4WNMA

Syk catalytic domain in complex with a potent triazolopyridine inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
273
Chain Sequence
VYEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title A Novel Triazolopyridine-Based Spleen Tyrosine Kinase Inhibitor That Arrests Joint Inflammation.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 273
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4wnmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4wnmA01
3FI8A 1P4FA 4NCTA 5AP7A 2VNWA 5EHLA 4G3EA 5A46A 5IEXA 1ZOEA 4NM3A 3KRXA 2H9VA 1JQHA 4XLIA 3PP1A 2XNNA 3S95A 1UV5A 4ZMFA 5HG5A 2QOLA 1LUFA 1PXIA 3PSDA 4X2GA 5HX6A 5C01A 2PMNX 3C4ZA 3QD4A 2PWLA 5I5ZA 2VTSA 4MXYA 3F3UA 4D55A 2QD9A 3ORMA 4PV0A 4MEDA 3F69A 3MB6A 4O0VA 3EN7A 2WMUA 4IX5A 4QD6A 2P2IA 5FEDA 3UYTA 4E4LA 3EIDA 3CQEA 1UA2A 2VV9A 2YEXA 3ORLA 2PZRA 3AD5A 3AT2A 3GGFA 4KIKA 4UXLA 4E6QA 3SRVB 5ACBC 5KHXA 1H1WA 3EQRA 2Y4PA 1O6KA 2OI4X 3VS2A 4FNZA 2BMCA 4XV2A 3KQ7A 3D15A 2YDIA 4FT9A 1HOWA 2B55A 2Z2WA 5HCZA 5L8JA 3TXOA 5C26A 4BDFA 4LMNA 3BEAA 4BZNA 4MX9A 4PRJA 3CPCA 3L9PA 4RZVA 4RVTA 2IZTA 5J8IA 3FL4A 4C33A 2VTMA 4BGGA 1Q97A 2XVDA 3QRJA 4I41A 4YJUA 1UWJA 5F94A 1YW2A 2GNGA 3KULB 2E9OA 4FGBA 4L6QA 4RIOA 5AM6A 5EW9A 4I0TA 5JQ8A 4A4OA 4EKKA 4ACGA 4JRNA 4AG8A 5CU2A 1XH5A 2YABA 5IQHA 1JSVA 4QMYA 4TTHB 4YHFA 1R0EA 2BFYA 3BGPA 3ZS5A 4F6WA 5LOHA 3E8EA 4FTTA 4RWLA 4A9SA 1Q41A 3LJ1A 3RMFA 1YXVA 4ZLYA 4W8EA 4F63A 2BALA 2XIRA 3K54A 3TNPC 5AA8A 3N4UA 4GFMA 4BYIA 4CKIA 5BNJA 3KXZA 3AXWA 4HGLA 3DLZA 3NDMA 4WO5A 5E8XA 3HDNA 4M3QA 2I0HA 5EYDA 3ZXZA 2Y9QA 4AN9A 4O83A 5M09A 5E8VA 1BUHA 3Q6WA 1QPCA 3BLRA 2HENA 3LXLA 5FTGA 4GIHA 3FLNC 5IMEA 4Y46A 1OBGA 4O81A 2WQBA 2PZ5A 3F5XA 3MY0A 2CDZA 4K8AA 5GZAA 4IFCA 3MDYA 4GG5A 4Y5QA 4GUEA 3FL5A 2A1AB 3IDCA 4FVQA 5HTCA 3MS9A 4J52A 3COIA 4U79A 3EQFA 3NVKI 1YDSE 1G3NA 5CT0A 4M69B 5CALA 3MFRA 3OWLA 2XNOA 3P4KA 3I6WA 3AC3A 3EQGA 4WKQA 4W8DA 4UZDA 1WCCA 4UWYA 2VTQA 2IVUA 3FMJA 1OL5A 2WEVA 1KOAA 3NUSA 3ID6C 5K0KA 5FP6A 5CEQA 3FUPA 4JDHA 3U54A 1SVHA 2WB8A 4RJ6A 5FM2A 1RJBA 4EK5A 4AACA 1KWPA 4PNKA 4IW0A 3ZUUA 4EONA 5DH3A 3FY0A 5LVPA 5LWNA 2PUUA 5D11A 4C4IA 5ITAA 4NIFB 1VJYA 5HNBA 5BMSA 4F99A 1R3CA 4QMZA 3BRBA 2G1TA 2PVLA 3D83A 4HPUE 2BHEA 4J8NA 3UMXA 2OF4A 5E1EA 4DFNA 4NUSA 4ZTNA 5HNIX 5C9CA 5T3QA 2WU6A 3ZXTA 3HP2A 3R63A 4MD8E 5CVGA 2QHNA 2VWXA 2JKKA 4LL0A 3SGCA 2F7EE 2JBPA 3ZYAA 3DV3A 2X9FA 4K1BA 4QP3A 4DGGA 2P0CA 1QCFA 3UYSA 2ZM1A 4RJ3A 3CJGA 2XA4A 2ZVAA 3O51A 5I9YA 4ZS0A 4BC6A 2PVKA 5K5XA 3DB8A 2PTKA 2XRWA 4ZY5A 4O21A 5IEYA 2VGPA 5CSHA 5BMMA 4Z7GA 4IB0A 4BCGA 3G9NA 5E9EA 3EZRA 2W17A 4HZSA 4E26A 4U3ZA 5CTPA 5EK7A 4C36A 4O86A 1OZ1A 4AA5A 4YLKA 3R8MA 4AZSA 2XEZA 2VO0A 4AF3A 3VBWA 1STCE 3LW0A 2R64A 3PUPA 4XG2A 4KABA 4O7VA 4NM5A 5FEQA 3AGLA 3O71A 2X9EA 2OFVA 3ZM4A 3C0IA 4KBCA 4C3FA 1UKHA 2GNJA 2JDVA 2V7OA 1OL1A 3EL7A 2OXXA 3KL8A 1LEWA 4D1ZA 4X2FA 4UZHA 4IZYA 2J0IA 1BKXA 3O8TA 4F70A 5CAUA 4P7EA 4U45A 1NA7A 2CN8A 3RPYA 4GMYA 3VBTA 2XJ0A 3QHRA 4G1WA 2W1ZA 3I79A 3Q32A 4N6ZA 2XK8A 3ACKA 2R3NA 3M11A 5TE0A 4F7SA 4XCUA 4AT5A 4PMPA 3R73A 1XO2B 1WBTA 4BDIA 2PU8A 5AA9A 4M12A 3EYGA 4JXFA 4OTDA 3DJ7A 4RIWA 3RINA 2HY81 3ANRA 4UEUA 4M8TA 4YJQA 5I9UA 3FAAA 4EH3A 4I23A 2C5XA 5CX9A 4N57A 3P9JA 2R7IA 3FSKA 5IQCA 4PDPA 4EH6A 1YHWA 4MHAA 5EM6A 1DAWA 2JBOA 4G2FA 3EZVA 3RAWA 1ZOHA 3RP9A 2CPKE 4GT5A 3TT0A 3TI1A 3OT3A 4EWHA 3KEXA 4ANOA 4X7QA 2WOUA 2OK1A 3LOKA 5KKRB 1B39A 3PVGA 2DQ7X 4BTJA 4YC6A 1T45A 1J91A 1UU8A 2VNYA 3ZTXA 3PDTA 4EWQA 1FGKA 4GL9A 2J0KA 3B2WA 3SX9A 3TZ9A 2Q0BA 4ZMEA 4FV9A 2OZOA 4BI2A 4JOAA 4IVCA 2QG5A 3CTQA 1LP4A 4FIHA 4IZ5A 2YLFA 4I6HA 2VRXA 2HZ0A 3F82A 3JS2A 3P5KA 4N4SA 5AM7A 3R7GA 3R7OA 4CFVA 1DAYA 4HVGA 3AOXA 3EH9A 3WZDA 2WMRA 3HV7A 4JG7A 3FXXA 4XH6A 3CE3A 3QQJA 4PTEA 4UY9A 5EHYA 4D9UA 3GCVA 2R0UA 3MYGA 4BDGA 2XNMA 4IIRA 3I0OA 3Q2MA 3Q52A 4KINA 2FSTX 4DH1A 5LARA 4JIAA 4RX8A 4E4MA 4RA4A 3V6SA 3NNUA 3QYZA 4IFGA 2QO7A 2VO3A 4KKHA 4W4WA 4WRSA 3KXNA 2ETKA 4LL5A 4OT6A 3L8XA 3GFWA 2VTAA 4D58A 3HMMA 4FV6A 3VS6A 3PPJA 1OPKA 5HG9A 4BCNA 3TNQB 2R9SA 1VEBA 4IVAA 5B2KA 2HOGA 2WTDA 2BZHB 2EB2A 3DS6A 4LG4A 3Q5IA 4M0ZA 4N6YA 4ZIMA 1I09A 2VX1A 5JKGA 3DDPA 3S2PA 2B4SB 2BR1A 3FC1X 3DAEA 1BYGA 3VS4A 3W10A 4EH7A 5IQFA 4IAKA 4ACDA 5BVOA 4EORA 2X0GA 4P90A 3QUPA 4AGUA 4DFYA 5HI2A 3NNVA 4AA4A 4JI9A 3ATSA 5ICPA 1JBPE 4FMQA 3MTFA 4LV8A 4BN1A 5DIAA 4FIJA 3MH2A 2GQRA 1ZYSA 3IK3A 2WMWA 2JIIA 3SD0A 3QD0A 5J79A 3QD3A 4RSSA 2XCKA 4YTHA 3BGZA 1E1VA 3QL8A 5J95A 1KV2A 2QVSE 5B2LA 5J87A 3R22A 3TUCA 5AV2A 3R1SA 1SM2A 3PXZA 4GJ2A 2BCJA 4JIKA 4QYEA 4N0SA 4QMPA 1XWSA 4FTNA 1O9UA 1O6YA 1UVRA 3DAKA 4CMTA 3KB7A 4OLIA 3ZC6A 4YTFA 1ATPE 4BCFA 3HMPA 4MKCA 3UOLA 1M7NA 2YIQA 3R8LA 4IAAA 4K18A 5L4QA 2VTJA 4I5CA 3DK7A 3VHKA 5KBRA 1OKWA 4BGHA 3VULA 4K77A 4RIXA 2QG7A 3VO3A 2RGPA 1P5EA 3F3TA 4NH1A 2C4GA 2R3QA 1ERKA 2E9UA 2P4IA 2BRMA 4KD1A 4QMUA 5CU3A 4PTCA 3C13A 2IZRA 5HOAA 3VJNA 