R1YA 4S31A 1APME 1ZY5A 3KF7A 4ZMFA 3COIA 3HMNA 3MVLA 4K6ZA 5CSXA 5C01A 3DQWA 3PJ1A 4L01A 2B9FA 4U40A 5FDXA 5ACKA 3NLBA 3TEIA 1E9HA 1YDTE 4BCHA 2JAVA 3S0OA 4FE2A 3LFEA 3FLZA 3QA0A 4WG5A 3WILA 3D2KA 3PJCA 5CSHA 3ZO1A 2QG5A 5BVDA 5HEZA 4EH6A 3GXLA 1JKLA 2W1FA 5KHWA 3KXHA 4TYHA 3Q04A 4C2VA 4O6LA 4FC0A 3TIYA 4MF1A 4UB7A 4PTGA 2YLEA 3UG2A 5EKOA 1A48A 3M11A 4CRSA 3LJ1A 5HGIA 3LMHA 2X2MA 5AP6A 4L3JA 2GNLA 2W96B 3CE3A 4G6NA 1JSVA 4O91A 5KMLA 2XYNA 1ZLTA 2Z8CA 4QYYA 3R7UA 3VWAA 5E8VA 4G3FA 1PKGA 5AA9A 2BRHA 1WVWA 3R9DA 4CG8A 1M17A 1YOJA 1OUYA 1W83A 3ACKA 3MBLA 5DI1A 5KZIA 3ORPA 3N4VA 1OKVA 3NUAA 4UMRA 3NNUA 3PXKA 4YJQA 3VNTA 1H1PA 1YWNA 2V22A 4OTDA 2XK3A 4F0FA 4L44A 3VHKA 3WOWA 5CF4A 3BELA 4J99A 5FWKK 2R3JA 2UZEA 5CZHA 3DKGA 1XKKA 3TV4A 5HIEA 2ITWA 3PP0A 5EM6A 5JGAA 2GNHA 4YLLA 2ZAZA 4RVLA 3FBVA 1JKKA 3IW5A 3ZUTA 3L9MA 3BPRA 1BLXA 3LE6A 4RIYA 2ZV7A 2HK5A 2WMTA 4JL9A 3GQIA 3ZUVA 2ITOA 3AG9A 4NL0A 2ESMA 4EBWA 3F7WA 1TQIA 4G31A 3VBXA 3V6RA 3E64A 3G2FA 3PWDA 2FGIA 2W17A 4MD8E 4QMMA 1FGKA 2WMXA 4Z55A 4PMSA 4MBIA 5HD7A 4O7LA 2QO9A 1KOBA 4LM5A 3BHUA 4TTHB 5HO6A 3RGFA 3RK5A 3FYKX 3OY1A 3CY3A 4RIXA 1MUOA 1OMWA 2VTAA 3OP5A 5HG9A 3UO6A 4CFVA 4E4XA 1BL7A 3BU6A 3KA0A 3NSZA 3F82A 3NUUA 3ZFMA 2JIVA 3W2CA 3LXLA 4DEDA 3FMNA 4PMPA 5IH4A 2FH9A 3R7VA 4UBAA 4E6AA 3QUEA 4L3PA 4PL3A 5IA4A 3BKBA 5ETFA 4HPUE 3DFAA 1Q41A 2WOUA 3TNIA 4Y72A 3VS3A 1FMKA 1Q5KA 4PL4A 4WG3A 5CF5A 2WOTA 1OZ1A 3QFVA 2PE1A 2W05A 3OY3A 5LVPA 4O82A 4AT3A 4S33A 2PL0A 3P7BA 4HYSA 3G6GA 3O8UA 1OPJA 1NVSA 4G3DA 3VC4A 4YTFA 4FSZA 1XH9A 2CGWA 5IQAA 5AM7A 4UV0A 3QGYA 2X7FA 4E8AA 4FG7A 2W0JA 1ZZ2A 2C5YA 2GCDA 3C9WA 4ZXTA 3UIBA 3EYHA 5GZ9A 5AUYA 2JKOA 4YO4A 4F9BA 2ZDTA 2X6DA 4JG8A 4KA3A 3QTZA 4FKGA 5HO7A 4M66A 2J90A 1R0EA 4EOSA 4EYMA 4D4VA 2J7TA 3P9JA 3DNDA 4EUUA 5CI7A 3A61A 2WIHA 2ITQA 3AC8A 4QP8A 4D5HA 1I09A 1HOWA 3HUBA 3Q60A 4QP2A 4DGOA 4EH8A 3RCDA 3W2PA 2XKEA 3R1QA 3MPTA 4GJ3A 4RWKA 4EOKA 4FSNA 4FTLA 1OECA 1J7LA 1OKWA 2JKQA 4M68A 3VBVA 4EK8A 4CTBA 3BLRA 4IHPA 1K3AA 4RPVA 1ZMUA 4PUZA 2UZLA 4CZUA 5I9YA 4QMLA 4AT4A 1U5RA 4FVPA 4DFLA 4ASZA
