5JGAA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 11c
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
296
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Discovery of a potent and highly selective transforming growth factor beta receptor-associated kinase 1 (TAK1) inhibitor by structure based drug design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 296
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jgaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jgaA01
3PY1A 2X4ZA 3DQXA 4IZYA 3ATTA 3NAXA 3H0YA 4MXCA 4JG8A 4GK2A 4I24A 3TNHA 4JAJA 4E26A 3U6JA 4AQCA 2PVKA 2QCSA 3HV3A 3IK3A 3NR9A 4C38A 4EH5A 3AGMA 1JSTA 3FI3A 3HUBA 1V1KA 2DYLA 4O6LA 4AZTA 5HU3A 3LCOA 3H9RA 2PU8A 4DG3E 2YIXA 5GIOE 4NFNA 3FMKA 2GHMA 3TI1A 4F9AA 3LFFA 1PHKA 3P86A 1ZAOA 3OEZA 3SKCA 5GNKA 1JSUA 2YITA 5EYCA 2OF4A 4UMQA 2ZV9A 3HMMA 5DR9A 2VWWA 2WTVA 3VWAA 5EQYA 3VUIA 2YM5A 4LFIA 4CQGA 3UE4A 5FXSA 1Q41A 5HD4A 3F5XA 1XWSA 5IEVA 4BCNA 4MK0A 4XH6A 4FKUA 1ZMUA 3GC0A 2WMAA 4QP2A 4O38A 2J7TA 5FLFA 4BC6A 2BVAA 5CAUA 5CSHA 3KRJA 4IAAA 2X2KA 3BEAA 4GG7A 3Q04A 5CEMA 4G16A 3CIKA 4FNZA 4DEAA 4IX6A 5FM2A 4QPMA 4C4IA 5GZAA 2WOUA 3BHTA 4GIIA 4YZMA 3ZYAA 5JEBA 3WF5A 4KIKB 4GH2A 4GS6A 3PA5A 2FSOX 3HUCA 3JVRA 5L2WA 3P7AA 2NRUA 4M97A 4FEUA 4ZTLA 3S00A 3WE4A 5EW9A 3MFSA 4L01A 2VTQA 4V01A 4FKVA 5M53A 2WFYA 1PXKA 3EB0A 2R3FA 5CLPA 3EJ1A 4BF2A 4I0SA 2J2IB 5IMEA 4IANA 4BDEA 2DWBA 4U42A 1T45A 4O0XA 2JFLA 3UC3A 4EJNA 3WYYA 5DEYA 2V62A 3RM6A 2ITPA 4ACGA 4EC9A 4TT7A 5K5XA 3ID6C 3ZMMA 3COMA 3D4QA 5AUTA 5GINE 4XNEA 3HAMA 1VYZA 3CJGA 4IADA 4AGWA 3FSKA 3FPQA 1ZMWA 2OIBA 4O0SA 2PVJA 2R0IA 4P7EA 1FPUA 3QTXA 4D4SA 2VWIA 1U46A 2I40A 2YFXA 4UYAA 4ZJJA 3QLGA 2QHNA 4AX8A 3W8LA 1URCA 5CU3A 2CN8A 4YURA 2YCSA 4IB0A 4IEBA 1KE8A 4E73A 2YIRA 3EKNA 4UBAA 4XLVA 1BMKA 1ZMVA 2X6EA 5K0XA 4O2PA 3WIKA 2J51A 2JDVA 2ZM4A 3V5TA 3NGAA 3R7OA 4HVIA 4D5HA 1WBNA 2Y9QA 4J99A 1WZYA 4RQVA 2YACA 5T6KA 1H8FA 2A27A 3RCJA 2YM4A 3DK3A 4FIHA 4AE6A 4FKGA 4U0IA 4ZLZA 4YSJA 3CP9A 4CCUA 3PRIA 3FL5A 4G3DA 4C58A 4ZZNA 1Y91A 1V0BA 4MCVA 3RWPA 3S0OA 4Y95A 4GG5A 1NVRA 4FIGA 4KB8A 5AA8A 5ETAA 3ORLA 4KINA 2X4FA 4G31A 4RJ5A 3DKOA 5HLPA 4BYIA 4L42A 3OXTA 3OOMA 4C4HA 2XJ2A 5J9LA 3E7OA 3DFAA 4G17A 3HMNA 2NRYA 1PXOA 3WZUA 4OTIA 4A9SA 5L8JA 3HP2A 4BCKA 2QQ7A 3TUBA 4LV8A 3W1FA 2F57A 4KRDA 2V0DA 3O96A 4B6LA 5HVKA 3UQGA 4IFCA 5AP2A 3ATSA 3PVBA 4RWLA 4NUSA 3PVUA 3PJ3A 4EORA 3MVLA 5BNJA 4HNIA 5DWRA 2J0IA 4EOMA 4F0GA 3F5UA 2JKKA 1YXSA 4GT3A 3TXOA 4PDSA 4O7RA 3ORIA 3DBCA 2EU9A 2OJFE 4FNYA 1KE9A 4UMRA 2JEDA 2WB8A 4FG7A 3BRBA 1FVRA 2XUUA 3ORXA 2UW8A 3FLYA 4YNOA 1PXJA 4L53A 4U6RA 5HU9A 3D5XA 2XRWA 2VN9A 4QO9A 4WSYA 3COKA 5JMSA 1J7LA 4FG8A 4J8NA 4NU1A 4O22A 4N0SA 5ANOA 2GS6A 4KKHA 4GVJA 1OIYA 4A4OA 3CBLA 3IGOA 3O7LD 3ZXZA 4OAUC 4NL0A 2BKZA 1GY3A 2YABA 5HIEA 1XBCA 4EK6A 4J71A 2OXYA 4EL9A 2GPHA 4MXXA 4L7SA 2IG7A 2WMTA 4JDHA 4FBXA 4FF8A 4TYHA 2UZTA 3IDCA 4WG5A 5D7AA 4YPSA 4Q9ZA 1YXXA 4IAIA 5AP6A 3PWYA 4P5ZA 3RPRA 4L3PA 3HLLA 1FINA 3AT2A 3GUBA 2J6MA 5LVMA 4TTHB 4XV3A 4J7BA 2CLXA 3UYSA 4XP2A 5JRSA 3KKVA 3BX5A 3WILA 4IVDA 1FBNA 3NNVA 3TL8A 3Q2MA 3OW4A 4D0WA 3OMVA 4FODA 4H3PA 5TO8A 4W8EA 3PXZA 1TQPA 4JRNA 4OAVB 3C13A 2O5KA 3PSBA 5LMKA 3ZRKA 2OK1A 4Z16A 3QWJA 5BVKA 3HA6A 3DCVA 4EOJA 4Z7GA 2R7IA 3HL7A 2QKRA 4OBOA 3U4WA 4EH9A 4IWOA 4FKWA 1DM2A 1WBPA 3R28A 1LUFA 3MH3A 4MD8E 2ZV2A 5AP0A 5ITAA 4H05A 3UP7A 3QZGA 4LGHA 3DZQA 5HKMA 4RVLA 2R3QA 3MPTA 3DXQA 2HY0A 3DBDA 1SZMA 1ZOHA 4AUAA 1GZOA 3PP0A 4RFZA 4YNEA 3R01A 4A7CA 2ACXA 3IPHA 3ZDUA 4F0FA 5CT0A 3DT1A 2YJSA 2XEYA 3NW5A 4M14A 5HG9A 3WZEA 1WBVA 4H3QA 1OI9A 3DJ5A 4O7ZA 3VUDA 4FV2A 4XOZA 2C0OA 5IF1A 4X2JA 1Q8WA 4QTDA 3ZLYA 4BDAA 3AC5A 3EWHA 3I5ZA 2W5HA 3CQWA 2CKOA 4I5HA 2VTHA 1W0XC 4RIYA 4UWBA 4DLIA 4NKSA 5JFSA 4Z3VA 4AA5A 1V0PA 3K5VA 4TWNA 3W55A 1PJKA 2ETKA 3IQ7A 3E3PA 1KE6A 2RG5A 4DFXE 3BU3A 3I1AA 2X8IA 4M0ZA 3F3UA 4I21A 3QTSA 4DCAA 3FE3A 5L6PA 3BHHA 4EJ7A 2W96B 3K3JA 3BYOA 3SV0A 3VW8A 1F5QA 5K9IA 4YTCA 2JFMA 4ZAUA 1Q62A 4WIHA 3R8MA 2WU7A 2WTJA 2W1ZA 2R5TA 3EQHA 3V5WA 4EOLA 4PNIA 2QHMA 4F9CA 4YUQA 1QL6A 3FQSA 3KULB 3ALNA 5HE0A 2VTMA 3BBWA 4CLJA 2IO6A 3NVMB 4DF3A 1OIQA 4JBQA 4RRVA 1FVTA 5BYZA 4LRMA 4TYGA 4GT4A 1PF8A 4BDGA 2JITA 5E8ZA 1OITA 2ZJWA 2BTRA 5AV4A 3O7LB 1FQ1B 4JNWA 2IW9A 4BTKA 4LOQA 5CEKA 2BPMA 3ETAA 4AG8A 4S31A 3MB7A 3NNXA 4I3ZA 4IX4A 4QYHA 5HICA 3VS3A 3E3BX 3KY2A 4YBKA 2PL0A 3ZS5A 2V5QA 2OLCA 3D7TB 3QHRA 1Y6BA 2WAJA 4U40A 4C35A 4JAIA 4F65A 4R5SA 4QP8A 5D12A 4EQUA 4JX7A 2IW8A 1H28A 1Q61A 1YWNA 2OJGA 2XKCA 4LOPA 4EEVA 5LXMA 4PTEA 1PKGA 1M52A 4WO5A 3VBXA 3QTUA 3RVGA 3KF7A 3LM0A 3OC1A 3IKAA 4RJ4A 3EYGA 5EQPA 1OIRA 3FDNA 3RPYA 3LJ1A 4GV1A 4QOXA 3UP2A 2FH9A 1SMHA 4F63A 4KBAA 4MBIA 4NFMA 5AM6A 3Q3BA 4ANMA 5C8NA 1Z9XA 3QTQA 4LG4A 1XBAA 3DJ6A 4G6NA 4ZSGA 4AAAA 1DI9A 4YLKA 2H34A 1ZLTA 4U97A 3C0GA 2RFNA 1OZ1A 3W18A 5AX3A 3RI1A 2PY3A 3EQBA 2CMWA 5G1XA 3UPXA 4CCBA 3JR1A 4WNPA 3CGFA 3FXXA 3QZHA 3M42A 3OVVA 4GFMA 4BWKA 5AV1A 5LCJA 3LMHA 3IW8A 3OT8A 3MWUA 5H2UA 5E1EA 1H1QA 4ZMEA 4CFFA 