2B1PA 4S30A 4QMQA 3LIJA 3Q96A 3VS0A 4TYEA 1IEPA 4W9XA 4R8QA 4IMYA 5AIKA 2JLDA 3FBVA 4WSYA 5CSVA 5ETIA 4CNHA 2ZV8A 3UVPA 2ITOA 3IOPA 3TDVA 3ZLYA 3PXFA 2V22A 5EI2A 1SVGA 1MP8A 2VD5A 2W1GA 3HNGA 4KUJA 4HYHA 1ZZLA 4JG8A 4CZTA 1YQJA 3P7CA 4O0YA 5IA2A 1XHAA 1URCA 3HAVA 4GSBA 4YGAA 5CS6A 4Z3VA 2BZIB 2OICA 3I60A 2R3KA 5JRQA 4QYFA 2C5OA 3BWJA 4J97A 3R9RA 4IJPA 5ETCA 1ZYCA 2UW7A 4FYNA 5CF8A 3HECA 3K3JA 4JL9A 3UZPA 3EB0A 4DLIA 3FKNA 2W99B 1OUKA 3VHEA 2YM3A 2VWWA 1B38A 3QQHA 4DFZE 2XKEA 2WMAA 3ENHA 4O6LA 3CBLA 4RRVA 2QOKA 4O7YA 3SG8A 3LMIA 3RAIA 4I5HA 2W4KA 3MWUA 4CFFA 3QAME 4EHGA 4DEHA 3PJ2A 4NWMA 4F7NA 2BZKB 4FEUA 2O2UA 4FSQA 5T68A 3PSBA 3Q9XA 3QZHA 4FTIA 2FA2A 1E1XA 3GBZA 3BLQA 4TWOA 3FC2A 2EVAA 3QTQA 3RZBA 4QTDA 4FICA 1BMKA 3LCOA 3OFMA 4KKEA 2JKOA 4F6UA 5E8YA 4D5KA 2XJ2A 1H1RA 1APME 3CPBA 4B7TA 4BDEA 2XF0A 5CAPA 4KB8A 2CMWA 2WTCA 4P5QA 4C0TA 3OTUA 3Q53A 3MVJA 2ZV2A 1WVWA 3NUUA 1Y57A 3H3CA 2C69A 4YJVA 3D7TB 5JK3A 3U6JA 4C37A 2BRNA 4C3PA 5AUUA 3UC4A 5BVKA 4AFEA 4YMJA 4PQNA 2RG5A 2ITYA 4MD7E 2GCDA 2WMQA 3DBQA 3PXYA 3R2YA 5E1SA 3Q4UA 4YTIA 3VVHA 2R7BA 4M68A 2BTRA 5DG5A 5EYMA 3ZO2A 4C3RA 5FRIA 5LWMA 2BKZA 3KMUA 2UVYA 3FZSA 4LI5A 5DPVA 3PA3A 5HIDA 2YZLA 3BKBA 3AC1A 2VWBA 3H30A 3OEZA 3DKCA 1PJKA 4U5JA 3R02A 5IA5A 4YC3A 5EYKA 4E6CA 3OWJA 3FMHA 1H28A 3NEWA 3K2LA 1OUYA 2VTRA 4G34A 5FEEA 5J7HA 2GHLA 1AQ1A 4J7BA 4RC3A 2XYUA 2YAKA 2OSCA 4JQEA 5H3QA 2ZOQA 4CV8A 3D4QA 4L67A 3DK6A 1PYEA 4WNMA 4IVDA 3BV3A 4ASDA 3HZTA 3MJ2A 2UVXA 3U4WA 1J7LA 4K11A 5FP5A 3V3VA 4MQ2A 5CEIA 3QLFA 3AMYA 3R8UA 5BVNA 4KS8A 4S32A 3V8SA 3WE4A 1P14A 1WBNA 2GNLA 3F6XA 3MGYA 4WUAA 2I7QA 4GH2A 4B8MA 4XEYA 4KIPA 4CFMA 2ACXA 1J1BA 2C3LA 2IVSA 3FI4A 2QCSA 4UYAA 3MESA 2I1MA 1H01A 1PRYA 4O7TA 2ZMDA 4CRLA 5I4NA 3S1HA 3OBJA 4MK0A 5D12A 4FL2A 3KCFA 1FINA 2PVNA 3BHTA 3RPVA 4CRSA 4ORKA 3KK9A 4WG3A 1LPUA 2WTWA 5E8UA 3SLSA 3QQKA 4DBXA 4N70A 4EH9A 2BDWA 2YITA 1OBDA 5DNRA 4L68A 2GHGA 4WA9A 5K0XA 3IS5A 3ULIA 1FVVA 5EQYA 5M4IA 4AU8A 2UZVA 1BL6A 3FI3A 4M67A 1ZY5A 2GFCA 3EWHA 4FF8A 3T9IA 2QOCA 2JIUA 2IVVA 2AYPA 3F3VA 5GZ8A 2X4FA 3PRFA 4XJ0A 3OEFX 4BWXA 3F3WA 3SXFA 3TZ7A 3DBEA 2J0MB 4FKQA 2QR7A 2XYNA 5DOSA 5H8EA 4O96A 4G6NA 3VQHA 3BU3A 3H0YA 2OIBA 4KRDA 5I3OA 3JR1A 4G3DA 1E9HA 4F9BA 4IANA 3GT8A 4QNYA 3SW7A 4ANLA 5A6OA 4I5PA 3OT8A 4ITIA 5HGIA 1Q3WA 4YSMA 4B6LA 5AUVA 3ZDUA 3AT3A 2OKRA 2VO7A 3NMUF 3TNWA 4NTSA 4IZ7A 1GIJA 2C0TA 2XMYA 4USDA 3KGAA 4EBVA 4F1TA 2B9JA 2GNFA 4EOSA 2X6EA 5HESA 2CGUA 4AUAA 4YZ9A 4C4JA 4BHNA 5KBQA 1RE8A 3QTIA 4R5YA 5CU4A 4W4VA 3KCKA 2Y7JA 2HZ4A 3QBNA 2V62A 1GIHA 1GIIA 2XZSA 3ALNA 4WNPA 3KXHA 2QU6A 4IWQA 4MNEA 3SAYA 2YM6A 4A4XA 5HU3A 5FWKK 4QP9A 3QXOA 5H8GA 3BWFA 4IDTA 3RM7A 3R7IA 3UGCA 2XNPA 2UW4A 2G15A 4B99A 4ZTSA 4FG9A 3A7IA 3RTPA 5A4LA 4LOOA 4Q2AA 4KKGA 2XNEA 4IWDA 2WQEA 1U59A 3LCSA 3ZU7A 3IW6A 3V51A 4BIEA 4EUUA 4ZP5A 3IW8A 3S3IA 2BVAA 5IH5A 3UQCA 2CCHA 3FZ1A 4FV7A 4LYNA 5F4NA 5AV4A 5BUEA 3GXLA 3D5VA 4KNBA 3R2BA 1PYXA 3MSSA 4J8MA 4F9AA 2FYSA 4XMOA 2X2MA 4WHZA 5HCXA 4EZ7A 2A4LA 2W1IA 3VWAA 3AMAA 3D9VA 5ANGA 3OROA 3TKIA 3R9NA 3UO6A 3ZEPA 3E8NA 1RQQA 3LXPA 3NW6A 3RCJA 1VR2A 5DEYA 4CFUA 4CMOA 4DTAA 2FSOX 1HCLA 2WMSA 3PJ3A 3V5TA 2W5HA 5CXZA 2Y4IC 5AJQA 5AP4A 1H27A 4YZDA 2OG8A 2WMBA 3I7BA 5F9EA 3EKKA 3E7VA 4AP7A 3P78A 2WQOA 1IAJA 2OZAB 4FKLA 4B8LA 2UZNA 3PY3A 4PMMA 3TG1A 2IW8A 3GEQA 5AP0A 4PF4A 3THBA 1CDKA 4FI1A 5HLPA 3CCNA 2RFSA 2ITNA 3PXRA 4QYGA 3H9OA 4CMUA 5I9ZA 2IN6A 1PY5A 1WFCA 2XKCA 3N4VA 4A9YA 2VU3A 4IVBA 4MD9E 4BIBA 3EFWA 3QTUA 4YBJA 3DU8A 4FKUA 3F7ZA 2QHMA 4X3FB 3LXKA 4BCQA 3ANQA 4JAIA 4OTRA 5E8SA 3UMWA 2A27A 3R6XA 5M4UA 4EZ3A 3RNIA 5JN2A 3G15A 1UU9A 4M7IA 3FHRA 4RVLA 5L2SA 2XS0A 4DYMA 4RIYB 5D7VA 2GSFA 3KREA 3H10A 3ZRLA 3REPA 2Y0AA 3R28A 2FH9A 3QHWA 4FC0A 2R2PA 3BYOA 3HV4A 4ZTLA 3A4OX 4ITHA 4NU1A 3T8OA 3MPTA 3CXWA 2UW9A 2YCSA 3DY7A 3E62A 2J5FA 2V55A 3BEGA 3BHUA 3Q04A 3R04A 4FODA 4IB1A 1JVPP 4PY1A 4BIDA 4BTFA 4E5BA 3UOHA 2ZDTA 1YXTA 1IA8A 5AR3A 2W1EA 4L8MA 3K5VA 5HE0A 4O0WA 3TWJA 4R78A 3ZZEA 4AWIA 4E6DA 5M07A 1XH7A 4CTCA 3EQBA 4J98A 5EG3A 4U43A 5HVJA 1Q62A 2QQ7A 1XBAA 4FV3A 2XIXA 3U87A 4FG7A 3N51A 4FGRA 5JGDA 1H1QA 4H39A 4BCMA 4G31A 1CMKE 4GYIA 3L8SA 1RW8A 4KSQA 3LLTA 4L46A 4YBKA 3NW5A 4JRVA 4BL1A 2BDFA 4DGOA 2VN9A 3BLHA 1OB3A 1WBWA 4I92A 4DAWA 3IQ7A 3DAJA 1VYZA 4FKSA 5HQ0A 5IPJA 3F5PA 4AZTA 5LMBA 4PUZA 4EUTA 3VC4A 5IUGA 2UW8A 3LVPA 5I9VA 2C6IA 4IBMA 1F3MC 3PG3A 3VJOA 3ZDIA 5DEWA 5CASA 3E8DA 1REKA 3EN6A 1K2PA 4YUQA 4G5JA 5J1VA 4XG6A 2UZWE 2QLUA 3DZOA 3HDMA 3OY1A 4L7SA 4I4EA 1FPUA 3PFQA 1MRYA 3Q9WA 4ASZA 5IQDA 3VAPA 3DKGA 3HVCA 4EBWA 3DGKA 3GQLA 3RK9A 5J5TA 2QOHA 4R77A 1OIQA 5CXHA 3A7JA 3B8RA 3I4BA 4CKRA 4ZY4A 3DK3A 3UPZA 4BRXA 3KVXA 1YDRE 4D2SA 2CCIA 4RX7A 4XBUA 5HBHA 4L53A 1G8AA 3BE2A 4C57A 3KVWA 3M1SA 5GJFA 4LMUA 3LJ2A 2OU7A 5L2TA 2B9FA 2GMXA 4NSTA 3DXNA 2HK5A 3R30A 3VF9A 1YXUA 2P3GX 4DH8A 1KV1A 2ESMA 1GNGA 2NRUA 4KIKB 4IAZA 5JFXA 3NUAA 