chains in the Genus database with same CATH superfamily
4YJNA 4AXDA 4EL9A 3MY0A 5I3RA 3DBDA 3PRIA 2O64A 2VX1A 2W1CA 3L8SA 2QONA 4EOOA 2Q0BA 2O5KA 2FB8A 3PA4A 4AF3A 2HXLA 4RJ4A 2Z7SA 4LRKA 4FTJA 5D41A 4FYNA 3UNJA 2E9VA 4C59A 2XVDA 5EYDA 4PX6A 3PXRA 5CXZA 2GHLA 3UDTA 2YIXA 3JY9A 3HECA 2BDJA 3GCVA 4D4YA 2PWLA 3LOKA 4ACCA 3D5XA 3U6IA 2RFSA 2VX0A 3KULA 3R8LA 3TNQB 3U55A 5HLPA 4KSQA 3AKLA 4DT9A 4ZTLA 2X8IA 4C57A 1IAHA 2BILB 2C47A 2ZB0A 4NZWB 3L1SA 2PMLX 2ZOQA 1VYWA 2EXMA 4H3BA 5JMSA 1AGWA 2JDRA 4UMQA 4LOQA 3RPVA 4NKAA 3VUKA 4OTIA 3HV5A 1QMZA 3BEGA 3DB6A 4YMJA 2WTVA 5AR2A 3AGMA 4FK6A 4M69B 2HENA 3U9NA 3DDPA 2NRUA 4OR5A 2VU3A 1BKXA 4KS7A 4XV9A 5TE0A 2YN8A 2Z7RA 3FMDA 4OTFA 3BYOA 4CV8A 1CKIA 4E6DA 4FTAA 4I5CA 4CLJA 3OT8A 2BTRA 3PUPA 5BUEA 1W82A 5EYCA 2YWPA 5L6PA 4GT5A 3FV8A 2PVNA 2XIKA 4HGSA 1REKA 4C2WA 2F2CB 2IEWA 5EW3A 5AV4A 4B8MA 3DT1A 1UV5A 2C1BA 4E6QA 2VZ6A 2AUHA 4Y8DA 3UOLA 4FSWA 4C3RA 5C26A 4JQ8A 4MYGA 5AV0A 4Z7GA 3U6HA 1W98A 1ZWSA 5AX9A 3H9RA 5EHYA 4AQCA 4DAWA 3DCVA 2C5VA 3EFKA 2F7XE 5HG5A 1J7IA 2BFXA 4DTAA 3R7GA 4QMYA 3D0EA 4JOAA 3F3ZA 4G2FA 4L53A 4BI0A 5AADA 1YXVA 5I9UA 3ORZA 2CDZA 4EOPA 3F5GA 2PHKA 3A2CA 1OI9A 2E9OA 4JQEA 4QPSA 4RLLA 4WO5A 5DFPA 5EH0A 4PTEA 2F7EE 4I6HA 1LEWA 2C0OA 4BBEA 1A9UA 4EH7A 4LGHA 1Y8YA 4B8LA 2R3LA 2R3RA 4IVBA 3EQFA 4APPA 4E4NA 4F7NA 4BWKA 2QC6A 4EK6A 1NW1A 4U9AA 5KBQA 2CKPA 4HVGA 3VBWA 3KRJA 4K0YA 4OTPA 3SXFA 3D94A 4AGDA 2G01A 2G2HA 3BYUA 3QYZA 4AXCA 4MWIA 3DKCA 1RQQA 1YI6A 3WF7A 3CGFA 1YI3A 1YDSE 4XBUA 4NFMA 4CNHA 5AX3A 4PWNA 5HCYA 3I7CA 3UVPA 2REIA 3EKKA 4EQUA 4F0GA 4BY9E 4JJRA 3W2OA 4LYNA 4Y46A 4TZRA 3N9XA 1MQBA 4C8BA 4YGAA 2GTNA 2X0PA 2XUUA 4AP7A 2B0QA 2GQGA 4KBKA 4YURA 2OIQA 3QRUA 5A4LA 2Y4IC 3CS9A 4YZCA 4I4FA 4PP7A 4O27B 4F70A 4HVHA 3VQHA 4HVDA 5FUTA 4DGNA 2O65A 4R7IA 3S4QA 4TNDA 4A9RA 4MAOA 