5J79A 1XJDA 5DH3A 3PXKA 5KX8A 2QO9A 2XK4A 2OH4A 4MTAA 4O7SA 4HCTA 4BR3A 2PE1A 5EM8A 1M2PA 4M15A 4NH1A 4EHVA 2ITNA 5IA1A 2GCDA 4ITJA 4KBCA 3ZLSA 4DH5A 3U6IA 1L3RE 4BCHA 5I9YA 1U4DA 2WEVA 4ITIA 3QCYA 1M2RA 2QOIA 2RFSA 3FHRA 4D2PA 4ZTSA 5BMSA 1RW8A 2W9ZB 4E93A 2QONA 1ND4A 4BGGA 4ZS4A 2ETMA 2XCKA 4O0UA 5CAPA 4GMYA 3QQGA 1J91A 1OKWA 3MJ2A 4L67A 4PPBA 4PMTA 4WHZA 2Q83A 3CE3A 4XHKB 2XNBA 3TZ8A 3QAME 2H6DA 2WEIA 3F3TA 4FL1A 4CD0A 2CGXA 4JXFA 4EOKA 2F4JA 3QZFA 4YC6A 4IFGA 3PTGA 4ANLA 1W8CA 4FZFB 2Y6MA 5M09A 3B8RA 4KD1A 3G90X 4HYHA 4BKZA 3P1AA 3W2SA 3D0EA 4I1ZA 4E20A 5DOSA 3LQ3A 3MV5A 1YVJA 4KSPA 3GVUA 4D9TA 3R1SA 3L8SA 2WMWA 3NX8A 4EK3A 3GB2A 4O7YA 5JGAA 4NM5A 4B99A 2R3RA 3ZM4A 3VUKA 2HELA 3OZ6A 4CNHA 4O7WA 4IIRA 4FTUA 3F7ZA 3ZEPA 1YWRA 4ORKA 1CSNA 3B2TA 3PJCA 1KSWA 4FKSA 3FLQA 3POOA 2OGVA 4QMVA 4XG6A 1AGWA 3W16A 4ZY5A 3PA3A 3HV5A 2BDWA 3UBDA 5C8MA 3CXWA 3ORPA 4FSMA 4O91A 4KIQA 5GJDA 4A9RA 4IAYA 2ONLC 3IONA 2IJMA 4QMLA 3P78A 3E92A 4CEGA 4R5YA 3P23A 5AP3A 3I79A 3AMBA 4OTQA 1ZY5A 3OBJA 5A4TA 5KMNA 3SC1A 4IAFA 5B0XA 3MESA 3AC8A 3UVPA 2XH5A 4J96A 4F7LA 3WI6A 2X6DA 1IA8A 1U59A 1VR2A 3ODYX 4UMTA 5BQ0A 4N4SA 5KHXA 5IQFA 4L45A 1SNUA 4X2NA 4FVRA 3DDQA 4L7FA 3ENMA 5HCZA 2PULA 4I6QA 4RIXB 5EQEA 2A2AA 2W05A 3I7BA 3RM7A 3DB8A 4Q5HA 3RALA 3U9NA 4D4RA 4BHNA 3LCDA 2C3JA 3FKOA 5AIKA 3TKUA 1V0OA 2XYUA 3W2OA 3QX2A 3NSZA 4LQMA 2UW3A 1H4LA 3II5A 3OS3A 4IDTA 4RBLA 2B52A 5HHWA 3KMUA 2HXLA 3BQRA 3H9FA 3SOAA 4E8AA 5M4FA 3KXGA 2ESMA 2W17A 3FYJX 4I92A 4TN6A 4C2WA 3CQEA 4AW1A 3W32A 4DBNA 4BDDA 1P4OA 2PZIA 3PZEA 4ZTRA 3VBYA 3LCTA 1CMKE 2R3PA 2XA4A 1DAWA 4EH4A 4LL0A 2WKMA 4IB1A 4DAWA 5KNJA 3ODZX 3GCPA 3ZBXA 2VV9A 4HVHA 5BUJA 1STCE 4N70A 4PY1A 1NVSA 1M7NA 3ULZA 4H1MA 5B2LA 2YDKA 5CALA 3Q32A 5L3AA 2YCFA 3MVHA 3G6HA 3ITZA 2IW6A 4OLIA 5DIAA 3LMIA 3KVXA 4KA3A 2YISA 1ZYCA 2GDOA 4PTGA 1X8BA 2PSQA 2VD5A 4FTCA 2QOLA 4IACA 3QYZA 2ZM1A 1KOBA 5HIDA 3R8VA 3ZEWA 5C4KA 2IVSA 3UPZA 1HCKA 5FDPA 2OIQA 1WBSA 1XHAA 4LMUA 4EUTA 4Y73A 5K0KA 3QQLA 3AC2A 4C02A 2VTJA 5CEQA 1U54A 4DG2E 3NYNA 3QF9A 3F5PA 4O1OA 1PXLA 4LUEA 1W7HA 3CY3A 3RPOA 4A9TA 2CKPA 5A6NA 4DT9A 1F3MC 2QURA 4Y46A 5EKOA 3A7GA 4IHPA 4M12A 3H4JA 5G6VA 1BUHA 3A60A 3LQ5A 1NW1A 3PJ8A 5D41A 4GUEA 4NW5A 1IASA 2ITOA 3G5DA 3LVPA 2Y8OA 1B39A 3QZIA 4FV0A 4I22A 4W4WA 2BZIB 4EZ3A 4HVDA 5IU2A 4QP9A 1DS5A 5E4HA 3VO3A 3CR0A 1REKA 2IWIA 4OUCA 3R9DA 3WARA 1ZWSA 1ZARA 4NCTA 3BV3A 5AR3A 3RKBA 3UQCA 3FMNA 1QPJA 3BYUA 4OBPA 3GOKA 5I3OA 3S2PA 4IM3A 3KRWA 4B9DA 2I7QA 3FI2A 2YM8A 3BLHA 2GS2A 3VS0A 4TYHB 1YDTE 4GJ2A 4GL9A 4M69B 4S33A 4O0YA 4C36A 5HTIA 4GU9A 4CMOA 2R3HA 5FRIA 3PIZA 1JNKA 4MNEB 4AW0A 4IQ6A 3MI9A 3QQHA 3KVWA 3FUPA 4QYGA 4QP6A 4CTBA 3Q6WA 3BLRA 3ZTXA 3A4OX 4FTAA 3PDTA 5AM7A 5DMZA 4FSNA 2CNUA 3BQCA 5HZNA 3RPVA 2JKOA 1OGUA 5AUWA 2W4JA 5H3QA 3FKLA 2PMOX 4FV3A 4NTTA 4E6QA 5KMKA 2VGPA 3HAVA 3NUPA 4JDIA 5CU2A 4DFZE 3C4CA 5EG3A 3E8EA 3NYXA 3VVHA 1M14A 4UZDA 4C57A 4IMYA 1UU8A 2G2IA 5GJGA 4ANBA 4JOAA 2FSLX 5GZ8A 3L9MA 4X0MA 3S3IA 3HRCA 5GIPE 3QXOA 1GIHA 3FLZA 4FKPA 4WNKA 4F1OA 5K3YA 4TRLA 3NMUF 3RK9A 3UOJA 4LOOA 4MBJA 3OW3A 4DT8A 2EWAA 1MRVA 1OL1A 2UZOA 5TKDA 4E6CA 4QMTA 4X3JA 2F7EE 1BX6A 3QCSA 4JJRA 2YLEA 5J1VA 2RSVA 3S95A 3TN8A 4BDFA 3QRKA 3RAIA 3MY1A 2C0IA 3HX4A 3R0TA 5LCKA 1A48A 2BDFA 4B8LA 5KCVA 2ZMCA 5J5TA 3S1HA 2RKUA 3BGZA 4FG9A 3GQLA 5DEWA 5T3QA 3MYGA 4AN9A 4EYMA 2XF0A 3HMIA 5CU0A 4ZS0A 1WMKA 2UW6A 2Y6OA 4HZSA 5CASA 4FEVA 2Z7QA 4JRVA 4ZY6A 3G15A 2QO2A 5CAQA 3OCGA 5IEYA 1Q97A 3KA0A 5CF4A 3V6SA 4C59A 4HYIA 3HEGA 5E8TA 2ITYA 4RSSA 4ZJIA 4CKIA 4BWXA 1H1PA 3F69A 4FTIA 3RAWA 2PMLX 4BDKA 3UMWA 2E9OA 5HBJA 4A4LA 4WD5A 2W5AA 3UO4A 3PY0A 5FP6A 2ONLA 4X3FA 3FZOA 4YO4A 3MJ1A 2YM6A 3C4ZA 3Q9YA 2VTSA 5AAFA 4JBPA 3FMMA 1YOJA 3N9XA 3OWPA 4N6YA 1KV1A 3VBTA 2J0MB 2VWYA 4FYOA 5M4UA 4W4VA 3HKOA 1OIUA 4GKHA 1QPDA 3DU8A 5HVJA 4DA5A 3RTPA 3DTWA 2WTWA 2CCHA 1LPUA 2XIYA 4IWPA 4FTJA 4CRSA 4UZHA 5CF6A 5JN2A 4G9CA 4I5MA 5KKRB 4II5A 5CX9A 3BELA 5AADA 4DFBA 2IZRA 2RF9A 3MFRA 4LYNA 2CNVA 2HOGA 1YI4A 2WTCA 4W9WA 4WNOA 3IGGA 4QMPA 4CQEA 5EFQA 4ZTNA 2W4OA 4QQTA 4XOYA 3ZO3A 3EQIA 3GFEA 3GCSA 1HCLA 2B7AA 3ZONA 3I5NA 3B2WA 4XJ0A 3UTOA 4F64A 3VS1A 1RE8A 3M1SA 3GI3A 5AX9A 5I3RA 2VAGA 5CF5A 2UZWE 3EFJA 3ORZA 4YLLA 5KBRA 5A54A 3DQWA 3ZU7A 4DE4A 2QOKA 3LCKA 2XKEA 3NRMA 1Q8ZA 3BPRA 2F7XE 3ZUTA 2E9PA 3HYHA 4ALUA 2P2IA 3MFUA 3NCGA 2C5NA 1PMVA 4BL1A 4C4EA 4E4MA 4F08A 3FV8A 4DGMA 2LGCA 2EB3A 4E1ZA 4ZMFA 3C9WA 4DN5A 4O86A 3R8UA 4HW7A 3D5UA 3FZPA 3G6GA 5FEDA 3V3VA 1PYXA 4FNWA 3ANQA 2FVDA 4NM7A 4I93A 1Y6AA 4EOIA 4RA4A 5LJJA 4PQNA 3DBFA 1JPAA 3TACA 3E7VA 2OZAA 4G5PA 5I4NA 5FM3A 5IG1A 2J9MA 3CKWA 4CFXA 2OFVA 4D0XA 5A3XA 3CY2A 5FBNC 2J5FA 4U3YA 1PY5A 4W9XA 4ZY4A 3FXZA 3DJ7A 4FSTA 3KFAA 4DTBA 3BZ3A 5CWZA 2FYSA 2ERZE 2J0KA 5JFVA 4DGNA 2JAMA 3G2FA 4EUUA 5L2QA 4ZSAA 2XMYA 5BPYA 3RK5A 1H24A 5TR6A 2ITTA 1H08A 5I9VA 2X2LA 3VUMA 5M4CA 3MTFA 2J0JA 4A9YA 5IUIA 1YI3A 4FV6A 3VF9A 3GT8A 3SGCA 4BCGA 3R7VA 4E4XA 4E6DA 2H9VA 2J0LA 4AGUA 3L8PA 3OHTA 3QQJA 2YEXA 3EL8A 4AW2A 2IVVA 3OCSA 2HY81 2C6MA 4K11A 