3PWYA

Crystal structure of an extender (spd28345)-modified human pdk1 complex 2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
289
structure length
281
Chain Sequence
b'PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGCLLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPSFVGTAQYVSPELLTEKSASKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of a potent and highly selective PDK1 inhibitor via fragment-based drug discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 281
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pwyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pwyA01
1YXUA 4FTCA 4TNBA 4FKRA 3GQLA 2W1ZA 3LFSA 3L8SA 3HMNA 3HLLA 2QOCA 1UWHA 1P4OA 2PYWA 2F4JA 3D7TA 5M44A 4F9CA 1URCA 4EH8A 4Q9SA 3QD0A 4A06A 3OROA 4Z7GA 2UW5A 3G0EA 4OTPA 5AUTA 3AGMA 1S9IA 5HBHA 3FL5A 4R7IA 3II5A 5J87A 2IPXA 3FLWA 4GYGA 4B99A 1KUTA 3IW6A 5IQHA 4TTHB 4FGBA 1JKLA 4YHTA 3ZO1A 1YDSE 4FF8A 5AA8A 1JLUE 4BCNA 3VBTA 2H6DA 4FT9A 4ACMA 3F2RA 3QX2A 3FQSA 3LIJA 3VUDA 5IH5A 4AOIA 5CZIA 4MXXA 5L8LA 2VWIA 2OH0E 3R71A 3LXNA 3UIUA 1ZOGA 2Z8CA 3VRYA 4TWOA 3PYYA 4V01A 2C6LA 4TWPA 4FSTA 4GK2A 3D5XA 3OW3A 4HW7A 4FNXA 4BZDA 5EM5A 5K3YA 5HO7A 5JSMA 4PV0A 2VTNA 3CLYA 4B9DA 3MH2A 3R0TA 5AAEA 4QMZA 5E92A 2GS2A 3UOLA 3CQEA 5C03A 3R00A 2XIXA 4GCJA 4IB3A 5HX8A 3ZCLA 3CKXA 5IQFA 1H1WA 4PDYA 2QNJA 1IAJA 3VAPA 3NAXA 4U40A 4RQKA 3BGPA 4S31A 2DYLA 2V7OA 4WG5A 3AD4A 4CV9A 2E9VA 3C51A 2A4LA 2ZB0A 3G33A 3LLTA 3NAYA 4RA5A 5AR3A 5J1WA 5FEQA 3UQFA 1UU9A 4RWIA 4XEYA 1JVPP 4RA4A 3VUKA 4XH6A 4AP7A 4RLKA 4FT3A 2FGIA 3R9RA 3PFQA 1MUOA 4IAKA 4LMNA 4N4SA 5HG7A 1OPJA 3RK5A 5GIPE 2BRHA 3R63A 3OCBA 3QTQA 5KNJA 3TEIA 4BTFA 5FEDA 5AR4A 3WARA 2WPAA 3JXWA 3G2FA 3M2WA 4IXPA 4EHZA 3B8QA 4NEUA 4EHGA 4ALUA 3R7OA 3ZFYA 1H1RA 4MQ1A 3VUGA 4XP3A 4HZSA 3N51A 5GINE 4G3CA 1Q24A 4PL5A 1GNGA 1Q99A 4AA5A 4MXAA 5ANKA 4C3FA 2ZV9A 3EHAA 1O9UA 5AAFA 5HE0A 4HVIA 4PUZA 4Y73A 1IA8A 2BKKA 3UIXA 2PMLX 4AXAA 3IK3A 5ANIA 4DE4A 3EQCA 4IMYA 4FZ7A 1V1KA 3QUEA 2GNLA 2ITYA 3T3UA 5AP4A 4IZYA 3FDNA 5B0XA 4U9AA 4XV2A 3IPHA 3OZ6A 3FXXA 1F0QA 3C4WA 4X3FB 5EYKA 4EWQA 4I5HA 2CLXA 2I0VA 3MYGA 2UZBA 4OT5A 4U3YA 4TXCA 4QOXA 4KNBA 4X21A 1XBCA 5CU6A 2JBPA 3W18A 5TE0A 5K9IA 2OXYA 3UNZA 3WYYA 3DLZA 2VTHA 4JRVA 2IVUA 1QPJA 3VRZA 1Z5MA 2W99B 4I6HA 4RG0A 2Q83A 3QBNA 3FQEA 2VRXA 1ZYSA 2QOBA 3OS3A 1R1WA 3ORIA 3SC1A 4F6SA 5KMOA 2C3KA 3NYOA 3OHTA 1OI9A 3E3BX 3BYOA 3D2IA 4EI4A 2FSTX 3KA0A 5IQEA 4UBAA 4Y72A 1QPDA 4QPAA 1REJA 3FJQE 3VUHA 2W1CA 2XS0A 2ETKA 3EIDA 3I7CA 4FTQA 4ANMA 5E8VA 4O0TA 4MK0A 4HCUA 4FX3A 4AZWA 1XJDA 3E8NA 3QYZA 4I1ZA 4YO4A 3NYXA 3CQUA 4RVLA 1UA2A 2GHGA 3QWKA 3RVGA 3TJCA 2YCRA 4F65A 4HGLA 3AG9A 3IW8A 4F9AA 1PXIA 3UO5A 5IA2A 1HCLA 2C6TA 3MY1A 3P08A 3A4PA 4U5JA 4KIOA 4IZ7A 3RMFA 4CYJA 2P2IA 4M12A 4IANA 4V0GB 1SM2A 1MQBA 2WTWA 2ITNA 2X7OA 2VTOA 4AZEA 3FHIA 5CAOA 5KKRC 4NK9A 5DOSA 4IACA 5E8UA 4FTKA 4CLIA 2PVHA 3TV7A 3WYXA 4L7SA 3GC0A 4M15A 5M57A 1W84A 1WCCA 4R5SA 3C4CA 2PMOX 4EOIA 4BHZA 5M53A 4I94A 3TT0A 5M55A 3DFCB 4G16A 3P4KA 4DH5A 5IQCA 4NU1A 2PMNX 1MRVA 4ACDA 1QPEA 3FMLA 2VWXA 4BDGA 3EYGA 2CPKE 2VX0A 4QPSA 4RFZA 3CQWA 3UVRA 4CFVA 5IPJA 3P9JA 1Y91A 2JDTA 3JYAA 3ORPA 4FZAB 2WZJA 3GU7A 4HYIA 4V0GA 4WD5A 4XRLA 5FXQA 4DGOA 2C0TA 4FK3A 4RIWB 4QMLA 4FTAA 4U6RA 4KABA 3LM0A 4KB8A 2JDVA 2F7EE 3Q32A 4JR7A 3P7AA 4FV5A 5HE1A 4KRCA 4JL9A 1WVXA 3TDWA 4DT9A 2JBOA 1W83A 4J95A 4K9YA 2OW3A 5CT0A 4BDHA 3KRRA 2C1AA 1WBPA 1V0BA 2YACA 3EZVA 4ZTMA 2UW6A 2CN5A 1QPCA 4ENXA 3ZRMA 3VHEA 3DBEA 4DGNA 3FXWA 1M2QA 1YVJA 2C3LA 3L9NA 3IW4A 3LXLA 5IF1A 3COKA 2DS1A 2X7GA 3R21A 4AZSA 4PDSA 4DFZE 2JIVA 4E6QA 1GIIA 5LOHA 3FY2A 2B9FA 3MJ1A 3FI4A 4MBJA 5CVGA 3C0GA 3LW0A 4M8TA 4RIWA 2W5HA 3UODA 2NRUA 1NW1A 1Y6BA 4FSMA 3QRKA 3ZSGA 4DGLC 5JT2A 1YXTA 2VWUA 4C59A 1OL5A 2YHVA 5CX9A 3T3VA 1XH5A 3I5ZA 3Q3BA 5HG5A 4H36A 5DH3A 3VBXA 3NYVA 4JRNA 4OTRA 4F1OA 4FKLA 3AMYA 2ITZA 4TZRA 4YJPA 4IJPA 1PMVA 3BBTB 3A7JA 5AP3A 4BCKA 2O2UA 2UVXA 3PA4A 2ZB1A 3SQQA 4JX3A 3ZO4A 5EM6A 3PSCA 3QQGA 2XRUA 3C4XA 4I93A 2Y6MA 4LOOA 4PQNA 4EZ5A 3Q53A 3VS6A 4D2PA 4CFWA 4APCA 5AV0A 4F7SA 4EH9A 5HCYA 5ANGA 4RX5A 2C6MA 5AV1A 5HE2A 3UQCA 4KS7A 3HP5A 2VWVA 3O17A 5LVMA 4XP2A 4BICA 4O7TA 3MPAA 2VZ6A 4JVGA 3NUYA 3O0GA 4U43A 4FKUA 4CT2A 2Y7JA 2C30A 2ACXA 3D5VA 3IGGA 3UP2A 4E8AA 3C0IA 4LRKA 3R8ZA 3BLRA 3Q96A 3ITZA 3KREA 4FUYA 2ITXA 3L8PA 4HGSA 2Y8OA 3AOXA 3AC4A 1CTPE 5HO6A 4ZZOA 4DBNA 3CBLA 4FA2A 5L2QA 4I22A 2ZV7A 3BV3A 4UMTA 4YZDA 3FC1X 4PPCA 4CG8A 5IQDA 4USFA 3DLSA 4BIEA 3BHHA 2BAJA 2XF0A 5BVWA 2PE2A 4GJ2A 5CENA 1U59A 3OFMA 2H8HA 3P7CA 4U97A 2PY3A 2HAKA 3ATSA 3MVLA 4E6DA 5J9YA 3F7WA 3UPXA 2R3RA 5JFSA 2UW0A 3FKOA 3JVSA 3GI3A 1OIYA 3IQ7A 4K33A 3R9NA 5HU9A 1MP8A 4XUFA 1XH9A 3F5PA 3TACA 5K5XA 4CFNA 3HKOA 4NH1A 2XMYA 5CS6A 4ERWA 4FG9A 3CGFA 4FL3A 3PZEA 4O27B 2WHBA 3ZEWA 1SNUA 3HRCA 4JS8A 5IEYA 1YW2A 3PVBA 3VJOA 3L1SA 1DAWA 3ZDUA 5M51A 1SMHA 3F61A 3HDNA 4Z3VA 3EL8A 4IVAA 1ZMWA 2GTMA 2PTKA 3D7ZA 4FNYA 4IB5A 4DG0E 4FYOA 2QOLA 1FVRA 4UMPA 2AYPA 4KINA 5DT3A 3BIZA 5ETIA 4OTFA 4H39A 3RPVA 2W4KA 2G2FA 