2DWBA 1PXJA 2WTIA 3PSDA 4G1WA 5M57A 4LMUA 2BAQA 3VQUA 3DBFA 2J0IA 5BNJA 2W1HA 2PU8A 1F5QA 4UWBA 1U5QA 4ZZNA 3FC1X 3E63A 4L6QA 2NRYA 4Y5HA 1Y6AA 4MNEA 4BCMA 4RVMA 5EM8A 4F1MA 3MJ1A 1Q99A 2YDJA 4IZYA 3B8RA 3FLQA 3QUDA 3UGCA 4BDBA 3CD8A 3D5WA 2YERA 3RNYA 3EL8A 3ZFXA 3MVHA 2PY3A 4GRBA 2R7IA 3P0MA 3R9HA 1XH6A 2CMWA 3WF6A 3EIDA 3PPJA 4FTIA 4QQJA 5CEPA 5FM3A 5F1ZA 2XK4A 1JQHA 1Q62A 2W9ZB 5A6OA 5IA2A 4IXPA 4BICA 3GU7A 2OGVA 3ROCA 1P4OA 3CP9A 3FI2A 5HG7A 3VJNA 5B2MA 3C7QA 2QOIA 3QU0A 3SW7A 4DEHA 4G3EA 4GMYA 3D14A 1V0BA 3Q52A 3LFBA 4O7RA 3NVKI 3BCEA 4BCGA 2ONLA 1H1SA 4TXCA 3FL5A 3UQFA 2YM6A 3RPRA 5CEIA 1T46A 4RG0A 4RWIA 5M44A 4LGDA 4MXYA 3PY0A 4DTKA 3EKNA 2AEGA 2XF0A 4BRXA 2XKDA 3OBJA 4H58A 1KWPA 2OXXA 5DA3A 2VGOA 5DLSA 2YCSA 3HRCA 3IW8A 4GIHA 4L68A 5B2LA 3R22A 2QHMA 1H01A 1JKSA 5JZNA 4V0GB 5A4TA 5HVYA 4G5JA 1OM1A 2JITA 4LL5A 1Y8GA 3C0GA 3BHYA 2HW6A 5L8JA 4FTUA 4M15A 4D9UA 4MUQA 2ZJWA 4NW6A 3F9NA 5EKNA 3NUSA 3RZBA 4BDGA 2YIRA 3ZRMA 4FODA 4C4GA 1Q8ZA 2P55A 4I5PA 4QTEA 4GUBA 3DK3A 3DXNA 2WHBA 3PVUA 3ZRLA 4QMVA 3RAKA 3GU6A 2XK9A 4JBQA 3CGOA 4QD6A 3SA0A 3PLSA 4PDSA 5TKDA 3F5UA 3CQUA 1W0XC 3HGKA 2XK7A 3BI6A 4A9YA 4C4FA 1ZYJA 2PE0A 4W4XA 2A2AA 5IQIA 4GV1A 5AUXA 3GU4A 2YCRA 3FC2A 2JIIA 4X2GA 1UVRA 1G8AA 1Q97A 2GHMA 3EZRA 1JWHA 5CLPA 1J91A 5FDPA 4KIKA 1JPAA 1XH7A 4A7CA 4UEUA 4G6OA 3H0ZA 4U7ZA 2J0JA 5T68A 3BBTB 5C4LA 3ZBXA 4FBXA 3I60A 3MFRA 4D5KA 2VWBA 3NAXA 1URWA 2B54A 2XNOA 5DH3A 4A4OA 2PSQA 3FDNA 1OIUA 2B9IA 5K4JA 2HCKA 2XBJA 1XWSA 1WMKA 2YJRA 3JVRA 2GNFA 3OOMA 3ORMA 4G3CA 1P5EA 2JAMA 4JX7A 2Y0AA 4YLJA 3W2QA 5HICA 3ZEWA 4FT0A 3W0NA 5LWNA 4BR3A 4FKIA 4F6UA 1OIQA 5EI2A 2C3JA 2OI4X 3UO4A 2QURA 4FTTA 4FK3A 3QQHA 3O17A 1DM2A 3GGFA 2HZNA 3HNGA 3NDMA 5BVNA 3P78A 4R5YA 3DOGA 3TZ8A 4U42A 3T9IA 4U3ZA 2XAOA 3R8VA 3FHRA 4TWOA 2VWXA 4U97A 4BVUA 4DEIA 5JK3A 4BWPA 2B4SB 2I0HA 4AAAA 4BTMA 5EW9A 2BALA 3HMIA 3AC3A 1CTPE 2XS0A 2X0OA 2Y6OA 5HO8A 3GCUA 4Z16A 3OCBA 3VW8A 2H96A 3LXKA 