2XCHA 4LGDA 4GIHA 4IXPA 5IQEA 1YOMA 2P3GX 3KMMA 1OL2A 2QOBA 4G1WA 5M56A 3L9LA 5FUTA 2Z7RA 1OKYA 3JUHA 2G2HA 2UW7A 3BV2A 4C3FA 3F61A 4ZJVA 4IVCA 4D1SA 4MWHA 4HJOA 3KN5A 4XV9A 3ZSIA 4UX9A 2YJRA 3DKFA 5DBXA 3FMLA 4K18A 4Z7HA 3F9NA 4G5JA 1NXKA 2A1AB 2XK8A 4MAOA 3TZ9A 3OXIA 3UG2A 4UEUA 5HE2A 4ANQA 4UYNA 3OY1A 1UU7A 3UIMA 3EN5A 4PMMA 3SRVB 4BTFA 1XKKA 5AUYA 3NZ0A 2WTDA 2C68A 3V5LA 3AGLA 5LVPA 2KULA 2BIKB 3F2AA 5CSVA 2C3IB 5A4CA 4ARKA 4BIBA 3MGYA 4GKIA 3R7GA 5AA9A 3F3WA 4H1JA 4P5QA 4ANOA 3MH2A 1KE7A 4M3QA 4O7LA 3OROA 3LJ0A 2UV2A 4IZ7A 3E5AA 2IZSA 4FTLA 2QC6A 3ELJA 3VW6A 3HRBA 5HO6A 2Y4PA 4YTFA 4JS8A 3HV4A 3OUNB 4IC8A 5D9HA 3NEWA 4DH8A 4CKRA 4FV4A 5M06A 1MQ4A 4JG6A 3RZBA 2NP8A 4O1PA 4CRLA 4XYFA 3Q9XA 5HE1A 4CT2A 1OL6A 3MFTA 4NEUA 4NW6A 2I1MA 4S32A 3AD5A 1YDSE 4TNDA 2C69A 3R8PA 4HCUA 4FZ6A 4RJ6A 1YXTA 4C3PA 4GU6A 2WQBA 3A2CA 3A4PA 3QGWA 4LUDA 3AQVA 4TNBA 1WCCA 2R3JA 4K1BA 4K2RA 5CF8A 1LP4A 5EI8A 4CYJA 4EH7A 4YP8A 2OWBA 4R7BA 3F3VA 2WMBA 4NIFA 3FPMA 3FAAA 3JXWA 3DAJA 4JR7A 5EOLA 3SXFA 4FEQA 3I6UA 4QP1A 3UODA 1PXPA 3VS6A 2GMXA 5JH6A 5KMJA 1J1BA 3K3IA 1ATPE 5IA3A 1R78A 1WBTA 1YKRA 5KMMA 3LW0A 4IW0A 3V51A 3O23A 4TL0A 4EONA 3A8WA 3HDMA 2PZ5A 4IWQA 3EN6A 3PYYA 2WOTA 3NYOA 4R3PA 4EOSA 3UOHA 4XG9A 5E92A 4HPTE 3LAUA 4A9UA 2QU5A 4QP4A 2B0QA 4G9RA 3UDBA 3ZFXA 2GNGA 4IB3A 5I9UA 3R8ZA 4QNAA 3FZTA 1SVGA 1L8TA 3TEIA 5A4QA 4KS7A 4UXLA 3ZZEA 3TJCA 5DG5A 4FTQA 3KGAA 5C8KA 3DB6A 4GYGA 4RWIA 5E91A 3FLNC 4AGDA 1Z57A 2RGPA 2R3IA 3UG1A 5AR7A 3PUPA 4W8DA 3THBA 3V8TA 2WMVA 3R7IA 4FOCA 2BZKB 2XRUA 4FVPA 3BLQA 1FGIA 4ERWA 3AMYA 2YAAA 1YWVA 3VJOA 3WF9A 2C5XA 4XX9A 3REPA 3ALOA 4AZFA 4BBEA 5HOAA 3DA6A 1PMUA 3V04A 4M13A 2GFCA 4I0TA 4ONAA 1UKHA 2VNWA 3JPVA 4RJ8A 2OFUA 3PP1A 4XP3A 5EHOA 5J9YA 3JS2A 4IH8A 1LEWA 1H0WA 1RQQA 4BCPA 4D2VA 4ASZA 3AMAA 1RJBA 3Q2JA 4X6RA 3VBQA 4BGQA 4A4XA 4CFUA 4NTSA 3UZPA 2BMCA 3LZBA 1Y8YA 1YXVA 3E87A 5B2MA 1NT2A 1JSVA 5FBOA 2B1PA 4D58A 3KXXA 3LXKA 3VUHA 4RVMA 3NUYA 4UWYA 1H07A 3QHWA 1YW2A 1ZOGA 2XK6A 3N51A 3DLZA 1LR4A 1GAGA 4FOBA 3UZTA 3O2MA 3W8QA 2QODA 2XNEA 1ZXEA 3EQDA 4CFWA 4AU8A 3FL4A 4X6QC 4ZK5A 3DTCA 3MVMA 2Z7SA 3SXRA 5K5NA 3R21A 4EH3A 5CXZA 2JIVA 3UOKA 5IQGA 3IO7A 4NM3A 1E1VA 5AWMA 5CSPA 2VNYA 4I6FA 4I94A 4N57A 2XIXA 1I09A 4CMTA 4M66A 3O8PA 4TYJA 1IEPA 2VO3A 2ETRA 3W33A 4UWCA 1OKZA 2BIYA 2EUFB 1VYWA 2ZVAA 3A7FA 3E62A 4M0YA 4EC8A 5B7VA 2W1FA 3Q4UA 1ZYDA 4FZ7A 3MN3A 2XIRA 4MX9A 3IW7A 4PV0A 1S9IA 4D2TA 5K4JA 1BKXA 5J7HA 3CQUA 5L8LA 4RMZA 4CV9A 4IZAA 3KRRA 4PX6A 4L44A 3O8TA 4YJNA 2BFXA 5CEIA 4ZZOA 1UWJA 2VRXA 3T3VA 1ZZ2A 3OT3A 5H8GA 1REJA 5A4EA 3R71A 4RVTA 5TF9A 4E7WA 3W10A 4LRJA 4BCOA 3O50A 3TKHA 1ZOEA 5EM7A 3MIAA 3ZSHA 1KV2A 2GHLA 3SG8A 5L2TA 5ANGA 4M7IA 2WELA 3LFAA 4KNBA 3LFBA 4DYMA 3VAPA 3U87A 3O0GA 4J98A 1YXUA 3LM5A 4JR3A 3ZFYA 4YSMA 3NW7A 3GOPA 4ZSLA 4ZTMA 3Q96A 2J90A 4M68A 3KN6A 4MD9E 3MA3A 1QMZA 4ZSEA 2OIDA 4H3BA 4CSVA 2ZB0A 1VZOA 3I60A 4JT3A 2BUJA 4EQCA 4CKJA 3UOLA 3L8VA 3EH9A 3KK9A 3DBQA 3EHAA 4QMXA 4EI4A 2NNWB 3GCUA 5LQFA 3LXPA 4MEDA 3GU5A 3SD0A 3U51A 3KC3A 4ASDA 2R0UA 4RT7A 5CI6A 5IUHA 5L6OA 2Y7JA 4YJQA 1LEZA 3R9RA 1Q8YA 2HWOA 5CXHA 1G5SA 5IUGA 5KMIA 3FQEA 3MA6A 3BYVA 5AP4A 1H00A 4FI1A 2IPXA 5IA2A 2R3KA 4JBOA 2QI8A 4FT5A 4V05A 2XNPA 4EOOA 1NVQA 3FI8A 2OJ9A 2YLFA 4FR4A 2DUVA 4RLLA 3EIDA 1U5QA 4FV1A 4J95A 2VTOA 5HG8A 4X2KA 2GFSA 5FQDC 4ALWA 2WQOA 4ACHA 4D28A 1CKIA 3QUPA 3NYVA 3PXRA 5BMMA 3DK6A 3TG1A 3OOGA 2EXCX 2GNHA 2X8EA 3ORKA 3K2LA 1E1XA 3SAYA 4BCJA 1XR1A 3EN4A 4L6QA 2YAKA 5HORA 3RJCA 2XVDA 4LMNA 2E9UA 4O83A 4XP0A 3BYSA 3W2RA 3CJFA 3U4UA 2BTSA 1JKLA 1OL7A 3EQCA 3C50A 3OWJA 4W4YA 5DRBA 2IZTA 2VTNA 1Q3DA 3JY0A 3W2CA 3NUXA 5CT7A 4EH2A 2O63A 3GNIB 5C01A 2PPQA 5M07A 3B8QA 2QO7A 3Q5IA 4YJPA 5IA0A 4QMNA 1UV5A 2R3NA 4L9IA 3NLBA 4K33A 3RAKA 2RL5A 5ANIA 2BRGA 3CD3A 4XMOA 4RX9A 4E4LA 5AUXA 4RX5A 4KWPA 4C8BA 3OBGA 3FLWA 4F4PA 3CEKA 2XP2A 5M08A 5FGKA 4O6EA 2CNQA 4PRJA 3ERKA 3QKMA 5ANJA 4FTOA 4XRLA 2P33A 2CKEA 2YERA 3H0ZA 3SQQA 2DS1A 3VJNA 3PA4A 4CMUA 4FL2A 4OTHA 1UU9A 3A7JA 3OFMA 1ZY4A 1P14A 4N6ZA 4ITHA 4U44A 1P4FA 5FTQA 2JLDA 1UNLA 4XCUA 4RWKA 4RA5A 2BZHB 3BIZA 2UZUE 5JSMA 4MF0A 4BICA 3MVJA 4RG0A 5CVFA 1VEBA 5CQWA 3DKGA 3CD8A 3VS7A 2OJJA 2R3LA 4WA9A 4KIKA 4YO6A 5DT0A 2BRHA 5J95A 1AD5A 5AEPA 3RNYA 5I9WA 4I6BA 3EQRA 5FXRA 4PF4A 4J1RA 2JDRA 2O8YA 2PVLA 2R7BA 3C51A 1Y8GA 3ZFMA 4F6UA 1OECA 1PXIA 4HGSA 4BKYA 2P0CA 4UN0C 3BBTB 2QOQA 4YC8A 4LL5A 2YDIA 4BDIA 3VQUA 5F20A 3RWQA 2V22A 1M2QA 1SM2A 3AT3A 3EKKA 2PUUA 4L8MA 2EVAA 3D7ZA 1B38A 4FUXA 4S2ZA 3AC4A 1GZ8A 2JD5A 3TZMA 3G33A 1Q5KA 2UZLA 2XBAA 3C4FA 3KCKA 4FNXA 4I4FA 3GENA 1MUOA 3W2PA 4EHZA 4FZAB 3KXZA 1UVRA 3HP5A 4LRKA 5DT3A 3SXSA 2CN5A 2X39A 4QMQA 5GJFA 3PXFA 5HX8A 1TVOA 3RK7A 2J5EA 2W0JA 3EFLA 2XS0A 2X7OA 2VWXA 3G9LX 3QQFA 4PP9A 5BVFA 3ZBFA 1DI8A 2Q0NA 4C4JA 4EZ5A 3ZDIA 1PKDA 3R00A 5M57A 4JI9A 3FEGA 5A46A 3FMJA 4OTRA 3QX4A 3AD4A 3DY7A 2J4ZA 3P0MA 5HESA 4F70A 2VTTA 3ZO1A 4AZSA 2ZB1A 4G2FA 4EK4A 5HNGA 4KKGA 4PDYA 4A06A 4QTAA 4NM0A 4RIWA 3TTIA 2HW6A 1BI7A 2WIPA 3A62A 4FSWA 2XM9A 4FVQA 