2W4OA 3KK9A 3UG1A 4RSSA 3PE1A 4AW1A 3FI3A 4FIHA 3E87A 4RWLA 1H26A 1NVQA 4WRSA 5CSPA 4R78A 3KVWA 2EU9A 5JKGA 4CNHA 2PL0A 3P79A 3TNPC 3U9NA 3LCSA 3PRFA 5I4NA 2ERKA 5HO8A 2PWLA 4GIIA 3H4JA 2OICA 1OUKA 4MXOA 4P5ZA 1ERKA 4D1XA 4EK4A 2CGUA 4X2GA 4YGAA 3SG9A 2W06A 5LMKA 2UW7A 3VW6A 2NRYA 2HY0A 4XJ0A 5KUPA 3SXRA 5DR2A 5KHXA 2UZVA 4IDVA 3AT2A 5G6VA 2EUFB 3L9MA 3QC9A 3COMA 4RVTA 2G15A 3EQGA 3R7YA 3PUPA 2UZTA 5KMNA 4FEQA 3NS9A 4GW8A 4BDKA 4FIGA 1KE7A 3LFNA 4WNOA 4MVFA 1OB3A 4BN1A 4TYJA 1W8CA 5HZNA 5JQ8A 4CZYB 1YHWA 3MH0A 4BBEA 3UTOA 1L8TA 3W33A 3ALOA 1OIQA 2CGVA 3F7ZA 2Z60A 3QTWA 4IWDA 4FTOA 4IX3A 4BCIA 4G31A 4MD9E 2C3IB 1DI9A 4WIHA 3ELJA 3G6HA 4XOZA 3V6RA 4ENYA 1PY5A 3MPMA 4G3GA 4GMYA 4E5BA 2WIPA 1YOLA 5D41A 3FZ1A 4Z9LA 5FDPA 2RFEA 5I9VA 3FZPA 5KCVA 4QTBA 4MNFA 2JEDA 4BCHA 1JSUA 2OKRA 2YIRA 3GCVA 2W1EA 3ODZX 4EOSA 1Q3DA 4RJ6A 4V05A 5AJQA 3ZYAA 3W2OA 3DJ7A 4PP9A 3NNUA 2WMUA 3HP2A 4YSMA 3UZRA 3U54A 5FDXA 3TUBA 2BAKA 4RIXA 2WQOA 1FQ1B 2OFUA 4LYNA 5CYIA 3V8TA 4P4CA 4N57A 2J0MB 3D2KA 3K2LA 2E9NA 1YDRE 4FKSA 1JSVA 4JDIA 2JITA 5E1EA 4O1OA 5HLPA 2ETMA 4NJ3A 2XNPA 3NIEA 3LAUA 3DJ5A 2CLQA 5HI2A 1DI8A 4YHFA 4C62A 3D0EA 2WFYA 3OP5A 2WTVA 3ORXA 4DGMA 1LPUA 1UKHA 3PXFA 3PY1A 4AGCA 5EG3A 3Q9YA 2BFYA 5FG8A 3DGKA 4JIKA 4P7EA 5E91A 2IZSA 3GC7A 2HWPA 4E4NA 4EH2A 4PNKA 4H1JA 1JQHA 3GUBA 4PMTA 1DM2A 3GC8A 2WD1A 3HYHA 4QYFA 4C3PA 2I0HA 4MNEA 1W98A 3FYJX 1RE8A 3GBZA 1RW8A 1OBDA 4OTWA 3R02A 3TV6A 4B8MA 4CT1A 4EOPA 3C7QA 3HA6A 4H1MA 3D15A 3LJ0A 1FPUA 5HX6A 3UC3A 3E88A 1UNLA 4GU6A 5CXZA 3NNXA 4HGTA 4YZ9A 1BX6A 4K1BA 2JC6A 4W4YA 3WIKA 1XH8A 4ID7A 2VV9A 4MWHA 5DI1A 2I0YA 3M42A 3S0OA 2XEYA 3PG1A 4FVPA 4FE2A 3QL8A 2PE1A 1TQPA 4FKTA 4XLVA 3T9TA 1GAGA 3BHTA 4H3BA 1AD5A 2I40A 4I4EA 5EHLA 1Q97A 2OXDA 3MFUA 3OY3A 4A7CA 4EK8A 4YJRA 1VR2A 2NP8A 4E5AX 2X1NA 2VAGA 4J96A 5I5ZA 5KZIA 2WQNA 4YC6A 1FVTA 2GHMA 2VU3A 5IKWA 3F5XA 3KCFA 5HESA 4I0RA 5DG5A 1OGUA 1SVHA 4F1MA 1A9UA 3CD8A 2DQ7X 3DDPA 4AN2A 2HELA 2HW7A 2QHMA 3OUKA 3ZBXA 5DA3A 4QMOA 4O0RA 2X4FA 4FSWA 4MX9A 3M11A 4M13A 2R64A 3ZLSA 2C5NA 2BZKB 4AWIA 5KMIA 3IDPA 3O8PA 1PF8A 2R3PA 4L3PA 4AZVA 5I9XA 4CGAA 2XK8A 2OJFE 2RL5A 3KFAA 3RGFA 4NW6A 5CASA 5F95A 2XUUA 4XG6A 3F3UA 1U54B 3DXQA 4B0GA 2IW8A 4AGWA 5CEMA 1IAHA 4FZFB 5HICA 4KA3A 3GQIA 3RM6A 3MESA 3PWYA 2GNGA 5IH4A 3V01A 4DGGA 4HYUA 2Z2WA 3I81A 1Q61A 3QTSA 2PVYA 4LQMA 2YLFA 4EOLA 4ZLOA 3Q2JA 2VO6A 3NUUA 4DFNA 4CYIA 4ZTRA 3KB7A 3W55A 3SRVB 2WOUA 2WXVA 3S95A 1TQMA 2YCSA 3MTFA 4A9YA 2W9FB 1ZY5A 3GCSA 3NWWA 1KOAA 5ANJA 4DG3E 3OXZA 1H27A 2I7QA 3ORNA 4UZDA 5I3OA 5KKRB 3C4EA 2IZRA 4NM0A 4QMNA 2YABA 4FKPA 4I20A 4IAIA 4QPMA 4BGHA 3ENMA 5GIOE 4FC0A 1WZYA 3CJGA 1BMKA 2BZHB 2P0CA 4GUBA 3K5UA 4I4FA 4ZSJA 3WI6A 4BTMA 2OU7A 3QQJA 2JKOA 1LR4A 4IX4A 5H8GA 4F7LA 2VTMA 1NY3A 3LFCA 3SRVA 5H8EA 3TV4A 3UO6A 3VUTA 1GY3A 2X6DA 3TKIA 1F3MC 1K9AA 3NMUF 1QL6A 4O0VA 4HYHA 3G0FA 4DEDA 2Y9QA 4A9TA 3KRJA 3ZSHA 4BGQA 5M08A 3Q6UA 2GDOA 4RZVA 5A4LA 5J9LA 2FO0A 1OKYA 2V55A 2YM6A 5JFXA 3U9CA 3KMMA 3OTUA 5DBXA 3R7EA 1Y57A 4R7HA 2XNOA 4QNAA 2VWWA 1H01A 5D12A 4ITIA 3NPCA 3RAHA 4RC3A 2WB8A 4NT4A 5IUIA 5AADA 3KL8A 2V62A 3D5UA 4UY9A 4A4XA 2I1MA 1B39A 5F4NA 4WUAA 4BYIA 2WO6A 4AF3A 3ALNA 3MBLA 5J5TA 4F6WA 4BWXA 4GFGA 4Y83A 2C6OA 4O6LA 5A4EA 3QCSA 4E93A 3DT1A 5C8NA 4OAUC 4GKHA 3OT3A 5J79A 1H07A 4FKQA 4FTUA 5EDPA 4M84A 1IG1A 1KWPA 3HMOA 2OSCA 4DFLA 1ND4A 4F7NA 2WOTA 3BBWA 4L44A 1FMKA 4YZNA 5CF4A 3FMEA 3DAKA 5LCJA 1JAMA 2E9OA 2RFNA 2YDIA 1PXLA 4LFIA 3EN6A 5IA3A 4NIFB 3LKMA 4WHZA 5FM2A 3UJGA 2G2IA 3KRLA 3K5VA 5IQGA 3RCJA 5JK3A 4B7TA 1BL6A 3QHRA 2ITTA 2W1HA 3BU5A 4W8DA 4AE9A 4AS0A 2HZNA 4FV8A 2R2PA 5LVPA 4C38A 1UU7A 4BZNA 4I6BA 5DFPA 3FMNA 3EYHA 2RFDA 4PTGA 3RAWA 5DEWA 4EBWA 2VN9A 3EKNA 4FV3A 5FTQA 3ZLYA 4D4SA 2I6LA 5K0XA 4ANLA 3QGYA 5AIRA 5DR9A 5E9EA 3L9PA 3ORKA 5CI7A 3DJ6A 4ZSEA 2XM9A 2WTKC 5FBOA 4AQCA 5L6WL 2ZDUA 3KN6A 3IOPA 4R1YA 4W9XA 1DAYA 4QP2A 2IWIA 3NRMA 4NIFA 3ZFMA 4BKYA 4QYEA 3EN5A 1F5QA 4UALA 4AA4A 5CEIA 5M4IA 1NVSA 3U6JA 3CTJA 5T3QA 1YI6A 3U51A 5HG8A 2IVTA 3QCQA 4AGUA 1HOWA 4J8MA 4I0SA 2J0IA 4ALVA 3ZEPA 5CVFA 3PJ8A 4M0YA 2ZM4A 3NX8A 2YWPA 5EOBA 4FTIA 4CFUA 4RX9A 3G6GA 4BYJA 4AT3A 4IAAA 2C5OA 2CJMA 4BDFA 2J0JA 1UNGA 3PPJA 4U81A 5EYCA 5EDQA 5HTCA 2P3GX 4AUAA 5A6OA 5I0BA 4FIFA 4XG3A 3ZM4A 4F99A 3ORLA 4KIKA 1M2PA 3CC6A 5AUWA 3ULIA 5GZ8A 4M67A 4XG4A 5T6KA 5AR7A 3UMXA 5FLFA 4C7TA 5KMLA 2ITVA 3OVVA 1ZXEA 4D0XA 2J7TA 3AD5A 5EHYA 3JY0A 5K0KA 4YNOA 2JFMA 3EQIA 3P78A 4MF0A 1SNXA 5L2WA 1G5SA 4BDDA 3QZGA 4ZEGA 4O84A 1PYXA 2YM3A 5LQFA 2ZJWA 3WF7A 2VNWA 2BPMA 3A99A 1ZARA 2O0UA 3PWDA 5CSVA 4ZTSA 3S00A 3DY7A 5LWNA 3IKAA 3QQKA 4JOAA 4KWPA 4S32A 2VO7A 3VBYA 5AP1A 4BHNA 3V5QA 5JRQA 4ZS4A 3OC1A 2PVNA 3PXYA 4BF2A 5C4LA 4IBMA 3ID6C 4HOKA 3RNYA 1R78A 4FEVA 4HJOA 4IE9A 5BVFA 3KKVA 1M7QA 3H0YA 3IO7A 5H3QA 2AC3A 3DA6A 4QYYA 1M52A 5TKDA 3W16A 4RZWA 3RK7A 4AACA 3DXPA 3UOHA 4WBOA 3TKUA 4PTEA 4A9UA 4FV9A 5CI6A 2XK9A 4R8QA 1H28A 4F7JA 3BQRA 3F69A 4FICA 3P86A 3W2SA 1M2RA 2BZJA 2QKWB 4I5PA 3ZUVA 1UKIA 3QD3A 2JKKA 4C4GA 4IM3A 4NUSA 3V6SA 3A8XA 2BFXA 3FZTA 