4XV1A 2R3KA 3A7HA 2GHGA 4EJ7A 3FY2A 3PA5A 4AGCA 4O0SA 3MIAA 4DYMA 3QTQA 2W1EA 2X2LA 5ANIA 3RK7A 4BTKA 2W4OA 1YKRA 4YZ9A 3EQDA 5D7AA 3F3TA 3DY7A 3PY3A 5EFQA 4BIDA 4AN2A 5A4CA 5A4EA 2IVUA 4JAIA 4O38A 3EFLA 3QZHA 2XCHA 4WBOA 4GCJA 1F0QA 5AV1A 4K77A 4USDA 2W9FB 4WNOA 5JKGA 3FZPA 5J8IA 3Q4UA 3R83A 4MQ1A 4ALWA 2QOKA 1E1XA 4RX7A 1PMEA 4ERWA 4DDGA 3R30A 3RI1A 4BYIA 1U4DA 4E3CA 5L4QA 4ORKA 3WF9A 2Q0NA 2J6MA 2VWYA 4KRDA 3PJ3A 4LGGA 4YC3A 4EOQA 5J7HA 2VTHA 2E9UA 2C6DA 4ZY5A 1YOLA 4I5HA 1OKZA 4ZSEA 3COKA 4ZAUA 4FKVA 5KBRA 2H8HA 2WELA 1FINA 2B53A 1W84A 3Q9YA 4XV2A 3V01A 4GG7A 1IA8A 3QTUA 4C62A 2Y8OA 4IJPA 2OJ9A 3SG8A 2XKFA 3KRWA 3H10A 3ROYA 4X21A 4BCJA 3OXTA 1ZOHA 5K0XA 3D7TB 3KXGA 4OTRA 2X4FA 4M8TA 3T3VA 4FT3A 2ZV9A 3FPMA 4RIWB 4C35A 1NVRA 2WTCA 3FPQA 3QA8A 3LZBA 1O6LA 4OAVB 3ZOSA 3K54A 5DYJA 2W7XA 3WYYA 3QTSA 4PMTA 1XMLA 4BHNA 3LMGA 4NFNA 2XRWA 4FVRA 3IG7A 3NYXA 5KX8A 4XX9A 4KB8A 3BLQA 5HBHA 3IGGA 3SRVB 2YM3A 5BYYA 4UWYA 4TRLA 5FQDC 2W5HA 5K3YA 1IEPA 3BEAA 3VAPA 1MP8A 2ONLC 2IW8A 3DGKA 3C0IA 4XEYA 3BLHA 4U80A 3EB0A 4C38A 3KVWA 2Z02A 4NK9A 2PMIA 5ETCA 2V55A 2BFYA 3VUGA 5HE2A 3RP9A 1J1BA 1GNGA 1XH8A 2GFCA 3D9VA 3E8CA 4DT8A 4DINA 5E91A 4J52A 3QC4A 3PPKA 3BU3A 4DLIA 1QCFA 4BZNA 5IQDA 3GEQA 4AZEA 5J9YA 2OJFE 2VO3A 1O6YA 4XUFA 3U9CA 3NZ0A 5E4HA 3L8XA 4NTSA 4TPTA 3BWFA 3VUDA 3IGOA 3QQKA 3EFJA 4FIHA 3MVJA 4KBCA 3OCTA 4AG8A 5LVNA 4MNFA 4ZJIA 4PPBA 1SVEA 5HBEA 5HCZA 4O4CA 4RC3A 3B2WA 4XOZA 2WMWA 4I41A 4EC8A 5KMJA 3CKWA 3Q9ZA 3FQSA 4EOMA 3BV2A 2XK6A 4FEXA 4DCEA 4FIGA 4AW5A 2RF9A 4XG8A 4BN1A 4MXAA 4ZZOA 1YI4A 4FICA 2BKKA 4LRMA 1WVXA 3P86A 3R9RA 5HHWA 2UW6A 3TV6A 4NIFB 5BVEA 3V5QA 4TNBA 3NW5A 3RPSA 3MS9A 3P5KA 4YSMA 4BCQA 2QLUA 4QP1A 4TWCA 4I93A 4AOIA 5HG8A 4L9IA 3M42A 3RVGA 4DGLC 4HYIA 3AMYA 1UU9A 2A98A 4DC2A 2IVSA 2CNUA 3FMEA 2R3IA 2PVKA 3T3UA 4AXAA 2VAGA 3QKLA 1LP4A 2BRMA 4F9WA 4QOXA 1OL5A 4FV6A 5GIPE 1YQJA 4DFXE 3UNZA 2C5NA 4FV3A 4YJOA 3TWJA 3VULA 1OUKA 2OJIA 3BQRA 