3LFSA 3KRRA 4CG8A 4X3FC 4A4LA 3IDPA 3SRVA 3RM6A 4BDAA 1YXSA 3HV6A 2Z7RA 3KA0A 1XR1A 1GJOA 3QD2B 1V1KA 3CEKA 4MBLA 5FLFA 4MNFA 3LFEA 2I40A 4AXAA 4ASEA 5CNOA 5M4CA 3PZEA 1H8FA 4BHZA 2PULA 3HUBA 4JNWA 4OTHA 3ZFMA 4D0XA 3VS1A 5IUIA 4DN5A 1Q5KA 4F0FA 4F4PA 5HO7A 4FTAA 4XX9A 3KULA 3JY0A 4EH5A 3SG9A 5E8WA 4M97A 3ZFXA 4X2KA 2YA9A 3VUHA 4FT0A 1Q8WA 4IEBA 1Q99A 4PTGA 5KE0A 2QOBA 3DXQA 3CY2A 3R1NA 2NRYA 4L7FA 2ZAZA 2HXLA 2W9ZB 4S31A 5BVWA 5DR2A 5AR2A 4YNEA 5F20A 4JBQA 4OBQA 1XQZA 5EM8A 3SHEA 4E3CA 1VYWA 2EXCX 5M53A 3FQEA 4TNBA 3CGFA 4FEXA 3R8VA 2EXEA 5BYYA 4QMXA 1CSNA 4GRBA 3ET7A 4J96A 4ANQA 4E5AX 3VS5A 3FDNA 4IWPA 1Y6BA 2QU5A 4FSUA 4Y95A 5CSXA 4CT2A 5HORA 3COHA 3DQWA 2FSLX 4OGRA 3PE1A 1S9JA 4Q5EA 3BIZA 3R9OA 1ZMVA 3ZBXA 2VWYA 3F61A 4XG8A 4K33A 5CT7A 2XBAA 3T3VA 3IGGA 4C35A 4Q9ZA 5AV1A 2PMOX 2OJFE 2ERZE 4R3CA 3O0GA 3MA3A 4RJ8A 3HMIA 5GJDA 4AW0A 2CKPA 4NM0A 4O6EA 3E7OA 4OAVB 2F7XE 5IDPA 3C0GA 4WT6A 1DS5A 1KE8A 4FBXA 4CFNA 5IUHA 3A7FA 3Q5ZA 3QUDA 5AP6A 3QQLA 3BYVA 2Z7SA 3MVHA 4OTFA 4Y5HA 3WILA 4U41A 5KMIA 4FG8A 4FIIA 4ZZMA 4CT1A 3FZTA 3ZSGA 3TKUA 5HG7A 3AMBA 3EN5A 4EZ5A 4FKGA 4H1JA 2J6MA 2YWVA 4R6VA 3IOKA 2WU7A 5CZHA 3U9NA 4HVHA 2XK4A 3BQCA 3L9NA 4KBKA 4RWIA 4EOPA 3LLAA 1S9IA 2EUFB 3UTOA 4IADA 4I0RA 1P4OA 3ZSHA 3WF7A 3OVVA 4Y8DA 3C1XA 2DS1A 1KE6A 3QTZA 4NZWB 2H8HA 4HZRA 5JEBA 4O2PA 4R1YA 3NIEA 1H1PA 5HCYA 1ZAOA 4DGMA 3SC1A 2BKKA 5D10A 2V7AA 2BFXA 4ZOGA 1Y6AA 3RKBA 4EOIA 2PUIA 3EN4A 4KIQA 3A61A 4C4GA 5KMJA 4JQ7A 3I1AA 2R3HA 4J53A 3EQPA 4OAUC 4ALWA 4RWJA 1R78A 3LFCA 1JKKA 2IO6A 4YJTA 4A9UA 2CKOA 2OLCA 2IZSA 5DI1A 5AADA 4B4LA 4CQEA 2PUPA 3G33A 1NT2A 4DCEA 3RHXA 4UXQA 2XBJA 4I94A 3WF9A 3QGWA 4EEVA 3GCUA 4CCBA 4IM0A 3FLWA 4P4CA 5CU0A 3O8PA 1DM2A 2C5YA 5CVFA 1YI3A 5L2WA 4CD0A 4C2WA 3ENMA 3PXQA 1M52A 2BILB 3TJCA 1Z9XA 5CLPA 3N4TA 3OXTA 5ANOA 3I6UA 4QTEA 3RBWA 4UMUA 3PLSA 2W96B 1KUTA 4USFA 4C2VA 4K6ZA 4WG4A 5HO6A 5CI6A 3G51A 2UW3A 3EHAA 2HCKA 4IC8A 3GC7A 2X1NA 1Y8YA 4EK8A 5HU9A 3AC8A 2C6KA 3D7ZA 4FTMA 4QNAA 4ZTRA 2W4JA 1V0OA 4DFBA 1U54A 1OKVA 3JUHA 3NSZA 3IW4A 3U8WA 4FSMA 4O7WA 2YERA 4W4YA 5DWRA 2AUHA 2XNGA 3HX4A 5H2UA 2HELA 4O22A 1Y91A 4F9WA 4HGTA 3OCBA 4FV4A 3MA6A 2GS6A 4RIWB 2GNHA 3EOCA 4HW7A 2Z60A 3OG7A 5IEVA 1URWA 3BCEA 3KF7A 3IW7A 3OXZA 4MXCA 5CWZA 3V01A 3ZEWA 1NY3A 4LRMA 4D28A 2XM9A 3UODA 3FZRA 4GEOA 1BL7A 5HE2A 4L01A 3KRJA 4UN0C 1L8TA 2J0JA 3U4UA 3LCKA 2C0IA 4J95A 3LMHA 3BHHA 4I5MA 5A9UA 2QOIA 2UW5A 4JT3A 4EHEA 4DINA 5FDXA 5CAOA 3F2RA 4BCKA 1KE7A 5BYLA 2ITTA 5TKDA 4IX3A 4WBOA 4EOKA 4NEUA 4UWCA 3R9DA 4AZFA 1M2PA 4G9RA 1IR3A 1YWVA 3PZHA 2HXQA 2ZM3A 1BI8A 3ZFYA 1NVSA 5CF4A 5GIOE 3CKXA 5ANDA 3QTRA 3IPHA 1SNXA 2IPXA 3HMNA 4R7IA 3Q4CA 5J1WA 4O1OA 1OPLA 1PKDA 2R0IA 5EYCA 3R1QA 3OD6X 2YM4A 3PE2A 3QLGA 5DMZA 1AD5A 2F57A 1BI7A 3H0ZA 3FZOA 4O7SA 2RG6A 4TW9A 3UIMA 2WIHA 1GZ8A 4XRLA 4BDHA 3LFNA 3QQUA 2XH5A 3FXWA 2H34A 3Q9ZA 4IZAA 4FV2A 2X8EA 3UVRA 4BVUA 1R0PA 1Z5MA 2BUJA 2Z8CA 3FQSA 4FTUA 4XG4A 3UE4A 3ULZA 4DT9A 4RPVA 4DH3A 3ZLWA 2HW6A 5C1QB 3QUEA 4BYJA 3UDBA 4RFYA 3NYVA 3P79A 3FV8A 1CKIA 3G0FA 3OOMA 4YC8A 3F2AA 4U97A 3DNDA 1PMNA 3CSVA 3OS3A 2QKRA 3B2TA 3NGAA 4J99A 4PL4A 3VBXA 2WAJA 4M66A 1ZRZA 3LFBA 4A9RA 4E1ZA 1YRPA 5EHOA 5GZ9A 5HE3A 3IDBA 4ZLOA 5AAEA 3RNYA 2C47A 3IW5A 1XH4A 3P23A 4FK6A 5D9HA 3R01A 5EI8A 3RI1A 4O7LA 4IB3A 4BCOA 4ZZNA 2YCRA 3L8VA 4I93A 3FXZA 4ALVA 2EB3A 2C3KA 1PKGA 3DB6A 3H9FA 4FZ6A 4JR7A 3TNIA 2CLQA 3NS9A 3JVSA 4XLVA 2W0JA 5IKWA 1J3HA 5HKMA 2I0YA 2C0OA 3BE9A 3A99A 2LAVA 4WBBB 3FPMA 2OH0E 4TYHA 3L8PA 2ZV9A 3FMLA 3FZPA 2C68A 4FIEA 4XV3A 5CSWA 5M44A 5AUWA 5M55A 4O0RA 3I0QA 4R3PA 5BYZA 4DLJA 2E2BA 4IE9A 4QYYA 3QRTA 4RC2A 2Z02A 4XP3A 4I6BA 5JQ5A 3T9TA 4FEVA 4E5WA 3D5WA 3RK5A 1DI9A 4AT3A 4OBOA 4MXAA 2IW6A 3HL7A 1WBVA 4O38A 2CKQA 3RWPA 1KOBA 4L42A 3V04A 4OTPA 3QWKA 4IACA 2YISA 3NNXA 1Q61A 3W2CA 3UP7A 5KMMA 4L9IA 4HYUA 3WZEA 3H4JA 4TYGA 5KKRC 4D1SA 2CLXA 2B9HA 2JDRA 3VUGA 4F0GA 2CNQA 1J1CA 2ZYBA 2WMTA 4RIXB 4ERWA 3PRIA 3ACJA 1HCKA 5A4CA 4CZUA 2ZB0A 4G6OA 4H3QA 4D0WA 4RA5A 5AR5A 4BI0A 3CLYA 2UUEA 1YWRA 3FYKX 4LOQA 5IH4A 4MWHA 4DFXE 1QMZA 3HAMA 3RPRA 3VRZA 4HNFA 1SMHA 3ERKA 2J90A 2R5TA 2BAKA 2JAVA 4V01A 3NUXA 1SNUA 2JFLA 2ZB1A 2CKEA 3QRUA 4FZFB 4HPTE 1YHSA 4RFZA 3D5XA 3OTVA 2A2AA 4HYIA 2JKMA 3COMA 3SVVA 1PXOA 3GNIB 5C4KA 4MXXA 4G17A 4ALUA 1H26A 2IW9A 4RG0A 3RALA 4EC8A 1Q8TA 1Y8GA 4FSZA 3O50A 4FTLA 1XBCA 5EDPA 5IU2A 4E73A 3KFAA 1QPJA 4OR5A 2X6DA 3LFQA 2PE1A 3GFEA 4PNIA 1H08A 3WZJA 2YIXA 3G6HA 4ZY6A 3AT4A 2DWBA 2PZPA 4E93A 2B52A 2R3RA 3ORNA 4IJ9A 4YLLA 5DBXA 4CYJA 5AFVA 3QRKA 2EWAA 2UZUE 3D2KA 3NLBA 1M7QA 4FKWA 4I20A 5GINE 3C51A 2W1HA 4XG3A 5CAQA 3SXRA 4YJSA 3QTSA 4AX8A 1A06A 1TKIA 3GI3A 4L52A 1KSWA 3FMEA 4QTAA 3UBDA 3V5QA 3GVUA 2A0CX 4MTAA 3SOCA 3SOAA 2IWIA 3ROCA 5FD2A 4FV5A 4M0YA 4R1VA 1Q8YA 2EU9A 4FV0A 4RC4A 2VTLA 1OI9A 3GU6A 4FNXA 2ITUA 4UYNA 4ENXA 3DFCB 4FTKA 3DJ6A 5FBNC 1K3AA 4WG5A 3CTJA 2VX3A 3DQXA 3E87A 3MY1A 