4HVGA 2PYWA 3ULIA 4GFGA 4BI0A 5I5ZA 2C6TA 3TM0A 4BBFA 3C0IA 3QKKA 1JKTA 2UZEA 4FL3A 4K8AA 3PJ2A 3CSVA 2REIA 3HV7A 3KU2A 2UW5A 3LPBA 3U54A 4U80A 1CTPE 2WZJA 5IMXA 4CXAA 3EQPA 4D2WA 3IW6A 4MXZA 4EH8A 2F49A 4HYUA 2G9XA 3UNJA 2OXDA 4BBMA 3RINA 3ZLWA 5HTBA 3CPBA 3DV3A 3FKNA 5JT2A 1PXMA 3M2WA 4JL9A 3UZRA 4IWDA 3QD4A 4FA2A 4U9AA 2B9IA 3CS9A 4XBRA 3EFWA 5T68A 4KUJA 2BILB 3LHJA 1FOTA 4F09A 2PHKA 5C9CA 4O2ZA 4I5PA 4WBBB 5L2IA 2JC6A 5EH0A 4PL3A 3ZC6A 3NPCA 1SYKA 5E90A 1M17A 3C4XA 4TWCA 3OWLA 3U8WA 3D94A 5D10A 3OG7A 4MQ2A 3EZRA 5FWKK 4I41A 1JAMA 2Z7LA 2X9EA 3VRZA 4CYIA 2GQSA 4GJ3A 3DKCA 4NIFB 1TQIA 4BTJA 1JVPP 4IX5A 5KO1A 3HDNA 1KWPA 1MRUA 4F1MA 3DGKA 4U8ZA 3ZUVA 5JQ8A 4QYYA 3L8XA 3JVSA 4ZOGA 4FSZA 1PYEA 1OUKA 2XBJA 3AT4A 2HZIA 2YM7A 4AOTA 3ORTA 2BCJA 3PG1A 3BE9A 3MW1A 3A7HA 4FSUA 4H58A 4HNFA 4B4LA 4U43A 4XLIA 4WT6A 4QMMA 4BCFA 4QYFA 5CSXA 3UO6A 2FA2A 4PPAA 3OF0A 2HENA 2YDJA 4P4CA 3FWQA 4EH6A 3LFNA 2QR7A 3R30A 2YIWA 3OCTA 4B8MA 3RZFA 1MRYA 4MXAA 5J87A 3PRFA 4CLIA 2GHGA 3H30A 4WKQA 5CVHA 5EDQA 5GHVA 5DNRA 4KABA 4UV0A 4XBUA 5HE3A 2R3MA 3FJQE 4K6ZA 1WVXA 1A9UA 5ANDA 3E8DA 4EK5A 4HPUE 3TUCA 3FBVA 5F1ZA 5H8EA 1JBPE 3COIA 4Y83A 2YM3A 1Q8TA 2C1BA 2HCKA 4HGLA 3WF8A 2G2FA 5AIRA 4QTBA 2YZLA 2QOCA 5DGZA 2PUPA 3TIYA 2CHLA 3ZOSA 3FZRA 4MYGA 3LKMA 2GTNA 2I0HA 2IVTA 3HVCA 2PVHA 4EK8A 3KMWA 4HZRA 3VIDA 5CANA 4L3JA 4QNYA 3QL8A 5EI6A 5AV3A 2QOFA 4HGEA 4DFUA 3WZJA 1H01A 3GC9A 2ITZA 4TYEA 2AYPA 2W1EA 3PXQA 1GOLA 2FSTX 4EKKA 2OF2A 2XNGA 3PVWA 4QD6A 4YU2A 2HXQA 1FGKA 3F82A 5IQCA 1RDQE 3QKLA 5D11A 5EK7A 3BHVA 2VTIA 4NJDA 2XYNA 4BKJA 2G01A 2C6IA 1OBGA 2OBJA 4OW8A 4WG3A 2VU3A 3QYWA 4JIAA 4JX3A 4OTPA 5GZ9A 4AN2A 4CT1A 4QQCA 4KSQA 4WUAA 3TCPA 3EYHA 4GFOA 1FVVA 3LFCA 4DEEA 3CTJA 4Y5QA 3NVKI 4IZ5A 4R1VA 2VWBA 3I0QA 4QRCA 2OZOA 2JDSA 2QLQA 3KXNA 5LMAA 3TIZA 4CZYB 2C6EA 4BZOA 3ZLXA 4F9YA 2C6DA 3SDJA 3VS2A 4YJOA 2XKFA 5CS6A 2BDJA 3FYKX 4RC3A 4RIYB 1JKSA 4XV1A 5AAEA 4EYJA 3R9NA 1ZYLA 4NZWB 3KRLA 2UW0A 4NYEA 3KULA 2WMUA 2UZDA 5EW8A 4FIFA 3SHEA 2PWLA 3DXNA 3DXPA 3DFCB 3UIXA 4O21A 4FT9A 1W84A 3IECA 4Q5EA 3VN9A 2QNJA 4FT7A 4MXOA 4PP7A 4IM0A 3CTQA 4X2FA 5I9XA 4QPSA 3QTRA 2FUMA 4PTCA 3P4KA 2VWVA 2YZAA 2WU6A 1OB3A 4RC2A 2ZYBA 3NUNA 3GP0A 1UU3A 2VUWA 2VX3A 2VO0A 4ASXA 3D7TA 1BL6A 3GC8A 5IZFA 4EWHA 4NWMA 2QR8A 1KUTA 2VGOA 5LMBA 5C03A 2ITWA 4DGOA 2W1DA 3LOKA 3MPAA 3F2NA 3KB7A 5ETFA 4PMPA 3LFQA 1H1RA 3QRUA 5CENA 3EMGA 4TYIA 3V6RA 3SA0A 2W1HA 3VUGA 5AP1A 4AOJA 3TNWA 4WRSA 5ANKA 3EQGA 3HA8A 2HIWA 4FV5A 4ENXA 5HIBA 3PE1A 4XUFA 5DLSA 4IJPA 2WQEA 3BHUA 3CTHA 3MS9A 3NUSA 4O27B 4IVBA 1XH4A 5LVNA 4O7TA 3RP9A 2BRMA 3QALE 2C0TA 4JVGA 4RQKA 3QBNA 2KTYA 2PVMA 2UVZA 4MHAA 3SVVA 5HLNA 5BVDA 4BY9E 4ZTQA 4PPCA 2XNMA 4DFNA 5KUPA 5HO8A 4R6VA 3Q60A 2XIZA 3RBWA 3W2QA 4YTIA 5DRDA 3UGCA 5DYJA 2AUHA 4DEIA 3TWJA 3LCSA 1J3HA 4EHEA 3FI4A 4DH1A 2FB8A 4TWPA 5HEZA 3N4VA 2ITUA 5EKNA 2JKQA 2W1GA 3TJDA 3VBWA 1BLXA 3A99A 5BVWA 4R77A 4ERKA 3H3CA 2C47A 1E9HA 3GU8A 2B9HA 4R7IA 5LMKC 4DGLC 3T9IA 5LWNA 5IKWA 2PZYA 3QTWA 4CG9A 2GNLA 3DK7A 3F88A 3TV4A 2I6LA 5ACKA 4FKTA 4PDOA 3SW4A 4FEXA 3ET7A 1QPEA 4FSRA 5E8YA 5HD7A 4FKRA 2CPKE 5TE0A 5EHLA 3FSFA 1P5EA 2WNTA 3V01A 4G3CA 5IQBA 1OUYA 1SVEA 2WMXA 3GBZA 4G3FA 3UIUA 3EFKA 4Z9LA 2UZNA 3BYMA 5C26A 3PLSA 4U79A 1GJOA 2O65A 2QOOA 4O0TA 5M55A 5A6OA 3EQFA 4K9YA 4YZBA 5C1QB 5BYYA 2YIQA 3GC7A 3VHKA 2ITQA 1H0VA 3EOCA 1H27A 3PFQA 3NCZA 4QMSA 4FKQA 4KIOA 4TW9A 1GZNA 2BFYA 3VF8A 3QA0A 5EDRA 3ZUUA 4CV8A 5HQ0A 5L2SA 4R3CA 3VULA 1IR3A 5AP5A 2VWZA 3TV6A 4Y8DA 4JDKA 5AR4A 2C6KA 2Z2WA 4YJTA 3Q5ZA 5AAGA 5M44A 3LFEA 4B0GA 3QD0A 3TNIA 2WHBA 2RFEA 4IX3A 4BIEA 2ZMDA 4NKAA 4S34A 2C1AA 3HECA 4FSQA 4G6OA 4C33A 4IC7A 4M84A 1NA7A 1Q3WA 2ZOQA 4JQEA 4OTDA 4QP3A 4KKEA 3P79A 2EB2A 2NO3A 3FY0A 3E8NA 2Q0BA 2VO7A 3G0FA 3PPZA 4XRJA 4NK9A 5FTOA 3BCEA 5LVLA 3CC6A 5KHWA 2W9FB 4YZCA 1F0QA 5ICPA 1S9JA 4CZTA 4F6SA 4GUBA 4V0GA 4BB4A 5J9ZA 4FMQA 1YHWA 4G3EA 3MSSA 3JYAA 4QTCA 1H25A 4P90A 4C37A 5HBHA 4C62A 4JLCA 4DH7A 2PUNA 3IDPA 2XK7A 3R6XA 4O7VA 5IQAA 3U55A 5M4IA 2C3LA 2VZ6A 5J8IA 2PMIA 5E9EA 3R1NA 4RIXA 5J7BA 2OW3A 3VBVA 4KBKA 5KKRC 2UW9A 5AUZA 3PE2A 3R8LA 2JBOA 5K4IA 2HZ0A 3ZO2A 4MVFA 5I0BA 2A4LA 2BHHA 4DEGA 2E9VA 3E88A 3OCBA 4DEDA 4CFMA 2PUIA 4NT4A 2XK3A 3QCQA 1OPKA 3QRIA 4WG4A 3WOWA 4YJVA 5IH5A 4ID7A 2PVFA 4YR8A 4YZNA 2P4IA 1HOWA 2R2PA 3AOXA 1AQ1A 4GRBA 4U45A 5IDPA 4FKIA 4KIPA 3R2BA 2BZJA 3QA8A 4FKOA 5HLWA 3O71A 1YQJA 3WE8A 2JDOA 4X7QA 4BHZA 3FMHA 4K77A 4ASEA 3VRYA 4TY1A 5LOHA 3C7QA 1YRPA 1XQZA 5KZIA 2ZAZA 4RIWB 3MH0A 3G51A 3R02A 2C30A 4QTEA 5AR8A 4CGAA 5HBEA 3T3UA 4APPA 3DPKA 5DI1A 3D14A 3R7EA 5BYLA 3QXPA 1I44A 3I81A 3DDPA 2P2HA 5DFPA 5AR5A 1H1WA 1PMEA 4XG8A 3UYTA 4BVUA 2GSFA 3LLAA 2YCQA 5CVGA 4UMUA 4GCJA 4U5JA 4LI5A 3L1SA 4WBOA 4D1XA 4QMZA 2X0GA 4DFLA 4EKLA 3D83A 5JQ5A 2XEZA 4F9BA 4OTFA 4ACMA 3PWDA 4QP7A 2CKQA 4FSYA 3TDWA 2ZV7A 3TDVA 5BVEA 1ZYJA 2PVRA 3GCVA 2O0UA 5CNOA 2F2UA 3NUAA 1QCFA 1A06A 3PSDA 3GEQA 4FTTA 5BX0A 3C4EA 4CZUA 4YTHA 5CEPA 4PNKA 2C5OA 4Q2AA 1OVEA 3WZKA 2QKWB 4DFYA 3VHEA 4GT5A 3O17A 4OTWA 3OUKA 