5DRBA 3PA3A 4D58A 3G5DA 2YLEA 2Y6OA 3CIKA 4S2ZA 3N4TA 4G17A 5GJDA 3RJCA 4MBLA 4M7IA 3GOPA 1Q41A 4XV3A 3FLZA 3RM7A 4CKRA 3Q60A 1OL6A 2ITUA 4AW5A 5HQ0A 2JD5A 3TIZA 2SRCA 3HA8A 3QRIA 4E73A 1E9HA 4FIJA 4I92A 4JAIA 1CKPA 1SYKA 4WG3A 4BCFA 3SW7A 3R30A 2BRGA 1G8SA 2YM5A 4FBXA 1KSWA 3N4UA 2ZAZA 4O7NA 2YIYA 2F49A 3R28A 4YC8A 1GOLA 4AT5A 3SGCA 4EUTA 3HDMA 3PSBA 4X2FA 2BRNA 4ASDA 2CSNA 3LPBA 4CTCA 2OJ9A 3ZS5A 2XKFA 3TCPA 2OWBA 3EKKA 3Q04A 4G5JA 5T68A 5L4QA 4FVQA 2OJIA 4IB0A 3W8QA 3OUNB 2QU6A 4YZBA 4YHJA 5JN2A 3GENA 2ZMCA 3CS9A 3BWJA 3R2YA 2YA9A 4FNZA 3LQ3A 4L3JA 3RALA 4E3CA 4KIQA 4IH8A 5HEZA 3R8UA 2UVYA 1SVEA 3U4WA 4I6FA 4ANOA 2GFCA 3FSFA 4K77A 2V22A 3W2RA 3A62A 2Z7SA 3VWAA 4EORA 3D94A 3EMGA 2EXMA 2P4IA 3OCGA 2NPQA 4BBMA 3C5UA 5J95A 1YDTE 3LFAA 4G3FA 5DT4A 5E8YA 4FEXA 3ZUUA 5GNKA 4UEUA 4FSZA 4GV1A 3SV0A 4D2RA 4AZTA 5BQ0A 4E6CA 4YZMA 3PY0A 3BEAA 4CFXA 3BZ3A 3T9IA 4XNEA 2CN8A 5I3RA 3R7UA 3ZRLA 2W0JA 4ZSLA 4NKSA 1YXVA 2PVFA 4XLIA 3TNHA 3MDYA 4UXLA 4QQTA 4FIEA 4RFYA 1JBPE 3IDCA 2NO3A 3O96A 5EI2A 1WMKA 2EB3A 4ZY6A 4BY9E 3QALE 4L00A 5L8KA 1ZMUA 4IFCA 4FKJA 3BHYA 2RFSA 3BU6A 3SAYA 4OTGA 4CZUA 3RPSA 5I9UA 4ZMEA 2OZOA 5HOAA 3MN3A 5AR2A 2W05A 4XBUA 4JDJA 4BB4A 4N0SA 4GSBA 1YWVA 1J91A 4NL0A 3LFBA 3O51A 2R3OA 3WILA 2G01A 2G1TA 1YI3A 4E26A 3BLHA 1J3HA 3U6HA 2PUNA 1GZOA 2YAKA 1PHKA 4I23A 1RQQA 2C5VA 4FTTA 5FGKA 4CSVA 3RCDA 3D9VA 2RF9A 4EQCA 1W0XC 1Z9XA 5FXSA 3AT3A 2DUVA 4JG7A 4KBKA 4BI2A 3SLSA 4QP4A 5B2MA 2WEIA 4AW2A 4GT3A 3RAIA 2PZ5A 5F20A 2C5XA 3WF8A 4O0SA 3U4UA 4AW0A 3Q5IA 2XRWA 4GYIA 3V5LA 3O7LB 3LCDA 4G6OA 4F0GA 4DBXA 2QO7A 3DK6A 3ZO2A 3RPRA 2WMTA 5F9EA 2UVZA 3PRIA 4IC8A 1CKJA 4ARKA 5AWMA 4S30A 3FI8A 3ZZEA 4O81A 4E6AA 4IAYA 4UN0C 1CDKA 2RG6A 5CT7A 2ONLC 4EL9A 4MH7A 5E8SA 2UZOA 2YN8A 4CZTA 3TTIA 3Q4TA 2GQRA 3R7IA 2BKZA 3BGZA 1OM1A 3CCNA 3NCGA 3OOMA 4GG7A 4EC8A 3KRXA 4RWJA 3B8RA 3KULB 4EJ7A 3PXRA 2R3GA 3GGFA 3P5KA 1Q8ZA 1U5RA 3RKBA 2WMBA 4F9WA 4K11A 3R1YA 4KKEA 4QP1A 4LGHA 2Q0NA 4ZJJA 4YTIA 5BVNA 2WQEA 1NT2A 2UZUE 2P33A 3ETAA 1V0PA 1GJOA 4UMQA 5DIAA 4GKIA 4TKSA 1A48A 5A14A 3LFEA 1W82A 4LMUA 5ICPA 4J1RA 3GXLA 5H9BA 1IRKA 4C4HA 4RIYB 4WBBB 4YO6A 5HIDA 2XP2A 3HUCA 2W96B 5I9ZA 3KULA 5AV3A 3Q5ZA 4MWIA 2PZPA 4FSRA 3WZJA 3HV6A 4YJSA 4FTLA 3I60A 2XJ2A 4L6QA 5CANA 2R9SA 4JI9A 3NUPA 1OIRA 4DH7A 2VTTA 4D0WA 4B6LA 5TT7A 2CGWA 3C50A 1XHAA 4KBCA 4YLJA 5TR6A 4AAAA 4EK3A 4UMUA 2IVSA 5HBEA 2YEXA 3GC9A 3LXKA 4NYEA 2O65A 2BMCA 4GH2A 5KMMA 2VWZA 4C57A 1U5QA 4O7WA 2F9GA 5DNRA 3EJ1A 3MY5A 5FEEA 3BYMA 4LUEA 4RIYA 3EZRA 2QOFA 3DAEA 3PA5A 2OIQA 3PVGA 2RIOA 1YQJA 2HYYA 2R3NA 4E4MA 1OZ1A 3A4OX 3FMMA 2WEVA 2KTYA 2X39A 1RDQE 3DDQA 4JG8A 2C6DA 2AUHA 5CU2A 2WTJA 5JFVA 3PJ1A 4UZHA 3TUDA 4NJDA 4GVAA 2YIWA 5IG1A 3KQ7A 2ITPA 2OLCA 2C68A 3S4QA 3OTVA 4RVMA 4CXAA 3MIYA 4DC2A 5IZFA 3HAVA 3BE9A 4QMXA 4U44A 4WNPA 1H4LA 4PP7A 4L53A 3F5UA 2BRMA 2OI4X 3A7IA 5CF8A 2OK1A 4XV1A 2FA2A 1CMKE 2HCKA 3KN5A 1M14A 1H1PA 2VTJA 4IX6A 3IS5A 4KD1A 4RX7A 3TZ9A 3VHKA 3I6WA 5JGAA 2FUMA 2GMXA 1LUFA 4TWCA 3GEQA 4DCAA 2UV2A 4LV5A 2WGJA 4YJVA 4ZXTA 4BZOA 5BYZA 3CY2A 2X8IA 2O63A 3CY3A 4LGGA 4C2WA 4IQ6A 4TRLA 4Z7HA 2B9JA 3NIZA 3ORTA 2BHHA 2OF2A 2J90A 3QD4A 4RJ4A 4DAWA 4O7SA 3BGQA 4BC6A 4D2VA 2GNHA 2JDRA 3R2BA 4EKKA 2WTKB 3POZA 3R01A 3UZPA 3R8LA 4M69B 4QP8A 3BELA 4X2NA 4O7VA 3FMJA 1E1VA 2C1BA 2C0OA 3FZOA 3BQCA 1TKIA 4QNYA 2QHNA 3P23A 4O2ZA 3TUCA 1R0EA 4HPTE 5A6NA 3CJFA 4FKVA 4A4OA 2Z7LA 3NLBA 5JMSA 3ROCA 3TZ7A 3CE3A 2UZWE 1L3RE 2B7AA 3DKGA 3NNVA 2QR7A 4TYHA 3VO3A 5M07A 3ULZA 1J7UA 3G9LX 4LG4A 3C4FA 3IW7A 5CEQA 3TL8A 4II5A 2GQSA 4IFGA 3MSSA 5EK7A 1M7NA 4LI5A 4OTQA 4DEHA 4GJ3A 4LOPA 3PJ2A 4FMQA 4PDOA 5I9YA 4HVSA 1WVYA 1V0OA 4FSNA 5CU0A 4UWBA 4LUDA 4M69A 2QOOA 2FB8A 4R77A 4BR3A 3OWJA 4JXFA 5LMBA 2X6EA 3W2QA 5EW3A 3QKLA 2GPHA 5C26A 3FWQA 4S33A 2WIHA 3KF7A 4O0UA 3FHRA 5B2LA 4C61A 3K3JA 3LCKA 3VS4A 3FV8A 3BYSA 4XV9A 5A4CA 4XOYA 4YTFA 5L8JA 2R3FA 2HXLA 4FTRA 1ZYJA 4ITJA 4TYGA 4BRXA 5CAPA 4RWKA 2W4JA 3A61A 4ZS0A 2GNIA 4YBJA 3HX4A 3R1NA 4D1ZA 4F9BA 5IQAA 2CCHA 2QOKA 2WU7A 3TI1A 4HVGA 4XX9A 5HU3A 1XKKA 4L01A 2A0CX 4RVKA 4CKIA 4RIXB 2ZVAA 4O21A 4R7BA 2C3JA 4FV1A 4D4RA 4ZSAA 5ACKA 4QYGA 2UW4A 2CKOA 2Y4IC 3F2AA 3ET7A 3QRUA 1G8AA 3DTWA 4Y46A 4BDEA 4RIOA 3VS0A 4FSUA 5CSHA 4E4XA 2X7FA 4YC3A 1FINA 4L52A 3ZOSA 2XK7A 5M09A 1GZKA 4FV2A 3DBQA 4C4FA 3KXNA 4FYNA 5FP5A 4ACGA 3EL7A 3FKNA 4IAFA 2IN6A 4FI1A 4JDKA 1R0PA 2O64A 4BVUA 4FT7A 3RZFA 2WMVA 2PUIA 5A3XA 3ZXZA 1BI7A 3HEGA 2X0GA 2J5EA 3MWUA 1PKDA 2G2HA 2FSOX 3OXTA 3E93A 3FLYA 2CCIA 3MJ2A 4MNEB 4WUNA 4BCQA 1YOJA 3W2PA 1OUYA 2J0KA 4IVCA 4Q2AA 2ERZE 4TN6A 3E8EA 2WKMA 1PMNA 1Y6AA 4IWOA 2ZMDA 4LM5A 4J71A 4G34A 4S34A 3VQHA 3DK3A 3GU4A 3W1FA 1BUHA 5HVJA 3ACJA 4L46A 4G6NA 3UIMA 3QGWA 5FP6A 4J8NA 4YP8A 3ZRKA 2XNNA 4D5KA 4O83A 2VTQA 3E5AA 5G1XA 5HGIA 4QO9A 4NW5A 2JKMA 3QTIA 3FBVA 3BI6A 1ZMVA 4FOBA 5FBNC 3V8WA 3FLSA 3REPA 5M4FA 5DEYA 1QCFA 2BVAA 2ZM1A 4QP6A 4X0MA 3DB6A 4ASEA 5E8ZA 4MAOA 3FUPA 4X6RA 4QTEA 4U7ZA 5DLSA 5D11A 2WMAA 3OG7A 4EH7A 4DN5A 1J7LA 3I0OA 4FR4A 4FV6A 4QTAA 2H34A 2B9IA 4W4VA 5D10A 3E8DA 