3OUKA 4BDBA 5DVRA 3TN8A 3FMNA 3WYXA 4G3FA 2JGZA 4RBLA 1R39A 2OF2A 3OWPA 4K2RA 2OIDA 3QKLA 5L3AA 3UP2A 2BIYA 4BKJA 3IONA 2PVJA 4FZDB 3SV0A 5JZJA 3R9HA 2X7GA 2RSVA 5AX3A 3LQ3A 4L44A 4CFWA 4ZS4A 4YR8A 3LQ5A 4GU6A 1FGIA 4GV1A 1YDTE 2QOFA 2ZMCA 4QOXA 1QPDA 1UU3A 3BELA 4EJNA 3D94A 4AOIA 1L3RE 4KBAA 3CTHA 1V0BA 2GTMA 5IF1A 4O0UA 4EOLA 1FMOE 4FTJA 3DJ5A 2OXYA 5J9YA 3G9LX 2IVTA 4YNOA 4FL3A 1Q8ZA 4D4VA 4UX9A 4BCIA 1B6CB 2BRGA 3DBDA 2G9XA 3NYXA 4WRGA 2VTTA 4YPSA 4NL0A 5DT0A 3UPXA 2FO0A 4R3RA 3WIKA 4EOOA 1XBBA 4GK2A 4RMZA 1NW1A 2BTSA 3PPZA 4LRKA 4ZSAA 2C6DA 2JDSA 2REIA 3AGMA 3MV5A 1FQ1B 2P33A 1ZYLA 4GVJA 3FLQA 3NAYA 4ID7A 3OCTA 4BDJA 4C38A 4EI4A 4NT4A 2HW7A 3GENA 1PMUA 3AC4A 4KIOA 3MY5A 5LJJA 3PTGA 5FUTA 2XKDA 2ONLC 4DEBA 4H1MA 3MB7A 3GC0A 3QTWA 2BAQA 4TPTA 5F1ZA 4S34A 3MH0A 1NXKA 3HRBA 4C61A 4GU9A 2WFYA 3TNHA 2VTPA 3V5LA 3GCPA 4O0SA 3SKCA 4RX5A 5DLSA 1ZY4A 3E3BX 4KS7A 1ZARA 2AC3A 4F09A 4LFIA 1WVYA 4ACCA 2W4OA 4PL5A 2GU8A 2PZYA 3FYJX 4F6SA 5I9XA 4DEGA 3S0OA 4O0XA 4XOYA 3MIAA 3V6RA 4AW1A 2WMVA 4PP7A 5DRDA 4V0GB 4FK3A 4LGGA 2GNIA 5FTOA 3PPKA 3FSFA 4BY9E 1IG1A 3UG2A 4QTBA 4RJ7A 5LVNA 3PSCA 5IQIA 4ZTMA 5CNNA 4XNEA 3F3ZA 4YZMA 3W16A 2ERKA 3UIBA 4BB4A 2CHLA 1R1WA 3NCGA 2YIYA 3EL8A 2E9NA 3GQIA 2RFDA 4FL1A 1M17A 4FKJA 4MXZA 1PMEA 4KSPA 3JYAA 4EYJA 4USEA 2JDTA 4DEIA 5ANEA 4ZK5A 4ASXA 1YI4A 4HCUA 5DFPA 3BPRA 4ANSA 3QA0A 1TVOA 4I22A 5FG8A 4AZVA 4GS6A 4G16A 4O82A 1NVQA 4H58A 3TV4A 4DH7A 4TY1A 4CLJA 4O7RA 2HWPA 2X81A 2VTIA 5DHJA 3KRWA 2RIOA 3GB2A 5AP5A 5LCKA 3RZFA 2WQNA 4JBVA 5M4FA 1JKSA 3MH1A 2X7FA 4HVDA 4EK4A 5CQWA 4HNIA 4AZWA 3KC3A 4AN3A 5ETFA 4O7NA 3NRMA 3P7BA 3TIYA 1Q3DA 3AQVA 4DITA 4JJRA 5A4TA 2ITXA 2PY3A 3OCSA 2X7OA 4ENYA 4BDCA 4EK6A 4O27B 3L1SA 5KHWA 2OGVA 4YZCA 5GHVA 1PF8A 3M42A 5A54A 5AAGA 1H4LA 3U9CA 3NX8A 5TOZA 5CVHA 3ZO3A 3AD4A 4AW5A 3CC6A 3G90X 5IA3A 2UW6A 1PXKA 3FLSA 3DA6A 4OW8A 2Q0NA 3QTXA 3QX4A 3OZ6A 3OUNB 4IHPA 3POOA 3TM0A 3VRYA 2YWPA 4DT8A 2GQGA 3U55A 5EM5A 3QQFA 5AP2A 3S00A 3EFKA 4YJNA 4BBFA 2R3OA 5EDQA 1J7UA 4IB5A 4H3PA 3A62A 4DG2E 5JGAA 2XJ1A 4MH7A 3MJ1A 4GK3A 3KRLA 3QF9A 1YVJA 4QP8A 3FKOA 2GFSA 4FA2A 2ITQA 5LMKC 4D2VA 2WMXA 3EYHA 5TT7A 4NFMA 4RJ4A 5ACKA 2YZAA 3ZLXA 5HVYA 4DEDA 5CANA 3R7VA 4L3PA 1H24A 2BRBA 3NNWA 4EQUA 4MBJA 2XNBA 4BKZA 3BQRA 3UNKA 4R7BA 4E8AA 3PIZA 1AGWA 3KXXA 3HP5A 3OP5A 2UV2A 4XUFA 3EQHA 5CAVA 3GU5A 4GIIA 2R3PA 5BX0A 2RFEA 5J9LA 5CZIA 5J7BA 4I4FA 2KULA 1PXPA 5AX9A 3W2OA 2PHKA 2Z7QA 5AR8A 4E4NA 5HTBA 2XM8A 4X0MA 4UMTA 4WUNA 1H25A 2QOQA 1U5RA 5K9IA 5KMNA 4O0TA 1UNHA 4BWPA 2XP2A 2QI8A 4JG6A 1J7IA 5E7RA 4F1OA 1CKJA 4RX9A 4OUCA 5B2MA 2J7TA 3DLSA 4BBMA 3C50A 4F9CA 5GNKA 2JDOA 4EQCA 4D2TA 3UIXA 5TO8A 1ZXEA 4F64A 4HJOA 4XG7A 3OW3A 5AIRA 5FM3A 3CR0A 3WF5A 5L6OA 3F88A 4FVPA 3WOWA 3QX2A 3DCVA 3E92A 2ITVA 4HGEA 5HD7A 5JSMA 4MXOA 2HYYA 2PSQA 1XJDA 2H6DA 1PXNA 3OBGA 2YCQA 5M51A 3CQUA 3NPCA 4AFJA 3VW8A 1U5QA 3TV7A 2CGWA 5EOLA 3JXWA 2W5AA 2O65A 2I0VA 2W7XA 3SDJA 3DOGA 5D1JA 4QYHA 4CVAA 1IA9A 3EFJA 4F7LA 3EQDA 4S33A 4IWOA 2VWIA 4UB7A 5IG1A 1YOLA 5G6VA 5JFWA 3C5IA 3FMMA 3OOGA 2R3MA 3C4XA 2B0QA 3GU8A 4BFMA 5CF5A 2IZUA 4PDSA 4W9WA 3TJDA 1H0WA 5IMXA 5HLNA 4Z7HA 4FKTA 2O0UA 5IH6A 1H07A 4D2RA 3A7GA 4IAIA 3BHYA 4BCHA 4WOVA 2PVFA 4I0SA 2YHVA 5LMAA 2RF9A 3LZBA 4L43A 3W18A 5HX8A 1JNKA 4IAFA 3MVMA 2ZDUA 4YTCA 1YI6A 2G01A 3GOPA 4QP7A 2WTIA 1MQ4A 5IQEA 4TYJA 2YCFA 4Z16A 5I0BA 1JSTA 5ANJA 4GCJA 5E91A 3MW1A 3ORKA 4MYGA 3CY3A 4PP9A 4RLLA 5AMNA 5ANKA 4P2KA 3SXSA 3CQWA 4JBOA 5DRBA 3OCGA 4FSTA 2C6OA 3GU7A 3COKA 1MRVA 3VBQA 5BVDA 3FE3A 3ODYX 4AGWA 2PVYA 4RVKA 2ZM4A 1MUOA 2PVRA 4ACHA 4AE9A 4XV1A 3VBYA 2W1DA 4F1MA 4YSJA 3MTLA 1WBOA 3RHKA 5M56A 3VS3A 4UALA 3P86A 3VS7A 1A48A 3Q2JA 3NUNA 3Q6UA 2WPAA 2J5EA 2XUUA 3NW7A 3QKKA 1W8CA 4D1XA 4PL3A 4C02A 2WOTA 3OC1A 3QWJA 4KWPA 3M2WA 3A2CA 2JD5A 3UJGA 4AOJA 4NJDA 4DEEA 2W5BA 4Z9LA 3NCZA 3RGFA 2HZIA 2PE2A 3O8UA 4J71A 3VUTA 3TACA 4Z55A 1GOLA 3NYOA 1H00A 5HEZA 4NFNA 4DBNA 4EKLA 1GY3A 4FEWA 2C30A 3EQCA 2C5NA 2PK9A 1YOMA 3LFFA 2OH4A 4JQ8A 3WBLA 3W8LA 2FB8A 3IG7A 1H0VA 2VTNA 4JX3A 4QP2A 2QONA 4S2ZA 4FR4A 5IZFA 5JZNA 4BWKA 2JAMA 3OXIA 1YKRA 4JDJA 5FXRA 5EFQA 2W05A 1OL7A 1ZYDA 4FEQA 2VUWA 1OMWA 2GTNA 4FOBA 4JS8A 4DGNA 4H05A 2OBJA 2VWZA 2XIZA 1WVXA 1OL6A 4CTBA 4TKSA 3R7EA 2PL0A 2PE0A 4U8ZA 3GCQA 3LXNA 4NTTA 4ZXTA 2C1BA 4C58A 4E6AA 4EC9A 4KA3A 4F9YA 4GYGA 4NCTC 2WEIA 5JRSA 3LJ0A 4M69A 4CEGA 2J50A 4FTQA 5GJGA 4UBAA 4ANNA 2O63A 3LE6A 3C0HA 5BPYA 3O23A 2F4JA 5JT2A 4LGHA 4OTIA 3UNJA 2B53A 2WHBA 5CYIA 2C5VA 3QRIA 4AGDA 3LMGA 4BKYA 5JFSA 4YZNA 1QL6A 3LFDA 2OIQA 1OIYA 4ZTQA 2X8IA 5CEMA 4NIFA 1SVEA 4YURA 2C6TA 2PVHA 3HV3A 2VZ6A 3I5ZA 4FIFA 3EQIA 4R5SA 3ZRKA 2WELA 4EHVA 4F0IA 3PLAE 5AUYA 1W7HA 3E88A 5HLWA 2LGCA 4FKVA 2G2HA 4GJ3A 5L6PA 4I21A 2QOOA 3G0EA 5KX8A 3TL8A 5KZ0A 2C6EA 3RAKA 2YIWA 1K9AA 2J0LA 3KN6A 2Q83A 1TQPA 3V5JA 4MCVA 4DFUA 1DI8A 3GC9A 3UO5A 2X8DA 4U44A 5DE2A 5L6WL 5TF9A 3C4WA 4FVRA 2FSMX 