3PWYA

Crystal structure of an extender (spd28345)-modified human pdk1 complex 2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
289
structure length
281
Chain Sequence
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGCLLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPSFVGTAQYVSPELLTEKSASKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of a potent and highly selective PDK1 inhibitor via fragment-based drug discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 72
structure length 281
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pwyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pwyA01
4FV0A 3HMIA 4ASXA 5FG8A 3KEXA 4YJRA 1UV5A 1ZYDA 2C6TA 3Q53A 4MK0A 4PTCA 4G31A 4MCVA 4ZIMA 3BLRA 3RJCA 1OL1A 3C1XA 2XK3A 4I0SA 3VC4A 3P78A 2UVYA 3FE3A 3L9LA 1HCKA 2ZDUA 3O7LB 5KO1A 2RKUA 1BYGA 2J2IB 2BPMA 3OS3A 4H1JA 4KWPA 3ZMMA 3MB7A 4BDIA 5I5ZA 3DXPA 5HG9A 2X1NA 4L3LA 4C62A 5CEKA 3NYOA 4H05A 5HKMA 2OZOA 5J87A 3DLZA 4LUDA 3JR1A 3P7CA 3MB6A 4ARKA 3MJ1A 4FTOA 1H1PA 2GHLA 4RJ5A 4YLLA 5IQBA 4A7CA 2QOLA 4DA5A 3SW7A 3EL8A 2NPQA 3QQHA 2VNYA 3V8SA 2VTQA 2DS1A 4IJ9A 4EHGA 3DJ6A 3OWKA 4YJNA 5AV2A 1P14A 5M51A 4EKLA 4LL0A 5L2IA 4IWQA 2BZJA 4ZSEA 4CRLA 3LQ8A 2H8HA 3BU3A 4WNOA 3VS7A 4ZMEA 2W0JA 3HYHA 1OIYA 4D5KA 3HMMA 3OT8A 5AUVA 4E4NA 4C2WA 4FV9A 4D2TA 3S1HA 2C3KA 1JOWB 3NIEA 3ZO2A 2PMLX 2DQ7X 3UODA 4ANNA 3BHTA 3SA0A 4GL9A 4IAFA 3ZCLA 4Q5EA 2Y6MA 5AR2A 4J8NA 5FXRA 3NVMB 2CGWA 4MH7A 4C38A 1YWVA 2B1PA 1VR2A 3HECA 2HZ4A 4FSYA 3BLQA 4JBQA 1WVXA 2G2IA 4FEQA 4FUXA 4IVCA 5M57A 3E88A 3LCOA 1ZZLA 3ZTXA 3NNXA 3F6XA 4BCOA 4LRKA 4O83A 5DMZA 4C7TA 3UZRA 5BVKA 1KV2A 1JSVA 3HRCA 3QD3A 3LLAA 3FPQA 2WQEA 4IWDA 5HIEA 4FOCA 4RIWB 4EKKA 1MQ4A 3ENHA 1ZMWA 3DBDA 4ZTHA 1M2RA 2O8YA 3I1AA 4I93A 2HIWA 3QZHA 2UZVA 3A60A 1XKKA 3LXKA 4BZDA 4MKCA 5LARA 1YHVA 5IEYA 4ZY6A 4AOJA 1QPDA 4XP0A 3ELJA 3IDPA 3W2CA 1PY5A 2R3NA 4C36A 1ZY4A 2BDFA 1YKRA 4IZ7A 3U6JA 4O1PA 2X6DA 5GHVA 4ZTSA 3VUGA 4BI1A 1J7LA 4C8BA 3THBA 2J51A 3RINA 2WQOA 5FM3A 2PUIA 1WZYA 4NKAA 5HLPA 4FK6A 4YPDA 3R0TA 4KUJA 1GZKA 2QOQA 3HV4A 1Q97A 5LCJA 3RBWA 4GMYA 4KKHA 4ZZMA 1AD5A 2W1GA 3K5UA 3P79A 4F7NA 1S9IA 5HE0A 4MXCA 4WG4A 4F9BA 4XS2A 5IA2A 3NCZA 3TDWA 1LPUA 5CEQA 2B0QA 4EYMA 3KQ7A 2QOHA 2VNWA 4JLCA 3I7BA 4IX4A 4O0XA 4QPMA 3RGFA 4BVUA 4O0VA 2PVKA 2YIYA 3BU6A 3O2MA 3C9WA 4FIFA 3EKKA 1U46A 4PV0A 4BRXA 4FSUA 4AA5A 4S32A 3PA3A 4KAOA 3WIGA 2Y6OA 3RWQA 2AC5A 3MA3A 5I3OA 4CCUA 4F1OA 3NAXA 1KE6A 4N4SA 1ZYLA 4EQUA 4K9YA 4O91A 3TKHA 2W1DA 3V3VA 3N4UA 5AP7A 5EHLA 3MVHA 4O6LA 3E3PA 5E8TA 5CQUA 4D55A 4FOBA 4GSBA 2A0CX 3UYTA 4CVAA 3W16A 3RP9A 2QLUA 2YWPA 4DEDA 5IDPA 4BIBA 5IUHA 3DBFA 5AUYA 1X8BA 4AW0A 4HGTA 4L68A 4BDHA 3NPCA 4CV9A 4LOQA 4A9YA 2UW0A 4XV2A 4TWCA 3RAWA 4CT2A 4CMTA 5KUPA 1OPJA 4BC6A 4EK4A 2OZAA 3RAHA 3VUMA 3HZTA 3PPJA 4EZ5A 4OTPA 1OUYA 3F5GA 4NM7A 2R9SA 3RK9A 2EVAA 3DZQA 5CAPA 5BVFA 4BICA 4NFNA 1U54A 5EM6A 2PU8A 4F6WA 2Z7QA 4J52A 2BKZA 4YTIA 1XO2B 5IPJA 4KSPA 2PVNA 3K54A 5AX9A 3EQRA 4NL0A 3JXWA 2PUNA 3UOJA 1H0WA 1FPUA 3BELA 3CTJA 5GNKA 2YZLA 4QMVA 5CAUA 2B54A 4L53A 3I4BA 5CANA 2JITA 1J7IA 3FJQE 4IVBA 3ORKA 4U42A 4J71A 3VRZA 3GGFA 4X3FC 4YBJA 3LQ5A 3B2WA 2UZTA 3UVQA 3ZZWA 3KA0A 3CC6A 3KRRA 3VHEA 2PE0A 3KRWA 3GU5A 3AMBA 4OUCA 2HXQA 4O0UA 1Y6BA 1H0VA 4K2RA 4D2RA 3LFDA 4ALWA 4EOMA 4FA2A 2XIZA 4ACMA 2B9JA 4E4MA 2HXLA 2BZIB 2GCDA 5K3YA 4AGUA 4PMPA 4O82A 1JKTA 3IPHA 4RLLA 2PMOX 3KVXA 3TI1A 4AT5A 1WAKA 2VWIA 3CGOA 4USDA 5H8EA 4HPTE 4JJRA 5AADA 4WO5A 2GFSA 5EM7A 2R3JA 2CNUA 5AR5A 3AOXA 3D7TA 4FTQA 4YR8A 2QNJA 2BZKB 2GHGA 3GFWA 3PXRA 4WHZA 3B2TA 3PIXA 3O23A 4AA0A 1XBBA 5BVNA 1IR3A 5IG1A 3NUAA 1PYEA 2BR1A 4UZHA 2X8DA 4W4YA 3REPA 4D2SA 4G34A 1HCLA 2WB8A 3HUCA 3W8LA 5JQ8A 4H3QA 3IS5A 3RCDA 5K0KA 1OZ1A 2GPHA 4G9CA 1V0PA 3QC9A 2BFYA 4KS7A 2V55A 2YM7A 4RX7A 3TWJA 4HZRA 3R1NA 2YLFA 4QMOA 4CYJA 4F9YA 1BMKA 3R8UA 4CFMA 4M0YA 2RG5A 4FYNA 3P86A 3SX9A 4WG5A 2YFXA 3S00A 5IH6A 5IH4A 2VTLA 5F94A 3DPKA 4JNWA 4QMYA 4FKSA 4J1RA 3RI1A 3UOLA 4AZSA 2B7AA 2CCHA 4MYGA 2UZBA 5D10A 5EDPA 3QZIA 3ZRMA 2VWWA 5DR9A 3F3ZA 2PMNX 4FT7A 4RWLA 3ZO3A 4EC9A 5LOHA 2XK4A 2GQRA 1PMVA 3HX4A 5FGKA 4IB5A 5DEWA 3R9DA 4AFEA 4XG3A 2J5FA 3F82A 2GU8A 4KIKB 2WQMA 3NGAA 4FUYA 4G5JA 3TXOA 4ZAUA 3P5KA 3HAMA 3CD3A 2WHBA 4EJ7A 3PFQA 3D0EA 5HU9A 2VWUA 3I0QA 3U9NA 4L01A 1G3NA 4QNAA 3FY0A 5E92A 1IRKA 4FTRA 3V6SA 4EOKA 4DFBA 4DT9A 3CJGA 2WU7A 3ANRA 3VBVA 1YQJA 4U5JA 2VTMA 4XRJA 3NW7A 5A4EA 4QP9A 1I09A 2WEVA 3TZ8A 4CFUA 3PG1A 3LQ3A 1GIIA 2OIDA 4NW6A 2UW3A 4PPCA 1P4OA 3F88A 3QWJA 4QPAA 3P08A 3VF9A 4Z7GA 3OY3A 3PIZA 2WMUA 1DM2A 4ZP5A 3TEIA 3TTJA 1KE8A 3RHKA 4EWQA 4PMSA 1WBPA 3Q9XA 4FI1A 5IQIA 4RQKA 3LIJA 3SC1A 4QMNA 2HWPA 3MH3A 2UW9A 2YM8A 3PPZA 1EH4A 3HNGA 5C1QB 4L46A 4RWJA 5AR8A 5ANDA 5J7HA 4KIOA 1RW8A 2F9GA 2X7GA 2IZUA 5AA8A 4YZ9A 5BVDA 5HD7A 3DAKA 3BBTB 4XP2A 5EH0A 3LCSA 1YWNA 1KV1A 5H2UA 4DG2E 4C3PA 5A3XA 3TUBA 3R00A 2XNMA 2ZMDA 4KRCA 4M0ZA 3N4TA 3QFVA 4NK9A 4FX3A 4AW2A 5JH6A 4MBJA 4CNHA 5LVOA 1XJDA 2YIRA 2F4JA 4U3YA 5HIDA 4M69B 5ANKA 4UXQA 2ZV8A 3I6UA 4HJOA 4R5YA 