4X3FC 5EQPA 4NCTC 3HV4A 1URWA 3F3VA 1FBNA 4FKGA 3Q4ZA 2YM4A 1FVVA 1R3CA 2UW8A 3TJDA 4MD7E 1G3NA 1YXXA 4O7RA 4ZZNA 3LZBA 3VN9A 3H30A 4WSYA 3A7GA 1H0VA 4MXZA 4YU2A 1Q62A 3AD6A 2ITWA 3MFSA 1UWJA 3FMHA 3OMVA 3BYVA 2XK6A 3HL7A 4Q5HA 1I09A 2QODA 5HD7A 1Z57A 5A54A 4PRJA 2QKRA 4K2RA 4EOKA 3ZXTA 1GIJA 5AUYA 2BTRA 1H25A 3QU0A 4PL3A 2XK4A 5CALA 1P2AA 5EM8A 3HMPA 5HHWA 3EFJA 4L45A 2W1FA 4EHVA 4PPBA 2UW3A 2YAAA 3HAMA 1IA9A 3TNQB 2WMRA 5ANDA 2HY81 1OL1A 2CKEA 4ZLYA 2C6EA 4YJQA 3F3TA 3E3PA 3BLQA 3ZMMA 3P0MA 3EN7A 4BDAA 3JPVA 3KRWA 2CNVA 5HKMA 2RGPA 4UWYA 2YIQA 3KXZA 3QYWA 3MI9A 4ZTLA 3RINA 3SXFA 3FL4A 4KRDA 3ZONA 3SVVA 3OWKA 4O96A 4QP7A 1OITA 5CSWA 1SZMA 5LARA 4UV0A 3IECA 4LGDA 2BTSA 4CTBA 3A7HA 4CQGA 3QA0A 3DKCA 3NEWA 2H9VA 2A19B 2YERA 5AX3A 3RNIA 4C02A 5BNJA 2YZLA 1DS5A 4FUXA 4J99A 5AUXA 4DTAA 1KE5A 2OIDA 2C0IA 3EQPA 4XG9A 4I41A 4QRCA 4D2SA 1FGKA 1AGWA 3R73A 2BR1A 3RK9A 3EN4A 3HRFA 5E8WA 4I21A 4FKWA 3BYUA 4OBOA 2XBJA 2BRBA 2W1IA 3WF5A 1PXJA 2YIXA 3PVUA 4GFOA 4C4IA 4AE6A 1VYZA 2BILB 3K54A 3NUNA 4FG8A 4BCJA 1JKSA 4JBPA 4PX6A 5CAQA 3RWQA 3I0QA 4K18A 5DPVA 3FZSA 4FL1A 3VC4A 4NM3A 3I4BA 4QT1A 4AN9A 3S3IA 1YHVA 3ZHPC 1P5EA 2HOGA 2QC6A 3C13A 2YFXA 3MFTA 4QMUA 1ZYCA 3VS1A 3UG2A 4BI0A 5C9CA 2WTDA 4L7FA 4C34A 3KU2A 3JUHA 1JOWB 5DN3A 3MA6A 2X4ZA 1XH7A 3Q4CA 2HIWA 2PUUA 4C8BA 4EZ3A 3D4QA 3EQDA 2O5KA 3SD0A 4F08A 4GU9A 4O6EA 4CFMA 1JWHA 1WAKA 2XEZA 4TYIA 4H3QA 5EFQA 4ALWA 2BDFA 3F82A 5CNOA 4ZZMA 3TIYA 4DCEA 4F09A 3M1SA 5BX0A 4ZMFA 4OBQA 4BCGA 5TF9A 5HNIX 5IQIA 4DFUA 3EN9A 3PP1A 2V0DA 3A2CA 4ZTNA 5HCXA 2GS7A 1Y8GA 3LOKA 5FUTA 1I44A 4F4PA 2OG8A 3TZMA 5IH6A 4D1SA 3HMMA 5C8MA 3UZTA 5IMEA 4GS6A 3AC3A 3BHUA 3VBQA 2ONLA 2JLDA 4LL0A 4X2KA 3VBWA 1K3AA 3QAME 2C69A 2CKPA 2X2MA 1YWRA 4CKJA 4ZSGA 3UE4A 3PY3A 3NGAA 4KS8A 4R3PA 1A06A 2R5TA 4IX5A 5EI6A 4G3DA 3E7VA 1PYEA 2QD9A 4GL9A 1ZLTA 4I5CA 2X81A 4F64A 4F9YA 5DYJA 2ZYBA 2C6IA 3PPZA 3LE6A 3PXZA 3Q52A 3ERKA 4BDJA 1JKTA 2QVSE 1XQZA 1Q8UA 2QO2A 2XKCA 3O50A 3SKCA 3QQLA 2G9XA 4M68A 3VF8A 2VNYA 4RJ7A 4H05A 1SVGA 4ZJIA 4RJ3A 3V5TA 3OT8A 5K4JA 3MIAA 3AC8A 4ZP5A 4EOJA 5CTPA 5JZJA 4KUJA 3NW7A 4ZJVA 5BVDA 2EXEA 5EYDA 3AC2A 4OTHA 3UQGA 4BDBA 4X7QA 3I7BA 2HWOA 1CKIA 3R6XA 3CP9A 4GK3A 3ZLXA 5CWZA 2B54A 4FNWA 5KE0A 2QCSA 4V04A 4MCVA 4QP9A 2QURA 3L8VA 5K5NA 5C27A 4BTJA 4QMSA 5KBRA 2PUPA 2VGPA 3EWHA 4CFFA 3FEGA 4I0TA 3MA3A 2RG5A 4AGDA 3OBJA 2RKUA 5AR5A 3VULA 4BWKA 2F2CB 1GZNA 2PVKA 3SX9A 4OR5A 3H9OA 2HK5A 2F7ZE 3BWFA 2QOQA 5J5SA 4KIKB 2GCDA 3QQHA 4RRVA 4W4WA 5A9UA 1EH4A 3BCEA 5KMJA 4YLKA 1ZWSA 3A7FA 3R9OA 3UOJA 2YM7A 5FD2A 5AUUA 2XYUA 2VO3A 4G9RA 4L67A 1YWNA 2ETRA 3QXOA 4RPVA 3KMWA 4N70A 3A8WA 5AP6A 4XG2A 4C33A 4QMQA 5D7AA 1KE6A 1WBSA 4OGRA 3A60A 5BPYA 2XH5A 1WBVA 2VO0A 3KC3A 1X8BA 3I1AA 2CNQA 1YI4A 4EWHA 1Q8TA 2WMQA 1OKZA 4GT4A 2HZIA 2YDKA 3W10A 3NUXA 3QWJA 4DEEA 1APME 1RJBA 4M3QA 5JZNA 4D28A 2Y0AA 2R3QA 4JR3A 5CY3A 1J7IA 3N9XA 3C0HA 4Y95A 2BIKB 2WNTA 5DWRA 4CVAA 1J1CA 3E62A 4FKOA 4UYNA 5D9HA 5EQYA 1O6YA 4E1ZA 4FTJA 1ZRZA 1U4DA 3R1SA 4HCTA 3LQ8A 3BE2A 5IISA 3VUIA 3PPKA 4HCVA 1XBAA 4IZAA 4JIAA 4IWQA 1ZOEA 4HVHA 2C5YA 5L6OA 3FLNC 2XM8A 4YJNA 2PULA 4FGRA 3LXPA 4WNKA 4O0YA 3O23A 1M17A 4F1TA 3MV5A 4ANSA 1VZOA 2VTLA 4GK4A 4YSJA 4GT5A 3TWJA 4Z16A 2B52A 1KOBA 4TYEA 5AEPA 4AOTA 4USEA 3OEFX 3NYNA 3GCPA 3BHVA 3QTUA 4OTDA 4FV4A 4FTMA 1K2PA 3AGLA 1YHSA 2R3HA 5FTOA 3TM0A 4L3LA 3BEGA 2J51A 5H8BA 5HTBA 3LCOA 4FV0A 4AN3A 2PPQA 3PIZA 3RHKA 5LWMA 4RC4A 1STCE 2XIZA 4O1PA 5CXHA 5AM6A 4KBAA 3GT8A 4W4XA 3PDTA 3GU5A 2BZIB 2FH9A 4IM0A 2OXXA 5FRIA 3T8OA 2XNGA 2OO8X 4NFMA 4BKJA 3RP9A 5CVHA 3OF0A 4KIPA 4ZOGA 4GVJA 3LJ2A 2A27A 4DITA 3HRBA 4FL2A 3KCKA 3CPBA 3UC4A 3DZOA 5FQDC 5CNNA 2JKQA 3Q9WA 2OZAB 1PKGA 4YPDA 2XCHA 5TOZA 1H1QA 2F57A 2OF4A 5LCKA 3KEXA 5L2TA 2YJRA 4D55A 4CLJA 3QZFA 1PXMA 5AR8A 2XKDA 4XCUA 3O8UA 2QONA 3QX4A 4EH6A 2Y4IB 4EUUA 3KVXA 4QMTA 1Q8WA 4UB7A 3TKHA 4DG2E 3V3VA 4TW9A 2ZM3A 2FSMX 4L8MA 2QI8A 5CU3A 4YZCA 3PSDA 4Y8DA 3MVMA 3QLGA 3D5WA 1PXKA 3QRTA 2O3PA 1MRYA 3GVUA 4C35A 4DEIA 2UUEA 3PXKA 4DH8A 3KY2A 2J4ZA 4E7WA 3MTLA 3NW6A 4UX9A 2OZAA 5AM7A 2YDJA 5IA0A 4J7BA 4MXCA 2VWYA 3HUBA 3IW5A 5ETCA 3UNKA 3MB6A 2Y4PA 1OPLA 3QFVA 4HPUE 4C2VA 1H00A 4IDTA 3DKOA 5DRDA 5IA4A 3WZUA 2QG7A 4M97A 4IWPA 3I5NA 4I6QA 5C8KA 3C5IA 1XH6A 3DZQA 4P2KA 2Z7QA 4RT7A 3WE8A 2OJGA 4YLLA 1H8FA 3Q9XA 3VS5A 4EOQA 3EQHA 4ERKA 5LXMA 5J1VA 1NVRA 4JQ8A 4ANBA 4AX8A 2GTNA 4QMVA 1OMWA 4XBRA 4J53A 3EH9A 2QO9A 3EFKA 2ITQA 5IEVA 4BCOA 4YR8A 1PXNA 1BI8A 4FZ6A 4Y5QA 5E1SA 4O2PA 4D2WA 5AUVA 1WBOA 2E2BA 3KK8A 3DFAA 4UXQA 3DNEA 3F6XA 1T45A 3VS3A 3MPTA 3MFRA 3QF9A 4R3CA 4DTBA 3LCTA 5BUIA 3CTHA 5BMSA 4JNWA 2W1DA 1WBNA 4R6VA 3F66A 4CMOA 2WU6A 3D14A 3I6UA 4L42A 4U80A 4XMOA 2HW6A 4AT4A 1Q4LA 2GSFA 3QTRA 4TL0A 3EFWA 4FIIA 4C4EA 4PL4A 3UYSA 3NVKI 3PLSA 1Q3WA 3E64A 3QKMA 2PVLA 3BRBA 3GU8A 3LQ5A 5ANEA 2XNBA 4IC7A 3LJ1A 3CXWA 2YCFA 3R9DA 2PSQA 4YTHA 4ZLZA 5BUEA 4E20A 2ZV2A 5AP5A 4CEGA 4DEBA 1MQ4A 4YMJA 3F88A 4RJ5A 5KX8A 4FKIA 4FT0A 3D83A 4BTKA 3MW1A 2BALA 3OY1A 4GUEA 3VW8A 5CSXA 2PVMA 3QTXA 5F1ZA 3RI1A 3FKLA 5DHJA 