5CY3A 3ZO4A 4XV9A 2YM8A 4JDIA 4CGAA 5HNGA 4ZJVA 2GPHA 4EQMA 2JITA 5TR6A 4GT4A 4D4RA 4FX3A 2ETRA 2QNJA 3U6IA 2UZEA 4MF0A 5FTQA 4GKIA 2QR8A 1GZOA 2ITZA 4TYIA 4X2JA 4YHJA 1KE9A 5IQGA 2NP8A 3KU2A 3ELJA 4G5PA 4CQGA 3DNEA 4FZAB 4P5ZA 4XG9A 2UZBA 3DPKA 1G5SA 3RPSA 5AUTA 3QC4A 2XIYA 1OKYA 5HICA 5HTIA 2KTYA 4YJRA 2OXDA 3VIDA 1IRKA 3Q60A 2WD1A 3QQGA 4JX7A 1OITA 4O2ZA 5C03A 4CXAA 3FMKA 2O64A 4PPBA 4RWKA 5BUIA 5L2QA 3O2MA 4LV5A 4AE6A 1Q24A 5DR6A 1W82A 4QO9A 2BDJA 2NO3A 3QCYA 4RZWA 4DFLA 4PDOA 3WZKA 1U54B 2RKUA 2UZOA 3ORPA 4O7ZA 4M15A 4QT1A 3UC3A 2PVMA 4AT4A 4X6QC 5LQFA 2VAGA 3HEGA 3F5UA 4PMSA 5DT3A 3EN9A 5M08A 3GU4A 2JEDA 4ANBA 1ZZ2A 5DR9A 3ZO1A 4C59A 4FSRA 3NR9A 3T3UA 3LPBA 5CF6A 3R1YA 4XS2A 3VUDA 3WZUA 3BU6A 1UWHA 3O7LD 3Q3BA 4GVAA 4FE2A 3NIZA 4LQMA 2PMLX 3JY9A 4DA5A 3TEIA 3ZLSA 4RT7A 4JLCA 2JFMA 4O1PA 3BZ3A 2P55A 3II5A 4G6LA 3Q4ZA 4CSVA 5HIEA 3LM0A 2F2CB 4XHKB 5HIBA 1OPJA 2E9VA 2QC6A 3N9XA 5DN3A 5DT4A 3SW4A 2WZJA 4TL0A 4OT5A 3BX5A 5A4QA 4Y73A 3O96A 2QODA 3VQUA 1ND4A 3PYYA 2ITWA 3FI2A 4LGDA 5CI7A 4EH2A 3OY3A 2WTKB 4CLIA 4E20A 2PZIA 3KY2A 3BU5A 3QALE 3RJCA 3TZMA 5HD4A 3POZA 2BIKB 3PWYA 1JAMA 5M57A 4ZTHA 4MF1A 1UNLA 3G6GA 3P1AA 4FOCA 3E93A 3ZOSA 5KNJA 2OJGA 4DTBA 3BHVA 3ETAA 2WTVA 4PX6A 1H1SA 2B9IA 1W83A 1OM1A 4U42A 4BBEA 4MVFA 2GDOA 5HBJA 3BBWA 3KMMA 3W55A 3SQQA 2YJSA 3GUBA 3PY1A 4L45A 4QTCA 2WTJA 4QMMA 3HV5A 4FT7A 3R00A 3VN9A 3ORIA 2WQMA 1SYKA 4AN2A 1ZMWA 4JAJA 2F49A 4ZSEA 3ZH8A 4PPCA 4NYEA 1XH9A 4ZZOA 3UZRA 1O6LA 3ORXA 3Q9YA 3ZONA 2VX0A 1FBNA 3C4EA 3IECA 3ZHPC 4BI1A 4YJPA 3TTIA 4C4FA 3ZRMA 1GZNA 4M84A 3UNZA 2I0EA 3A60A 2R4BA 3C4CA 4GFOA 3PJ1A 2IJMA 5AUZA 5LCJA 3EFLA 3I5NA 4II5A 4V05A 3DKFA 4TRLA 3PVWA 3WF8A 2F2UA 3C7QA 2UW0A 1WBSA 1JKLA 2QKWB 5EH0A 5F95A 2YFXA 3PY0A 5HBEA 4TYHB 4EJ7A 4DEAA 4ARKA 4WNKA 2HZNA 3CGOA 4FTCA 1F0QA 4ZSJA 4WD5A 4AA0A 3V5WA 5IA1A 2H96A 3SA0A 2RL5A 2WKMA 2XK3A 4OBPA 5DYJA 1JOWB 1UU7A 4RFMA 4QPMA 4APPA 4OTQA 5IDNA 3O7LB 1MRUA 3QKMA 1JSUA 4XYFA 5FGKA 3LKMA 3PWDA 3TTJA 4U80A 3AD6A 2OJ9A 4DE4A 2BAJA 3MPMA 3ORTA 4JR3A 1PXMA 2WNTA 3CIKA 3E63A 3WARA 2CJMA 4TWPA 2YAAA 4K9YA 4WIHA 4QMNA 5J5SA 3CP9A 3DTCA 4QMWA 4GFGA 3HKOA 3RWQA 4XP2A 3DZQA 3HRCA 3K3IA 4PMTA 1CM8A 3TV6A 3MBLA 3RK7A 4U7ZA 3ZCLA 2ZJWA 1JLUE 4FIGA 5AP3A 2OJIA 5FXQA 3R8PA 4IC7A 2F9GA 4NKSA 2CGXA 4TWCA 2XK9A 5E4HA 1IAHA 4EOMA 5KZIA 3DT1A 2JKQA 4CG9A 2WTKC 3KXMA 4XP0A 4NW5A 1W98A 2QLQA 3G2FA 4KAOA 4XBRA 4DTKA 1BLXA 2C1AA 5I3RA 2V5QA 2SRCA 3DBCA 3R0TA 2PMIA 4EHZA 5EDRA 3QA8A 4FUXA 3ALOA 1PMVA 1XH8A 4A06A 4QQTA 3MFSA 3R71A 5K3YA 3UO4A 4TWNA 4C62A 3CD8A 2BRHA 1WZYA 1VZOA 3KF4A 2C3IB 3PJ8A 5AR7A 5B7VA 4RQVA 4MAOA 5CEPA 2JC6A 4CKJA 3OF0A 2W9FB 4ZAUA 2GQSA 5EW8A 5AWMA 4QMSA 5AR4A 3W2RA 5KUPA 2XCHA 4GUBA 5EKNA 4WNOA 5AEPA 3I7CA 5D41A 5KO1A 5HG8A 4HYSA 3FKLA 2A19B 4U81A 3F9NA 2NPQA 2OO8X 2ONLA 4V04A 3V8WA 2J9MA 2X4ZA 4MQ1A 5AUXA 1GZKA 1YXXA 3PIYA 4CCUA 4F7JA 5JFVA 4CV9A 4EOQA 4LM5A 3EJ1A 4MWIA 3MFTA 4JDKA 4FTRA 5L8LA 4NKAA 2W1CA 4ZSGA 4QQJA 2FGIA 5K5NA 4BGQA 2PPQA 3PG1A 4FKRA 4BZOA 1M14A 3AC5A 3QZIA 5LVLA 3OHTA 4U40A 4ZEGA 3PXKA 3DKOA 3HRFA 3Q4TA 3RVGA 4QMTA 4FV8A 4W4XA 5AV0A 5A3XA 1RDQE 4YJOA 4K0YA 4F08A 1JKTA 1NVRA 3L9LA 4NW6A 4XRJA 5I9WA 5KCVA 2YACA 4PPAA 2XEYA 5C27A 3VW6A 3NUYA 3W2PA 3A8XA 4QMLA 2E9PA 2ZV7A 5EW3A 3QXPA 4J1RA 3GOKA 5K4JA 3MIYA 1M2RA 2ETMA 3D7TA 3U51A 4IDVA 4QP4A 4AOTA 4A7CA 1WBPA 2J51A 3F66A 4CZYB 2OFUA 3CKWA 4AQCA 2YDKA 5LVOA 4PDYA 5GIPE 1WMKA 3U6HA 3QC9A 5A6NA 5BVEA 2Z7LA 5K4IA 2NNWB 3KK8A 4HVSA 4U0IA 4RGJA 3VUIA 4QMVA 3G5DA 3WYYA 4FSYA 2YM7A 5KMOA 2QURA 4C4EA 2V0DA 4D2PA 3LFAA 4HVIA 3UQFA 1ZOGA 2VWVA 3WI6A 2G2IA 4G3GA 3TIZA 2WIPA 4X21A 5BUJA 4DGLC 4I24A 4X3JA 3IKAA 1OVEA 1YOJA 1W0XC 2YLEA 1F5QA 5LVMA 3LCTA 4QP6A 4BCJA 2CGVA 4UWBA 5ETAA 2YDJA 1XKKA 3C5UA 3ZMMA 4BDDA 2ITPA 4FNYA 4IXPA 4GK4A 1OKZA 2CSNA 2YIRA 4KRCA 5M06A 1U4DA 3QU0A 4HCTA 1OIUA 4Q9SA 5E90A 5FQDC 4D9TA 3A8WA 4QPAA 3LHJA 3OW4A 2QO2A 4I6QA 4M14A 4U9AA 5KMKA 5EQEA 3BYUA 1CKPA 3S4QA 3ZBFA 2VGOA 4FZ7A 5FDPA 4IQ6A 1QPEA 3NWWA 1OIRA 2PUNA 4FYOA 4L3LA 1GAGA 1Q4LA 2UZDA 5DA3A 4YHTA 3DFAA 1JPAA 3FLYA 3GCSA 3W33A 4APCA 5A14A 2WXVA 2CNVA 4O84A 3RAHA 3C9WA 1PXLA 4G9CA 4B9DA 3NAXA 5IQBA 4ZJIA 3UIUA 4AGCA 4C7TA 3FJQE 2WGJA 5CSPA 4DG0E 5JGBA 3W32A 2CN5A 5EOBA 4EH4A 3QFVA 1ZWSA 3KKVA 4DH5A 4RVMA 3MN3A 4YU2A 3DBFA 4UMQA 5C4LA 3BGQA 3BI6A 4QRCA 4U6RA 4ONAA 4IH8A 3WIGA 5LXMA 2HWOA 3JVRA 5JMSA 3KN5A 5LMKA 3NZ0A 3LM5A 4E4XA 3DTWA 1FOTA 1MQBA 3L9MA 5HO8A 5IA0A 2Y4IB 3MI9A 4TXCA 4V0GA 4DHFA 3IO7A 4GW8A 4M13A 3NUPA 1UKIA 3A7HA 4L3JA 4DC2A 4IAYA 1FMKA 1FVTA 2Y8OA 4Y72A 4TZRA 2Y6MA 3D14A 4LOPA 5HE1A 1JWHA 1I44A 1U46A 3BV2A 1Z57A 4YZBA 4R7HA 3HGKA 3QZFA 5D7AA 3KMWA 4TT7A 1TQIA 2BPMA 3LAUA 4HGSA 5H8BA 3UOKA 2VO6A 4AS0A 4BCPA 3UZTA 4DCAA 5C8KA 3LQ8A 4FSNA 4MBIA 4D2WA 4ZSLA 2X39A 2VWUA 3JPVA 4IX4A 3D5UA 5KMLA 4LRJA 4HCVA 5EKOA 3CJFA 3NYNA 3PP0A 4IM3A 3W1FA 5E8ZA 2HAKA 4MNEB 2OJJA 