4IH8A 2JC6A 1KUTA 2RSVA 4YPDA 2VUWA 2CCHA 4EOLA 4OAUC 4GK4A 1H25A 5IQFA 4I22A 4EONA 3GVUA 1P14A 5B0XA 4FOBA 4BB4A 5EHLA 4CXAA 2QKWB 5AV2A 5LJJA 5M09A 4O96A 5JFSA 2BIKB 3TJCA 2VTQA 5CVHA 3PTGA 4CZTA 3TV7A 3JY0A 1H24A 4E4LA 3QXOA 3MPMA 2GS7A 4YHTA 3RCJA 4JBOA 4LOPA 3LMIA 3OWPA 3O7LD 4C4EA 3A60A 5IZFA 2QOBA 2R2PA 3OTUA 4IVCA 2B1PA 5HTIA 4MD7E 4R3CA 5B2KA 4IB0A 3HLLA 3CY2A 2C6TA 5AAFA 4H39A 4RA4A 5FGKA 3EYGA 3W8LA 4BDIA 3KCKA 4IX4A 4TY1A 5G1XA 2OU7A 4IADA 1G5SA 2UW7A 2AC5A 2VWVA 3MFUA 1UNGA 3IQ7A 4L42A 4ANLA 2HW7A 3UNKA 4BCIA 3ZC6A 1PYEA 4P7EA 5AR7A 3QCYA 4IEBA 2IN6A 3HA6A 4B9DA 3QZFA 5JSMA 4ZY6A 3Q53A 4DF3A 3HMMA 5FXSA 1CDKA 2JD5A 3EQBA 3ORIA 4QDEA 3DAKA 5LARA 2A0CX 5F20A 1GZNA 3PIYA 2HOGA 4DHJA 3NWWA 4OGRA 4U45A 2WQMA 3KXMA 4RMZA 4TYHB 4FOCA 2WQNA 5CEOA 3IK3A 1H0VA 1VEBA 2QD9A 5A6NA 3PVBA 3R8ZA 5F94A 2EXEA 4S34A 5CY3A 1SM2A 4EWHA 5EHOA 1KV2A 4FV7A 3MH1A 4I6FA 3EH9A 4K2RA 2C3LA 4KABA 3ZLYA 4ZJVA 2VD5A 4EC9A 5I9VA 3POOA 2XIRA 3VS0A 2IZSA 4GFMA 5HNBA 4GG5A 4IAYA 4QPMA 2C6KA 3BHVA 4RQKA 3GU8A 4MTAA 5LWMA 2QR8A 5AUVA 2OBJA 4CKIA 5KE0A 1PKDA 4H05A 5M51A 3QX2A 1BI7A 4JG7A 5HE1A 3FQEA 4B99A 5BMSA 4AQKA 5DWRA 4XMOA 5A54A 4KUJA 4FKRA 4MCVA 3KRLA 1AD5A 4WNKA 5FTQA 1PRYA 4ZSLA 4Q9ZA 2YDKA 4FSYA 2Z7LA 2YA9A 1J7UA 4BC6A 3UOHA 5EQEA 4QTBA 2JBPA 4GYIA 3PVGA 4PL5A 3F69A 4AW1A 5GHVA 4EZ3A 1DAYA 5BVOA 3C4CA 1YOMA 2CN8A 3PE2A 3LFQA 3NFGB 2RL5A 2UW8A 3COHA 2YABA 4G9CA 4JLCA 4RIYB 5LXMA 5CU2A 1WBNA 2GU8A 4IX6A 4G16A 3UPXA 2CGXA 5C8KA 3DJ7A 3A8XA 2KTYA 3LCKA 2OWBA 3LFSA 4RJ8A 3UZPA 3KN6A 2FSLX 3BGPA 3PE1A 4J98A 3FYJX 1KE6A 3WF5A 4RIXB 3QQGA 5IG1A 3O71A 4I1ZA 1G8JA 5BPYA 3OC1A 4XHKB 1VR2A 2W5AA 2E2BA 4RX9A 3OW3A 5D11A 4FSMA 3AMAA 3DAJA 2Y4IB 4NEUA 3P5JC 2WD1A 1XH5A 4GH2A 4DH3A 1IG1A 4LG4A 4RVTA 3ZLXA 5I9XA 4WIHA 3V5JA 3P79A 4IAKA 3TUDA 3DPKA 1XMMA 5D12A 2OO8X 5GJFA 2WXVA 2YFXA 3VF9A 1M2PA 4IM3A 1ZARA 2RKUA 4FKJA 3SOAA 3FZOA 3ZO4A 5IPJA 2BMCA 4WT6A 2RGPA 3RMFA 3VONA 5C8MA 