4X7QA 5HCXA 3VBYA 4LMUA 5DI1A 1KOBA 4OGRA 3MS9A 2YABA 2W4JA 3PJ8A 1Z5MA 4Q9SA 4AN9A 4OTQA 3FUPA 5HG7A 2VWVA 1JSTA 5AUWA 1XHAA 3MYGA 3OW4A 4NFMA 4QO9A 3V51A 5HNIX 3QUEA 4IANA 3R1SA 3UO4A 5EW3A 4O2PA 2W1ZA 5DT4A 4EONA 5IQDA 3CD8A 3FZTA 4M3QA 1H07A 1Z57A 3NLBA 1Z9XA 1GZOA 2BTSA 3AT4A 3KU2A 4RJ8A 3F66A 3R2YA 4LRMA 2NO3A 1CSNA 3Q04A 3OVVA 5CI7A 2QODA 3RNYA 5HICA 4DFYA 5E8UA 3VVHA 3LJ2A 2V7OA 3DAEA 4C0TA 3JY9A 2V22A 4G3GA 4QMMA 3FDNA 1M2QA 2I6LA 4QMQA 5JMSA 2XK9A 5F4NA 3VS4A 5B2KA 4AACA 2B9IA 4TNBA 4F9AA 5E8XA 5J8IA 4XLIA 2WXVA 3RHXA 4WSYA 4JDHA 5CVHA 4OTGA 3KXZA 5I9YA 5D9HA 4BKJA 3PY0A 2BAQA 5JFXA 3I60A 5CALA 3F2RA 3PJ3A 4FEVA 4BDJA 4O0YA 4E4LA 4LM5A 2P2IA 2WO6A 4EOSA 3OWJA 3PLSA 4MXAA 3PA4A 2HY81 2PULA 3PWYA 3N51A 1CKPA 5AUTA 2EXCX 5AUUA 2VV9A 5L6PA 1PMEA 4TY1A 2ZYBA 4MWHA 4YLKA 5C03A 3JVSA 3NCGA 3UOHA 2PVRA 5HVYA 2GNLA 3CEKA 3FZPA 2VN9A 2CDZA 2GQGA 3AXWA 3SRVA 2YJRA 4IDVA 3E62A 2P4IA 1WBWA 3KXHA 4R1YA 4X6RA 1T45A 2CJMA 4O7YA 4D1ZA 4NEUA 5C9CA 4U3ZA 3TIZA 1T46A 4A9RA 3SG9A 5HORA 3MN3A 3B8QA 3BEGA 4C4HA 1AQ1A 3UPXA 3OT3A 4DBXA 3PP0A 2GS7A 3QGWA 2F57A 5DGZA 3PUPA 4O7RA 1VEBA 3MH2A 4XV1A 3GUBA 5CSXA 3OWPA 4JVGA 3DKGA 2CPKE 3IW7A 3V5PA 1UKIA 2W5HA 3QQLA 3NR9A 3GCVA 4FTNA 3RPRA 4CFNA 5CWZA 5I9ZA 1WBVA 3HEGA 3NZ0A 5F20A 1IAHA 3FLWA 4N6ZA 2JBPA 2BCJA 2WOTA 3UDBA 3K3IA 5IQAA 3JYAA 3A99A 5AIRA 4WRSA 5EM5A 3C4WA 3UIXA 2W1HA 3LCDA 3VUTA 2F2UA 2VO3A 1ATPE 2CKEA 3KFAA 4R3RA 4XLVA 5IA3A 2W9ZB 4FIEA 3S2PA 1UNGA 2XZSA 3VS0A 4X2GA 4ZSGA 5FTQA 2HWOA 5K5XA 4BCFA 3UZTA 3PE1A 4HVSA 2X8IA 4CLIA 2JAVA 3F5UA 3QTZA 1CMKE 3VUHA 5JQ5A 4MBLA 4QTBA 3FQSA 3ALOA 3HMNA 5LWMA 3FQHA 1E9HA 2I0YA 3MY0A 4RWIA 4DTAA 3GC8A 3Q6WA 4XX9A 3FMKA 3HL7A 4YBKA 5FEEA 3PSBA 2P0CA 1VYZA 5ANEA 3A61A 2OFVA 2JKOA 4JX3A 3BEAA 4W8DA 4AGWA 5M53A 3EOCA 3IDBA 1H27A 2XYUA 2R7BA 1KOAA 4XUFA 3PE2A 1WBNA 4FL1A 3POOA 4WG3A 3EN7A 4AAAA 5JGDA 4I92A 2ZV7A 1W84A 2WD1A 4E4XA 5J5TA 4C59A 3JPVA 4E20A 1NW1A 2QOOA 3NDMA 4NSTA 4XOYA 3BX5A 4BYIA 4IX6A 3H0YA 5HX8A 2H9VA 2HZNA 4E5BA 4ANBA 3TDVA 4NYEA 3RZFA 3R73A 4TPTA 5HLWA 4LGDA 2RL5A 3ULZA 3R21A 5A6NA 2O63A 4UMPA 3D5WA 5G1XA 2OZAB 3NW5A 4Y46A 2IVTA 5EHYA 3OTUA 4E5WA 4WRGA 4L7FA 4OTWA 3F3TA 3GOKA 5H3QA 3KXMA 4Y83A 1QMZA 2PVYA 2PZIA 3QCYA 1OPLA 3SAYA 4CMUA 5EOLA 1U54B 4Z7HA 2UZWE 4MXXA 1CDKA 3L9MA 3A7FA 4L00A 2J9MA 1P5EA 2BDWA 5KNJA 5LXMA 2XK8A 2ZAZA 4LMNA 5AMNA 5K5NA 3EMGA 2EB3A 2I0VA 4Q5HA 2HCKA 4JS8A 4BWKA 4RRVA 2F7ZE 4UZDA 1JKLA 4N70A 3DJ7A 3KVWA 3ZO1A 3QTRA 4YU2A 2PMIA 2FSLX 4GFOA 1B6CB 4YO6A 4B4LA 4DCAA 2J0LA 2O2UA 5CX9A 5CAOA 4UWYA 3DY7A 2OGVA 2WPAA 5EDRA 5CYIA 3GU4A 3Q6UA 4YGAA 3ZEWA 5HBJA 3EQHA 3LVPA 5AJQA 3FMMA 4CEGA 4PF4A 3G0FA 3QD2B 3H4JA 3Q5ZA 4ZEGA 4PDYA 1JQHA 3KULA 4M68A 3PVBA 4EOQA 3DV3A 4F0IA 4ACCA 5HG5A 3EL7A 4FKWA 4CKRA 2QR8A 2C6EA 4L67A 3WI6A 2JDVA 3TKUA 3MH1A 2W5BA 4RZVA 4JL9A 2PVLA 2X9FA 4OTHA 5KKRC 3CSVA 5H9BA 3D7TB 4KBAA 4K1BA 3HLLA 3KF7A 4DEIA 3DT1A 5HBHA 1M52A 2WTKB 4L6QA 4WOVA 4EC8A 2NRUA 2QU5A 4GJ2A 5KMKA 5C01A 2CNQA 2WQNA 2QHMA 1FMOE 3BE9A 3DQXA 3O0GA 2B55A 4TWNA 3TTIA 5IF1A 1H00A 1Q8WA 4PMMA 3HP5A 2X7OA 4QTCA 4O27B 4U45A 4IBMA 3A2CA 3ZONA 2P33A 4NW5A 5KMOA 2XCHA 4GG7A 4C3RA 4MTAA 3V5TA 3FI8A 2W17A 2IPXA 3VS2A 1BI8A 3HV3A 4I0RA 4CD0A 1J1CA 5HD4A 4ZZOA 3R30A 3R9NA 3RNIA 2P55A 2VGOA 4AZFA 2JBOA 3W33A 3ZRKA 3FHIA 2XK7A 2BRNA 3BWFA 5BX0A 2GNGA 2QG5A 3L8SA 1OMWA 3OUKA 5FTOA 4ZJIA 5C4KA 1QPEA 4U97A 5GJDA 5HE1A 4S33A 2J0JA 1UU9A 4FKUA 2C69A 4I41A 3EQDA 4GK4A 3PG3A 3IK3A 4FEXA 1FVTA 3SKCA 2X39A 2PUPA 5CZHA 4QMUA 1W98A 3AGMA 1U5QA 5ETCA 3DTCA 4O7SA 4JDJA 4R7IA 4P7EA 3O50A 3E92A 2GQSA 3FYJX 2DWBA 5CNNA 5EYKA 2R3QA 4F7SA 2WTVA 1Q8ZA 4GT4A 3Q3BA 4AE6A 4DITA 4YMJA 5CF6A 3DDPA 3R02A 5E8ZA 2Z2WA 3NW6A 5LVLA 3ZXTA 3A62A 4M97A 4W4VA 3RPSA 4YURA 3UQCA 4U44A 3QX2A 4OTFA 2RFEA 3VUKA 5FP5A 4DEAA 4KD1A 3VIDA 4C4IA 3W32A 4C37A 4QTDA 4FV4A 5L2TA 5CSHA 4I4EA 4EOLA 3UBDA 4M7IA 2R3MA 2C3JA 4DG0E 5CXZA 2HZ0A 1NVSA 4FSRA 5AIKA 4DG3E 5HVJA 3UVRA 3ZBFA 3PTGA 5EW8A 3OG7A 4S2ZA 3QLGA 1WMKA 5TOZA 4MQ1A 3F3WA 5M06A 2E2BA 4IC7A 4TL0A 2BALA 2WZJA 4A06A 1YI3A 2QU6A 2QOCA 3BYOA 4FR4A 4IXPA 4MF0A 2ITPA 5K9IA 1Q62A 4FT9A 4NM0A 4HYSA 2ITUA 2HK5A 3EFLA 1O6YA 3A4OX 2JDRA 5K0XA 1V0BA 1S9JA 1ZAOA 1J7UA 4O7VA 4ZY5A 5I0BA 4HYUA 5DG5A 3LW0A 3R83A 5LWNA 4OTRA 4IACA 1ZYCA 4EUTA 4GRBA 4O7WA 5EQYA 2IZTA 5L8KA 4BDKA 2GNFA 5GZ9A 3TIYA 4NTTA 2J0IA 5D1JA 5JZJA 5E8SA 2UZNA 3PVUA 4JX7A 1O6KA 4L9IA 5AP6A 3R8ZA 2ZV2A 4PMTA 4V01A 3VWAA 2BAJA 4R78A 4X2NA 4ASZA 1WVYA 3DLSA 4GW8A 1P2AA 5HTIA 3DNEA 2E9UA 4EH2A 2BROA 4C2VA 3MSSA 3SOCA 1AGWA 4RLKA 3V6RA 4O22A 4I6HA 3PJ2A 4RX5A 2JD5A 4RX9A 1PRYA 1XWSA 1M7NA 4I4FA 2X9EA 2BIYA 1Q41A 3UP2A 3LHJA 4KKEA 4EHZA 3BQCA 2IVSA 2ITQA 2WELA 3IQ7A 5DRBA 4BDCA 5FEDA 4EHVA 4CRSA 2JKQA 2VD5A 4AU8A 4TYGA 3W2RA 2Z8CA 1IA9A 4B9DA 3QTUA 3CGFA 3Q96A 4OT6A 4YC3A 1Y8GA 4CFFA 3SLSA 1MP8A 4PL4A 2F7XE 1BL6A 2WMTA 3AC1A 2REIA 5KMIA 5C4LA 4NCTA 5DR2A 4PP9A 1YI4A 3SW4A 5CS6A 4DTBA 4J7BA 2Y4IB 3QQFA 3FKOA 4ANOA 2YEXA 4Y72A 3R6XA 4ZJVA 4W8EA 4UXLA 2PE1A 1OKYA 3GB2A 1OGUA 4YNEA 4FVPA 4LGGA 