4FIJA 3NIZA 1H1SA 4I23A 1ZRZA 2HK5A 2R4BA 3ENHA 4FX3A 4XG4A 2PZRA 3C1XA 4HOKA 3VUTA 1U54B 4RZWA 3R04A 4RIOA 1CDKA 4GYIA 3Q4ZA 4YPDA 3DAEA 2A19B 3DBEA 3QWKA 4L3LA 4DGGA 3VS5A 1JWHA 3G0EA 4X2GA 5B2KA 5HX6A 4KS8A 3PJ1A 5KMOA 2OICA 4O84A 3RPSA 1Z5MA 4YZ9A 4O0VA 4CFNA 4D9UA 2Z02A 4E5WA 2C4GA 4M69A 2JAVA 4LV5A 5L4QA 3ACKA 3V8SA 2OKRA 4F99A 4MNEA 2VTRA 2Y4IB 3OTUA 4MKCA 4D4VA 2SRCA 5AMNA 4GK3A 4C3RA 3ZO4A 1O6YA 1IA9A 5FEEA 3FC2A 3DNEA 4YJRA 2BALA 1XBBA 1EH4A 3T9TA 3TT0A 5IH6A 5FTGA 2C3KA 4FYNA 4PDPA 4R3RA 4YHJA 3V8WA 3A7IA 1OM1A 4U81A 1QPCA 4L43A 5CSWA 4DHFA 3R7YA 2I0VA 2PVNA 4FK3A 5EW3A 4AACA 2QVSE 2C6LA 5CAVA 3GU4A 1VJYA 3IS5A 4HYSA 5C4LA 5TOZA 5EHYA 2WQNA 2BR1A 5AV0A 3M11A 4R8QA 2UZVA 1WVWA 5A14A 1R39A 2QOHA 2CJMA 3BWFA 5HG5A 3AC1A 3UQFA 4J53A 4D1ZA 4RWJA 3KK8A 2W99B 4YGAA 4A07A 4RGJA 1O6LA 2XJ0A 2W7XA 1Q8UA 1NY3A 3MB6A 3R9OA 1IAHA 2BHEA 2OSCA 3QRTA 4I4EA 1K9AA 1UWHA 5IDNA 3NIEA 4EOPA 5E8UA 5JGDA 5HCXA 4AGCA 5H8BA 1J7UA 5IPJA 2B55A 5AFVA 4APCA 3TKIA 2F9GA 3KF4A 3PXYA 5DA3A 4BDHA 4F6WA 3QC9A 2OO8X 4MNFA 5AV2A 2JDTA 3WYXA 4QQJA 3BKBA 3CCNA 4C4GA 2EXEA 2WTKB 5A9UA 3TUDA 3PIYA 5IQHA 5EYKA 3VQHA 2YWPA 2BAKA 5FXQA 3G9NA 1J7IA 1OKVA 2AC3A 5J5SA 4IVAA 4KAOA 5E8WA 3TTJA 3DAKA 3A8XA 1IRKA 3FMEA 3FLSA 3D5WA 3H10A 4WNMA 3PSCA 4ACDA 4O81A 4MQ1A 4DEHA 4PL5A 2CSNA 2UZBA 3I4BA 2YWVA 4QQ5A 4JG7A 2EXMA 4H39A 4WUNA 4AZVA 1W98A 3AD6A 3LFSA 5AR2A 2JGZA 5KBQA 4FT0A 5DVRA 4K0YA 3WF7A 4HGTA 3KEXA 2FGIA 4I5CA 4WOVA 5AJQA 5JK3A 3VS4A 5J1WA 3ROYA 1K3AA 3GCQA 3VNTA 1UA2A 4EHGA 3QD2B 4AS0A 4CG8A 5EOBA 2X81A 4TWOA 4J97A 3ZSGA 3FY2A 3SW7A 4JQ7A 4YLJA 4X3FB 5EM6A 4I6HA 3UNZA 3MY0A 4TPTA 4DITA 1BI8A 3L9PA 4KRCA 3P7CA 3CLYA 5EDPA 2V7OA 4O0WA 4UXQA 3LXNA 4BCIA 4BTMA 1PW2A 2HZ4A 1APME 4QT1A 3C4WA 4RJ3A 4IAKA 5HCYA 2W1IA 5ETIA 4ZLYA 4ZLOA 3V5JA 3VC4A 1BYGA 5JFXA 3I6WA 1PRYA 4L00A 2WTIA 2ITVA 3QD3A 5H9BA 4DG0E 2XK9A 3AC3A 3F7WA 4EOQA 5HI2A 3P9JA 2Z8CA 3A61A 3BEGA 4E5BA 2LAVA 3FC1X 2BAJA 3GU7A 2O2UA 4RLKA 2R3GA 4ANSA 4BZNA 4FV9A 4MWIA 3U9CA 5CTPA 4ALVA 4Y72A 2Y4IC 3D2IA 4RX7A 3IW4A 4TXCA 3N4TA 3QU0A 3LXLA 4JDJA 3ORMA 5CY3A 4FKLA 3SX9A 4NCTC 3MPMA 3OXZA 5C27A 3D2KA 3I7CA 3Q9WA 1MP8A 4D4YA 4HCVA 4Z55A 4QYEA 5HG7A 2PVYA 3OD6X 4MXYA 2B54A 3EN7A 4GEOA 5CYIA 2ZDTA 3PVGA 3UIBA 2X7GA 4AT5A 2CGUA 2QD9A 4C0TA 4YJSA 5DR6A 4FT3A 3K5UA 3E63A 4XG7A 4DLJA 2GQGA 2ZDUA 5BVOA 4PUZA 3L9NA 3MH1A 5F94A 4AE9A 2ZM3A 3O8UA 3LLTA 3ZH8A 3FHIA 4FEWA 3PLAE 3Q9ZA 4RC4A 1MQBA 1OL5A 4OT6A 3D15A 4R1YA 4EWQA 1XH5A 1XH9A 4DTKA 2ERKA 1M7QA 5CI7A 3NS9A 3KXHA 2OZAB 2VO6A 2DQ7X 2BRNA 5CQUA 4XG3A 2H8HA 1J1CA 2R3OA 1Q4LA 1GZKA 4BCQA 4F9WA 2GNIA 2HW7A 1KOAA 1YHSA 3HRFA 2QLUA 3ZRLA 3E64A 3UC4A 3LQ8A 4EQMA 3FMDA 2BROA 5A4LA 1OPJA 4MF1A 5CZIA 3N4UA 4BN1A 4BRXA 2V55A 4AT4A 2WTKC 5D7VA 4LM5A 5KE0A 1PMNA 1ERKA 4TKSA 2CCIA 3WF6A 5E7RA 2Z60A 4PMSA 4GK4A 3GQIA 4F7JA 3ANRA 4BZDA 2A0CX 4BDJA 4C34A 4D5KA 1P2AA 3QLFA 3R2YA 4I20A 4J8MA 1Q99A 3DZOA 4ZZMA 1O6KA 4FIEA 4DEBA 4L46A 2YCRA 5IH4A 2F7ZE 3BI6A 3DNDA 3DOGA 4R78A 2W4KA 1G3NA 2WQMA 4UB7A 2W1CA 3R9HA 4AT3A 1GIJA 3QC4A 1TKIA 3SRVA 3F2RA 4FV8A 4AA4A 2CDZA 2CGVA 1K2PA 4R7HA 4XV2A 3CKXA 3R63A 3QTZA 3BWJA 3C5UA 3UVRA 4D2SA 1FMKA 3P7BA 1JKKA 5JZJA 2X1NA 4B7TA 2VX1A 3QQKA 3ZXTA 4FC0A 5DT4A 3MY5A 3ZRMA 5DR2A 3TV7A 2WGJA 2XNNA 1JLUE 2XNOA 2GNJA 4F0IA 2ITXA 4BFMA 4QMUA 4U3ZA 2C6OA 2RIOA 2ZV8A 3AG9A 4X3FC 2G15A 4DH3A 4RFMA 4YHTA 2B4SB 2P55A 1WAKA 3EN9A 4V0GB 4BI2A 5ETCA 4IB5A 1CM8A 1ZYSA 4ACCA 2IVUA 4RVKA 5EI2A 3IG7A 2VTAA 1Y57A 3HMPA 2OG8A 1R1WA 4FTMA 4I0RA 4OR5A 4USDA 4FGRA 3R22A 4PL4A 3QQUA 4IJ9A 2OH0E 2OJIA 2C5VA 3UJGA 5IEXA 5KMLA 4FE2A 3V5QA 5LVOA 1TQMA 2IN6A 3UVQA 4GSBA 5DHJA 4ZXTA 4G6LA 4JQ8A 4GW8A 3QTIA 4USFA 3TZ7A 3EL7A 4E5AX 1R0PA 3K54A 4L68A 4RZVA 2WMSA 3LIJA 3OWKA 4IM2A 1H26A 4IBMA 4JIKA 5L6WL 3GXLA 5HO7A 4XS2A 1IAJA 5F4NA 4BYJA 3TNPC 4J52A 4MD7E 4FGBA 5F9EA 3BGQA 1G8AA 4C4FA 3HGKA 2R64A 5AP7A 4EBWA 2HZNA 2XB7A 4BIDA 1UNGA 4E6AA 4WSQA 3SOCA 5ACBC 5IQIA 2QG5A 3FXWA 4FIIA 3KXMA 2YIYA 3NDMA 3C0HA 4GVAA 3HZTA 3KRXA 5E8SA 3GGFA 5IQDA 3MIYA 2BAQA 2YN8A 2B9JA 2C5YA 2O3PA 2UW4A 3PZHA 5HNBA 3QCXA 2B53A 3R1YA 4AZWA 2YHVA 2BRBA 4FK6A 1YDRE 3SG9A 4MBLA 3ROCA 1SNXA 3U6HA 1CKJA 3PIXA 4ENYA 5IISA 4RX8A 3SLSA 4BWPA 1FMOE 2FSMX 2XZSA 3D9VA 3FQHA 3P5KA 4E4NA 4CTCA 3Q53A 2FO0A 3FZSA 3Q4CA 3TNQB 4OGRA 3QGYA 2HYYA 3R73A 4O7NA 2O64A 2JIIA 3RGFA 5F95A 4EBVA 2UVYA 4ZSJA 3T8OA 2OXXA 2G1TA 3IW5A 2OI4X 1WFCA 2RFDA 4W4XA 2I0EA 4NJ3A 2F2CB 3RMFA 2AC5A 2VTPA 4UY9A 2Y0AA 2XJ1A 1UNHA 5JRQA 3R83A 1R0EA 3KCFA 4IDVA 5FP5A 5HVYA 3GU6A 5CNNA 5CZHA 5LARA 4DC2A 5BUIA 2V7AA 4FKJA 3UO5A 3OP5A 2PE2A 3F3ZA 3NNUA 3Q52A 4OTGA 4RFYA 3ZHPC 4V04A 3ZZWA 4USEA 2CLQA 4G34A 5CEOA 3O51A 2NPQA 1ZZLA 4FUYA 5TT7A 4U41A 3V5PA 4BDBA 4BCMA 4D2RA 3BU6A 2W5BA 1KE5A 1XH6A 2XKDA 3R1QA 4BGHA 1WBWA 3KREA 4U7ZA 4DTAA 3LMGA 2WIHA 5JFWA 4Q9SA 4G3GA 3RAHA 4BDCA 5FD2A 2PZPA 4AXAA 3WZDA 4AOIA 2WPAA 3PY3A 5I9ZA 3EZVA 4BI1A 4RPVA 2WO6A 3IOPA 4MH7A 2VWUA 3QUEA 2IZUA 4QMWA 2VTLA 3P08A 4AZEA 2GTMA 1OBDA 5E8VA 3H9OA 3HMOA 4LGGA 5EYDA 3PPJA 