3OMVA 1PXJA 4I3ZA 4QPSA 3D2IA 3UVQA 3V8TA 4A9TA 2X2LA 4D4SA 3LCDA 5CQUA 4A07A 4C8BA 4I6FA 3VBVA 1G8SA 3DXPA 2G2FA 2B54A 3E8CA 4FUYA 4H3BA 2FVDA 4EYMA 5IISA 3TUDA 2XIKA 3MH3A 5L2IA 1UNGA 2QO9A 5AV3A 3IGOA 3ITZA 3PJCA 4GG7A 3C4FA 3R7UA 2C6LA 4NM7A 5A4EA 3V5PA 4RLKA 4UMPA 3HA6A 1T46A 4QQCA 4IX6A 3P7AA 2BROA 4GKHA 2YM5A 4X6RA 1ZMUA 4XOZA 3QYWA 4EH8A 4DG3E 2RFNA 3CS9A 1XH6A 2JIVA 3WF6A 3PIXA 1LEZA 1TQMA 4BTKA 3R7YA 3FLZA 4HOKA 4RJ5A 2I6LA 5EM7A 5CEOA 3AC2A 3PVBA 4OTGA 5H9BA 2W1FA 5HZNA 4Q5HA 4ACMA 4ZJJA 4GT3A 3TUBA 5IQAA 3ZM9A 1WAKA 2W06A 3DDQA 3HMOA 2X2KA 2XK7A 3PVUA 3QCSA 4QP1A 3FHIA 4PWNA 3WE8A 5EI6A 4FNWA 3BYMA 1IASA 1V0PA 4UV0A 4ITJA 1BX6A 3A4PA 3ZC5A 4JBPA 4BTMA 3P08A 3QZGA 3FMDA 4BF2A 2IG7A 3ATTA 3TDWA 2Y6OA 3HA8A 2O5KA 3W8QA 2O3PA 2R3GA 4LUEA 5EQPA 3E5AA 3MPAA 4TNDA 2HY0A 4QQ5A 4EL9A 4FKIA 3UOJA 3R21A 3P0MA 3K5UA 2C3JA 4YPDA 4UMRA 1W84A 5HHWA 1M2QA 2AC5A 5FBOA 3UQGA 2OW3A 2O8YA 3QCQA 5E92A 2F7ZE 1YHVA 2UZTA 3TKHA 3FPQA 4JVGA 1CTPE 3ODZX 2OZAA 3VUMA 5HVKA 3F2NA 5B0XA 3RCDA 4G3CA 3UG1A 2B7AA 3CD3A 3EMGA 4NJ3A 1PW2A 4U3YA 4WSQA 5BVFA 3W2SA 3PA4A 4BR3A 2XRUA 2VTHA 3FQHA 3E64A 3VF8A 3PA5A 5FXSA 5CENA 5BQ0A 5ANIA 2HIWA 3ROYA 1REJA 3ZZWA 2C6MA 4B0GA 1X8BA 3RPOA 2J4ZA 3VNTA 4DF3A 3E3PA 2R3LA 2YJRA 5JH6A 4ZLZA 3F7WA 4CYIA 1LR4A 4NK9A 4X3FA 4QMOA 3GC8A 4FKOA 4BDKA 5G1XA 4FT3A 2CNUA 4IM2A 4ANMA 1OECA 2WO6A 5C8MA 4RQKA 3ZSIA 4YO6A 3MFUA 4YP8A 1A9UA 3FY2A 3FEGA 4FSWA 4RIYA 4AAAA 2DYLA 1ZLTA 5CEKA 5DGZA 4YLJA 4I1ZA 4CFXA 3ZUTA 2GS2A 5AP1A 3D0EA 3KXGA 4FKPA 3FWQA 3NVMB 3HYHA 4OTWA 4C4HA 2GS7A 3EKNA 3W2QA 1PHKA 2YN8A 5IA4A 4L00A 2VTOA 4C34A 3F5GA 3GP0A 3TCPA 2BHHA 3H9RA 4TN6A 5CU6A 4X2NA 3ORZA 5AAFA 3O17A 3BBTB 4BZDA 5C8NA 3B8QA 4EK3A 2GHMA 4FV1A 3R8ZA 4YO4A 3MVLA 1YWNA 3QCXA 1SZMA 2OWBA 4Y85A 4FT5A 3OWKA 2XB7A 2P2HA 4D5HA 3HUCA 3VUKA 1OL2A 2BZJA 3HLLA 5T6KA 3ZUVA 3AG9A 2R3FA 3BYSA 4AZEA 4EOJA 3QGYA 1Q8UA 4D4YA 4H36A 5E8TA 2DUVA 2J2IB 5J9ZA 1EH4A 4FTOA 3TZ8A 4O91A 4E7WA 2XK6A 4LUDA 1ZYJA 2PYWA 2EXMA 1FVRA 2UZLA 2FUMA 1OGUA 4ERKA 2R3IA 3I81A 2UVZA 5L8KA 4Y83A 2R3JA 2XKFA 3R83A 1KE5A 4AW2A 4BICA 4F65A 1P2AA
chains in the Genus database with same CATH superfamily
3FI8A 1P4FA 4NCTA 5AP7A 2VNWA 5EHLA 4G3EA 5A46A 5IEXA 1ZOEA 4NM3A 3KRXA 2H9VA 1JQHA 4XLIA 4DHJA 3PP1A 2XNNA 3S95A 1UV5A 4ZMFA 5HG5A 2QOLA 1LUFA 1PXIA 3PSDA 4X2GA 5HX6A 5C01A 2PMNX 3C4ZA 3QD4A 2PWLA 5I5ZA 4AXFA 2VTSA 4MXYA 3F3UA 4D55A 2QD9A 3ORMA 4PV0A 4MEDA 3F69A 3MB6A 4O0VA 3EN7A 2WMUA 4IX5A 4QD6A 2P2IA 5FEDA 3UYTA 4E4LA 3EIDA 3CQEA 1UA2A 2VV9A 2YEXA 3ORLA 2PZRA 3AD5A 3AT2A 3GGFA 4KIKA 4UXLA 4E6QA 2ZFYA 3SRVB 5ACBC 5KHXA 1H1WA 3EQRA 2Y4PA 1O6KA 2OI4X 3VS2A 4FNZA 2BMCA 4XV2A 3KQ7A 3D15A 2YDIA 4FT9A 1HOWA 2B55A 2Z2WA 5HCZA 5L8JA 3TXOA 5C26A 3AKJA 4BDFA 4LMNA 3BEAA 4BZNA 4MX9A 4PRJA 3CPCA 3L9PA 4RZVA 4RVTA 2IZTA 5J8IA 3FL4A 4C33A 2VTMA 4BGGA 1Q97A 2XVDA 3QRJA 4I41A 4YJUA 1UWJA 5F94A 1YW2A 2GNGA 3KULB 2E9OA 4FGBA 4L6QA 4RIOA 5AM6A 5EW9A 4I0TA 5JQ8A 4A4OA 4EKKA 4ACGA 4JRNA 4AG8A 5CU2A 1XH5A 2YABA 5IQHA 1JSVA 4QMYA 4TTHB 4YHFA 1R0EA 2BFYA 3BGPA 3ZS5A 4F6WA 5LOHA 3E8EA 4FTTA 4RWLA 4A9SA 1Q41A 3LJ1A 3RMFA 1YXVA 4ZLYA 4W8EA 4F63A 2BALA 2XIRA 3K54A 3TNPC 5AA8A 3N4UA 4GFMA 4BYIA 4CKIA 5BNJA 3KXZA 3AXWA 4HGLA 3DLZA 3NDMA 4WO5A 5E8XA 3HDNA 4M3QA 2I0HA 5EYDA 3ZXZA 2Y9QA 4AN9A 4O83A 5M09A 5E8VA 1BUHA 3Q6WA 1QPCA 3BLRA 2HENA 3LXLA 5FTGA 4GIHA 3FLNC 5IMEA 4Y46A 1OBGA 4O81A 2WQBA 2PZ5A 3F5XA 3MY0A 2CDZA 4K8AA 5GZAA 4IFCA 3MDYA 4GG5A 4Y5QA 3UDSA 4GUEA 3FL5A 2A1AB 3IDCA 4FVQA 5HTCA 3MS9A 4J52A 1OGYA 3COIA 4U79A 3EQFA 3NVKI 1YDSE 1G3NA 5CT0A 4M69B 5CALA 3MFRA 3OWLA 2XNOA 3P4KA 3I6WA 3AC3A 3EQGA 4WKQA 4W8DA 4UZDA 1WCCA 4UWYA 2VTQA 2IVUA 3FMJA 1OL5A 2WEVA 1KOAA 3NUSA 3ID6C 5K0KA 5FP6A 5CEQA 3FUPA 4JDHA 3U54A 1SVHA 2WB8A 4RJ6A 5FM2A 1RJBA 4EK5A 4AACA 1KWPA 4PNKA 4IW0A 3ZUUA 4EONA 5DH3A 3FY0A 5LVPA 5LWNA 2PUUA 5D11A 4C4IA 5ITAA 3KIOC 4NIFB 1VJYA 5HNBA 5BMSA 4F99A 1R3CA 4QMZA 3BRBA 2G1TA 2PVLA 3D83A 4HPUE 2BHEA 4J8NA 3UMXA 2OF4A 5E1EA 4DFNA 4NUSA 4ZTNA 5HNIX 5C9CA 5T3QA 2WU6A 3ZXTA 3HP2A 3R63A 4MD8E 5CVGA 2QHNA 2VWXA 2JKKA 4LL0A 3SGCA 2F7EE 2JBPA 3ZYAA 3DV3A 2X9FA 4K1BA 4QP3A 4DGGA 2P0CA 1QCFA 3UYSA 2ZM1A 4RJ3A 3CJGA 2XA4A 2ZVAA 3O51A 5I9YA 4ZS0A 4BC6A 2PVKA 5K5XA 3DB8A 2PTKA 2XRWA 4ZY5A 4O21A 5IEYA 2VGPA 5CSHA 5BMMA 4Z7GA 4IB0A 4BCGA 3G9NA 5E9EA 3EZRA 2W17A 4HZSA 4E26A 4U3ZA 5CTPA 5EK7A 4C36A 4O86A 1OZ1A 4AA5A 4YLKA 3R8MA 4AZSA 2XEZA 2VO0A 4AF3A 3VBWA 1STCE 3LW0A 2R64A 3PUPA 4XG2A 4KABA 4O7VA 4FRFA 4NM5A 5FEQA 3AGLA 3O71A 2X9EA 2OFVA 3ZM4A 3C0IA 4KBCA 4C3FA 1UKHA 2GNJA 2JDVA 2V7OA 1OL1A 3EL7A 2OXXA 3KL8A 1LEWA 4D1ZA 4X2FA 4UZHA 4IZYA 2J0IA 1BKXA 3O8TA 4F70A 5CAUA 4P7EA 4U45A 1NA7A 2CN8A 3RPYA 4GMYA 3VBTA 2XJ0A 3QHRA 4G1WA 2W1ZA 3I79A 3Q32A 4N6ZA 2XK8A 3ACKA 2R3NA 3M11A 5TE0A 4F7SA 4XCUA 4AT5A 4PMPA 3R73A 1XO2B 1WBTA 4BDIA 2PU8A 5AA9A 4M12A 3EYGA 4JXFA 4OTDA 3DJ7A 4RIWA 3RINA 2HY81 