1OIRA 5IDPA 1LEZA 3NCZA 5CX9A 3H0YA 2R3FA 3KN5A 3GCPA 5ANEA 1ZYLA 3G90X 4IC8A 2OK1A 3A7FA 4WOVA 4ZZMA 4AXFA 5IA3A 3RPOA 4S2ZA 5A46A 2OW3A 3ALOA 3IPHA 4DH1A 2YAKA 3BQCA 3O2MA 1YHSA 1YRPA 3OOGA 4OBQA 3RKBA 1ND4A 4AW2A 5J87A 4D4SA 1HCLA 4CLIA 3L9PA 4XYFA 4ACGA 4GEOA 2IW6A 4G17A 3OHTA 4X3JA 5J5SA 3N4UA 4ZS4A 4I21A 3GQLA 4KWPA 4ANMA 2BR1A 4LMNA 2XBAA 3WZUA 5HU9A 5KMIA 3SG9A 5IQEA 2O3PA 1WBPA 4M12A 4CV9A 1OIYA 2HELA 4L67A 5IQHA 4FSQA 5E8SA 1I44A 4YC6A 3FJQE 5A9UA 2UVXA 5BV3A 4BF2A 2WGJA 1H1WA 1OKYA 5CXHA 4A9SA 2I1MA 4PPAA 5FM2A 3D5VA 2XNNA 3QRKA 4MWHA 3FLYA 4O4BB 1NA7A 4E5BA 4CMOA 2ITTA 3TJDA 5CSVA 1TVOA 4FV5A 3FXWA 5J1VA 3DKOA 3P08A 3R63A 4EJNA 4HGTA 4GIIA 3O51A 3W16A 4ACDA 1OITA 3C4WA 3MI9A 4YNEA 1GIHA 1V0OA 4EKKA 4BCOA 2YISA 3I7BA 1MRYA 2VTLA 3LCOA 5IEXA 4IDVA 3A4OX 3Q2MA 4K8AA 5AP2A 2C6OA 2JDSA 2DUVA 3R9OA 3UDBA 1JBPE 5HESA 2GNJA 4GJ2A 2EVAA 3KK9A 4UXLA 3V04A 3UO5A 3GI3A 3KULB 4O83A 3DKFA 4AXEA 5KKRC 2I0VA 3NAYA 3II5A 2OH0E 4HOKA 4FKOA 1SNXA 2CSNA 2OIBA 3Q4TA 5E8XA 3RNIA 1M2QA 3DK7A 2A1AB 3R7EA 1KE7A 5L2TA 4XCUA 1TZDA 5ITAA 5LQFA 1GJOA 5E90A 4YR8A 4EK3A 4ITIA 4O21A 2YIWA 4M97A 4I4EA 1PYXA 5J9ZA 5AP3A 1P2AA 2C6MA 5TOZA 4DHFA 3W0SA 2BAKA 3FLWA 4R6VA 4I3ZA 4F09A 1UWHA 1WAKA 1BL6A 4OUCA 3WE4A 4ASXA 4JIAA 2F7ZE 3VUTA 2PVYA 3BV3A 3ZRKA 4C36A 2YIQA 3FMLA 2YITA 5FXQA 4DEBA 5CAUA 4LV8A 3UZTA 4EK5A 2ZB1A 3DJ6A 3EN6A 4ZTMA 4R5SA 4EOJA 1NY3A 1PXPA 2HWOA 2VTJA 2G2FA 2C6LA 2F4JA 1Q3DA 3LVPA 4RC2A 5CS6A 3SDJA 4CQEA 2RG5A 4F7SA 4ARKA 2WPAA 5KMKA 4L8MA 3F2RA 2HYYA 1B39A 4AZTA 2JLDA 4FKWA 3ORXA 4TKSA 3R02A 2PMOX 5C03A 4YUQA 4MK0A 4W8EA 3R2BA 3G51A 5K0KA 4O0RA 3EQIA 1W2FA 4YZMA 4O4FA 4TYEA 2OH4A 4HYHA 3UQGA 3OCGA 4PNKA 3I0OA 3VS1A 4O0WA 3PA3A 2VGPA 1R39A 3RPYA 4C02A 2HAKA 4QTCA 4Y5QA 2XIYA 5CYIA 5BYLA 3FZRA 1GY3A 3HRBA 2X1NA 3MB7A 2A4LA 3FXXA 3R73A 3RAWA 3W32A 1YXSA 3Q32A 3F2AA 3EN9A 4X2NA 2QHNA 2WFYA 1P4FA 2ITXA 4CRLA 2EWAA 2WTJA 1H26A 5DRDA 5L2WA 3TT0A 5FEQA 4QRCA 2J50A 