5EYMA 4AN3A 1U5RA 3BE2A 4XG2A 3WBLA 5HTCA 2GQRA 5FEQA 5CU4A 3RHKA 1GNGA 3WIGA 4AA0A 2E2BA 3Q6UA 1O9UA 3F6XA 3MTLA 5AUUA 1YHVA 3NW6A 4FICA 5HNIX 3BU5A 4ZTHA 4AWIA 2VX0A 5KZ0A 3AXWA 3CGOA 2HAKA 4OT5A 4F1TA 5DE2A 4O0RA 3E8CA 3ZM9A 2PE0A 5DPVA 4AFEA 2BKKA 5FDXA 4YHFA 4C61A 4O82A 4D55A 3UMXA 2H96A 5HGIA 3ZCLA 1G8SA 5CU6A 4XEYA 4ZIMA 1YOLA 3OY3A 3QFVA 1JOWB 4EZ7A 2HWPA 3NNWA 4H36A 3Q4TA 4JBVA 4E3CA 1OMWA 2QG7A 3COHA 2GU8A 1IG1A 2J50A 4Y85A 5FG8A 3C5IA 2GS7A 4IE9A 4HVSA 1UKIA 5E8XA 4C2VA 3NUUA 5JGBA 3R7UA 4ANNA 2WMRA 2R9SA 3NAYA 3I0OA 4NSTA 2XIKA 4FV7A 2OU7A 2UUEA 3E93A 5DN3A 4AF3A 3ZC5A 4AFJA 4Y5HA 4O96A 3IDBA 3IOKA 3F5GA 3GFWA 2WXVA 1W83A 2JKMA 3LJ2A 1SVHA 3OTVA 2WD1A 3PG3A 1CKPA 1JQHA 3PPKA 3MDYA 4FTRA 4YZDA 3RCDA 4DINA 4S30A 4QMYA 3CPCA 3NWWA 3QUDA 5L8KA 5JZNA 3LFDA 2I0YA 4FTKA 2XM8A 3POZA 1Q24A 4QMOA 3LE6A 5E1SA 5M51A 3BGPA 4AW5A 2CGWA 2X2MA 2B9FA 4M8TA 4QPAA 3FZ1A 3MBLA 2WMQA 4RJ7A 4YBJA 1W82A 3S4QA 5CAOA 2JIUA 2E9NA 5ANEA 2X7FA 1XH8A 1OPLA 2JBPA 1XO2B 4YJUA 3RHXA 1URWA 2YA9A 1DAYA 1YI6A 2QU6A 3JY9A 3ORNA 5BUEA 4FTNA 3KL8A 3OEFX 4TZRA 5AUVA 5IA4A 3UNKA 3ACJA 3HV6A 3F66A 2GNFA 4OBQA 3KQ7A 4DCEA 4DBXA 4L52A 4YC3A 4PWNA 4ZP5A 4F7SA 4UALA 4P2KA 5BVNA 1BL7A 2PK9A 3QRJA 5EM5A 4YMJA 1GIIA 2PTKA 1XH7A 2RG6A 4UMPA 4CVAA 2W06A 1WVYA 3HNGA 3DLSA 4FZDB 4AP7A 3D5VA 4C7TA 4F7NA 1T46A 2X8DA 3DS6A 5IA5A 4CFVA 4X21A 5JKGA 3RNIA 1WBOA 4WRGA 4ZEGA 4IAZA 2PMNX 1R3CA 4M67A 5LWMA 5D1JA 2UVXA 2X9FA 3BHYA 1PXNA 1B6CB
chains in the Genus database with same CATH superfamily
3PY1A 2X4ZA 3DQXA 4IZYA 3ATTA 3NAXA 1TZDA 3H0YA 4MXCA 4JG8A 4GK2A 4I24A 3TNHA 4JAJA 4E26A 3U6JA 4AQCA 2PVKA 2QCSA 2AQXA 3HV3A 3IK3A 3NR9A 4C38A 4EH5A 3AGMA 1JSTA 3FI3A 3HUBA 1V1KA 2DYLA 4O6LA 4AZTA 5HU3A 3LCOA 3H9RA 2PU8A 4DG3E 2YIXA 5GIOE 4NFNA 3FMKA 2GHMA 3TI1A 4F9AA 3LFFA 1PHKA 3P86A 1ZAOA 3OEZA 3SKCA 5GNKA 1JSUA 2YITA 5EYCA 2OF4A 4UMQA 2ZV9A 3HMMA 5DR9A 2VWWA 2WTVA 3VWAA 5EQYA 3VUIA 2YM5A 4LFIA 4CQGA 3UE4A 5FXSA 1Q41A 5HD4A 3F5XA 1XWSA 5IEVA 4BCNA 4MK0A 4XH6A 4FKUA 1ZMUA 3GC0A 2WMAA 4QP2A 4O38A 2J7TA 5FLFA 4BC6A 2BVAA 5CAUA 5CSHA 3KRJA 4IAAA 2X2KA 3BEAA 4GG7A 3Q04A 5CEMA 4G16A 3CIKA 4FNZA 4DEAA 4IX6A 5FM2A 4QPMA 4C4IA 5GZAA 2WOUA 3BHTA 4GIIA 4YZMA 3ZYAA 5JEBA 3WF5A 4KIKB 4GH2A 4GS6A 3PA5A 2FSOX 3HUCA 3JVRA 5L2WA 3P7AA 2NRUA 4M97A 4FEUA 4ZTLA 3S00A 3WE4A 5EW9A 3MFSA 4L01A 2VTQA 4V01A 4FKVA 5M53A 2WFYA 1PXKA 3EB0A 2R3FA 5CLPA 3EJ1A 4BF2A 4I0SA 2J2IB 5IMEA 4IANA 4BDEA 2DWBA 4U42A 1T45A 4O0XA 2JFLA 3UC3A 4EJNA 3WYYA 5DEYA 2V62A 3RM6A 2ITPA 4ACGA 4EC9A 4TT7A 5K5XA 3NFGB 3ID6C 3ZMMA 3COMA 3D4QA 5AUTA 5GINE 4XNEA 3HAMA 1VYZA 3CJGA 4IADA 4AGWA 3FSKA 3FPQA 1ZMWA 2OIBA 4O0SA 2PVJA 2R0IA 4P7EA 1FPUA 3QTXA 4D4SA 2VWIA 1U46A 2I40A 2YFXA 4UYAA 4ZJJA 3QLGA 2QHNA 4AX8A 3W8LA 1URCA 5CU3A 2CN8A 4YURA 2YCSA 4IB0A 4IEBA 1KE8A 4E73A 2YIRA 3EKNA 4UBAA 4XLVA 1BMKA 1ZMVA 2X6EA 5K0XA 4O2PA 3WIKA 2J51A 2JDVA 2ZM4A 3V5TA 3NGAA 3R7OA 4HVIA 4D5HA 1WBNA 2Y9QA 4J99A 1WZYA 4RQVA 2YACA 5T6KA 1H8FA 2A27A 3RCJA 2YM4A 3DK3A 4FIHA 4AE6A 2IEWA 4FKGA 4U0IA 4ZLZA 4YSJA 3CP9A 4CCUA 3PRIA 3FL5A 4G3DA 4C58A 4ZZNA 1Y91A 1V0BA 4MCVA 3RWPA 3P5JC 3S0OA 4Y95A 4GG5A 1NVRA 4FIGA 4KB8A 5AA8A 5ETAA 3ORLA 4KINA 2X4FA 4G31A 4RJ5A 3DKOA 5HLPA 4BYIA 4L42A 3OXTA 3OOMA 4C4HA 2XJ2A 5J9LA 3E7OA 3DFAA 4G17A 3HMNA 2NRYA 1PXOA 3WZUA 4OTIA 4A9SA 5L8JA 3HP2A 4BCKA 2QQ7A 3TUBA 4LV8A 3W1FA 2F57A 4KRDA 2V0DA 3O96A 4B6LA 5HVKA 3UQGA 4IFCA 5AP2A 3BLAA 3ATSA 3PVBA 4RWLA 4NUSA 3PVUA 3PJ3A 4EORA 3MVLA 5BNJA 4HNIA 5DWRA 2J0IA 4EOMA 4F0GA 3F5UA 2JKKA 1YXSA 4GT3A 3TXOA 4PDSA 4O7RA 3ORIA 3DBCA 2EU9A 2OJFE 4FNYA 1KE9A 4UMRA 2JEDA 3O5AA 2WB8A 4LV7A 4FG7A 3BRBA 1FVRA 2XUUA 3ORXA 2UW8A 3FLYA 4YNOA 1PXJA 4L53A 4U6RA 5HU9A 3D5XA 2XRWA 2VN9A 4QO9A 4WSYA 3COKA 5JMSA 1J7LA 4FG8A 4J8NA 4NU1A 4O22A 4N0SA 5ANOA 2GS6A 4KKHA 4GVJA 1OIYA 4A4OA 3CBLA 3IGOA 3O7LD 3ZXZA 4OAUC 4NL0A 2BKZA 1GY3A 2YABA 5HIEA 3W0QA 1XBCA 4EK6A 4J71A 2OXYA 4EL9A 2GPHA 4MXXA 4L7SA 2IG7A 2WMTA 4JDHA 4FBXA 4FF8A 4TYHA 2UZTA 3IDCA 4WG5A 5D7AA 4YPSA 4Q9ZA 1YXXA 4IAIA 5AP6A 3PWYA 4P5ZA 3RPRA 4L3PA 3HLLA 1FINA 3AT2A 3GUBA 2J6MA 5LVMA 4TTHB 4XV3A 4J7BA 2CLXA 3UYSA 4XP2A 5JRSA 3KKVA 3BX5A 3WILA 4IVDA 1FBNA 3NNVA 3TL8A 3Q2MA 3OW4A 4D0WA 3OMVA 4FODA 4H3PA 5TO8A 4W8EA 3PXZA 1TQPA 4JRNA 4OAVB 3C13A 2O5KA 3PSBA 5LMKA 3ZRKA 2OK1A 4Z16A 3QWJA 5BVKA 3HA6A 3DCVA 4EOJA 4Z7GA 2R7IA 3HL7A 2QKRA 4OBOA 3U4WA 4EH9A 4IWOA 4FKWA 1DM2A 1WBPA 3R28A 1LUFA 3MH3A 4MD8E 2ZV2A 5AP0A 5ITAA 4H05A 3UP7A 3QZGA 4LGHA 3DZQA 5HKMA 4AXCA 4RVLA 2R3QA 3MPTA 3DXQA 2HY0A 3DBDA 1SZMA 1ZOHA 4AUAA 1GZOA 3PP0A 4RFZA 4YNEA 3R01A 4A7CA 2ACXA 3IPHA 3ZDUA 4F0FA 5CT0A 3DT1A 2YJSA 2XEYA 3NW5A 4M14A 5HG9A 3WZEA 1WBVA 4H3QA 1OI9A 3DJ5A 4O7ZA 3VUDA 4FV2A 4XOZA 2C0OA 5IF1A 4X2JA 1Q8WA 4QTDA 3ZLYA 4BDAA 3AC5A 3EWHA 3I5ZA 2W5HA 3CQWA 2CKOA 4I5HA 2VTHA 1W0XC 4RIYA 4UWBA 4DLIA 4NKSA 5JFSA 4Z3VA 4AA5A 1V0PA 3K5VA 4TWNA 3W55A 1PJKA 2ETKA 3IQ7A 3E3PA 1KE6A 2RG5A 4DFXE 3BU3A 3I1AA 2X8IA 4M0ZA 3F3UA 4I21A 3QTSA 4DCAA 3FE3A 5L6PA 3BHHA 4EJ7A 2W96B 3K3JA 