3ANRA 4UEUA 4M8TA 4YJQA 5I9UA 3FAAA 4EH3A 2XAMA 4I23A 2C5XA 5CX9A 4N57A 3P9JA 2R7IA 3FSKA 5IQCA 4PDPA 4EH6A 1YHWA 4MHAA 5EM6A 1DAWA 2JBOA 4G2FA 3EZVA 3RAWA 1ZOHA 3RP9A 2CPKE 4GT5A 3TT0A 3TI1A 3OT3A 4EWHA 3KEXA 4ANOA 4X7QA 2WOUA 2OK1A 3LOKA 5KKRB 1B39A 3PVGA 2DQ7X 4BTJA 4YC6A 1T45A 1J91A 1UU8A 2VNYA 3ZTXA 3PDTA 4EWQA 1FGKA 4GL9A 2J0KA 3B2WA 3SX9A 3TZ9A 2Q0BA 4ZMEA 4FV9A 2OZOA 4BI2A 4JOAA 4IVCA 2QG5A 3CTQA 1LP4A 4FIHA 4IZ5A 2YLFA 4I6HA 2VRXA 2HZ0A 3F82A 3JS2A 3P5KA 4N4SA 5AM7A 3R7GA 3R7OA 4CFVA 1DAYA 1W2FA 3AOXA 3EH9A 4HVGA 3WZDA 2WMRA 3HV7A 4O4BB 4JG7A 3FXXA 4XH6A 3CE3A 3QQJA 4PTEA 4UY9A 5EHYA 4D9UA 3GCVA 2R0UA 3MYGA 4BDGA 2XNMA 4IIRA 3I0OA 3Q2MA 3Q52A 4KINA 2FSTX 4DH1A 5LARA 4JIAA 4RX8A 4E4MA 4RA4A 3V6SA 3NNUA 3QYZA 4IFGA 2QO7A 2VO3A 4KKHA 4W4WA 4WRSA 3KXNA 3UDZA 2ETKA 4LL5A 4OT6A 3L8XA 3GFWA 2VTAA 4D58A 3HMMA 4FV6A 3VS6A 3PPJA 1OPKA 5HG9A 4BCNA 3TNQB 2R9SA 1VEBA 4IVAA 5B2KA 2HOGA 2WTDA 2BZHB 2EB2A 3DS6A 4LG4A 3Q5IA 4M0ZA 4N6YA 4ZIMA 1I09A 2VX1A 5JKGA 3DDPA 3S2PA 2B4SB 2BR1A 3FC1X 3DAEA 1BYGA 3VS4A 3W10A 4EH7A 5IQFA 4IAKA 4ACDA 5BVOA 4BJJB 4EORA 2X0GA 4P90A 3QUPA 4AGUA 4DFYA 5HI2A 3NFFB 3NNVA 4AA4A 4JI9A 3ATSA 5ICPA 1JBPE 4FMQA 3MTFA 4LV8A 4BN1A 5DIAA 4FIJA 3MH2A 2GQRA 1ZYSA 3IK3A 2WMWA 2JIIA 3SD0A 3QD0A 5J79A 3QD3A 4RSSA 2XCKA 4YTHA 3BGZA 1E1VA 3QL8A 5J95A 1KV2A 2QVSE 5B2LA 5J87A 3R22A 3TUCA 5AV2A 3R1SA 1SM2A 3PXZA 4GJ2A 2BCJA 4JIKA 4QYEA 4N0SA 4QMPA 1XWSA 4FTNA 1O9UA 1O6YA 1UVRA 3DAKA 4CMTA 3KB7A 4OLIA 3ZC6A 4YTFA 1ATPE 4BCFA 3HMPA 4MKCA 3W0OA 3UOLA 1M7NA 2YIQA 3R8LA 4IAAA 4K18A 5L4QA 2VTJA 4I5CA 3DK7A 3VHKA 5KBRA 1OKWA 4BGHA 3VULA 4K77A 4RIXA 2QG7A 3VO3A 2RGPA 1P5EA 3F3TA 4NH1A 2C4GA 2R3QA 1ERKA 2E9UA 2P4IA 2BRMA 4KD1A 4QMUA 5CU3A 4PTCA 3C13A 2IZRA 5HOAA 3VJNA 2B1PA 4S30A 4QMQA 3LIJA 3Q96A 3VS0A 4TYEA 1IEPA 4W9XA 4R8QA 4IMYA 5AIKA 2JLDA 3FBVA 4WSYA 5CSVA 5ETIA 4CNHA 2ZV8A 3UVPA 2ITOA 3IOPA 3TDVA 3ZLYA 3PXFA 2V22A 5EI2A 1SVGA 1MP8A 2VD5A 2W1GA 3HNGA 4KUJA 4HYHA 1ZZLA 4JG8A 4CZTA 1YQJA 3P7CA 4O0YA 5IA2A 1XHAA 1URCA 3HAVA 4GSBA 4YGAA 5CS6A 4Z3VA 2BZIB 2OICA 3I60A 2R3KA 5JRQA 4QYFA 2C5OA 3BWJA 4J97A 3R9RA 4IJPA 5ETCA 1ZYCA 2UW7A 4FYNA 5CF8A 3HECA 3K3JA 4JL9A 3UZPA 3EB0A 4DLIA 3FKNA 2W99B 1OUKA 3VHEA 2YM3A 2VWWA 1B38A 3QQHA 4DFZE 2XKEA 2WMAA 3ENHA 4O6LA 3CBLA 4RRVA 2QOKA 1G8KA 4O7YA 3SG8A 3LMIA 3RAIA 4I5HA 2W4KA 3MWUA 4CFFA 3QAME 4EHGA 4DEHA 3PJ2A 4NWMA 4F7NA 2BZKB 4FEUA 2O2UA 4FSQA 5T68A 3PSBA 3Q9XA 3QZHA 4FTIA 2FA2A 1E1XA 3GBZA 3BLQA 4TWOA 3FC2A 2EVAA 3QTQA 3RZBA 4QTDA 4FICA 1BMKA 3LCOA 3OFMA 4KKEA 2JKOA 4F6UA 5E8YA 4D5KA 2XJ2A 1H1RA 1APME 3CPBA 4B7TA 4BDEA 2XF0A 5CAPA 4KB8A 2CMWA 2WTCA 4P5QA 4C0TA 3OTUA 3Q53A 3TMOA 3MVJA 2ZV2A 1WVWA 3NUUA 1Y57A 3H3CA 2C69A 4YJVA 3D7TB 5JK3A 3U6JA 4C37A 2BRNA 4C3PA 5AUUA 3UC4A 5BVKA 4AFEA 4YMJA 4PQNA 2RG5A 2ITYA 4MD7E 2GCDA 2WMQA 3DBQA 3PXYA 3R2YA 5E1SA 3Q4UA 4YTIA 3VVHA 2R7BA 4M68A 2BTRA 4DHZA 5DG5A 5EYMA 3ZO2A 4C3RA 5FRIA 5LWMA 2BKZA 3KMUA 2UVYA 3FZSA 4LI5A 5DPVA 3PA3A 5HIDA 2YZLA 3BKBA 3AC1A 2VWBA 3H30A 3OEZA 3DKCA 1PJKA 4U5JA 3R02A 5IA5A 4YC3A 5EYKA 4E6CA 3OWJA 3FMHA 1H28A 3NEWA 3K2LA 1OUYA 2VTRA 4G34A 5FEEA 5J7HA 2GHLA 1AQ1A 4J7BA 4RC3A 2XYUA 2YAKA 2OSCA 4JQEA 5H3QA 2ZOQA 4CV8A 3D4QA 4L67A 3DK6A 1PYEA 4WNMA 4IVDA 3BV3A 4ASDA 3HZTA 3MJ2A 2UVXA 3U4WA 1J7LA 4K11A 5FP5A 3V3VA 4MQ2A 5CEIA 3QLFA 3AMYA 3R8UA 5BVNA 4KS8A 4S32A 3V8SA 3WE4A 1P14A 1WBNA 2GNLA 3F6XA 3MGYA 4WUAA 2I7QA 4GH2A 4B8MA 4XEYA 4KIPA 4CFMA 2ACXA 1J1BA 2C3LA 2IVSA 3FI4A 2QCSA 4UYAA 3MESA 2I1MA 1H01A 1PRYA 4O7TA 2ZMDA 4CRLA 5I4NA 3S1HA 3OBJA 4MK0A 5D12A 4FL2A 3KCFA 1FINA 2PVNA 3BHTA 4AAYA 3RPVA 4CRSA 4ORKA 3KK9A 4WG3A 1LPUA 2WTWA 5E8UA 3SLSA 3QQKA 4DBXA 4N70A 4EH9A 2BDWA 2YITA 1OBDA 5DNRA 4L68A 2GHGA 4WA9A 5K0XA 3IS5A 3ULIA 1FVVA 5EQYA 5M4IA 4AU8A 2UZVA 1BL6A 3FI3A 4M67A 1ZY5A 2GFCA 3EWHA 4FF8A 3T9IA 2QOCA 2JIUA 2IVVA 2AYPA 3F3VA 5GZ8A 2X4FA 3PRFA 4XJ0A 3OEFX 4BWXA 3F3WA 3SXFA 3TZ7A 3DBEA 2J0MB 4FKQA 2QR7A 2XYNA 5DOSA 5H8EA 4O96A 4G6NA 3VQHA 3BU3A 3H0YA 2OIBA 4O4FA 4KRDA 5I3OA 3JR1A 4G3DA 1E9HA 4F9BA 4IANA 3GT8A 4QNYA 3SW7A 4ANLA 5A6OA 4I5PA 3OT8A 4ITIA 5HGIA 1Q3WA 4YSMA 4B6LA 5AUVA 3ZDUA 3AT3A 2OKRA 2VO7A 3NMUF 3TNWA 4NTSA 4IZ7A 1GIJA 2C0TA 2XMYA 4USDA 3KGAA 4EBVA 4F1TA 2B9JA 2GNFA 4EOSA 2X6EA 5HESA 2CGUA 4AUAA 4YZ9A 4C4JA 4BHNA 5KBQA 1RE8A 3QTIA 4R5YA 5CU4A 4W4VA 3KCKA 2Y7JA 2HZ4A 3QBNA 2V62A 1GIHA 1GIIA 2XZSA 3ALNA 4WNPA 3KXHA 2QU6A 4IWQA 4MNEA 3SAYA 2YM6A 4A4XA 5HU3A 5FWKK 4QP9A 3QXOA 5H8GA 3BWFA 4IDTA 3RM7A 3R7IA 3UGCA 2XNPA 2UW4A 2G15A 4B99A 4ZTSA 4FG9A 3A7IA 3RTPA 5A4LA 4LOOA 4Q2AA 4KKGA 2XNEA 4IWDA 2WQEA 1U59A 3LCSA 3ZU7A 3IW6A 3V51A 4BIEA 4EUUA 4ZP5A 3IW8A 3S3IA 2BVAA 5IH5A 3UQCA 2CCHA 3FZ1A 4LDTA 4FV7A 4LYNA 5F4NA 5AV4A 5BUEA 3GXLA 2X0OA 3D5VA 4KNBA 3R2BA 1PYXA 3MSSA 4J8MA 4F9AA 2FYSA 4XMOA 2X2MA 4WHZA 5HCXA 4EZ7A 2A4LA 2W1IA 3VWAA 3AMAA 3D9VA 5ANGA 3OROA 3TKIA 3R9NA 3UO6A 3ZEPA 3E8NA 