3ACJA 5CZIA 4EH2A 3RK9A 3VRYA 4O0XA 4JDKA 3GENA 4FNYA 5BVKA 5IA1A 2QO7A 4BCFA 3OMVA 3BGZA 3AC2A 3G33A 2C0TA 1CSNA 4HYUA 5AP0A 4ZTSA 3N4TA 3Q5ZA 2QO2A 5IEYA 1GZ8A 5HVKA 4OBPA 2EB2A 3UVRA 4OBOA 3QCXA 4BBMA 4XG9A 1BUHA 4RQVA 3HYHA 3Q6WA 3NNXA 4X3FA 4RX5A 3ET7A 4FG9A 3CCNA 3O96A 4FSUA 4RWJA 3CBLA 1W7HA 3PY1A 3UP2A 2VWIA 4BFMA 1G8SA 3EN5A 3I6WA 5I4NA 2PZYA 5E8WA 1GIIA 4PNIA 4PY1A 3H30A 4ZSGA 3ZSHA 1M7NA 3E87A 3K3JA 4O4DA 4B4LA 2PUPA 2AC3A 4FEWA 3C51A 2XB7A 3ENHA 3FMKA 1IRKA 2WMUA 4F78A 5CNNA 4J71A 4CCUA 4LUEA 3F5PA 4FSRA 4PQNA 2W99B 5IH6A 4DEEA 5HX8A 4O7VA 4DH8A 5E7RA 3ZXZA 3NIEA 3BYMA 3NS9A 5IQGA 4O0VA 1UNHA 3P7AA 4DFYA 3DNEA 3LQ8A 3TCPA 4O7ZA 3KXZA 5EI8A 1XH4A 3ATTA 4ZK5A 4RFZA 3FEGA 3C4ZA 3SV0A 2ETMA 1YWRA 4IZ5A 4NM7A 5HOAA 3SGCA 3AD4A 5KCVA 2WEIA 3SQQA 2WTKC 3TIZA 2QR7A 3CIKA 4HNFA 3C4EA 1NXKA 3LAUA 1R0PA 3OBGA 3G9NA 1DI8A 4NJ3A 4S30A 5JGDA 2PUNA 4U81A 5CF8A 5JN2A 3G15A 3DDQA 1M52A 2ETRA 2GTMA 3AD5A 5CTPA 4Z3VA 3QCQA 2XALA 4AZFA 3SW4A 3AKJA 4KIPA 3SD0A 5ANKA 4NM0A 2QVSE 2NP8A 3W18A 3RHKA 1GZKA 5ETAA 2WU6A 5M4IA 4CMUA 5KZ0A 4CD0A 3UMWA 3S1HA 2VNYA 3L9NA 3ENMA 3I79A 1XR1A 4D4RA 5LVOA 3VUIA 1VJYA 3E7OA 2IJMA 3O50A 4FIFA 2IWIA 3MH0A 3H3CA 4ALVA 3W10A 3KU2A 4W4VA 4I6BA 3DU8A 4BIBA 3G6HA 5CNOA 4D1ZA 4BGGA 4G3GA 5DR9A 2IVVA 4YJVA 3R04A 1B6CB 5BMMA 4IBMA 3KEXA 4P2KA 1MQ4A 1Z57A 4WUAA 5DHJA 3ANRA 3TKUA 1FMOE 2C30A 3HRFA 4FV8A 1TKIA 4M0YA 5IMXA 4HCTA 4R7BA 4FKLA 1PMVA 3QKKA 1R78A 2YAAA 4QYEA 4AS0A 3RTPA 3C50A 3A8WA 3MPAA 3R7IA 1ZZLA 4WRSA 1PXMA 1O6KA 3FE3A 3UODA 3GNIB 2XKCA 3WIKA 4O7WA 2JFLA 2X9FA 3AC4A 4FTOA 4U8ZA 4ZLOA 5JFXA 2WZJA 4BDFA 4EHGA 2HY81 4FV9A 5E8ZA 5KUPA 4FZFB 2ZV8A 4F1OA 2OJJA 3IW7A 3I5ZA 4KIKB 4IDTA 2R64A 3KIOC 2B55A 2YIYA 2KULA 4IB3A 3DLZA 3TACA 4XP0A 5DOSA 2YZAA 4RVKA 4BCPA 5IF1A 2BKZA 2JGZA 2OG8A 4ZTHA 4O7NA 4TW9A 2BCJA 3KRXA 1ZAOA 1UU7A 2JDOA 3OEZA 4EQCA 1E1VA 5FTGA 2GNIA 4FZ6A 1UKHA 4J8MA 4L00A 5HX6A 3G9LX 2R3GA 1KE9A 4RLKA 4FIEA 4O81A 