4Q5EA 2F2UA 5IQBA 3L9LA 3B2WA 4MXYA 4IM2A 2JIIA 4NTSA 4U8ZA 4X3FA 4CMTA 2GNJA 3KXHA 4JG6A 4NCTA 2FVDA 1WFCA 2PE0A 4NZWB 1B6CB 5BVKA 3MH3A 3OW4A 4EK6A 4B4LA 2VWBA 5EI8A 3SHEA 3AXWA 2IZTA 3FZRA 3R7GA 1YXSA 3DNDA 1Q8YA 2OIBA 2QQ7A 3RTPA 5EKOA 5BVEA 3POOA 2PHKA 3PIXA 5DGZA 2CMWA 5EHOA 5TO8A 4PMMA 5AFVA 4I24A 4JAJA 2QG5A 2YWVA 2W5BA 3OD6X 5JGDA 3U87A 3ZSIA 1UU3A 2VTAA 1PW2A 4WKQA 4IJ9A 4QMMA 3R9HA 3VBVA 2UZEA 3BV2A 2WQMA 2YCQA 2BHEA 2HZ0A 4WG4A 2PZIA 5KMKA 3OEZA 4IEBA 3PJ3A 4D5HA 4YPSA 5AP7A 1OKVA 1JKKA 4ORKA 3DCVA 3UGCA 3CD3A 3GCQA 1FMOE 3LMHA 3AQVA 3BX5A 4X2JA 3RHXA 3H0ZA 3TZ8A 2B1PA 4AOJA 5BVOA 3ZC5A 5BUJA 4KKGA 4IZ5A 3WIGA 4AFEA 4LRMA 2XIRA 2X2LA 4MTAA 4XYFA 5EKNA 3NVMB 2GHLA 4RX8A 4I3ZA 3ODYX 4G5PA 3F2NA 2EWAA 5CEPA 4KSPA 1B38A 4JX7A 3H9RA 5KZ0A 1Q5KA 3OWLA 1KV2A 4CQEA 4Q9ZA 2UZNA 4CMUA 4MYGA 3ACKA 2IO6A 4RLLA 3EOCA 4D2TA 3SW4A 2WMXA 3R83A 2YITA 3CSVA 2R7IA 5KHWA 4C36A 1NXKA 2ZV8A 3PIYA 3PXQA 3UOKA 3QD2B 3QUDA 3PJCA 1IEPA 3ANQA 3MY0A 4RBLA 4CCBA 3LMIA 4AFJA 4CD0A 5LVOA 1MRUA 3RPOA 1OPKA 3DBFA 5CZHA 4DT8A 2V5QA 2GQGA 4IAZA 3V51A 3KXXA 4IHPA 1QMZA 4ZTHA 3IONA 4EYMA 2R3IA 1ZAOA 5IA1A 2PK9A 5EQEA 5C4KA 1BYGA 4C4JA 5AP0A 1XR1A 5IDPA 3PLAE 3E92A 4EJNA 5L6PA 3COIA 3P1AA 3CR0A 4G1WA 2VTRA 3ZBFA 5KBQA 4EZ7A 4FEWA 4XG7A 4D4YA 2XJ1A 5M06A 1O6KA 3DS6A 4OW8A 4YJTA 3TNWA 4HNFA 4HVDA 3EQRA 4QMPA 2P55A 4GG5A 5IUHA 1JPAA 4AU8A 1P14A 4USDA 2R4BA 2WQBA 3MB7A 3ZLWA 2DWBA 4G6LA 4CV8A 2VTSA 4ZIMA 2Z7RA 5IA5A 2FSLX 2VD5A 3IDBA 3QRJA 2ESMA 4K0YA 3G15A 3LLAA 2W17A 4O86A 4PMPA 4RFMA 4XG8A 3TXOA 1BLXA 3UP7A 1LEWA 3ORZA 3ZTXA 3NNWA 3SA0A 2OBJA 3R04A 3WZDA 2CHLA 5GZ9A 1WBTA 1UU8A 1PXPA 3GNIB 3JS2A 2BUJA 5HD4A 4KKHA 4WSQA 5HVKA 3B2TA 4XRJA 4WRGA 1P4FA 4WNMA 4L43A 4FODA 5J8IA 5AP2A 5JQ5A 1TVOA 3FI2A 3LHJA 2YM8A 5HNBA 5HLWA 3LVPA 3TTJA 1H0WA 4OBPA 4EK5A 1U46A 4BCPA 4DA5A 4TYHB 5DT0A 1W7HA 1XWSA 2E9PA 4IADA 4DTKA 2BDJA 4EH4A 5C01A 2IVVA 4QQCA 4E5WA 4FZDB 2B0QA 4LV8A 4D4VA 4CG9A 2EXCX 2R7BA 3DU8A 3G90X 1OKWA 4E4LA 4TNDA 4CRSA 2X9EA 3QLFA 2VTIA 3DTCA 1R39A 4JQEA 5HIBA 4BKZA 5IMXA 3KMUA 4U0IA 3WBLA 5HLNA 4BIDA 2QLUA 4NWMA 3W8LA 4IIRA 2X8EA 2JDOA 1ZZ2A 1H1SA 2B9HA 2REIA 1KE8A 4DFBA 1IR3A 4PPAA 3V5JA 3QZIA 5L2IA 1YRPA 2JFLA 4RGJA 4JQ7A 1PXOA 4BI1A 2C6KA 4JDHA 2VGOA 3VIDA 2PU8A 3OCTA 5F94A 4QP3A 1VJYA 4O7ZA 4I5MA 2QOIA 3TNIA 4XHKB 5BYYA 2J9MA 2W5AA 4F70A 5KO1A 3ATTA 2CGXA 1WBWA 2P2HA 3QKKA 2W7XA 4FK6A 4PTCA 4ZTQA 4JT3A 3KXGA 3F5GA 4EKLA 2XJ0A 3AC5A 3LMGA 4DHFA 1UNHA 1IASA 3FPQA 5M4UA 5AA9A 2WAJA 2F7XE 5H2UA 2XZSA 3DPKA 4P5QA 5ETFA 4KSQA 2BCJA 3ZM9A 1XH4A 5E8TA 4U42A 3WE4A 4DEAA 4FOCA 2J6MA 3RBWA 3KGAA 2AC5A 3DXNA 4U41A 5EYMA 3TDVA 4O22A 4C0TA 1VEBA 3NUAA 1J1BA 3PE2A 2IJMA 4DLIA 3RAKA 5A4QA 4Z55A 3FXZA 4OUCA 5FXRA 4YBKA 5D1JA 1OECA 4ACCA 5M4CA 5HNGA 2ZOQA 4HNIA 2BAQA 2VTPA 4MD8E 4EH3A 3CEKA 4APPA 5AX9A 2QU5A 2YISA 4RJ8A 5DVRA 2VX1A 3EFLA 5BMMA 2PZRA 5HTIA 3FAAA 5CEOA 2X9FA 1H08A 4EH5A 4O82A 3F3WA 4AA0A 2CNUA 1TQIA 2BDWA 4R3RA 5FWKK 2LAVA 3MVHA 4BFMA 2I0EA 4EQMA 4ZY4A 3NCZA 4B8LA 5IUGA 5L3AA 5J9ZA 4XP0A 4W8EA 3QXPA 1REKA 1ZOHA 2WTCA 4C37A 2J5FA 4OTIA 3VS2A 4O0XA 1OIUA 3FYKX 2HXQA 2JIUA 2E9UA 1OVEA 2OH4A 3NSZA 4M0ZA 4MF1A 4MQ2A 4JBOA 5E7RA 3BPRA 4FSYA 1XO2B 3EB0A 4PDPA 1KE9A 3O2MA 4H3PA 5JGBA 3VQUA 3VUMA 3OWPA 4F0FA 4ZK5A 3NUSA 2QLQA 1KV1A 1VYWA 4JBVA 4W9WA 4DYMA 4PNIA 3C9WA 3EQBA 3OOGA 3QCXA 5ACBC 4JBQA 3GFEA 4IB1A 3S2PA 4TPTA 4C58A 4UMRA 4QYHA 3H3CA 3U55A 4WT6A 4M66A 3ZO3A 4YUQA 4GFMA 4GIHA 2WELA 5EW8A 5HE3A 3ENHA 4RQVA 2BROA 3IG7A 3OXIA 4HGEA 5AMNA 5JRSA 2BIYA 4YJOA 2IW9A 5FM3A 2XB7A 4TY1A 2XIKA 3C1XA 3CGOA 5LMAA 2O8YA 4IVDA 4DFXE 4O7LA 3O7LD 1LP4A 3UVQA 4LOQA 4NM5A 5IU2A 3R8MA 4F63A 4HZRA 4TWNA 4MEDA 4K8AA 3ZU7A 4YURA 2UZDA 3HNGA 4WA9A 3WF6A 3JR1A 1GZ8A 4F0IA 4WO5A 2YZAA 5JH6A 3PP0A 4EHEA 1JSTA 3GB2A 3R8PA 1OL7A 4FEUA 2QR8A 5E4HA 5A4TA 3SG8A 3SOAA 1PRYA 2YJSA 3MGYA 2PVRA 4DEGA 3GFWA 3NR9A 3OBGA 4N6YA 5CQUA 4KAOA 4D9TA 3QQFA 4G3EA 5I9WA 3AMAA 3R22A 3ZUTA 5CEKA 4NTTA 5EH0A 1HCKA 5GHVA 4AG8A 4M14A 5EW9A 5AUZA 3THBA 3UDBA 4ZAUA 2R3KA 2XKEA 3CTQA 3QQUA 4FSQA 3SDJA 4ANNA 4AZFA 2WMWA 2XNEA 3KF4A 3AC1A 3DAJA 3L8XA 5J7HA 3Q6WA 4R5YA 5M56A 4OAVB 5K4IA 4HYSA 3PTGA 4NSTA 3VF9A 1WVWA 3O71A 4UWCA 4RMZA 3ROYA 4NFNA 5DMZA 4YNEA 3CKWA 5GZAA 4FV7A 4U3ZA 2RSVA 3UNJA 4EONA 2R3MA 2IG7A 1ZZLA 4RC2A 5B2KA 3LFFA 1AQ1A 3ORMA 5GJFA 2XA4A 4DH3A 3QTZA 1CSNA 3UBDA 3FLQA 4BGGA 4MHAA 3FQHA 3UPZA 4QTDA 3ZH8A 3W2CA 2H96A 2JGZA 2C4GA 3JVRA 4A07A 4GRBA 2GNFA 3FE3A 3KXMA 4PY1A 3FY0A 4UYAA 2X8DA 2GU8A 3BKBA 5HCZA 3R8VA 4FTNA 4X3JA 3MVJA 4DINA 2Q0BA 3I79A 4ANQA 2XIYA 3H9FA 3FSKA 3V5PA 4G2FA 4JLCA 3RZBA 2R3JA 5E90A 3DBCA 3GOKA 4QD6A 4X6QC 3RPYA 3IGOA 2ITOA 2OGVA 3WZEA 2XNMA 3NZ0A 5EDRA 3S1HA 4FVRA 3UO4A 4F6UA 4BIBA 3DBDA 5LVLA 3ZZWA 1PMUA 2XK3A 3HZTA 3GCUA 1CM8A 3QUPA 3CPCA 3Q4UA 4CRLA 4BBFA 2ZDTA 1U54A 5HBJA 4A9RA 2LGCA 5HG9A 5HORA 2V7AA 3MS9A 3Q2MA 3V5WA 5AV4A 3WF9A 2PZYA 2W1GA 3HV5A 2XVDA 2R0UA 1BKXA 3LFQA 3HVCA 4LL5A 5ITAA 1ZY4A 3H10A 2NNWB 1PMEA 2UW9A 4GEOA 4YJUA 5CU4A 3UVPA 2X2KA 2JAVA 5HIEA 5HVYA 