1ZOGA 4YTHA 3ZC6A 2RIOA 3R7GA 4MD8E 4BCKA 4YO4A 3GC9A 5CSWA 5B2MA 4XHKB 3MPMA 4CFXA 1PYXA 1KWPA 4BTMA 1FQ1B 2YCFA 1R39A 4DGMA 3CKWA 5JGAA 3Q2JA 2SRCA 3H30A 5CI6A 4DGNA 1UU7A 3A4PA 5BNJA 3W55A 4CFWA 3KXNA 5A14A 5IH5A 5DPVA 3SRVB 3ZSHA 4G3CA 3LFFA 4DH8A 1U59A 2BRBA 4Y73A 4ZJJA 4NKSA 4BCJA 4CZYB 5JRQA 5LVPA 1ZARA 3C4EA 3WE8A 1P4FA 1XH6A 2FVDA 4NJ3A 3P0MA 4RZWA 4UWBA 3WYXA 2QLQA 4C58A 3R8LA 4ENYA 5K4JA 3IO7A 4X0MA 2CSNA 5FBNC 3MI9A 4N0SA 5J1VA 4I94A 5DOSA 5EHOA 2VTNA 4BDBA 4HGEA 2WMWA 4U41A 4L7SA 5FDXA 4O81A 4PTEA 5EM8A 3CBLA 5M4FA 4XMOA 3VS6A 1DS5A 3FBVA 1W82A 3CPCA 3HKOA 3D83A 3DBEA 3MPTA 4UMTA 4ASEA 3P9JA 2CLXA 4O0RA 4HGSA 1WBSA 3A8XA 3WARA 4G6LA 4UALA 2Q83A 2G1TA 3QCQA 4UV0A 2FO0A 3SV0A 4GKHA 2UW6A 1OBDA 3WF5A 3GP0A 1YXVA 3OY1A 5AUZA 1ZMUA 3I5ZA 3ZH8A 3QA0A 4G3EA 2R3OA 4F6SA 5J1WA 3QU0A 3QQUA 4QQJA 4QMLA 3U55A 3E8NA 2B9FA 3F3UA 4QP3A 3M1SA 4F7JA 4P2KA 4QQCA 1MRUA 4NH1A 4FVQA 3SXFA 1XH4A 3BPRA 4DN5A 4GH2A 5J9LA 5DR6A 3LM5A 1PMNA 4DC2A 2LAVA 2PVJA 3ZRLA 3QTSA 3BU5A 3NUXA 2QO9A 2YZAA 4RX8A 1BX6A 3KCKA 2UW7A 4LUEA 2YISA 2OF2A 3GT8A 2C5VA 4RVKA 4PL3A 3CE3A 3PZEA 4MWIA 4RFZA 4S34A 3FWQA 2X0GA 1OL5A 2UW8A 5FUTA 2WIHA 4D4YA 3L1SA 3AMAA 3PY1A 1ERKA 2YM6A 3WZDA 2XH5A 3R7EA 3KMWA 2W06A 4EWHA 4AZWA 1OKVA 5I9UA 3EQIA 3ZDUA 4C4GA 2VTIA 4B99A 4AW5A 4I21A 4K18A 3KRLA 4XG4A 2UZEA 2O0UA 3C4CA 1UWHA 1ZMVA 4NZWB 5FTGA 3AC3A 1YOLA 4DEHA 3OCSA 2YM5A 3OFMA 4E6AA 3RPYA 3QCSA 5KBRA 2XIRA 4K11A 4H3BA 4DGOA 5J79A 3DU8A 3WE4A 2WMVA 2GMXA 5IQCA 4XG9A 2PE2A 3AG9A 2OKRA 3PVGA 4FIIA 4FTKA 4JQEA 4QP4A 4EHEA 2WTJA 4PDSA 4XJ0A 3NEWA 5E4HA 1Y8YA 3F2NA 4GFMA 5A4LA 1KE9A 4GJ3A 4XOZA 4U8ZA 1OB3A 3M2WA 4FSTA 5FQDC 4QTAA 3ULIA 3LFEA 4PP7A 3MBLA 2XUUA 2QQ7A 4IM2A 5CU0A 5CLPA 4GV1A 2QONA 1J3HA 4G16A 4F7LA 3OBGA 1PXNA 5BUEA 4QT1A 4WBBB 4MNFA 4TYEA 4ANQA 3BYVA 2OXDA 2R64A 3EFKA 4U81A 2BMCA 5L6OA 3PXZA 4O86A 4HCVA 4DLIA 4UEUA 3JS2A 2J5EA 4CLJA 5IU2A 4Q2AA 5LMBA 3H0ZA 5KCVA 3LXPA 5IEVA 2AYPA 1OL7A 3NNUA 3UTOA 3FL5A 4YUQA 4JQ8A 3EQBA 1A9UA 4IVAA 4BWXA 4XG6A 4CT1A 3MFTA 3UQFA 3PDTA 4KA3A 3GCPA 1NVRA 3KULB 3SG8A 4ZY4A 3PSDA 2OF4A 4L3PA 4WNKA 3QKLA 4LYNA 1YXTA 2OJFE 4M84A 4RC3A 4DE4A 2DUVA 4IAIA 2PY3A 4C4FA 4KIPA 4JQ7A 4CKIA 4IX5A 5IEXA 2R3KA 2VTPA 2Z7LA 1Q8TA 4JR7A 4LL5A 4FNWA 2FGIA 5EKOA 5GJFA 4AF3A 4IB0A 3ORNA 3PJCA 2QOKA 4AN2A 5C27A 4E8AA 5IZFA 3V5WA 2JFLA 3T3UA 2XNNA 1VZOA 5LJJA 1H1SA 4AZTA 1GZNA 4ANMA 4F08A 3EQFA 3ZLXA 1H26A 3OOMA 3L9PA 3V01A 2G9XA 4GCJA 3T9IA 3VUIA 4QOXA 3V5JA 2Y4PA 1Q24A 3AC8A 4TTHB 3DXQA 5DYJA 2R3HA 3PRFA 4FV6A 3WZJA 4CCBA 1JPAA 5CVGA 3FZOA 1WVWA 4YJQA 2IN6A 1H4LA 2B9HA 3F7ZA 5AX3A 5J9ZA 1NT2A 3BWJA 4O7NA 2YWVA 3QXOA 2YLEA 3WILA 1URCA 3TV7A 3N4VA 4FNYA 3TNIA 3VS5A 4TWOA 5GJGA 2A1AB 5E91A 5K4IA 2YIWA 3FMNA 4UMUA 5GZ8A 1JVPP 4XV9A 4I20A 1UKHA 3Q9WA 4KABA 4BBFA 2XEZA 4TYIA 3RKBA 3U4UA 5GIOE 2IJMA 1JKSA 1KE5A 1TQPA 1Y6AA 4U80A 4E5AX 4LOPA 4XEYA 4F99A 4I6BA 5DT3A 4IE9A 1F3MC 4X2KA 1FVRA 4FKLA 4BWPA 4A9SA 3FZSA 1H1WA 4FTTA 1YHWA 2RGPA 2JEDA 4EK6A 1YXSA 1K9AA 1V1KA 4J98A 3Q4UA 5AM7A 4CZTA 3R7IA 4FICA 3ROYA 1QPJA 2QOIA 5AV4A 2Q0NA 3FPMA 4IFGA 4ZMFA 3AT3A 4W9WA 3W2QA 4RC2A 3ZFMA 1G8AA 3A8WA 4ONAA 5BMMA 3VJNA 4FSZA 1FBNA 1MRVA 2ONLC 2WQBA 3QZFA 5CTPA 3QHWA 4FTJA 1VJYA 3MGYA 1ZLTA 5ANGA 2C6MA 4DEBA 3ACKA 1SVEA 2C47A 2W4KA 4FV2A 2J50A 2C30A 4WIHA 4D58A 5F1ZA 4C34A 2IG7A 4FE2A 4C3FA 1DI8A 3DDQA 4NIFA 4Y95A 3UMXA 4B6LA 4HVGA 4EBWA 1RE8A 3E87A 3PXYA 3I79A 4X3FA 5BYYA 5IA4A 1E1VA 3C0GA 4GK2A 1GOLA 3LFAA 2GTMA 4PWNA 5E8WA 1IA8A 1PXJA 1PXPA 3D7ZA 5DIAA 3SD0A 3ETAA 2B4SB 4D2VA 1V0OA 3U6IA 2LGCA 3DOGA 3O7LD 2YAKA 3ROCA 3W2PA 4EJNA 5AAGA 5M4UA 4R7BA 4HGLA 4HVHA 1QPCA 4DFXE 4TWPA 3LM0A 3OMVA 1SM2A 4HW7A 3BRBA 1BLXA 3NUSA 4DGLC 1R0EA 3VHKA 3RPOA 3FHRA 3RZBA 3Q52A 2XF0A 5AWMA 3KMUA 3ODZX 2C68A 2EXEA 3RK7A 1L8TA 4BI2A 1PKDA 3DXNA 3R71A 1Q8UA 4FZ7A 4EZ7A 3RWPA 4GUEA 1OIUA 5BVEA 2XYNA 4PX6A 5ACKA 2HY0A 4WT6A 3VBTA 4E3CA 5A6OA 5F95A 1RDQE 1JNKA 3OXTA 4ZTMA 2GTNA 3TM0A 3TNQB 1J1BA 3COMA 2HYYA 1YRPA 3VJOA 4F6UA 4HYIA 2XCKA 2C6DA 5HU3A 3W2SA 4BL1A 4USFA 5E7RA 4PNIA 2AC3A 1Q99A 4JOAA 5AR4A 2RFSA 4AZVA 1YDTE 4IZAA 4A4XA 3D4QA 1FGIA 1ZOEA 4G9RA 2F7EE 3LAUA 1SZMA 3FMDA 4H1MA 4FTLA 2OBJA 3I81A 3P7AA 5AP5A 4C02A 2BAKA 4FF8A 3F2AA 4YC8A 4RFYA 5KZIA 2JDTA 4BGHA 3NX8A 4RJ3A 4EBVA 3H3CA 4FTUA 4O7LA 3NWWA 4BCNA 2ZB1A 4DEEA 2I1MA 2ZOQA 4YZBA 4BDDA 5I9XA 2PTKA 3O8PA 3R9OA 2KTYA 1E1XA 4MBIA 1WBTA 4YZDA 5ANOA 2AUHA 3R7VA 4R1VA 4C33A 3EIDA 3D5VA 1B38A 3KK9A 5HTBA 3LPBA 4XBUA 4HNIA 4ERWA 4M12A 4DT8A 3NS9A 4R7HA 5AP0A 1U4DA 4G17A 4GFGA 3OEFX 2Q0BA 4BBEA 3PJ1A 3KN6A 3QALE 4O6EA 4RVMA 4C35A 4LQMA 4F65A 3HP2A 1OECA 4ITHA 5M4IA 3BGPA 4FK3A 2UZUE 4LFIA 2XM9A 3QRUA 5FM2A 2I40A 3GC0A 3O17A 2IO6A 4ANSA 2WAJA 2XKFA 2ZM3A 4FSNA 4AS0A 3ACJA 3ZFYA 3EN9A 3HRBA 5AV0A 3FMHA 4WBOA 3T8OA 2VWZA 4D9TA 3BQRA 4ACHA 3DBQA 3QD4A 3UC4A 5HZNA 4WKQA 3EQPA 2QO7A 4PDPA 3A7JA 3UNJA 4V04A 4DINA 3HMPA 4LOOA 2GNJA 3QRTA 4GVAA 4A4OA 3G5DA 2QURA 4X21A 4GKIA 4G3DA 5ETIA 3W18A 3DKOA 1RJBA 4DH3A 5C8KA 1O6LA 2GFCA 2VO6A 3L8PA 2ZB0A 3QBNA 4ZLYA 