3BYOA 3SV0A 3VW8A 1F5QA 5K9IA 4YTCA 2JFMA 4ZAUA 1Q62A 4WIHA 3R8MA 2WU7A 2WTJA 2W1ZA 2R5TA 2X0PA 3EQHA 3V5WA 4PNIA 2QHMA 4EOLA 4F9CA 1QL6A 3FQSA 4YUQA 3KULB 3ALNA 5HE0A 2VTMA 3BBWA 4CLJA 2IO6A 3NVMB 4DF3A 1OIQA 3TYKA 4JBQA 4RRVA 1FVTA 5BYZA 4LRMA 4TYGA 4GT4A 1PF8A 4BDGA 2JITA 5E8ZA 1OITA 2ZJWA 2BTRA 5AV4A 3O7LB 1FQ1B 4JNWA 2IW9A 4BTKA 4LOQA 5CEKA 2BPMA 3ETAA 4AG8A 4S31A 3MB7A 3NNXA 4I3ZA 4IX4A 4QYHA 5HICA 3VS3A 3E3BX 3KY2A 4YBKA 2PL0A 3ZS5A 2V5QA 2OLCA 3D7TB 3QHRA 1Y6BA 2WAJA 4U40A 4C35A 4JAIA 4F65A 4R5SA 4QP8A 5D12A 4EQUA 4JX7A 2IW8A 1H28A 1Q61A 1YWNA 2OJGA 2XKCA 4LOPA 4EEVA 5LXMA 4PTEA 1PKGA 1M52A 4WO5A 3VBXA 3QTUA 3RVGA 3KF7A 3LM0A 3OC1A 3IKAA 4RJ4A 3EYGA 5EQPA 1OIRA 3FDNA 3RPYA 3LJ1A 4GV1A 4QOXA 3UP2A 2FH9A 1SMHA 4F63A 4KBAA 4MBIA 4NFMA 5AM6A 3Q3BA 4ANMA 5C8NA 1Z9XA 3QTQA 4LG4A 1XBAA 3DJ6A 4G6NA 3AKLA 4ZSGA 4AAAA 1DI9A 4YLKA 2H34A 1ZLTA 4U97A 3C0GA 2RFNA 1OZ1A 3W18A 5AX3A 3RI1A 2PY3A 3EQBA 2CMWA 5G1XA 3UPXA 4CCBA 3JR1A 4WNPA 3CGFA 3FXXA 3QZHA 3M42A 3OVVA 4GFMA 4BWKA 5AV1A 5LCJA 3LMHA 3IW8A 3OT8A 3MWUA 5H2UA 5E1EA 1H1QA 4ZMEA 4CFFA 5J79A 1XJDA 5DH3A 3PXKA 5KX8A 2QO9A 2XK4A 2OH4A 4MTAA 4O7SA 4HCTA 4BR3A 2PE1A 5EM8A 1M2PA 4M15A 4NH1A 4EHVA 2ITNA 5IA1A 2GCDA 4ITJA 4KBCA 3ZLSA 4DH5A 3U6IA 1L3RE 4BCHA 5I9YA 1U4DA 3AKJA 2X0QA 2WEVA 4ITIA 3QCYA 1M2RA 2QOIA 2RFSA 3FHRA 4D2PA 4ZTSA 5BMSA 1RW8A 2W9ZB 4E93A 2QONA 1ND4A 4BGGA 4ZS4A 2ETMA 2XCKA 4O0UA 5CAPA 4GMYA 3QQGA 1J91A 1OKWA 3MJ2A 4L67A 4F78A 4PPBA 4PMTA 4WHZA 2Q83A 3CE3A 4XHKB 2XNBA 2XARA 3TZ8A 3QAME 2H6DA 2WEIA 3F3TA 4FL1A 4CD0A 2CGXA 4JXFA 4EOKA 2F4JA 3QZFA 4YC6A 4IFGA 3PTGA 4ANLA 1W8CA 4FZFB 2Y6MA 5M09A 3B8RA 4KD1A 3G90X 4HYHA 4BKZA 3P1AA 3W2SA 3D0EA 4I1ZA 4E20A 5DOSA 3LQ3A 3MV5A 1YVJA 4KSPA 3GVUA 4D9TA 3R1SA 3L8SA 2WMWA 3NX8A 4EK3A 3GB2A 4O7YA 5JGAA 4NM5A 4B99A 2R3RA 3ZM4A 3VUKA 2HELA 3OZ6A 4CNHA 4O7WA 4IIRA 4FTUA 3F7ZA 3ZEPA 1YWRA 4ORKA 1CSNA 3B2TA 3PJCA 1KSWA 4FKSA 3FLQA 3POOA 2OGVA 4QMVA 4XG6A 1AGWA 3W16A 4ZY5A 3PA3A 3HV5A 2BDWA 3UBDA 5C8MA 3CXWA 3ORPA 4FSMA 4O91A 4KIQA 5GJDA 4A9RA 4IAYA 2ONLC 3IONA 2IJMA 4QMLA 3P78A 3E92A 4CEGA 4R5YA 3P23A 5AP3A 3I79A 3AMBA 4OTQA 1ZY5A 3OBJA 5A4TA 5KMNA 1OGYA 3SC1A 4IAFA 5B0XA 3MESA 3AC8A 3UVPA 2XH5A 4J96A 4F7LA 3WI6A 2X6DA 1IA8A 1U59A 1VR2A 3ODYX 4UMTA 5BQ0A 4N4SA 5KHXA 5IQFA 4L45A 1SNUA 4X2NA 4FVRA 3DDQA 4L7FA 3ENMA 5HCZA 2PULA 4I6QA 4RIXB 5EQEA 2A2AA 2W05A 3I7BA 3RM7A 3DB8A 4Q5HA 3RALA 3U9NA 4D4RA 4BHNA 3LCDA 2C3JA 3FKOA 5AIKA 3TKUA 1V0OA 2XYUA 3W2OA 3QX2A 3NSZA 4LQMA 2UW3A 4BJJB 1H4LA 3II5A 3OS3A 4IDTA 4RBLA 2B52A 5HHWA 3KMUA 2HXLA 3BQRA 3H9FA 3SOAA 4E8AA 5M4FA 3KXGA 2ESMA 2W17A 3FYJX 4I92A 4TN6A 4C2WA 3CQEA 4AW1A 3W32A 4DBNA 4BDDA 1P4OA 2PZIA 3PZEA 4ZTRA 3VBYA 3LCTA 1CMKE 2R3PA 2XA4A 1DAWA 4EH4A 4LL0A 2WKMA 4IB1A 4DAWA 5KNJA 3ODZX 3GCPA 3ZBXA 2VV9A 4HVHA 5BUJA 1STCE 4N70A 4PY1A 1NVSA 1M7NA 3ULZA 4H1MA 5B2LA 2YDKA 5CALA 3Q32A 5L3AA 2YCFA 3MVHA 3G6HA 3ITZA 2IW6A 4OLIA 5DIAA 3LMIA 3KVXA 4KA3A 2YISA 1ZYCA 2GDOA 4PTGA 1X8BA 2PSQA 2VD5A 4QDVA 4FTCA 2QOLA 4IACA 3QYZA 2ZM1A 1KOBA 5HIDA 3R8VA 3ZEWA 5C4KA 2IVSA 3UPZA 1HCKA 5FDPA 2OIQA 1WBSA 1XHAA 4LMUA 4EUTA 4Y73A 5K0KA 3QQLA 3AC2A 4C02A 2VTJA 5CEQA 1U54A 4DG2E 3NYNA 3QF9A 4DDGA 3F5PA 4O1OA 1PXLA 4LUEA 1W7HA 3CY3A 3RPOA 4A9TA 2CKPA 5A6NA 4DT9A 1F3MC 2QURA 4Y46A 5EKOA 3A7GA 4IHPA 4M12A 3H4JA 5G6VA 1BUHA 3A60A 3LQ5A 1NW1A 3PJ8A 5D41A 4GUEA 4NW5A 1IASA 2ITOA 3G5DA 3LVPA 2Y8OA 1B39A 3QZIA 4FV0A 4I22A 4W4WA 2BZIB 4EZ3A 4HVDA 5IU2A 4QP9A 1DS5A 5E4HA 3VO3A 3CR0A 1REKA 2IWIA 4OUCA 3R9DA 3WARA 1ZWSA 1ZARA 4NCTA 3BV3A 5AR3A 3RKBA 3UQCA 3FMNA 1QPJA 3BYUA 4OBPA 3GOKA 5I3OA 3S2PA 4IM3A 3KRWA 4B9DA 2I7QA 3FI2A 2YM8A 3BLHA 2GS2A 3VS0A 4TYHB 1YDTE 4GJ2A 4GL9A 4M69B 4S33A 4O0YA 4C36A 5HTIA 4GU9A 4CMOA 2R3HA 5FRIA 3PIZA 1JNKA 4MNEB 4AW0A 4IQ6A 3MI9A 3QQHA 3KVWA 3FUPA 4QYGA 4QP6A 4CTBA 3Q6WA 3BLRA 3ZTXA 3A4OX 4FTAA 3PDTA 5AM7A 5DMZA 4FSNA 2CNUA 3BQCA 5HZNA 3RPVA 2JKOA 1OGUA 5AUWA 2W4JA 5H3QA 3FKLA 2PMOX 4FV3A 4NTTA 4E6QA 5KMKA 2VGPA 3HAVA 3NUPA 4JDIA 5CU2A 4DFZE 3C4CA 5EG3A 3E8EA 3NYXA 3VVHA 1M14A 4UZDA 2XAOA 4C57A 4IMYA 1UU8A 2G2IA 5GJGA 4ANBA 4JOAA 2FSLX 5GZ8A 3L9MA 4X0MA 3S3IA 3HRCA 5GIPE 3QXOA 1GIHA 3FLZA 4FKPA 4WNKA 4F1OA 3BL7A 5K3YA 4TRLA 3NMUF 3RK9A 3UOJA 4LOOA 4MBJA 3OW3A 4DT8A 2EWAA 1MRVA 1OL1A 2UZOA 5TKDA 4E6CA 4QMTA 4X3JA 2F7EE 1BX6A 3QCSA 4JJRA 2YLEA 5J1VA 2RSVA 3S95A 3TN8A 4BDFA 3QRKA 3RAIA 3MY1A 2C0IA 3HX4A 3R0TA 5LCKA 1A48A 4AXEA 2BDFA 4B8LA 5KCVA 2ZMCA 5J5TA 3S1HA 2RKUA 3BGZA 4FG9A 3GQLA 5DEWA 5T3QA 3MYGA 4AN9A 4EYMA 2AEGA 2XF0A 3HMIA 5CU0A 4ZS0A 1WMKA 2UW6A 2X0OA 2Y6OA 4HZSA 5CASA 4FEVA 2Z7QA 4JRVA 4ZY6A 3G15A 2QO2A 5CAQA 3OCGA 5IEYA 1Q97A 3KA0A 5CF4A 3V6SA 4C59A 4HYIA 3HEGA 5E8TA 2ITYA 4RSSA 4ZJIA 4CKIA 4BWXA 1H1PA 3F69A 4FTIA 3RAWA 2PMLX 4BDKA 3UMWA 2E9OA 5HBJA 4A4LA 4WD5A 2W5AA 3UO4A 3PY0A 5FP6A 2ONLA 4X3FA 3FZOA 4YO4A 3MJ1A 2YM6A 3C4ZA 3Q9YA 2VTSA 5AAFA 4JBPA 3FMMA 2IF8A 1YOJA 3N9XA 3OWPA 4N6YA 1KV1A 3VBTA 4DHIB 2J0MB 2VWYA 4FYOA 5M4UA 4W4VA 3HKOA 1OIUA 4GKHA 1QPDA 3DU8A 5HVJA 4DA5A 