1FGIA 3K3IA 4O0WA 2R0IA 4EOMA 1ZYLA 3HV7A 5B7VA 1FOTA 3DQWA 3R7VA 1Y8YA 4ASXA 2OJJA 4JJRA 4Y5HA 3ZDIA 3G9NA 2W9ZB 3LM5A 1YOMA 3AMBA 3P7BA 3PZHA 4J98A 5EM7A 4LRJA 3FC2A 1ZYDA 3DV3A 4BWPA 4EEVA 3F3ZA 3OCSA 4QQJA 5ETAA 3TN8A 2C47A 3V8SA 5A46A 4IVBA 4C3RA 4DFYA 3E8CA 4YTCA 2R3LA 4PMSA 4EC9A 3GP0A 3QC4A 4DH1A 3C4ZA 4XS2A 3TG1A 4QMWA 2J0LA 4J52A 3LFDA 2IW6A 4A9SA 5CAUA 5FTGA 4OT6A 2GS6A 5DR6A 3UYTA 2J2IB 2EVAA 1T46A 2FYSA 4EOOA 4MKCA 4O38A 5CF5A 2WMSA 3QZHA 4U79A 4MBIA 2HZ4A 2IZUA 3JY9A 4QQ5A 3SXSA 5IDNA 5LJJA 2B53A 5AAGA 4QTCA 4R1VA 4L9IA 3HECA 4K6ZA 1OL2A 4J97A 3QCYA 4U45A 3ANRA 4WOVA 5C1QB 3PVWA 3VVHA 4FT5A 2Z02A 3UMWA 3DQXA 3F9NA 4QMYA 2JDSA 3QA8A 3E63A 1UV5A 4PWNA 2EB2A 2XYNA 3FMDA 4OLIA 4BDIA 5DE2A 5JEBA 4ZY5A 4CCUA 3VS7A 1LEZA 1S9JA 1YKRA 3MH1A 3FMKA 4ACHA 4DF3A 4ASZA 4ONAA 3GU6A 2HENA 3QHWA 4PF4A 4FG7A 1BL7A 3ZC6A 4EQUA 4A4LA 5AV2A 5L2SA 3NDMA 5GJGA 4IW0A 2QOHA 2WTIA 1PJKA 2KULA 3R1QA 3V04A 3UIBA 5J7BA 1ATPE 2JAMA 3ZFXA 3IOKA 2PVJA 3HGKA 4EYJA 4NM7A 4EBVA 1H24A 3FPMA 1OBGA 5BYLA 3AT4A 3WOWA 1UVRA 2CKQA 3DB8A 4BCMA 1GIHA 2B55A 5ANOA 5CQWA 5CF6A 3EQFA 4BDCA 2UZLA 1XBBA 5CLPA 5D7VA 4O91A 3VNTA 3RWPA 3N4VA 1NA7A 1O6LA 4DLJA 3U8WA 2GFSA 3DKFA 4L68A 3HV3A 3WZKA 3U6IA 4TT7A 4Y85A 3VJNA 3D7TB 4H58A 4NKAA 3G51A 2CDZA 3Q9ZA 5CAVA 2OFVA 4P90A 5IEXA 3SOCA 2VX3A 3PG3A 1E1XA 2XCKA 4ITHA 5LMKC 3DOGA 3W32A 4O7YA 4N6ZA 3O8TA 2XBAA 2J50A 3BU3A 3HMIA 5JFWA 2A1AB 2B4SB 3NW5A 1JNKA 2VUWA 3E7OA 5E8XA 5EOLA 2PMIA 2A2AA 4BL1A 3COHA 5LVNA 5AIKA 3DK7A 4G9CA 4D9UA
chains in the Genus database with same CATH superfamily
1YXUA 4FTCA 4TNBA 4FKRA 3GQLA 2W1ZA 3LFSA 3L8SA 3HMNA 3HLLA 2QOCA 1UWHA 1P4OA 2PYWA 2F4JA 3D7TA 5M44A 4F9CA 1URCA 4EH8A 4Q9SA 3QD0A 4A06A 1OGYA 3OROA 4Z7GA 2UW5A 3G0EA 4OTPA 5AUTA 3AGMA 1S9IA 5HBHA 3FL5A 4R7IA 3II5A 5J87A 2IPXA 3FLWA 4GYGA 4B99A 1KUTA 3IW6A 5IQHA 4TTHB 4FGBA 4F78A 1JKLA 4AXFA 4YHTA 3ZO1A 1YDSE 4FF8A 5AA8A 1JLUE 4BCNA 3VBTA 2H6DA 4FT9A 4ACMA 3F2RA 3QX2A 3FQSA 3LIJA 3VUDA 5IH5A 4AOIA 5CZIA 4MXXA 5L8LA 2VWIA 2OH0E 3R71A 3LXNA 3UIUA 1ZOGA 2Z8CA 3VRYA 4TWOA 3PYYA 4V01A 2C6LA 4TWPA 4FSTA 4GK2A 3D5XA 3OW3A 4HW7A 4FNXA 4BZDA 5EM5A 5K3YA 5HO7A 5JSMA 4PV0A 2VTNA 3CLYA 4B9DA 3MH2A 3R0TA 5AAEA 4QMZA 5E92A 2GS2A 3UOLA 1XMMA 3CQEA 5C03A 3R00A 2XIXA 4GCJA 4IB3A 5HX8A 3ZCLA 3CKXA 5IQFA 1H1WA 4PDYA 2QNJA 1IAJA 3VAPA 3NAXA 3W0MA 4U40A 4RQKA 3BGPA 4S31A 2DYLA 2V7OA 4WG5A 3AD4A 4CV9A 2E9VA 3C51A 2A4LA 2ZB0A 3G33A 3LLTA 3NAYA 4RA5A 5AR3A 5J1WA 5FEQA 3UQFA 1UU9A 4RWIA 4XEYA 1JVPP 4RA4A 3VUKA 4XH6A 4AP7A 4RLKA 4FT3A 2FGIA 3R9RA 3PFQA 1MUOA 4IAKA 4LMNA 4N4SA 5HG7A 1OPJA 3RK5A 5GIPE 2BRHA 3R63A 3OCBA 3QTQA 5KNJA 3TEIA 4BTFA 5FEDA 5AR4A 3WARA 2WPAA 3JXWA 3G2FA 3M2WA 4IXPA 4EHZA 4O4EA 3B8QA 4NEUA 4EHGA 4ALUA 3R7OA 3ZFYA 1H1RA 4MQ1A 3VUGA 4XP3A 4HZSA 3N51A 5GINE 4G3CA 1Q24A 4PL5A 1GNGA 1Q99A 4AA5A 4MXAA 5ANKA 4C3FA 2ZV9A 3EHAA 1O9UA 5AAFA 5HE0A 4HVIA 4PUZA 4Y73A 1IA8A 2BKKA 3UIXA 2PMLX 4AXAA 3IK3A 5ANIA 4DE4A 3EQCA 4IMYA 3ML1A 4FZ7A 1V1KA 3QUEA 2GNLA 2ITYA 3T3UA 5AP4A 4IZYA 3FDNA 5B0XA 4U9AA 4XV2A 3IPHA 3OZ6A 3FXXA 1F0QA 3C4WA 4X3FB 5EYKA 4EWQA 4I5HA 2CLXA 2I0VA 3MYGA 2UZBA 4OT5A 4U3YA 4TXCA 4QOXA 4KNBA 4X21A 1XBCA 5CU6A 2JBPA 2ZFYA 3W18A 2XANA 5TE0A 5K9IA 2OXYA 3UNZA 3WYYA 3DLZA 2VTHA 4JRVA 2IVUA 1QPJA 3VRZA 1Z5MA 2W99B 4I6HA 4RG0A 2Q83A 3QBNA 3FQEA 2VRXA 1ZYSA 2QOBA 3OS3A 1R1WA 3ORIA 3SC1A 4F6SA 5KMOA 2C3KA 3NYOA 3OHTA 1OI9A 3E3BX 3BYOA 3D2IA 4EI4A 2FSTX 3KA0A 5IQEA 4UBAA 4Y72A 1QPDA 4QPAA 1REJA 3FJQE 3VUHA 2W1CA 2XS0A 2ETKA 3EIDA 3I7CA 4FTQA 4ANMA 5E8VA 4O0TA 4MK0A 4HCUA 4FX3A 4AZWA 1XJDA 3E8NA 3QYZA 4I1ZA 4YO4A 3NYXA 3CQUA 4RVLA 1UA2A 2GHGA 3QWKA 3RVGA 3TJCA 2YCRA 4F65A 4HGLA 3AG9A 3IW8A 4F9AA 1PXIA 3UO5A 5IA2A 1HCLA 2C6TA 3MY1A 3P08A 3A4PA 4U5JA 4KIOA 4IZ7A 3RMFA 4CYJA 2P2IA 4M12A 4IANA 4V0GB 1SM2A 1MQBA 2WTWA 2ITNA 2X7OA 2VTOA 4AZEA 3FHIA 5CAOA 5KKRC 4NK9A 5DOSA 4IACA 5E8UA 4FTKA 4CLIA 2PVHA 3TV7A 3WYXA 4L7SA 3GC0A 4M15A 5M57A 1W84A 1WCCA 4R5SA 3C4CA 2PMOX 4EOIA 4BHZA 5M53A 4I94A 3TT0A 5M55A 3DFCB 4G16A 3P4KA 4DH5A 5IQCA 4NU1A 2PMNX 1MRVA 4ACDA 1QPEA 3FMLA 2VWXA 4BDGA 3EYGA 2CPKE 2VX0A 4QPSA 4RFZA 3CQWA 3UVRA 4CFVA 5IPJA 3P9JA 1Y91A 2JDTA 3JYAA 3ORPA 4FZAB 2WZJA 3GU7A 4HYIA 4V0GA 4WD5A 4XRLA 5FXQA 4DGOA 2C0TA 4FK3A 4DHZA 4RIWB 4QMLA 4FTAA 4U6RA 4KABA 3LM0A 4KB8A 2JDVA 2F7EE 3Q32A 4JR7A 3P7AA 4FV5A 5HE1A 4KRCA 4JL9A 1WVXA 3TDWA 4DT9A 2JBOA 1W83A 4J95A 4K9YA 2OW3A 5CT0A 1G8KA 4BDHA 3KRRA 2C1AA 1WBPA 1V0BA 2YACA 3EZVA 4ZTMA 2UW6A 2CN5A 1QPCA 4ENXA 3ZRMA 3VHEA 3DBEA 4DGNA 3FXWA 1M2QA 1YVJA 2C3LA 3L9NA 3IW4A 3W0OA 3LXLA 5IF1A 3COKA 2DS1A 2X7GA 3R21A 4AZSA 4PDSA 4DFZE 2JIVA 4E6QA 1GIIA 5LOHA 3FY2A 2B9FA 3MJ1A 3FI4A 4MBJA 5CVGA 3C0GA 3LW0A 4M8TA 4RIWA 2W5HA 3UODA 2NRUA 1NW1A 1Y6BA 4FSMA 3QRKA 3ZSGA 4DGLC 5JT2A 1YXTA 2VWUA 4C59A 1OL5A 2YHVA 5CX9A 3T3VA 1XH5A 3I5ZA 3Q3BA 5HG5A 4H36A 5DH3A 3VBXA 3NYVA 4JRNA 4OTRA 4F1OA 4FKLA 3AMYA 2ITZA 4TZRA 4YJPA 4IJPA 1PMVA 3BBTB 3A7JA 5AP3A 4BCKA 2O2UA 2UVXA 3PA4A 2ZB1A 3SQQA 4JX3A 3ZO4A 5EM6A 3PSCA 3QQGA 2XRUA 3C4XA 4I93A 