4O21A 4EK3A 2RSVA 4D4SA 2WMXA 4QMWA 1XH7A 4RJ6A 3IOKA 5TO8A 2OIQA 3UQGA 5A9UA 3BYUA 5AUXA 2J4ZA 3GOPA 3JY0A 3BGZA 3MIYA 3ODYX 2PPQA 4BTFA 2F2CB 3K3JA 4QPSA 1U5RA 4FZ6A 4IX3A 3OUNB 4E6DA 3DB8A 3L8VA 4KBKA 1GIHA 2Z02A 2XNBA 3FI4A 3QQGA 3QYWA 3E5AA 3IKAA 4CFVA 2VWYA 2B53A 3G2FA 1G5SA 4OR5A 4ASDA 5HOAA 4CMOA 2WMQA 3FXXA 3PXQA 3VS1A 4ENXA 2XB7A 5HQ0A 5GINE 4GIHA 3SXRA 4K6ZA 3QL8A 1Q4LA 3I0OA 2PVMA 4O84A 2X6EA 3MDYA 3FLNC 2W1EA 3MFSA 4RIXA 3PPKA 3IONA 3IOPA 4ACGA 3LFNA 3VS3A 2YDIA 1DAYA 3MW1A 2FSOX 4MVFA 4YHTA 5BMSA 5J7BA 4QQTA 2PL0A 3OD6X 4KNBA 5CF5A 4MEDA 4ZK5A 2PZPA 1IG1A 2WFYA 2ITVA 3OXIA 5KMLA 4DF3A 5DNRA 2X4FA 5J95A 4TW9A 1URWA 4JR3A 4FYOA 4O2ZA 4BCHA 4BIEA 5GIPE 5L8JA 5BVOA 3LMHA 1GJOA 3ZHPC 4U6RA 3WZKA 3EZVA 1IEPA 2OJ9A 3WF6A 3ZU7A 2XNGA 5EI6A 3CY2A 2W1CA 2YCSA 3QD0A 5JZNA 4FIGA 5KX8A 3IG7A 4AXAA 4EOOA 4NJDA 3D5XA 5JN2A 2CN8A 3LFSA 4EORA 4GU9A 1BUHA 2W7XA 4FG8A 3FLQA 4PL5A 4X2FA 3DK7A 4I24A 4AA4A 4B8LA 1LP4A 4BGQA 3EJ1A 4RQVA 4IJPA 1H08A 5HCZA 3KRJA 3AC5A 1KE7A 2X81A 4FT0A 4IAZA 4FV3A 3U6HA 4E26A 1W83A 4FKGA 1PW2A 4DFUA 4JXFA 1XH5A 5LMKC 4QMSA 4FL2A 1GNGA 3DFCB 3U54A 2IW8A 5ITAA 5M08A 3ZS5A 3TCPA 3H9FA 1M2PA 3FLZA 3O8UA 4CKJA 2WTCA 4WNPA 4JAIA 4G1WA 3FSFA 2XRWA 3QTWA 2OXXA 1OVEA 4NM5A 5L2QA 4PQNA 3GCSA 4D0WA 4ZZNA 4EOJA 1M17A 2CGUA 3NMUF 4YSMA 4R8QA 3AGLA 3WYYA 4ITIA 3O71A 3COIA 3HV5A 3POZA 4UY9A 4FTMA 2PK9A 3BIZA 5M4CA 3PP1A 5JRSA 3F5PA 4K0YA 3Q5IA 4Y5QA 3PXFA 2G2FA 5EYMA 5H8GA 1Q8YA 3D2KA 5G6VA 1ZZ2A 2PHKA 2Z7RA 4R6VA 4D1SA 4MD7E 2WMRA 4DH5A 4FT5A 1JKKA 5HIBA 4WNMA 4BIDA 2PYWA 2XM8A 4GYIA 5AEPA 2C5NA 4P5QA 1ZY5A 2PZYA 3CS9A 1YXUA 1R3CA 2XBJA 3ZLWA 4C4JA 3BYSA 2E9NA 5HE2A 3LFBA 1ZOHA 3AT2A 2GDOA 4EK8A 2QOFA 1TKIA 2HELA 3UNZA 4FG9A 2OG8A 4J96A 2ETMA 4RWKA 4DTKA 5AAEA 2J0MB 4DHFA 5AM6A 4UX9A 3BV3A 2R5TA 4F0FA 2JLDA 3RM6A 4LG4A 4HZSA 2RG6A 4YJPA 4GG5A 1YDSE 4H58A 2IW9A 5TKDA 3DGKA 4QP2A 2F49A 3V8WA 4ALUA 2ITNA 3E93A 3LFQA 3NSZA 4M66A 4AX8A 3R2BA 4OAUC 3SVVA 3CR0A 4NU1A 4E6CA 1A48A 4CGAA 3HVCA 2A27A 4P4CA 4EK5A 5C26A 2X2MA 3GC7A 1SVGA 3NNWA 5CU2A 3GVUA 3CCNA 3C4ZA 3LOKA 3DTWA 3O8TA 3QRJA 3I7CA 3CXWA 4I6FA 4AG8A 1NVQA 4RA5A 3ZDIA 2J6MA 1A06A 5E8VA 4BR3A 4JG8A 4XG8A 4IEBA 5LMAA 3FMLA 4RMZA 4IZ5A 3DKCA 4NM3A 4E7WA 1JWHA 4MXZA 2XA4A 2C0OA 2BZHB 4XCUA 1YHSA 3G33A 3GI3A 3TJDA 3UIBA 2FUMA 1NA7A 5IMEA 2QVSE 1PXMA 5IQEA 2JFMA 2YIQA 2HOGA 4RIOA 5EI8A 1BKXA 3HV7A 5FD2A 3T3VA 5IA5A 4FTCA 4YJUA 3KKVA 4E73A 4PPBA 3RTPA 3KL8A 3TV4A 2NRYA 1RQQA 3IW6A 5FWKK 4IB1A 4DFLA 2Y9QA 3NUUA 3R7UA 3OC1A 3R8PA 2NNWB 5DBXA 2BHEA 2QCSA 5JFWA 2ITWA 4FSWA 2E9OA 4FV8A 2VUWA 2X8EA 3CQWA 3MH0A 4BCMA 3WZEA 4KKGA 4QP6A 3LKMA 1REJA 4K8AA 3C7QA 3LZBA 2CNVA 2X2LA 2CCIA 2QKRA 3RAKA 4MXOA 5CZIA 4BHZA 2VX0A 4NIFB 5DHJA 4MAOA 2IVUA 3ERKA 2J0KA 2O3PA 4CYIA 5C8MA 2YM4A 2ZMCA 3DJ5A 4X3FB 3RVGA 5EI2A 5T3QA 1XBCA 2OIBA 2R2PA 3QKKA 4QD6A 4XBRA 5M55A 5TR6A 3TKIA 4RIYA 1SNUA 3DB6A 2XJ0A 3LE6A 3ZOSA 3BKBA 3QTXA 4Q9ZA 4UBAA 3IECA 2XMYA 2GSFA 5AR7A 4IWPA 3CLYA 4CTBA 1PMUA 4YZMA 1H01A 2DYLA 3KMMA 3OROA 4FKPA 4OTIA 4XP3A 1OL2A 2WTWA 2V5QA 5E90A 2J7TA 4F1TA 3WF9A 5AP2A 4OTDA 4F4PA 5CAVA 5EKNA 4M8TA 5HI2A 5IMXA 3UG1A 1K2PA 2VX3A 3R7OA 4Z55A 3MV5A 1VYWA 4ID7A 4UWCA 4DCEA 1TQIA 4DGGA 5EQEA 2XJ2A 2YACA 3EQCA 3G90X 4Z16A 2ERKA 4I5CA 5L8LA 4YJTA 5AV1A 5AR3A 5CT0A 4RJ4A 2O5KA 3PRIA 3A7IA 2Y0AA 3LXLA 4JBPA 4IADA 4IVDA 4FGRA 4FKIA 3RK5A 4HNFA 3AD5A 5BVWA 3UO6A 2WMBA 3U9CA 4EOPA 5IQFA 2UW4A 4J8MA 3OZ6A 4B8MA 1H25A 3BYMA 2C3IB 2OJJA 4IAKA 2C6LA 4EOIA 4DLJA 4K77A 5IISA 2XP2A 1I44A 5HBEA 2H34A 4YSJA 5BYLA 3UO5A 5AP1A 3OXZA 1XQZA 5BUIA 3E8CA 3EYGA 3V5QA 5HO7A 5FP6A 3PY3A 3UYSA 2OFUA 2PZRA 4MQ2A 3E7OA 3EN6A 5M56A 4FKTA 1ND4A 2HAKA 3OEZA 4L43A 3ZLYA 4OBOA 3QCXA 5HNBA 3FI3A 2JIIA 4APPA 4YTFA 2BHHA 4RC4A 3EKNA 3QLFA 4ACDA 2ITYA 1UNLA 2NP8A 3OHTA 3PYYA 3QRKA 2Y7JA 3FY2A 3FC2A 5FRIA 2QC6A 1PXOA 1Y57A 3FKLA 5BPYA 2W99B 4O0SA 3VBXA 1G8SA 1IAJA 4WUNA 1XH9A 3B8RA 3Q9ZA 4OW8A 4XG2A 3HMOA 4V0GA 3QRIA 4EH3A 2FH9A 3DNDA 2XNPA 2YA9A 3G6HA 4QP7A 4B7TA 4S31A 2R3GA 3D14A 2O64A 2VO0A 2FB8A 5J9YA 4FG7A 3SGCA 5FBOA 3TNPC 1ZRZA 3W8QA 4AT3A 1ZWSA 4ZS0A 4UMRA 3R04A 5D11A 4WUAA 3FV8A 3DK3A 4FZAB 2WTKC 5E9EA 5CVFA 4I1ZA 2OI4X 3L9NA 2VTAA 3HV6A 5DT0A 4I5HA 5KZ0A 3ZSGA 4EZ3A 5JFSA 4I0TA 5LQFA 4TNDA 3GQIA 3TZMA 1BL7A 3FZ1A 2EWAA 2I0EA 2PVFA 2XBAA 5KMNA 2C4GA 2FSMX 3Q4ZA 2XIXA 5DN3A 4TYJA 3NVKI 4AE9A 4QYFA 3FAAA 4EYJA 5CY3A 2IZRA 3O51A 4EQMA 3C50A 3QZGA 4BDFA 4FGBA 5E1EA 3RM7A 5HEZA 5A46A 2C5YA 3GCUA 3QF9A 2HW7A 4FKJA 2W1FA 2C1AA 5DE2A 4BKYA 5KMMA 2VX1A 2Z60A 4RIXB 4F70A 2OJIA 1IASA 5CU3A 4N57A 2CMWA 4A9TA 2ZJWA 3PSCA 2WEIA 1FINA 4U40A 4MNEA 5HGIA 3KN5A 4AGCA 5HO8A 4ZSLA 2E9PA 3T9TA 2VWXA 2YCRA 3WF8A 1H8FA 2QG7A 5LVMA 4ZSJA 1H24A 4L45A 1H1QA 3KCFA 1FOTA 4FKQA 3F5XA 3MTLA 3MESA 1XBAA 3E3BX 4IWOA 1UU3A 3CQUA 5HE3A 3BE2A 3ORZA 5DH3A 3UP7A 1OUKA 2GS2A 3UC3A 3F9NA 5CEMA 3CTQA 3CQEA 4QYGA 4AOTA 3GQLA 4TT7A 4GK3A 5A4CA 4FSMA 1TVOA 3EH9A 2WTIA 3AC2A 5DFPA 3BGQA 1KUTA 4APCA 5L6WL 4LI5A 3VF8A 3MFUA 2C0IA 4TXCA 4ZLOA 5EW9A 4EUUA 4Z3VA 3FQEA 1M14A 