3RTPA 3DTWA 2WTWA 2CCHA 1LPUA 2XIYA 4IWPA 4FTJA 4CRSA 4UZHA 5CF6A 5JN2A 4G9CA 4I5MA 5KKRB 4II5A 5CX9A 3BELA 5AADA 4DFBA 2IZRA 2RF9A 3MFRA 4LYNA 2CNVA 2HOGA 1YI4A 2WTCA 4W9WA 4WNOA 3IGGA 4QMPA 4CQEA 5EFQA 4ZTNA 2W4OA 4QQTA 4XOYA 3ZO3A 3EQIA 3GFEA 3GCSA 1HCLA 2B7AA 3ZONA 3I5NA 3B2WA 4XJ0A 3UTOA 4F64A 3VS1A 1RE8A 3M1SA 3GI3A 5AX9A 5I3RA 2ZFYA 2VAGA 5CF5A 2UZWE 3EFJA 3ORZA 4YLLA 5KBRA 5A54A 3DQWA 3ZU7A 4DE4A 2QOKA 3LCKA 2XKEA 3NRMA 1Q8ZA 3BPRA 2F7XE 3ZUTA 2E9PA 3HYHA 4ALUA 2P2IA 3MFUA 3NCGA 2C5NA 1PMVA 4BL1A 4C4EA 4E4MA 4F08A 3FV8A 4DGMA 2LGCA 2EB3A 4E1ZA 4ZMFA 3C9WA 4DN5A 4O86A 3R8UA 4HW7A 3D5UA 3FZPA 3G6GA 5FEDA 3V3VA 2A98A 1PYXA 4FNWA 3ANQA 2FVDA 4NM7A 4I93A 1Y6AA 4EOIA 4RA4A 5LJJA 4PQNA 3DBFA 1JPAA 3TACA 3E7VA 2OZAA 4G5PA 5I4NA 5FM3A 5IG1A 2J9MA 3CKWA 4CFXA 2OFVA 4D0XA 4AAYA 5A3XA 3CY2A 5FBNC 2J5FA 4U3YA 1PY5A 4W9XA 4ZY4A 3FXZA 3DJ7A 4FSTA 3KFAA 4DTBA 3BZ3A 5CWZA 2FYSA 2ERZE 2J0KA 5JFVA 3W0RA 4DGNA 2JAMA 3G2FA 4EUUA 5L2QA 4ZSAA 2XMYA 5BPYA 3RK5A 1H24A 5TR6A 2ITTA 1H08A 5I9VA 4QDEA 2X2LA 3VUMA 5M4CA 3MTFA 2J0JA 4A9YA 5IUIA 1YI3A 4FV6A 3VF9A 3GT8A 3SGCA 4BCGA 3R7VA 4E4XA 4E6DA 2H9VA 2J0LA 4AGUA 3L8PA 3OHTA 3QQJA 2YEXA 3EL8A 4AW2A 2IVVA 3OCSA 2HY81 2C6MA 4K11A 2XCHA 4LGDA 4GIHA 4IXPA 5IQEA 1YOMA 4O4CA 2P3GX 3KMMA 1OL2A 2QOBA 4G1WA 5M56A 3L9LA 5FUTA 2Z7RA 1OKYA 3JUHA 2G2HA 2UW7A 3BV2A 4C3FA 3F61A 4ZJVA 4IVCA 4D1SA 4MWHA 4HJOA 3KN5A 4XV9A 3ZSIA 4UX9A 2YJRA 3DKFA 5DBXA 3FMLA 4K18A 4Z7HA 3F9NA 4G5JA 1NXKA 2A1AB 2XK8A 4MAOA 3TZ9A 3OXIA 3UG2A 4UEUA 5HE2A 4ANQA 4UYNA 3OY1A 1UU7A 3UIMA 3EN5A 4PMMA 3SRVB 4BTFA 1XKKA 5AUYA 3NZ0A 3UDSA 2WTDA 2C68A 3V5LA 3AGLA 5LVPA 2KULA 2BIKB 3F2AA 5CSVA 2C3IB 5A4CA 4ARKA 4BIBA 3MGYA 4GKIA 3R7GA 5AA9A 3F3WA 1XMLA 4H1JA 4P5QA 4ANOA 3MH2A 1KE7A 4M3QA 4O7LA 3OROA 3LJ0A 2UV2A 4IZ7A 3E5AA 2IZSA 4FTLA 2QC6A 3ELJA 3VW6A 3HRBA 5HO6A 2Y4PA 4YTFA 4JS8A 3HV4A 3OUNB 4IC8A 5D9HA 3NEWA 4DH8A 4CKRA 4FV4A 5M06A 1MQ4A 4JG6A 3RZBA 2NP8A 4O1PA 4CRLA 4XYFA 3Q9XA 5HE1A 4CT2A 1OL6A 3MFTA 4NEUA 4NW6A 2I1MA 4S32A 3AD5A 1YDSE 4TNDA 2C69A 3R8PA 4HCUA 4FZ6A 4RJ6A 1YXTA 4C3PA 4GU6A 2WQBA 3A2CA 3A4PA 3QGWA 4LUDA 3AQVA 4TNBA 1WCCA 2R3JA 4K1BA 4K2RA 5CF8A 1LP4A 5EI8A 4CYJA 4EH7A 4YP8A 2OWBA 4R7BA 3F3VA 2WMBA 4NIFA 3FPMA 3FAAA 3JXWA 3DAJA 4JR7A 5EOLA 3SXFA 4FEQA 3I6UA 4QP1A 3UODA 1PXPA 3VS6A 2GMXA 5JH6A 5KMJA 1J1BA 3K3IA 1ATPE 5IA3A 1R78A 1WBTA 1YKRA 5KMMA 3LW0A 4IW0A 3V51A 3O23A 4TL0A 4EONA 3A8WA 3HDMA 2PZ5A 4IWQA 3EN6A 3PYYA 2WOTA 3NYOA 4R3PA 4EOSA 3UOHA 4XG9A 5E92A 4HPTE 3LAUA 4A9UA 2QU5A 4QP4A 2B0QA 4G9RA 3UDBA 3ZFXA 2GNGA 4IB3A 5I9UA 3R8ZA 4QNAA 3FZTA 1SVGA 1L8TA 3W0OA 3TEIA 5A4QA 4KS7A 4UXLA 3ZZEA 3TJCA 5DG5A 4FTQA 3KGAA 5C8KA 3DB6A 4GYGA 4RWIA 3KIOC 5E91A 3FLNC 4AGDA 1Z57A 2RGPA 2R3IA 3UG1A 5AR7A 3PUPA 4W8DA 3THBA 3V8TA 2WMVA 4DHZA 3R7IA 4FOCA 2BZKB 2XRUA 4FVPA 3BLQA 1FGIA 4ERWA 3AMYA 2YAAA 1YWVA 3VJOA 3WF9A 2C5XA 4XX9A 4FJVA 3REPA 3ALOA 4AZFA 4BBEA 5HOAA 3DA6A 1PMUA 3V04A 4M13A 2GFCA 4I0TA 4ONAA 1UKHA 2VNWA 3JPVA 4RJ8A 2OFUA 3PP1A 4XP3A 5EHOA 5J9YA 3JS2A 4IH8A 1LEWA 1H0WA 1RQQA 4BCPA 4D2VA 4ASZA 3AMAA 1RJBA 3Q2JA 4X6RA 3VBQA 4BGQA 4A4XA 4CFUA 1ST4A 4NTSA 3UZPA 2BMCA 3LZBA 1Y8YA 1YXVA 3E87A 5B2MA 1NT2A 1JSVA 5FBOA 2B1PA 4O4FA 4D58A 3KXXA 3LXKA 3VUHA 4RVMA 3NUYA 4UWYA 1H07A 3QHWA 1YW2A 1ZOGA 2XK6A 3N51A 3DLZA 1LR4A 1GAGA 4FOBA 3UZTA 3O2MA 3W8QA 2QODA 2XNEA 1ZXEA 3EQDA 4CFWA 4AU8A 3FL4A 4X6QC 4ZK5A 3DTCA 3MVMA 2Z7SA 3SXRA 5K5NA 3R21A 4EH3A 5CXZA 2JIVA 3UOKA 5IQGA 3IO7A 4NM3A 1E1VA 5AWMA 5CSPA 2VNYA 4I6FA 4I94A 4N57A 2XIXA 1I09A 4CMTA 4M66A 3O8PA 4TYJA 1IEPA 2VO3A 2ETRA 3W33A 4UWCA 1OKZA 2BIYA 2EUFB 1VYWA 2ZVAA 3A7FA 3E62A 4M0YA 4EC8A 5B7VA 2W1FA 3Q4UA 1ZYDA 4FZ7A 3MN3A 2XIRA 4MX9A 3IW7A 4PV0A 1S9IA 4D2TA 5K4JA 1BKXA 5J7HA 3CQUA 5L8LA 4RMZA 4CV9A 4IZAA 3KRRA 4PX6A 4L44A 3O8TA 4YJNA 2BFXA 5CEIA 4ZZOA 1UWJA 2VRXA 3T3VA 1ZZ2A 3OT3A 5H8GA 1REJA 5A4EA 3R71A 4RVTA 5TF9A 4E7WA 3W10A 4LRJA 4BCOA 3O50A 3TKHA 1ZOEA 5EM7A 3MIAA 3ZSHA 1KV2A 2GHLA 3SG8A 5L2TA 5ANGA 4M7IA 2WELA 3LFAA 4KNBA 3LFBA 4DYMA 3VAPA 3U87A 3O0GA 4J98A 1YXUA 3LM5A 4JR3A 3ZFYA 4YSMA 3NW7A 3GOPA 4ZSLA 4ZTMA 3Q96A 2J90A 4M68A 3KN6A 4MD9E 3MA3A 1QMZA 4ZSEA 2OIDA 3W0NA 4H3BA 4CSVA 2ZB0A 1VZOA 3I60A 4JT3A 2BUJA 4EQCA 4CKJA 3UOLA 3L8VA 3EH9A 3KK9A 3DBQA 3EHAA 4QMXA 4EI4A 2NNWB 3GCUA 5LQFA 3LXPA 4MEDA 1W2DA 3GU5A 3SD0A 3U51A 3KC3A 4ASDA 2R0UA 4RT7A 5CI6A 5IUHA 5L6OA 2Y7JA 4YJQA 1LEZA 3R9RA 1Q8YA 2HWOA 5CXHA 1G5SA 5IUGA 5KMIA 3FQEA 3MA6A 3BYVA 5AP4A 1H00A 4FI1A 2IPXA 5IA2A 2R3KA 4JBOA 2QI8A 4FT5A 4V05A 2XNPA 4EOOA 1NVQA 3FI8A 2OJ9A 2YLFA 4FR4A 2DUVA 4RLLA 3EIDA 1U5QA 4FV1A 4J95A 2VTOA 5HG8A 4X2KA 2GFSA 5FQDC 4ALWA 2WQOA 4ACHA 4D28A 1CKIA 3QUPA 3NYVA 3PXRA 5BMMA 3DK6A 3TG1A 3OOGA 2EXCX 2GNHA 2X8EA 3ORKA 3K2LA 1E1XA 3SAYA 4BCJA 1XR1A 3EN4A 4L6QA 2YAKA 5HORA 3RJCA 2XVDA 4LMNA 2E9UA 4O4BB 4O83A 4XP0A 3BYSA 3W2RA 3CJFA 3U4UA 2BTSA 1JKLA 1OL7A 3EQCA 3C50A 3OWJA 4W4YA 5DRBA 2IZTA 2VTNA 1Q3DA 3JY0A 3W2CA 3NUXA 5CT7A 4EH2A 2O63A 3GNIB 5C01A 2PPQA 5M07A 3B8QA 2QO7A 3Q5IA 4YJPA 5IA0A 4QMNA