2Y6MA 4LOOA 4PQNA 4EZ5A 3Q53A 3VS6A 4D2PA 3KIOC 4CFWA 4APCA 5AV0A 4F7SA 4EH9A 5HCYA 5ANGA 4RX5A 2C6MA 5AV1A 5HE2A 3UQCA 4KS7A 3HP5A 2VWVA 3O17A 5LVMA 4XP2A 4BICA 4O7TA 3MPAA 2VZ6A 4JVGA 3NUYA 3O0GA 4U43A 4FKUA 4CT2A 2Y7JA 2C30A 2ACXA 3D5VA 3IGGA 3UP2A 4E8AA 3C0IA 2IEWA 4LRKA 3R8ZA 3BLRA 3Q96A 3ITZA 3KREA 4FUYA 2ITXA 3L8PA 4HGSA 2Y8OA 3AOXA 3AC4A 1CTPE 5HO6A 4ZZOA 4DBNA 3CBLA 4FA2A 5L2QA 4I22A 2ZV7A 3BV3A 4UMTA 4YZDA 3FC1X 4PPCA 4CG8A 5IQDA 4USFA 3DLSA 4BIEA 3BHHA 2BAJA 2XF0A 5BVWA 2PE2A 4GJ2A 5CENA 1U59A 3OFMA 2H8HA 3P7CA 4U97A 2PY3A 2HAKA 3ATSA 3MVLA 4E6DA 5J9YA 3F7WA 3UPXA 2R3RA 5JFSA 2UW0A 3FKOA 3JVSA 3GI3A 1OIYA 3IQ7A 4K33A 3R9NA 5HU9A 1MP8A 4XUFA 1XH9A 3F5PA 3TACA 5K5XA 4CFNA 3HKOA 4NH1A 2XMYA 5CS6A 4ERWA 4FG9A 3CGFA 4FL3A 3PZEA 4O27B 2WHBA 3ZEWA 1SNUA 3HRCA 4JS8A 5IEYA 1YW2A 3PVBA 3VJOA 3L1SA 1DAWA 3ZDUA 5M51A 1SMHA 3F61A 3HDNA 4Z3VA 3UDSA 3EL8A 4IVAA 1ZMWA 2GTMA 2PTKA 3D7ZA 4FNYA 4IB5A 4DG0E 3NFGB 4FYOA 2QOLA 1FVRA 4UMPA 2AYPA 4KINA 5DT3A 3BIZA 5ETIA 4OTFA 4H39A 3RPVA 2W4KA 2G2FA 2W4OA 3KK9A 3UG1A 4RSSA 3PE1A 4AW1A 3FI3A 4FIHA 3E87A 4RWLA 1H26A 1NVQA 4WRSA 5CSPA 4R78A 3KVWA 2EU9A 5JKGA 4CNHA 2PL0A 3P79A 3TNPC 3U9NA 3LCSA 3PRFA 5I4NA 2ERKA 5HO8A 2PWLA 4GIIA 3H4JA 2OICA 1OUKA 4MXOA 4P5ZA 1ERKA 4D1XA 4EK4A 2CGUA 4X2GA 4YGAA 3SG9A 2W06A 5LMKA 2UW7A 3VW6A 2NRYA 2HY0A 4XJ0A 5KUPA 3SXRA 5DR2A 5KHXA 2UZVA 4IDVA 3AT2A 5G6VA 2EUFB 4I6LA 3L9MA 3QC9A 3COMA 4RVTA 1W2DA 2G15A 3EQGA 3R7YA 3PUPA 2UZTA 5KMNA 4FEQA 3NS9A 4GW8A 4BDKA 4FIGA 1KE7A 3LFNA 4WNOA 4MVFA 1OB3A 4BN1A 4TYJA 1W8CA 5HZNA 5JQ8A 4CZYB 1YHWA 3MH0A 4BBEA 3UTOA 1L8TA 3W33A 3ALOA 1OIQA 2CGVA 3F7ZA 2Z60A 3QTWA 4IWDA 3UDZA 4FTOA 4IX3A 4BCIA 4G31A 4MD9E 2C3IB 1DI9A 4WIHA 3ELJA 3G6HA 4XOZA 3V6RA 4ENYA 1PY5A 3MPMA 3BL7A 4G3GA 4GMYA 4E5BA 2WIPA 1YOLA 5D41A 3FZ1A 4Z9LA 5FDPA 2RFEA 5I9VA 3FZPA 5KCVA 4QTBA 4MNFA 2JEDA 4BCHA 1JSUA 2OKRA 2YIRA 3GCVA 2W1EA 3ODZX 4EOSA 1Q3DA 4RJ6A 4V05A 5AJQA 3ZYAA 3W2OA 3DJ7A 4O4BB 4PP9A 3NNUA 2WMUA 3HP2A 4YSMA 3UZRA 3U54A 5FDXA 3TUBA 2BAKA 4RIXA 2WQOA 1FQ1B 2OFUA 4LYNA 5CYIA 3V8TA 4P4CA 4N57A 2J0MB 3D2KA 3K2LA 2E9NA 1YDRE 4FKSA 1JSVA 4JDIA 2JITA 5E1EA 4O1OA 5HLPA 2ETMA 4NJ3A 2XNPA 3NIEA 3LAUA 3DJ5A 2CLQA 5HI2A 1DI8A 4YHFA 4C62A 3D0EA 2WFYA 3OP5A 2WTVA 3ORXA 4DGMA 1TZDA 1LPUA 1UKHA 3PXFA 3PY1A 4AGCA 5EG3A 3Q9YA 2BFYA 3TYKA 5FG8A 3DGKA 4JIKA 4P7EA 5E91A 2IZSA 3GC7A 2HWPA 4E4NA 4EH2A 4PNKA 4H1JA 1JQHA 3GUBA 4PMTA 1DM2A 3GC8A 2WD1A 3HYHA 4QYFA 4C3PA 2I0HA 4MNEA 1W98A 3FYJX 1RE8A 3GBZA 1RW8A 1OBDA 4OTWA 3R02A 3TV6A 4B8MA 4CT1A 4EOPA 3C7QA 3HA6A 4H1MA 3D15A 3LJ0A 1FPUA 5HX6A 3UC3A 3E88A 1UNLA 4GU6A 5CXZA 3NNXA 4HGTA 4O4DA 4YZ9A 1BX6A 4K1BA 2JC6A 4W4YA 3WIKA 1XH8A 4ID7A 2VV9A 4MWHA 5DI1A 2I0YA 3M42A 3S0OA 2XEYA 3PG1A 4FVPA 4FE2A 3QL8A 2PE1A 1TQPA 4FKTA 4XLVA 3T9TA 1GAGA 3BHTA 4H3BA 1AD5A 2I40A 4I4EA 5EHLA 1Q97A 2OXDA 3MFUA 3OY3A 4A7CA 4EK8A 4YJRA 1VR2A 2NP8A 4E5AX 2X1NA 2VAGA 4J96A 5I5ZA 5KZIA 2WQNA 4YC6A 1FVTA 2GHMA 2VU3A 5IKWA 3F5XA 3KCFA 5HESA 4I0RA 5DG5A 1OGUA 1SVHA 4F1MA 1A9UA 3CD8A 2DQ7X 3DDPA 4AN2A 2HELA 2HW7A 2QHMA 3OUKA 3ZBXA 5DA3A 4QMOA 4O0RA 2X4FA 4FSWA 4MX9A 3M11A 4M13A 2R64A 3ZLSA 2C5NA 2BZKB 4AWIA 5KMIA 3IDPA 3O8PA 1PF8A 2R3PA 4L3PA 4AZVA 5I9XA 4CGAA 2XK8A 2OJFE 2RL5A 3KFAA 3RGFA 4NW6A 5CASA 5F95A 2XUUA 4XG6A 3F3UA 1U54B 3DXQA 4B0GA 2IW8A 4AGWA 5CEMA 1IAHA 4FZFB 5HICA 4KA3A 3GQIA 3RM6A 3MESA 3PWYA 2GNGA 5IH4A 3V01A 4DGGA 4HYUA 2Z2WA 3I81A 1Q61A 3QTSA 2PVYA 4LQMA 2YLFA 4EOLA 4ZLOA 3Q2JA 2VO6A 3NUUA 4DFNA 4CYIA 4ZTRA 3KB7A 3W55A 3SRVB 2WOUA 2WXVA 3S95A 1TQMA 2YCSA 3MTFA 4A9YA 2W9FB 2AEGA 1ZY5A 3GCSA 3NWWA 1KOAA 5ANJA 4DG3E 3OXZA 1H27A 2I7QA 3ORNA 4UZDA 5I3OA 5KKRB 3C4EA 2IZRA 4NM0A 4QMNA 2YABA 4FKPA 4I20A 4IAIA 4QPMA 4BGHA 3ENMA 5GIOE 4FC0A 1WZYA 3CJGA 1BMKA 2BZHB 2P0CA 4GUBA 3K5UA 4I4FA 4JMQA 4ZSJA 3WI6A 4BTMA 4DHJA 2OU7A 3QQJA 2JKOA 1LR4A 4IX4A 5H8GA 4F7LA 2VTMA 1NY3A 3LFCA 3SRVA 5H8EA 3TV4A 3UO6A 3VUTA 1GY3A 2X6DA 3TKIA 1F3MC 1K9AA 3NMUF 1QL6A 4O0VA 4HYHA 3G0FA 4DEDA 2Y9QA 4A9TA 3KRJA 3ZSHA 4BGQA 5M08A 3Q6UA 2GDOA 4RZVA 5A4LA 5J9LA 2FO0A 1OKYA 2V55A 2YM6A 5JFXA 3U9CA 3KMMA 3OTUA 5DBXA 3R7EA 1Y57A 4R7HA 2XNOA 4QNAA 2VWWA 1H01A 5D12A 4ITIA 3NPCA 3RAHA 4RC3A 2WB8A 4NT4A 5IUIA 5AADA 3KL8A 2V62A 3D5UA 4UY9A 4A4XA 2I1MA 1B39A 5F4NA 4WUAA 4BYIA 2WO6A 4AF3A 3ALNA 3MBLA 5J5TA 4F6WA 4BWXA 4GFGA 4Y83A 2C6OA 4O6LA 5A4EA 3QCSA 4E93A 3DT1A 5C8NA 4OAUC 4GKHA 3OT3A 5J79A 1H07A 4FKQA 4FTUA 5EDPA 4M84A 1IG1A 1XMLA 1KWPA 3HMOA 2OSCA 4DFLA 1ND4A 4F7NA 2WOTA 3BBWA 4L44A 1FMKA 4YZNA 5CF4A 3FMEA 3DAKA 5LCJA 1JAMA 2E9OA 2RFNA 2YDIA 1PXLA 4LFIA 3EN6A 5IA3A 4NIFB 3LKMA 4WHZA 5FM2A 3UJGA 2G2IA 3KRLA 3K5VA 5IQGA 3RCJA 5JK3A 4B7TA 1BL6A 3UDTA 3QHRA 2ITTA 2W1HA 3BU5A 4W8DA 4AE9A 4AS0A 2HZNA 4FV8A 2R2PA 5LVPA 4C38A 1UU7A 4BZNA 4I6BA 5DFPA 3FMNA 3EYHA 2RFDA 4PTGA 3RAWA 5DEWA 4EBWA 2VN9A 3EKNA 4FV3A 5FTQA 3ZLYA 4D4SA 2I6LA 5K0XA 4ANLA 3QGYA 5AIRA 5DR9A 5E9EA 3L9PA 3ORKA 5CI7A 3DJ6A 4ZSEA 2XM9A 2WTKC 5FBOA 4AQCA 5L6WL 2ZDUA 3KN6A 3IOPA 4R1YA 4W9XA 1DAYA 4QP2A 2IWIA 3NRMA 4NIFA 3ZFMA 