3HDNA 4FEWA 3MTFA 2QD9A 3ZM9A 3A7GA 4ZTRA 4D9UA 3VN9A 3E64A 5CASA 2I0HA 1K3AA 3EWHA 4MHAA 5EQPA 4JI9A 3ZO4A 2QO2A 1OBGA 2B52A 5EYDA 4EEVA 3AD4A 4FT3A 3SHEA 4EI4A 4QMPA 5DLSA 2C0TA 4S30A 4YJVA 3ZUUA 3EQGA 1FVVA 3DK6A 3QHRA 3FEGA 5IQHA 5HTCA 3F7WA 2R3RA 4II5A 4A4LA 1MRYA 3V8TA 1NXKA 5AP4A 4KINA 4FIJA 3OCBA 4FV5A 3ZZEA 5CSVA 2G15A 4BTJA 3NYNA 3TNWA 4N6YA 3JUHA 5D7AA 3LLTA 5BYZA 3OP5A 4OAVB 2CKPA 4RT7A 2OO8X 4RGJA 2UZOA 3FLYA 4YC6A 3UG2A 3MPAA 4PRJA 4GIIA 2PUUA 4FIHA 2R3PA 4G6NA 4DBNA 1PHKA 3FSKA 1YOJA 2EU9A 3HGKA 5ICPA 4FZDB 5M44A 4M67A 2W96B 4BBMA 2FSTX 1GZ8A 2BKKA 3R8VA 3R22A 4TYHA 2BRMA 3R63A 4PNKA 5JSMA 4ORKA 4BI0A 2X7FA 5JK3A 4GU6A 5ETFA 5TT7A 3NAYA 1WCCA 3IW8A 3ENMA 4YTCA 4FMQA 3IW5A 4QMTA 1OITA 5KE0A 1W0XC 2ERZE 4ZS4A 4LV5A 2YM3A 3IW4A 3QKMA 5D41A 3I5NA 3II5A 3C13A 3JVRA 4G3FA 3RCJA 4D4VA 1WFCA 4UB7A 2BIKB 3TV6A 4DFNA 4KRDA 2Y4IC 4BFMA 5CSPA 2HENA 2W05A 4ZXTA 1JBPE 3QA8A 2X2KA 3MWUA 2V0DA 3DAJA 3MVJA 5DA3A 2UVZA 3ZYAA 4UYAA 4XRLA 5FEQA 1R0PA 2OLCA 4BB4A 3EFWA 2QOBA 1TQMA 3R9HA 4F64A 4R77A 2HW6A 4BY9E 2JKMA 4I6QA 4P90A 1SNXA 2XK6A 1H1RA 3P7BA 5TE0A 5DVRA 1OIRA 4A07A 4FKVA 4O7TA 2C5XA 3LJ1A 3N9XA 4PUZA 5I3RA 2CGVA 3QXPA 4BYJA 5JKGA 1UWJA 4NUSA 3V5LA 2KULA 3HA8A 5IUGA 4YPSA 3EHAA 4WSQA 1HOWA 3LCKA 2Y8OA 5EG3A 5HCYA 2OSCA 3U8WA 4UYNA 4DYMA 2VTHA 3MVLA 5KBQA 2JAMA 4Z9LA 4D5HA 4TZRA 2A2AA 4O0TA 4F0GA 3GU8A 1YWRA 4KSQA 2EXMA 4ANLA 5I9WA 5B2LA 3LMGA 4YZNA 3WBLA 3H10A 2A19B 1APME 3IGOA 4IHPA 1DAWA 2YDKA 5LCKA 1GY3A 4RBLA 5CU6A 4IW0A 4L8MA 3E8DA 5B7VA 1YXXA 2W4OA 3R9RA 4CQGA 2VRXA 3KY2A 1CKIA 4H3PA 5T68A 4DFZE 4YJOA 3VUDA 5IA0A 4YP8A 3AD6A 2IVVA 3ORMA 5HNGA 3TZ7A 1STCE 3QYZA 2W1IA 4X6QC 4IZYA 4E93A 4Y85A 3TG1A 3VW6A 1PXIA 1SVHA 3ITZA 4U0IA 3MY5A 4DH1A 2V7AA 2WKMA 3BHHA 3BV2A 3FXWA 1CKJA 4IC8A 3VRYA 1UU8A 4I5MA 3DA6A 5CU4A 3D94A 5IDNA 4RIYB 3W10A 3BLHA 4IAAA 4QQ5A 2JIUA 3EZRA 5J5SA 5CXHA 2VGPA 2WU6A 2ETRA 2FYSA 4AN3A 1OKZA 5AAFA 3OTVA 3FI2A 3MJ2A 3FMEA 4OBPA 3GFEA 1YOMA 2OXYA 4BCIA 2ZM1A 4W9XA 5I9VA 4GT3A 1QCFA 4IIRA 4ZTLA 4G2FA 5KHXA 3H9OA 1OL6A 1XR1A 5AFVA 3MIAA 4MXYA 4ALVA 3RPVA 3TL8A 2ACXA 3OCGA 2VTRA 5HX6A 5CQWA 5KKRB 3C5IA 4BCPA 3GU7A 5ANIA 5E8YA 1WBOA 5CEOA 5JGBA 1F5QA 4ZLZA 3BCEA 4ZTQA 1REKA 4GVJA 4D4RA 2E9VA 5JEBA 3RMFA 2GNHA 4M15A 4AWIA 4RVTA 2J90A 2P2HA 2YERA 3NUYA 4RVLA 4YZCA 4EL9A 5M09A 4PPAA 2YN8A 4O0WA 3SOAA 4RFMA 3W2OA 4IH8A 3CPBA 3QUDA 1SMHA 3UGCA 1PXKA 2UZLA 3ANQA 4FKRA 5B0XA 3CTHA 4ZOGA 4C57A 4O96A 1Q61A 3CKXA 4HYHA 4H36A 3OW3A 2UZDA 3H9RA 3ZSIA 5HVKA 3BHYA 4HPUE 3ZXZA 4I22A 2YJSA 3R8MA 3RAIA 3EN5A 2G01A 1GIJA 3DQWA 1R1WA 4CTCA 4K33A 3V04A 3D5UA 3ZEPA 2WOUA 2R4BA 1OM1A 2VWBA 3KRXA 1YDRE 2XIYA 4FODA 4FVRA 1UA2A 4PDOA 3Q4CA 2BTRA 2PWLA 4HVIA 2BRHA 2XJ1A 5L2WA 1PKGA 4JDKA 3ZUTA 2HZIA 4D2PA 3TJCA 4E1ZA 5JT2A 1XH8A 3C51A 1OI9A 4XG7A 3TUDA 2IWIA 3KGAA 2YCQA 3GENA 5D7VA 2OU7A 3L8XA 3WZUA 5L4QA 5DEYA 5A4TA 4JDIA 2OK1A 4EH7A 2WTDA 3WOWA 4G5PA 2JDSA 3R1QA 2GS6A 3QUPA 3ZUVA 4E6QA 4D1XA 4O7ZA 4G6OA 3WIKA 3UPZA 3TT0A 3CJFA 5H8BA 4JBOA 3QX4A 4CSVA 3TNHA 3KF4A 2CLQA 2ZVAA 2O65A 3SXSA 3UIUA 1FGKA 2X4ZA 3LXNA 1OKWA 4BN1A 5L3AA 3LMIA 4L42A 4LV8A 5CENA 4V05A 4FKOA 1M7QA 3K2LA 3GBZA 3G6GA 4BDEA 4RIWA 5L2SA 3FC1X 1Q3DA 3LJ0A 2C6IA 4YLJA 4FZFB 4V0GB 3WF7A 2WNTA 3CY3A 5LVNA 3BZ3A 3NYXA 3I6WA 5HO6A 4GS6A 4FTAA 3ZM4A 4LGHA 3KXGA 2ONLA 4WA9A 4KIQA 5KMJA 3QQKA 3QTIA 1B39A 3D9VA 5CF4A 4YHJA 3GNIB 3P4KA 4JRVA 1NY3A 3VULA 3OF0A 3PXKA 3PIYA 4DH7A 3GEQA 1JSUA 5BUJA 3UNKA 2JC6A 2UUEA 2XRUA 4BGGA 3OBJA 1SYKA 1YVJA 3M11A 5ETAA 4UN0C 3VQUA 4TKSA 1PJKA 3FXZA 3TACA 1YI6A 4FTIA 1J91A 3S95A 3LFCA 3R1YA 3UOKA 1F0QA 2C6OA 2ITTA 3D15A 2YIXA 2ZDTA 3EN4A 3F61A 4FBXA 2R3IA 4USEA 4A9UA 4PY1A 4NT4A 1YW2A 3OWLA 4KBCA 4KS8A 2XVDA 4RPVA 4ITJA 3AMYA 5IQGA 3C5UA 3AQVA 4MD9E 2XKEA 2XIKA 2PZ5A 3MA6A 2WIPA 3HRFA 4AFJA 2FA2A 2R0IA 5CEIA 4F63A 2CKQA 3PLAE 3SDJA 2BFXA 1H28A 3ET7A 4GT5A 4QRCA 4YNOA 3TZ9A 4H39A 4ZSAA 3ZC5A 3C4XA 4FNZA 3VNTA 3UMWA 3ID6C 2IW6A 4MNEB 4CXAA 3GCQA 4FV7A 3NUPA 4O38A 4IQ6A 4UMQA 2VU3A 5CT7A 1CTPE 2C5OA 4C4EA 3UJGA 4JG6A 1MUOA 5FDPA 1MQBA 2CN5A 3UVPA 2JDOA 4XNEA 2VTOA 3KC3A 2EB2A 2JGZA 2XNEA 4EH8A 1PF8A 3D2IA 3PZHA 4GYGA 3TUCA 4JIKA 1OIQA 4QP8A 4J95A 4ERKA 1OPKA 4HCUA 3BBWA 4Y8DA 4U7ZA 5AV3A 5A54A 4B0GA 1Y91A 5I4NA 3ZLSA 2BDJA 2YDJA 4IAYA 4AGDA 3IDCA 5AA9A 2VTJA 5HESA 4J53A 4DAWA 3MFRA 3S0OA 4RJ7A 4BDAA 5KHWA 4X3JA 5JFVA 2QR7A 3VW8A 2R0UA 4I3ZA 1LEZA 3VBQA 2ITZA 1R78A 2WMAA 3G9LX 4JRNA 4J97A 3UZPA 3VBWA 4QMXA 4XV3A 2JIVA 3AC4A 4RG0A 4BDGA 2C3LA 3UIMA 3COKA 3S4QA 3NIZA 2ZM4A 3QWKA 3ATTA 4FNXA 4MX9A 3E63A 2YAAA 4RA4A 4W4WA 1LR4A 4MF1A 1ZYSA 5AP3A 5HHWA 3HA6A 1BI7A 1UNHA 2YITA 3ORIA 3Q4TA 2UVXA 3R28A 4QNYA 5F9EA 4OT5A 3FKNA 4W4XA 3HDMA 3K5VA 4AUAA 5EYCA 1O9UA 3KREA 4XH6A 3NNVA 3QTQA 4L44A 3G0EA 3QGYA 4BZOA 3SQQA 2ETKA 5CF8A 3DCVA 4QYHA 4AOIA 3IGGA 2I7QA 4KB8A 3FMJA 4AZEA 2C6KA 4FEUA 5GZAA 3EB0A 2PSQA 5E1SA 3C0IA 4JG7A 2XKDA 4AW1A 2PVHA 3DFAA 4HCTA 3MY1A 4J99A 4U79A 2RFDA 4NWMA 2OH4A 5CNOA 3U4WA 4U9AA 3O96A 3QAME 4IM0A 5ANJA 3Q60A 4YJSA 2R7IA 3EYHA 1JAMA 4L3JA 