3Q9XA 5HKMA 3EQGA 5JRSA 4FGRA 5CU4A 5CSWA 4I24A 1KSWA 1YXTA 2Z7QA 4XRJA 3DS6A 3ZFYA 5EYKA 4BWXA 4BDEA 3QQFA 2X8DA 3UIMA 1YHVA 2JIUA 3COMA 3OZ6A 4C4IA 2B9HA 1ZMWA 3E8EA 5IQCA 4EYJA 3GOPA 3QD2B 4JIKA 5J5TA 3WZEA 3C5UA 3GCQA 3QF9A 3LIJA 2YM8A 4NCTA 4YTIA 4QMQA 1KOAA 5IUIA 5CU0A 3POZA 5ANOA 2WQOA 3DBCA 2QI8A 4QQ5A 4I6LA 1PY5A 4KBAA 3VUMA 3EZVA 4MQ2A 5C27A 5A4QA 4AN9A 1OPLA 2JFMA 5CQUA 5BX0A 2CKOA 2GS6A 4FT5A 3TTJA 5J9LA 2E9PA 4DG0E 2OZAB 4PPCA 3WE8A 3B8QA 3KXXA 3MVMA 1H08A 2BUJA 5HTBA 3EMGA 4QMOA 1TQPA 4RGJA 3F61A 1AQ1A 2NNWB 4ZTRA 4QYGA 2IZUA 4EOIA 1Q8YA 4D2WA 3PVWA 2XNPA 4W9WA 3O0GA 3C1XA 4X3FC 5IUHA 3KMUA 4OW8A 2VNWA 2XMYA 3ANQA 4GSBA 5JEBA 4FKUA 3PRFA 4G5PA 4IX5A 5JZJA 1KE8A 3QXPA 4LL0A 4N70A 4XP2A 3DJ5A 3KFAA 4KSPA 4NT4A 1H0WA 3DA6A 2GSFA 4IFCA 4DHZA 5CAPA 3TUBA 4HW7A 3ULZA 2SRCA 2RFNA 3LKMA 4HVSA 4BKYA 5JQ5A 1Y6BA 3H9OA 3PJ2A 4YJSA 1UWJA 3FMHA 1YHWA 4O2PA 4ANSA 4AZWA 4OT5A 2R3HA 1OL1A 4YLKA 5AEPA 4N57A 2VTNA 5EG3A 4EBVA 4H36A 5M4CA 3U54A 4HPTE 5FEEA 2P3GX 4FNWA 4M7IA 3JXWA 4GS6A 3IONA 1ZRZA 3ZDIA 2V5QA 3MFSA 3WARA 5HD4A 4RFMA 3VS6A 2VO6A 5DRBA 5K9IA 3DFCB 2XYUA 2O8YA 2UZUE 1KV1A 3WZKA 3PG1A 2W4KA 3RWPA 4QP6A 4LRJA 4AUAA 2YM7A 2OZOA 3HV7A 2X6EA 4E93A 2W4JA 1BMKA 1UNLA 1ZXEA 3ZO2A 2X0GA 3DXPA 3FI8A 3W2RA 4HVIA 1O9UA 5IU2A 4TL0A 3E8NA 1SNUA 1BYGA 1FVTA 5F4NA 3ID6C 4YJUA 5HTCA 4I0TA 5DIAA 2R5TA 3REPA 4FMQA 4R78A 4QMNA 3F66A 3A7GA 4AACA 4FZ7A 4AOTA 1TQMA 5K4IA 4GT3A 4LI5A 5J7BA 4IM0A 2WB8A 2HWPA 2LAVA 5LVMA 4PDYA 5IUGA 2QOHA 2Y9QA 5AUTA 3RM7A 4YHJA 2GPHA 4QMPA 4IACA 4FGBA 4M67A 1CM8A 2QU6A 2XANA 4C0TA 3BLAA 3R00A 3LFFA 3VS7A 1S9JA 5GJDA 3W55A 2O0UA 3LLTA 3MB6A 4XOYA 3QRJA 4BDHA 4F64A 2IG7A 2QNJA 4Q9SA 4TYJA 4AAYA 4WKQA 3QZGA 4D2RA 4C34A 4MXCA 5DT0A 2AQXA 3TKHA 4UZHA 3UC3A 4R8QA 3Q2JA 3KQ7A 4DFUA 4XLVA 4AGUA 5EOLA 3UZRA 3KL8A 3ZS5A 3TDWA 2V7AA 3KC3A 2W1GA 5FEDA 3TYKA 1XBCA 2V7OA 3L8VA 3TTIA 1K9AA 1OVEA 2J5FA 1OB3A 3QYWA 4DHIB 3IO7A 2QODA 4BDDA 3VS2A