4BKYA 4QYEA 3EN5A 1F5QA 4UALA 4AA4A 1ST4A 5CEIA 5M4IA 1NVSA 3U6JA 3CTJA 5T3QA 1YI6A 3U51A 5HG8A 2IVTA 3QCQA 4AGUA 1HOWA 4J8MA 4I0SA 2J0IA 4ALVA 3ZEPA 5CVFA 3PJ8A 4M0YA 2ZM4A 3NX8A 2YWPA 5EOBA 4FTIA 4CFUA 4RX9A 3G6GA 4BYJA 4AT3A 4IAAA 2C5OA 2CJMA 4BDFA 2J0JA 1UNGA 3PPJA 4U81A 5EYCA 5EDQA 5HTCA 2P3GX 4AUAA 5A6OA 5I0BA 4AXDA 4FIFA 4XG3A 3ZM4A 4F99A 3ORLA 4KIKA 1M2PA 3CC6A 5AUWA 3ULIA 5GZ8A 4M67A 4XG4A 5T6KA 5AR7A 3UMXA 5FLFA 4C7TA 5KMLA 2ITVA 3OVVA 1ZXEA 4D0XA 2J7TA 3AD5A 5EHYA 3JY0A 5K0KA 4YNOA 2JFMA 3EQIA 3P78A 4MF0A 1SNXA 5L2WA 1G5SA 4BDDA 3QZGA 4ZEGA 4O84A 1PYXA 2YM3A 5LQFA 2ZJWA 3WF7A 2VNWA 2BPMA 3A99A 1ZARA 2O0UA 3PWDA 5CSVA 4ZTSA 3S00A 3DY7A 5LWNA 3IKAA 3QQKA 4JOAA 4KWPA 4S32A 2VO7A 3VBYA 5AP1A 4BHNA 3V5QA 5JRQA 4ZS4A 3OC1A 2PVNA 3PXYA 4BF2A 5C4LA 4IBMA 3ID6C 4HOKA 3VONA 3RNYA 1R78A 3PFYA 4HJOA 4IE9A 5BVFA 4FEVA 3KKVA 1M7QA 3H0YA 3IO7A 5H3QA 2AC3A 3DA6A 4QYYA 1M52A 5TKDA 3W16A 4RZWA 3RK7A 4AACA 3DXPA 3UOHA 4WBOA 3TKUA 4PTEA 4A9UA 4FV9A 5CI6A 2XK9A 4R8QA 1H28A 4F7JA 3BQRA 3F69A 4FICA 3P86A 3W2SA 1M2RA 2BZJA 2QKWB 4I5PA 3ZUVA 1UKIA 3QD3A 2JKKA 4C4GA 4IM3A 4NUSA 3V6SA 3A8XA 2BFXA 3FZTA 5DRBA 3PA3A 4D58A 3G5DA 2YLEA 2Y6OA 3CIKA 4S2ZA 3N4TA 4G17A 5GJDA 3RJCA 4MBLA 4M7IA 3GOPA 1Q41A 4XV3A 3FLZA 3RM7A 4CKRA 3Q60A 1OL6A 2ITUA 4AW5A 5HQ0A 2JD5A 3TIZA 2SRCA 3HA8A 3QRIA 4E73A 1E9HA 4FIJA 4I92A 4JAIA 1CKPA 1SYKA 4WG3A 4BCFA 3SW7A 3R30A 2BRGA 3W0QA 1G8SA 2YM5A 4FBXA 1KSWA 3N4UA 2ZAZA 4O7NA 2YIYA 2F49A 3R28A 4YC8A 1GOLA 4AT5A 3SGCA 4EUTA 3HDMA 3PSBA 4X2FA 2BRNA 4ASDA 2CSNA 3LPBA 4CTCA 2OJ9A 3ZS5A 2XKFA 3TCPA 2OWBA 3EKKA 3Q04A 4G5JA 5T68A 5L4QA 4FVQA 2OJIA 4IB0A 3W8QA 3OUNB 2QU6A 4YZBA 4YHJA 5JN2A 3GENA 2ZMCA 3CS9A 3BWJA 3R2YA 2YA9A 4FNZA 3LQ3A 4L3JA 3RALA 4E3CA 4KIQA 4IH8A 5HEZA 3R8UA 2UVYA 1SVEA 3U4WA 4I6FA 4ANOA 2GFCA 3FSFA 4K77A 2V22A 3W2RA 3A62A 2Z7SA 3VWAA 4EORA 3D94A 3EMGA 2EXMA 2P4IA 3OCGA 2NPQA 4BBMA 3C5UA 5J95A 1YDTE 3LFAA 4G3FA 5DT4A 5E8YA 4FEXA 4QDVA 3ZUUA 5GNKA 4UEUA 4FSZA 4GV1A 3SV0A 4D2RA 4AZTA 4QDEA 5BQ0A 4E6CA 4YZMA 3PY0A 3BEAA 4CFXA 3BZ3A 3T9IA 4XNEA 2CN8A 5I3RA 3R7UA 3ZRLA 2W0JA 4ZSLA 4NKSA 1YXVA 2PVFA 4XLIA 3TNHA 3MDYA 4UXLA 4QQTA 4FIEA 4RFYA 1JBPE 3IDCA 2NO3A 3O96A 5EI2A 1WMKA 2EB3A 4ZY6A 4BY9E 3BL9A 3QALE 4L00A 5L8KA 1ZMUA 4IFCA 4FKJA 3BHYA 2RFSA 3BU6A 3SAYA 4OTGA 4CZUA 3RPSA 5I9UA 4ZMEA 2OZOA 5HOAA 3MN3A 5AR2A 2W05A 4XBUA 4JDJA 4BB4A 4N0SA 4GSBA 1YWVA 1J91A 4NL0A 3LFBA 3O51A 2R3OA 3WILA 2G01A 2G1TA 1YI3A 4E26A 3BLHA 1J3HA 3U6HA 2PUNA 1GZOA 2YAKA 1PHKA 4I23A 1RQQA 2C5VA 4FTTA 5FGKA 4CSVA 3RCDA 3D9VA 2RF9A 4EQCA 1W0XC 1Z9XA 5FXSA 3AT3A 2DUVA 4JG7A 4KBKA 4BI2A 3SLSA 4QP4A 5B2MA 2WEIA 4AW2A 4GT3A 3RAIA 2PZ5A 5F20A 2C5XA 3WF8A 4O0SA 3U4UA 4AW0A 3Q5IA 2XRWA 4GYIA 3V5LA 3O7LB 3LCDA 4G6OA 4F0GA 4DBXA 2QO7A 3DK6A 3ZO2A 3RPRA 2WMTA 5F9EA 2UVZA 3PRIA 4IC8A 1CKJA 4ARKA 5AWMA 4S30A 3FI8A 3ZZEA 4O81A 4E6AA 4IAYA 4UN0C 1CDKA 2RG6A 5CT7A 2ONLC 4EL9A 4QEBA 4MH7A 5E8SA 2UZOA 2YN8A 4CZTA 3TTIA 3Q4TA 2GQRA 3R7IA 2BKZA 3BGZA 1OM1A 3CCNA 3NCGA 3OOMA 4GG7A 4EC8A 3KRXA 4RWJA 3B8RA 3KULB 4EJ7A 3PXRA 2R3GA 3GGFA 3P5KA 1Q8ZA 1U5RA 3RKBA 2WMBA 4F9WA 4K11A 3R1YA 4KKEA 4QP1A 4LGHA 2Q0NA 4ZJJA 4YTIA 5BVNA 2WQEA 1NT2A 2UZUE 2P33A 3ETAA 1V0PA 1GJOA 4UMQA 5DIAA 4GKIA 4TKSA 1A48A 5A14A 3LFEA 1W82A 4LMUA 5ICPA 4J1RA 3GXLA 5H9BA 1IRKA 4C4HA 4RIYB 4WBBB 4YO6A 5HIDA 2XP2A 3HUCA 4AQKA 2W96B 5I9ZA 3KULA 5AV3A 3Q5ZA 4MWIA 2PZPA 4FSRA 3WZJA 3HV6A 4YJSA 4FTLA 3I60A 2XJ2A 4L6QA 5CANA 2R9SA 4JI9A 3NUPA 1OIRA 4DH7A 2VTTA 4D0WA 4B6LA 5TT7A 2CGWA 3C50A 1XHAA 4KBCA 4YLJA 5TR6A 4AAAA 4EK3A 4UMUA 2IVSA 5HBEA 2YEXA 3GC9A 3LXKA 4NYEA 2O65A 2BMCA 4GH2A 5KMMA 2VWZA 4C57A 1U5QA 4O7WA 2F9GA 2X0OA 5DNRA 3EJ1A 3MY5A 5FEEA 3BYMA 4LUEA 4RIYA 3EZRA 2QOFA 3DAEA 3PA5A 2OIQA 3PVGA 2RIOA 1YQJA 2HYYA 2R3NA 4E4MA 1OZ1A 3A4OX 3FMMA 2WEVA 2KTYA 2X39A 1RDQE 3DDQA 4JG8A 2C6DA 2AUHA 5CU2A 2WTJA 5JFVA 3PJ1A 4UZHA 2A98A 3TUDA 4NJDA 4GVAA 2YIWA 5IG1A 3KQ7A 2ITPA 2OLCA 2C68A 3S4QA 3OTVA 4RVMA 4CXAA 3MIYA 4DC2A 5IZFA 3HAVA 3BE9A 4QMXA 4U44A 4WNPA 1H4LA 4PP7A 4L53A 3F5UA 2BRMA 2OI4X 3A7IA 5CF8A 2OK1A 4XV1A 2FA2A 1CMKE 2HCKA 3KN5A 1M14A 1H1PA 2VTJA 4IX6A 3IS5A 4KD1A 4RX7A 3TZ9A 3VHKA 3I6WA 5JGAA 2FUMA 2GMXA 1LUFA 4TWCA 3GEQA 4DCAA 2UV2A 4LV5A 2WGJA 4YJVA 4ZXTA 4BZOA 5BYZA 3CY2A 2X8IA 2O63A 3CY3A 4LGGA 4C2WA 4IQ6A 4TRLA 4Z7HA 2B9JA 3NIZA 3ORTA 2BHHA 2OF2A 2J90A 3QD4A 4RJ4A 4DAWA 4O7SA 3BGQA 4BC6A 4D2VA 2GNHA 2JDRA 3R2BA 4EKKA 2WTKB 3POZA 3R01A 3UZPA 3R8LA 4M69B 4QP8A 3BELA 4X2NA 4O7VA 3FMJA 1E1VA 2C1BA 2C0OA 3FZOA 3BQCA 1TKIA 4QNYA 2QHNA 3P23A 4O2ZA 3TUCA 1R0EA 4HPTE 5A6NA 3CJFA 4FKVA 4A4OA 2Z7LA 3NLBA 5JMSA 2XALA 3ROCA 3TZ7A 3CE3A 2UZWE 1L3RE 2B7AA 3DKGA 3NNVA 2QR7A 4TYHA 3VO3A 5M07A 3ULZA 1J7UA 3G9LX 4LG4A 3C4FA 3IW7A 5CEQA 3TL8A 4II5A 2GQSA 4IFGA 3MSSA 5EK7A 1M7NA 4LI5A 4OTQA 4DEHA 4GJ3A 4LOPA 3PJ2A 4FMQA 4PDOA 5I9YA 4HVSA 1WVYA 1V0OA 4FSNA 5CU0A 4UWBA 4LUDA 4M69A 2QOOA 2FB8A 4R77A 4BR3A 3OWJA 4JXFA 5LMBA 2X6EA 3W2QA 5EW3A 3QKLA 2GPHA 5C26A 3FWQA 4S33A 2WIHA 3KF7A 4O0UA 3FHRA 5B2LA 4C61A 3K3JA 3LCKA