2GNIA 3W1FA 4QP1A 4RSSA 1UVRA 3C4FA 5EDQA 2JKKA 4CQEA 5IKWA 3GXLA 1GAGA 4U43A 3ZBXA 1DI9A 3GU6A 5HG8A 2R3LA 4GUBA 4WD5A 1Q3WA 3OOGA 3G51A 4DEGA 1KSWA 2BRGA 3R01A 4TYHB 2UV2A 2WMSA 3R7YA 3QC4A 1ZXEA 4EH5A 3LCTA 3HUBA 3HAVA 3ORPA 4YHFA 4D0XA 2VO7A 5FLFA 3S3IA 4AT4A 3F3VA 3P1AA 2BILB 3FYKX 5D12A 3MVMA 2ITXA 3DZOA 2OW3A 5CEPA 5ACBC 2XNOA 2RFNA 3PWDA 2BVAA 4C61A 3PA5A 4HOKA 3VO3A 2Z7SA 5BQ0A 3G9NA 3C0HA 3NYVA 4IDTA 3KK8A 4NCTC 3U51A 1W7HA 4QMZA 3VQHA 1JLUE 1LUFA 3NRMA 3FL4A 2WGJA 4TRLA 5IA1A 3DKFA 2XEYA 4OBQA 4XYFA 4EH4A 4PTGA 5EOBA 4BCQA 4F1MA 1L3RE 5DRDA 2G2HA 4M13A 3BHUA 3E7VA 4FC0A 4BCGA 4OLIA 5TF9A 2CHLA 4BKZA 4JAJA 2H96A 3FLSA 2OWBA 4HVDA 1PXLA 3M42A 5DWRA 5A4QA 3P23A 4JT3A 4X2JA 4CG8A 4JIAA 3ZFXA 2QI8A 4R5SA 2ESMA 5IUIA 4KIKA 4D28A 3KXXA 2ZV9A 3Q9YA 4F09A 1FMKA 4IFCA 4P5ZA 3KB7A 3BHVA 2VAGA 1ZYJA 3CP9A 4BF2A 4EH9A 2XKCA 4IMYA 4I5PA 2VZ6A 2OICA 2UW5A 3RALA 4L52A 2OH0E 4BTKA 4CV8A 3Q32A 2H6DA 4FV1A 2A4LA 2VTSA 4F9CA 2BUJA 1QL6A 2V62A 1Q5KA 5FXQA 3F69A 3DBCA 3G15A 2P3GX 4QYEA 3CIKA 4LRJA 4Y5HA 4JBVA 2W5AA 4ZTNA 3U87A 4R3CA 4EH6A 4AP7A 3VAPA 3OCTA 3DS6A 5T6KA 4IM3A 4CZUA 4FL3A 2RF9A 3ORLA 5EK7A 2CGXA 5EFQA 4F9WA 4CG9A 4M14A 2QKWB 2IZSA 5LMKA 3PVWA 4GEOA 5FXSA 3ATSA 3EFJA 4NTSA 3E8EA 4IB3A 2ITOA 2OJGA 3ALNA 2C1BA 3FZRA 3QQJA 3Q2MA 4QYYA 4BHNA 3COHA 3TN8A 1W8CA 3BI6A 2XS0A 3ORXA 3ORTA 4EQCA 1CM8A 3NUNA 1LEWA 5CAQA 2VTTA 4D2WA 4O1OA 4AQCA 4FSQA 2W9FB 4R3PA 2QHNA 4BZNA 3UE4A 2GHMA 2YHVA 4TN6A 5C8NA 4QTEA 3A7HA 5M07A 2EUFB 2CKOA 4M69A 4I23A 5HLNA 2R3FA
chains in the Genus database with same CATH superfamily
4FV0A 3HMIA 4ASXA 5FG8A 3KEXA 4YJRA 1UV5A 1ZYDA 2C6TA 3Q53A 4MK0A 4PTCA 4G31A 4MCVA 4ZIMA 3BLRA 3RJCA 1OL1A 3C1XA 2XK3A 4I0SA 3VC4A 3P78A 2UVYA 3FE3A 3L9LA 1HCKA 2ZDUA 1ST4A 3O7LB 1XMMA 5KO1A 2RKUA 2AQXA 1BYGA 2J2IB 2BPMA 3OS3A 4H1JA 4KWPA 3ZMMA 3MB7A 4BDIA 5I5ZA 3DXPA 5HG9A 2X1NA 4L3LA 4C62A 5CEKA 3NYOA 4H05A 5HKMA 2OZOA 5J87A 3DLZA 4LUDA 3JR1A 3P7CA 3MB6A 4ARKA 3MJ1A 4FTOA 1H1PA 2GHLA 4RJ5A 4YLLA 5IQBA 4A7CA 2QOLA 4DA5A 3SW7A 3EL8A 2NPQA 3QQHA 2VNYA 3V8SA 2VTQA 2DS1A 4IJ9A 4EHGA 3DJ6A 3OWKA 4YJNA 5AV2A 1P14A 5M51A 4EKLA 4LL0A 5L2IA 4IWQA 2BZJA 4ZSEA 4CRLA 3LQ8A 2H8HA 3BU3A 4WNOA 3VS7A 4ZMEA 2W0JA 3HYHA 1OIYA 4D5KA 3HMMA 3OT8A 5AUVA 4E4NA 4C2WA 4FV9A 4D2TA 2X0QA 3S1HA 2C3KA 1JOWB 3NIEA 3ZO2A 2PMLX 2DQ7X 3UODA 4ANNA 3BHTA 3SA0A 4GL9A 4IAFA 3ZCLA 4Q5EA 2Y6MA 5AR2A 4J8NA 5FXRA 3AKKA 3NVMB 2CGWA 4MH7A 4C38A 1YWVA 2B1PA 1VR2A 3HECA 2HZ4A 4FSYA 3BLQA 4JBQA 1WVXA 2G2IA 4FEQA 4FUXA 4IVCA 5M57A 3E88A 3LCOA 1ZZLA 3ZTXA 3NNXA 3F6XA 4BCOA 4LRKA 4O83A 5DMZA 4C7TA 3UZRA 4DHIB 5BVKA 1KV2A 1JSVA 3HRCA 3QD3A 3LLAA 3FPQA 2WQEA 4IWDA 5HIEA 4FOCA 4RIWB 4EKKA 1MQ4A 3ENHA 1ZMWA 3DBDA 4ZTHA 1M2RA 2O8YA 3I1AA 4I93A 2HIWA 3QZHA 2UZVA 3A60A 1XKKA 3LXKA 1G8JA 4BZDA 4MKCA 5LARA 1YHVA 5IEYA 4ZY6A 4AOJA 1QPDA 4XP0A 3ELJA 3IDPA 3W2CA 1PY5A 2R3NA 4C36A 1ZY4A 2BDFA 1YKRA 4IZ7A 3U6JA 4O1PA 2X6DA 5GHVA 4ZTSA 3VUGA 4BI1A 1J7LA 4C8BA 3THBA 2J51A 3RINA 2WQOA 5FM3A 2PUIA 1WZYA 4NKAA 5HLPA 4FK6A 4YPDA 3R0TA 4KUJA 1GZKA 2XALA 2QOQA 3HV4A 4O4DA 1Q97A 5LCJA 3RBWA 4GMYA 4KKHA 4ZZMA 1AD5A 2W1GA 3K5UA 3P79A 4F7NA 1S9IA 5HE0A 4MXCA 4WG4A 4F9BA 4XS2A 5IA2A 3NCZA 3TDWA 1LPUA 5CEQA 2B0QA 4EYMA 3KQ7A 2QOHA 2VNWA 4JLCA 3I7BA 4IX4A 4O0XA 4QPMA 3RGFA 4BVUA 4O0VA 2PVKA 2YIYA 3BU6A 3O2MA 3C9WA 4FIFA 3EKKA 1U46A 4PV0A 4BRXA 4FSUA 4AA5A 4S32A 3PA3A 4KAOA 3WIGA 2Y6OA 3RWQA 2AC5A 3MA3A 5I3OA 4CCUA 4F1OA 3NAXA 1KE6A 4N4SA 1ZYLA 4EQUA 4K9YA 4O91A 3TKHA 2W1DA 3V3VA 3N4UA 5AP7A 5EHLA 3MVHA 4O6LA 3E3PA 5E8TA 5CQUA 4D55A 4FOBA 4GSBA 2A0CX 3UYTA 4CVAA 3W16A 3RP9A 2QLUA 2YWPA 4DEDA 5IDPA 4BIBA 5IUHA 3DBFA 5AUYA 1X8BA 4AW0A 4HGTA 4L68A 4BDHA 3NPCA 4CV9A 4LOQA 3ML1A 4A9YA 2UW0A 4XV2A 4TWCA 3RAWA 4CT2A 4CMTA 5KUPA 1OPJA 4BC6A 4EK4A 2OZAA 3RAHA 3VUMA 3HZTA 3PPJA 4EZ5A 4OTPA 1OUYA 3F5GA 4NM7A 2R9SA 3RK9A 2EVAA 3DZQA 5CAPA 5BVFA 4BICA 4NFNA 1U54A 5EM6A 2PU8A 4F6WA 2Z7QA 4J52A 2BKZA 4YTIA 1XO2B 5IPJA 4KSPA 2PVNA 3K54A 5AX9A 3EQRA 4NL0A 3JXWA 2PUNA 3UOJA 1H0WA 1FPUA 3BELA 3CTJA 5GNKA 2YZLA 4QMVA 5CAUA 4QEBA 2B54A 4L53A 3I4BA 5CANA 2JITA 1J7IA 3FJQE 4IVBA 3ORKA 4U42A 4J71A 3VRZA 3GGFA 4X3FC 4YBJA 3LQ5A 3B2WA 2UZTA 3UVQA 3W0QA 3ZZWA 3KA0A 3CC6A 3KRRA 1G8KA 3VHEA 2PE0A 3KRWA 3GU5A 3AMBA 4OUCA 2HXQA 1TZDA 4O0UA 1Y6BA 1H0VA 4K2RA 4D2RA 3LFDA 4ALWA 3NFGB 4EOMA 4FA2A 2XIZA 4ACMA 2B9JA 4E4MA 2HXLA 2BZIB 2GCDA 5K3YA 4AGUA 4PMPA 4O82A 1JKTA 3IPHA 4RLLA 2PMOX 3KVXA 3TI1A 4AT5A 1WAKA 2VWIA 3CGOA 4USDA 5H8EA 4HPTE 4JJRA 5AADA 4WO5A 2GFSA 5EM7A 2R3JA 2CNUA 5AR5A 3AOXA 3D7TA 3W0OA 4FTQA 4YR8A 2QNJA 2BZKB 2GHGA 3GFWA 3PXRA 4WHZA 3B2TA 3PIXA 3O23A 4AA0A 1XBBA 5BVNA 1IR3A 5IG1A 3NUAA 1PYEA 2BR1A 3KIOC 4UZHA 2X8DA 4W4YA 3REPA 4D2SA 4G34A 1HCLA 2WB8A 3HUCA 3W8LA 5JQ8A 4H3QA 3IS5A 3RCDA 5K0KA 1OZ1A 2GPHA 4G9CA 1V0PA 3QC9A 2BFYA 4KS7A 2V55A 2YM7A 4RX7A 3TWJA 4HZRA 3R1NA 2YLFA 4QMOA 4CYJA 4F9YA 1BMKA 3R8UA 4CFMA 4M0YA 2RG5A 4FYNA 3P86A 3SX9A 4WG5A 2YFXA 3S00A 5IH6A 5IH4A 2VTLA 5F94A 3DPKA 4JNWA 4QMYA 4FKSA 4J1RA 3RI1A 3UOLA 4AZSA 2B7AA 2CCHA 4MYGA 2UZBA 5D10A 5EDPA 3QZIA 3ZRMA 2VWWA 5DR9A 3F3ZA 2PMNX 4FT7A 4RWLA 3ZO3A 4EC9A 5LOHA 2XK4A 2GQRA 1PMVA 3HX4A 5FGKA 4IB5A 5DEWA 3R9DA 4AFEA 4XG3A 2J5FA 3F82A 2GU8A 4KIKB 2WQMA 3NGAA 4FUYA 4G5JA 3TXOA 4ZAUA 3P5KA 3HAMA 3CD3A 2WHBA 4EJ7A 3PFQA 3D0EA 5HU9A 2VWUA 3I0QA 3U9NA 4L01A 1G3NA 4QNAA 3FY0A 5E92A 1IRKA 4FTRA 3V6SA 4EOKA 4DFBA 4DT9A 3AKLA 3CJGA 2WU7A 3ANRA 3VBVA 1YQJA 4U5JA 2VTMA 4XRJA 3NW7A 5A4EA 4QP9A 1I09A 2WEVA 3TZ8A 4CFUA 3PG1A 3LQ3A 1GIIA 2OIDA 4NW6A 2UW3A 4PPCA 1P4OA 3F88A 3QWJA 4QPAA 3P08A 3VF9A 4Z7GA 3OY3A 3PIZA 2WMUA 1DM2A 4ZP5A 3TEIA 3TTJA 1KE8A 3RHKA 4EWQA 4PMSA 1WBPA 3Q9XA 4FI1A 4JMQA 5IQIA 4RQKA 3LIJA 3SC1A 4QMNA 2HWPA 3MH3A 2UW9A 2YM8A 3PPZA 1EH4A 3HNGA 5C1QB 4L46A 4RWJA 5AR8A 5ANDA 5J7HA 4KIOA 1RW8A 2F9GA 2X7GA 2IZUA 5AA8A 4YZ9A 5BVDA 5HD7A 3DAKA 3BBTB 4XP2A 5EH0A 3LCSA 1YWNA 1KV1A 5H2UA 4DG2E 4C3PA 5A3XA 3TUBA 3R00A 2XNMA 2ZMDA 4F78A 4KRCA 4M0ZA 3N4TA 3QFVA 4NK9A 4FX3A 4AW2A 5JH6A 4MBJA 4CNHA 5LVOA 1XJDA 2YIRA 2F4JA 4U3YA 5HIDA 4M69B 5ANKA 4UXQA 2ZV8A 3I6UA 4HJOA 4R5YA 4X7QA 5HCXA 3VBYA 4LMUA 5DI1A 1KOBA 4OGRA 3MS9A 2YABA 2W4JA 3PJ8A 1Z5MA 4Q9SA 4AN9A 4OTQA 3FUPA 5HG7A 2VWVA 1JSTA 5AUWA 1XHAA 3MYGA 3OW4A 4NFMA 4QO9A 3V51A 5HNIX 3QUEA 4IANA 3R1SA 3UO4A 5EW3A 4O2PA 2W1ZA 5DT4A 4EONA 5IQDA 3CD8A 3FZTA 4M3QA 1H07A 1Z57A 3NLBA 1Z9XA 1GZOA 2BTSA 3AT4A 3KU2A 4RJ8A 3F66A 3R2YA 4LRMA 2NO3A 1CSNA 3Q04A 3OVVA 5CI7A 2QODA 3RNYA 5HICA 4DFYA 5E8UA 3VVHA 3LJ2A 2V7OA 3DAEA 4C0TA 3JY9A 2V22A 4G3GA 4QMMA 3FDNA 1M2QA 2I6LA 3UDZA 4QMQA 5JMSA 2XK9A 5F4NA 3VS4A 5B2KA 4AACA 2B9IA 4TNBA 4F9AA 5E8XA 5J8IA 4XLIA 2WXVA 3RHXA 4WSYA 4JDHA 5CVHA 4OTGA 3KXZA 5I9YA 5D9HA 4BKJA 3PY0A 2BAQA 5JFXA 3I60A 5CALA 3F2RA 3PJ3A 4FEVA 4BDJA 4O0YA 4E4LA 4LM5A 2P2IA 2WO6A 4EOSA 3OWJA 3PLSA 4MXAA 3PA4A 2HY81 2PULA 3PWYA 3N51A 1CKPA 5AUTA 2EXCX 5AUUA 2VV9A 5L6PA 1PMEA 4TY1A 3BL9A 2ZYBA 4MWHA 4YLKA 5C03A 3JVSA 3NCGA 3UOHA 2PVRA 5HVYA 2GNLA 3CEKA 3FZPA 2VN9A 2CDZA 2GQGA 3AXWA 3SRVA 2YJRA 4IDVA 3E62A 2P4IA 1WBWA 3KXHA 4R1YA 4X6RA 1T45A 2CJMA 3BLAA 4O7YA 4D1ZA 4NEUA 5C9CA 4U3ZA 3TIZA 1T46A 4A9RA 3SG9A 5HORA 3MN3A 3B8QA 3BEGA 4C4HA 1AQ1A 3UPXA 3OT3A 3W0RA 4DBXA 3PP0A 2GS7A 3QGWA 2F57A 5DGZA 3PUPA 4O7RA 1VEBA 3MH2A 4XV1A 3GUBA 5CSXA 3OWPA 4JVGA 3DKGA 2CPKE 3IW7A 3V5PA 1UKIA 2W5HA 3QQLA 3NR9A 2IF8A 3GCVA 4FTNA 3RPRA 4CFNA 5CWZA 5I9ZA 1WBVA 3HEGA 3NZ0A 5F20A 1IAHA 3FLWA 4N6ZA 2JBPA 2BCJA 2WOTA 3UDBA 3K3IA 5IQAA 3JYAA 3A99A 5AIRA 4WRSA 5EM5A 3C4WA 3UIXA 2W1HA 3LCDA 3VUTA 1XMLA 2F2UA 2VO3A 1ATPE 2CKEA 3KFAA 4R3RA 4XLVA 5IA3A 2W9ZB 4FIEA 3S2PA 1UNGA 2XZSA 3VS0A 4X2GA 4ZSGA 5FTQA 2HWOA 5K5XA 4BCFA 3UZTA 3PE1A 4HVSA 4DDGA 2X8IA 4CLIA 2JAVA 3F5UA 3QTZA 1CMKE 3VUHA 5JQ5A 4MBLA 4QTBA 3FQSA 3ALOA 3HMNA 5LWMA 3FQHA 1E9HA 2I0YA 3MY0A 4RWIA 4DTAA 3GC8A 1ST0A 3Q6WA 4XX9A 3FMKA 3HL7A 4YBKA 5FEEA 3PSBA 2P0CA 1VYZA 5ANEA 3A61A 2OFVA 2JKOA 4JX3A 3BEAA 4W8DA 4AGWA 5M53A 3EOCA 3IDBA 1H27A 2XYUA 2R7BA 1KOAA 4XUFA 3PE2A 1WBNA 4FL1A 3POOA 4WG3A 3EN7A 4AAAA 5JGDA 4I92A 2ZV7A 1W84A 2WD1A 4E4XA 5J5TA 4C59A 3JPVA 4E20A 1NW1A 2QOOA 3NDMA 4NSTA 4XOYA 3BX5A 4BYIA 4IX6A 3H0YA 5HX8A 2H9VA 2HZNA 4E5BA 4ANBA 3TDVA 4NYEA 3RZFA 3R73A 4TPTA 5HLWA 4LGDA 2RL5A 3ULZA 3R21A 5A6NA 2O63A 4UMPA 3D5WA 5G1XA 2OZAB 3NW5A 4Y46A 2IVTA 5EHYA 3OTUA 4E5WA 4WRGA 4L7FA 4OTWA 3F3TA 3GOKA 4AXFA 5H3QA 3KXMA 4Y83A 1QMZA 2PVYA 2PZIA 3QCYA 1OPLA 3SAYA 4CMUA 5EOLA 1U54B 4Z7HA 2UZWE 4MXXA 1CDKA 3L9MA 3A7FA 4L00A 2J9MA 1P5EA 2BDWA 5KNJA 5LXMA 2XK8A 2ZAZA 4LMNA 5AMNA 5K5NA 3EMGA 2EB3A 2I0VA 4Q5HA 2HCKA 4JS8A 4BWKA 4RRVA 2F7ZE 4UZDA 1JKLA 4N70A 3DJ7A 3KVWA 3ZO1A 3QTRA 4YU2A 2PMIA 2FSLX 4GFOA 1B6CB 4YO6A 4B4LA 3BL7A 4DCAA 2J0LA 2O2UA 5CX9A 5CAOA 4UWYA 3DY7A 2OGVA 2WPAA 5EDRA 5CYIA 3GU4A 3Q6UA 4YGAA 3ZEWA 5HBJA 3EQHA 3LVPA 5AJQA 3FMMA 4CEGA 4PF4A 3G0FA 3QD2B 3H4JA 3Q5ZA 4ZEGA 4PDYA 1JQHA 3KULA 4M68A 3PVBA 4EOQA 3DV3A 4F0IA 4ACCA 5HG5A 3EL7A 4FKWA 4CKRA 2QR8A 2C6EA 4L67A 3WI6A 2JDVA 3TKUA 3MH1A 2W5BA 4RZVA 4JL9A 2PVLA 2X9FA 4OTHA 5KKRC 3CSVA 5H9BA 3D7TB 4KBAA 4LDTA 4K1BA 3HLLA 3KF7A 4DEIA 3DT1A 5HBHA 1M52A 2WTKB 4L6QA 4WOVA 4EC8A 2NRUA 2QU5A 4GJ2A 5KMKA 5C01A 2CNQA 2WQNA 2QHMA 1FMOE 3BE9A 3DQXA 3O0GA 2B55A 4TWNA 3TTIA 5IF1A 1H00A 1Q8WA 4PMMA 3HP5A 2X7OA 4QTCA 4O27B 4U45A 4IBMA 3A2CA 3ZONA 2P33A 4NW5A 5KMOA 2XCHA 4GG7A 4C3RA 4MTAA 3V5TA 3FI8A 4I6LA 2W17A 2IPXA 3VS2A 1BI8A 3HV3A 4I0RA 4CD0A 1J1CA 5HD4A 4ZZOA 3R30A 3R9NA 3RNIA 2P55A 2VGOA 4AZFA 2JBOA 3W33A 3ZRKA 3FHIA 2XK7A 2BRNA 3BWFA 5BX0A 2GNGA 2QG5A 3L8SA 1OMWA 3OUKA 5FTOA 4ZJIA 5C4KA 1QPEA 4U97A 5GJDA 5HE1A 4S33A 2J0JA 1UU9A 4FKUA 2C69A 4I41A 3EQDA 4GK4A 3PG3A 3IK3A 4FEXA 1FVTA 3SKCA 2X39A 2PUPA 5CZHA 4QMUA 1W98A 3AGMA 1U5QA 5ETCA 3DTCA 4O7SA 4JDJA 4R7IA 4P7EA 3O50A 3E92A 2GQSA 3FYJX 2DWBA 5CNNA 5EYKA 2R3QA 4F7SA 2WTVA 1Q8ZA 4GT4A 3Q3BA 4AE6A 4DITA 4YMJA 5CF6A 3DDPA 3R02A 5E8ZA 2Z2WA 3NW6A 5LVLA 3ZXTA 3A62A 4M97A 4W4VA 3RPSA 4YURA 3UQCA 4U44A 3QX2A 4OTFA 2RFEA 3VUKA 5FP5A 4DEAA 4KD1A 3VIDA 4C4IA 3W32A 4C37A 4QTDA 4FV4A 5L2TA 5CSHA 4I4EA 4EOLA 3UBDA 4M7IA 2R3MA 2C3JA 4DG0E 5CXZA 2HZ0A 1NVSA 4FSRA 5AIKA 4DG3E 5HVJA 3UVRA 3ZBFA 3PTGA 5EW8A 3OG7A 4S2ZA 3QLGA 1WMKA 5TOZA 4MQ1A 3F3WA 5M06A 2E2BA 4IC7A 4TL0A 2BALA 2WZJA 4A06A 1YI3A 2QU6A 2QOCA 3BYOA 4FR4A 4IXPA 4MF0A 2ITPA 5K9IA 1Q62A 4FT9A 4NM0A 4HYSA 2ITUA 2HK5A 3EFLA 1O6YA 3A4OX 2JDRA 5K0XA 1V0BA 1S9JA 1ZAOA 1J7UA 4O7VA 4ZY5A 5I0BA 4HYUA 5DG5A 3LW0A 3R83A 5LWNA 4OTRA 4IACA 1ZYCA 4EUTA 4GRBA 4O7WA 5EQYA 2IZTA 5L8KA 4BDKA 2GNFA 5GZ9A 3TIYA 4NTTA 2J0IA 5D1JA 5JZJA 5E8SA 2UZNA 3PVUA 4JX7A 1O6KA 4L9IA 5AP6A 3R8ZA 2ZV2A 4PMTA 4V01A 3VWAA 2BAJA 4R78A 4X2NA 4ASZA 1WVYA 3DLSA 4GW8A 1P2AA 5HTIA 3DNEA 2E9UA 4EH2A 2BROA 4C2VA 3MSSA 3SOCA 1AGWA 4RLKA 3V6RA 4O22A 4I6HA 3PJ2A 4RX5A 2JD5A 4RX9A 1PRYA 1XWSA 1M7NA 4I4FA 2X9EA 2BIYA 1Q41A 3UP2A 3LHJA 4KKEA 4EHZA 3BQCA 2IVSA 2ITQA 2WELA 3IQ7A 5DRBA 4BDCA 5FEDA 4EHVA 4CRSA 2JKQA 2VD5A 4AU8A 4TYGA 3W2RA 2Z8CA 1IA9A 4B9DA 3QTUA 3CGFA 3Q96A 4OT6A 4YC3A 1Y8GA 4CFFA 3SLSA 1MP8A 4PL4A 2F7XE 2WMTA 1BL6A 3AC1A 2REIA 5KMIA 5C4LA 4NCTA 5DR2A 4PP9A 1YI4A 3SW4A 5CS6A 4DTBA 4J7BA 2Y4IB 3QQFA 3FKOA 4ANOA 2YEXA 4Y72A 3R6XA 4ZJVA 4W8EA 4UXLA 2PE1A 1OKYA 3GB2A 1OGUA 4YNEA 4FVPA 4LGGA 1ZOGA 4YTHA 3ZC6A 2RIOA 3R7GA 4MD8E 4BCKA 4YO4A 3GC9A 5CSWA 5B2MA 4XHKB 3MPMA 4CFXA 1PYXA 1KWPA 4BTMA 1FQ1B 2YCFA 1R39A 4DGMA 3CKWA 5JGAA 3Q2JA 2SRCA 3H30A 5CI6A 4DGNA 1UU7A 3A4PA 5BNJA 3W55A 4CFWA 3KXNA 5A14A 5IH5A 5DPVA 3SRVB 3ZSHA 4G3CA 3LFFA 4DH8A 1U59A 2BRBA 4Y73A 4ZJJA 4NKSA 4BCJA 4CZYB 5JRQA 5LVPA 1ZARA 3C4EA 3WE8A 1P4FA 1XH6A 2FVDA 4NJ3A 3P0MA 4RZWA 4UWBA 3WYXA 2QLQA 4C58A 3R8LA 4ENYA 5K4JA 3IO7A 4X0MA 2CSNA 5FBNC 3MI9A 4N0SA 5J1VA 4I94A 5DOSA 5EHOA 2VTNA 4BDBA 4HGEA 2WMWA 4U41A 4L7SA 5FDXA 4O81A 4PTEA 5EM8A 3CBLA 5M4FA 4XMOA 3VS6A 1DS5A 3FBVA 1W82A 3CPCA 3HKOA 3D83A 3DBEA 3MPTA 4UMTA 4ASEA 3P9JA 2CLXA 4O0RA 4HGSA 1WBSA 3A8XA 3WARA 4G6LA 4UALA 2Q83A 2G1TA 3QCQA 4UV0A 2FO0A 3SV0A 4GKHA 2UW6A 1OBDA 3WF5A 3GP0A 2XAOA 1YXVA 3OY1A 5AUZA 1ZMUA 3I5ZA 3ZH8A 3QA0A 4G3EA 2R3OA 4F6SA 5J1WA 3QU0A 3QQUA 4QQJA 4QMLA 3U55A 3E8NA 2B9FA 3F3UA 4QP3A 3M1SA 4F7JA 4P2KA 1OGYA 4LV7A 4QQCA 1MRUA 4NH1A 4FVQA 3SXFA 1XH4A 3BPRA 4DN5A 4GH2A 5J9LA 5DR6A 3LM5A 1PMNA 4DC2A 2LAVA 2PVJA 3ZRLA 3QTSA 3BU5A 3NUXA 2QO9A 2YZAA 4RX8A 1BX6A 3KCKA 2UW7A 4LUEA 2YISA 2OF2A 3GT8A 2C5VA 4RVKA 4PL3A 3CE3A 3PZEA 4MWIA 4RFZA 4S34A 3FWQA 2X0GA 4DDIA 1OL5A 2UW8A 5FUTA 2WIHA 4D4YA 3L1SA 3AMAA 3PY1A 1ERKA 2YM6A 3WZDA 2XH5A 3R7EA 3KMWA 2W06A 4EWHA 4AZWA 1OKVA 5I9UA 3EQIA 3ZDUA 4C4GA 2VTIA 4B99A 4AW5A 4I21A 4K18A 3KRLA 4XG4A 2UZEA 2O0UA 3C4CA 1UWHA 1ZMVA 4NZWB 5FTGA 3AC3A 1YOLA 4DEHA 3PFYA 3OCSA 2YM5A 3OFMA 4E6AA 3RPYA 3QCSA 5KBRA 2XIRA 4K11A 4H3BA 4DGOA 5J79A 3DU8A 3WE4A 2WMVA 2GMXA 5IQCA 4XG9A 2PE2A 3AG9A 2OKRA 3PVGA 4FIIA 4FTKA 4JQEA 4QP4A 4EHEA 2WTJA 4PDSA 4XJ0A 3NEWA 5E4HA 1Y8YA 3F2NA 4GFMA 5A4LA 1KE9A 4GJ3A 4XOZA 4U8ZA 1OB3A 3M2WA 4FSTA 5FQDC 4QTAA 3ULIA 3LFEA 4PP7A 3MBLA 2XUUA 2QQ7A 4IM2A 5CU0A 5CLPA 4GV1A 2QONA 1J3HA 4G16A 4F7LA 3OBGA 1PXNA 5BUEA 4QT1A 4WBBB 4MNFA 4TYEA 4ANQA 3BYVA 2OXDA 2R64A 3EFKA 4U81A 2BMCA 5L6OA 3PXZA 4O86A 4QDEA 4HCVA 4DLIA 3TYKA 4UEUA 3JS2A 2J5EA 4CLJA 5IU2A 4Q2AA 5LMBA 3H0ZA 5KCVA 3LXPA 5IEVA 2AYPA 1OL7A 3NNUA 3UTOA 3FL5A 4YUQA 4JQ8A 3EQBA 1A9UA 4IVAA 4BWXA 4XG6A 4CT1A 3MFTA 3UQFA 3PDTA 4KA3A 3GCPA 3W0PA 1NVRA 3KULB 3SG8A 4ZY4A 3PSDA 2OF4A 4L3PA 4WNKA 2XANA 3QKLA 4LYNA 1YXTA 2OJFE 4M84A 4RC3A 4DE4A 2DUVA 4IAIA 2PY3A 4C4FA 4KIPA 4JQ7A 4CKIA 4IX5A 5IEXA 2R3KA 2VTPA 2Z7LA 1Q8TA 4JR7A 4LL5A 4FNWA 2FGIA 5EKOA 5GJFA 4AF3A 4IB0A 3ORNA 3PJCA 2QOKA 4AN2A 5C27A 4E8AA 5IZFA 3V5WA 2JFLA 3T3UA 2XNNA 1VZOA 5LJJA 1H1SA 4AZTA 1GZNA 4ANMA 4F08A 3EQFA 3ZLXA 1H26A 3OOMA 3L9PA 3V01A 2G9XA 4GCJA 3T9IA 3VUIA 4QOXA 3V5JA 2Y4PA 1Q24A 3AC8A 4TTHB 3DXQA 5DYJA 2R3HA 3PRFA 4FV6A 3WZJA 4CCBA 1JPAA 5CVGA 3FZOA 1WVWA 4YJQA 2IN6A 1H4LA 2B9HA 3F7ZA 5AX3A 5J9ZA 1NT2A 3BWJA 4O7NA 2YWVA 3QXOA 2YLEA 3WILA 1URCA 3TV7A 3N4VA 4FNYA 3TNIA 3VS5A 4TWOA 5GJGA 2A1AB 5E91A 5K4IA 2YIWA 3FMNA 4UMUA 5GZ8A 1JVPP 4XV9A 4I20A 1UKHA 3Q9WA 4KABA 4BBFA 2XEZA 4TYIA 3RKBA 3U4UA 5GIOE 2IJMA 1JKSA 1KE5A 1TQPA 1Y6AA 4U80A 4E5AX 4LOPA 4XEYA 4F99A 4I6BA 5DT3A 4IE9A 1F3MC 4X2KA 1FVRA 4FKLA 4BWPA 4A9SA 3FZSA 1H1WA 4FTTA 1YHWA 2RGPA 2JEDA 4EK6A 1YXSA 1K9AA 1V1KA 4J98A 3Q4UA 5AM7A 4CZTA 3R7IA 4FICA 3ROYA 1QPJA 2QOIA 5AV4A 2Q0NA 3FPMA 4IFGA 4ZMFA 3AT3A 4W9WA 3W2QA 4RC2A 3ZFMA 1G8AA 3A8WA 4ONAA 5BMMA 3VJNA 4FSZA 1FBNA 1MRVA 2ONLC 2WQBA 3QZFA 5CTPA 3QHWA 4FTJA 1VJYA 3MGYA 1ZLTA 3AKJA 5ANGA 2C6MA 4DEBA 3ACKA 1SVEA 2C47A 2W4KA 4FV2A 2J50A 2C30A 4WIHA 4D58A 5F1ZA 4C34A 2IG7A 4FE2A 4C3FA 1DI8A 3DDQA 4NIFA 4Y95A 3UMXA 4B6LA 4HVGA 4EBWA 1RE8A 3E87A 3PXYA 3I79A 4X3FA 5BYYA 5IA4A 1E1VA 3C0GA 4GK2A 1GOLA 3LFAA 2GTMA 4PWNA 5E8WA 1IA8A 1PXJA 1PXPA 3D7ZA 5DIAA 3SD0A 3ETAA 2B4SB 4D2VA 1V0OA 3U6IA 2LGCA 3DOGA 3O7LD 2YAKA 3ROCA 3W2PA 4EJNA 5AAGA 5M4UA 4R7BA 4HGLA 4HVHA 1QPCA 4DFXE 4TWPA 3LM0A 3OMVA 1SM2A 4HW7A 3BRBA 1BLXA 3NUSA 4DGLC 1R0EA 3VHKA 3RPOA 3FHRA 3RZBA 3Q52A 2XF0A 5AWMA 3KMUA 3ODZX 2C68A 2EXEA 3RK7A 1L8TA 4BI2A 1PKDA 3DXNA 3R71A 1Q8UA 4FZ7A 4EZ7A 3RWPA