1RQQA 3LXPA 3NW6A 3RCJA 1VR2A 5DEYA 4CFUA 4CMOA 4DTAA 2FSOX 1HCLA 2WMSA 3PJ3A 3V5TA 2W5HA 5CXZA 2Y4IC 5AJQA 5AP4A 1H27A 4YZDA 2OG8A 2WMBA 3I7BA 5F9EA 3EKKA 3E7VA 4AP7A 3P78A 2WQOA 1IAJA 2OZAB 4FKLA 4B8LA 2UZNA 3PY3A 4PMMA 3TG1A 2IW8A 3GEQA 5AP0A 4PF4A 3THBA 1CDKA 4FI1A 5HLPA 3CCNA 2RFSA 2ITNA 3PXRA 4QYGA 3H9OA 4CMUA 5I9ZA 2IN6A 1PY5A 1WFCA 2XKCA 3N4VA 4A9YA 2VU3A 4IVBA 4MD9E 4BIBA 3EFWA 3QTUA 4YBJA 3DU8A 4FKUA 3F7ZA 2QHMA 4X3FB 3LXKA 4BCQA 3ANQA 4JAIA 4OTRA 5E8SA 3UMWA 2A27A 3R6XA 3TYKA 5M4UA 4EZ3A 3RNIA 5JN2A 3G15A 1UU9A 4M7IA 3FHRA 4RVLA 5L2SA 2XS0A 4DYMA 4RIYB 5D7VA 2GSFA 3KREA 3H10A 3ZRLA 3REPA 2Y0AA 3R28A 2FH9A 3QHWA 4FC0A 2R2PA 3BYOA 3HV4A 4ZTLA 3PFYA 3A4OX 4ITHA 4NU1A 3T8OA 3MPTA 2UW9A 3CXWA 2YCSA 3DY7A 3E62A 2J5FA 2V55A 3BEGA 3BHUA 3Q04A 3R04A 4FODA 4IB1A 1JVPP 4PY1A 4BIDA 4BTFA 4E5BA 3UOHA 2ZDTA 1YXTA 1IA8A 5AR3A 4AQKA 2W1EA 4L8MA 3K5VA 5HE0A 4O0WA 3TWJA 4R78A 3ZZEA 4AWIA 4E6DA 5M07A 1VLRA 1XH7A 4CTCA 3EQBA 4J98A 5EG3A 4U43A 5HVJA 1Q62A 2QQ7A 1XBAA 4FV3A 2XIXA 3U87A 4FG7A 3N51A 4FGRA 5JGDA 1H1QA 4H39A 4BCMA 4G31A 1CMKE 4GYIA 3L8SA 1RW8A 4KSQA 3LLTA 4L46A 4YBKA 3NW5A 4JRVA 4BL1A 2BDFA 4DGOA 2VN9A 3BLHA 1OB3A 1WBWA 4I92A 4DAWA 3IQ7A 3DAJA 1VYZA 4FKSA 5HQ0A 5IPJA 3F5PA 4AZTA 5LMBA 4PUZA 4EUTA 3VC4A 5IUGA 2UW8A 3LVPA 5I9VA 2C6IA 4IBMA 1F3MC 3PG3A 3VJOA 3ZDIA 5DEWA 5CASA 3E8DA 1REKA 3EN6A 1K2PA 4YUQA 4G5JA 5J1VA 4XG6A 2UZWE 2QLUA 3DZOA 3HDMA 3OY1A 4L7SA 4I4EA 1FPUA 3PFQA 1MRYA 3Q9WA 4ASZA 5IQDA 3VAPA 3DKGA 3HVCA 4EBWA 3DGKA 3GQLA 3RK9A 5J5TA 3BLAA 2QOHA 4R77A 1OIQA 5CXHA 3A7JA 3B8RA 3I4BA 4CKRA 4ZY4A 3DK3A 3UPZA 4BRXA 3KVXA 1YDRE 4D2SA 2CCIA 4RX7A 4XBUA 5HBHA 4L53A 1G8AA 3BE2A 4C57A 3KVWA 3M1SA 5GJFA 4LMUA 3LJ2A 2OU7A 5L2TA 2B9FA 2GMXA 4NSTA 3DXNA 2HK5A 3R30A 3VF9A 1YXUA 2P3GX 4DH8A 1KV1A 2ESMA 1GNGA 2NRUA 4KIKB 4IAZA 5JFXA 3NUAA 3LFSA 3KRRA 4CG8A 4X3FC 4A4LA 3IDPA 3SRVA 3RM6A 4BDAA 1YXSA 3HV6A 2Z7RA 3KA0A 1XR1A 2XARA 1GJOA 3QD2B 1V1KA 3CEKA 4MBLA 5FLFA 4MNFA 3LFEA 2I40A 4AXAA 4ASEA 5CNOA 5M4CA 3PZEA 2A98A 1H8FA 4BHZA 2PULA 3HUBA 4JNWA 4OTHA 3ZFMA 4D0XA 3VS1A 5IUIA 4DN5A 1Q5KA 4F0FA 4F4PA 5HO7A 4FTAA 3W0SA 4XX9A 3KULA 3JY0A 4EH5A 3SG9A 5E8WA 4M97A 3ZFXA 4X2KA 2YA9A 3VUHA 4FT0A 1Q8WA 4IEBA 1Q99A 4PTGA 5KE0A 2QOBA 3DXQA 3CY2A 3R1NA 2NRYA 4L7FA 2ZAZA 2HXLA 2W9ZB 4S31A 5BVWA 5DR2A 5AR2A 4YNEA 5F20A 4JBQA 4OBQA 1XQZA 5EM8A 3SHEA 4E3CA 1VYWA 2EXCX 5M53A 3FQEA 4TNBA 3CGFA 4FEXA 3R8VA 2EXEA 5BYYA 4QMXA 1CSNA 4GRBA 4BJJA 3ET7A 4J96A 4ANQA 4E5AX 3VS5A 3FDNA 4IWPA 1Y6BA 2QU5A 4FSUA 4Y95A 5CSXA 4CT2A 5HORA 3COHA 3DQWA 2FSLX 4OGRA 3PE1A 1S9JA 4Q5EA 3BIZA 3R9OA 1ZMVA 3ZBXA 2VWYA 3F61A 4AXEA 4XG8A 4K33A 5CT7A 2XBAA 3T3VA 3IGGA 4C35A 4Q9ZA 5AV1A 2PMOX 2OJFE 2ERZE 4R3CA 3O0GA 3MA3A 4RJ8A 3HMIA 5GJDA 4AW0A 2CKPA 4NM0A 4O6EA 3E7OA 4OAVB 2F7XE 5IDPA 3C0GA 4WT6A 1DS5A 1KE8A 4FBXA 4CFNA 5IUHA 3A7FA 3Q5ZA 3QUDA 5AP6A 3QQLA 3BYVA 2Z7SA 3MVHA 4OTFA 4Y5HA 3WILA 4U41A 5KMIA 4FG8A 4FIIA 4ZZMA 4CT1A 3FZTA 3ZSGA 3TKUA 5HG7A 3AMBA 3EN5A 4EZ5A 4FKGA 4H1JA 2J6MA 2YWVA 4R6VA 3IOKA 3AKKA 2WU7A 5CZHA 3U9NA 4HVHA 2XK4A 3BQCA 3L9NA 4KBKA 4RWIA 4EOPA 3LLAA 1S9IA 2EUFB 3UTOA 4IADA 4I0RA 1P4OA 3ZSHA 3WF7A 3OVVA 4Y8DA 3C1XA 2DS1A 1KE6A 3QTZA 4NZWB 2H8HA 4HZRA 5JEBA 4O2PA 4R1YA 3NIEA 1H1PA 5HCYA 1ZAOA 4DGMA 3SC1A 2BKKA 5D10A 4LV7A 2V7AA 2BFXA 4ZOGA 1Y6AA 3RKBA 4EOIA 2PUIA 3EN4A 4KIQA 3A61A 4C4GA 5KMJA 4JQ7A 3I1AA 2R3HA 4J53A 3EQPA 4OAUC 4ALWA 4RWJA 1R78A 3LFCA 1JKKA 2IO6A 4YJTA 4A9UA 2CKOA 2OLCA 2IZSA 5DI1A 5AADA 4B4LA 4CQEA 2PUPA 3G33A 1NT2A 4DCEA 3P5JC 3RHXA 4UXQA 2XBJA 4I94A 3WF9A 3QGWA 4EEVA 3GCUA 4CCBA 4IM0A 3FLWA 4P4CA 5CU0A 3O8PA 1DM2A 2C5YA 5CVFA 1YI3A 5L2WA 4CD0A 4C2WA 3ENMA 3PXQA 1ST4A 1M52A 2BILB 3TJCA 1Z9XA 3UDTA 5CLPA 3N4TA 3OXTA 5ANOA 3I6UA 4QTEA 3RBWA 4UMUA 3PLSA 2W96B 1KUTA 4USFA 4C2VA 4K6ZA 4WG4A 5HO6A 5CI6A 3G51A 2UW3A 3EHAA 2HCKA 4IC8A 3GC7A 2X1NA 1Y8YA 4EK8A 5HU9A 3AC8A 2C6KA 3D7ZA 4FTMA 4QNAA 4ZTRA 2W4JA 1V0OA 4DFBA 1U54A 1OKVA 3JUHA 3NSZA 3IW4A 3U8WA 4FSMA 4O7WA 2YERA 4W4YA 5DWRA 2AUHA 2XNGA 3HX4A 5H2UA 2HELA 4O22A 1Y91A 4F9WA 4HGTA 3OCBA 4FV4A 3MA6A 2GS6A 4RIWB 2GNHA 3EOCA 4HW7A 2Z60A 3OG7A 4O4EA 1URWA 3BCEA 3KF7A 3IW7A 3OXZA 4MXCA 5CWZA 3V01A 3ZEWA 1NY3A 4LRMA 4D28A 2XM9A 3UODA 3FZRA 4GEOA 1BL7A 5HE2A 4L01A 3KRJA 4UN0C 1L8TA 2J0JA 3U4UA 3LCKA 2C0IA 4J95A 3LMHA 3BHHA 4I5MA 5A9UA 2QOIA 2UW5A 4JT3A 4EHEA 4DINA 5FDXA 5CAOA 3F2RA 4BCKA 1KE7A 5BYLA 2ITTA 5TKDA 4IX3A 4WBOA 4EOKA 4NEUA 4UWCA 3R9DA 4AZFA 1M2PA 4G9RA 1IR3A 1YWVA 3PZHA 2HXQA 2ZM3A 1BI8A 3ZFYA 1NVSA 5CF4A 5GIOE 3CKXA 5ANDA 3QTRA 3IPHA 1SNXA 2IPXA 3HMNA 3ML1A 4R7IA 3Q4CA 5J1WA 4O1OA 1OPLA 1PKDA 2R0IA 5EYCA 3R1QA 3OD6X 2YM4A 3PE2A 3QLGA 5DMZA 1AD5A 2F57A 1BI7A 3H0ZA 3FZOA 4O7SA 2RG6A 4TW9A 3UIMA 2WIHA 1GZ8A 4XRLA 4BDHA 3LFNA 3QQUA 2XH5A 3FXWA 2H34A 3Q9ZA 4IZAA 4FV2A 2X8EA 3UVRA 4BVUA 1R0PA 1Z5MA 2BUJA 2Z8CA 3FQSA 4FTUA 4XG4A 3UE4A 3ULZA 4DT9A 4RPVA 4DH3A 3ZLWA 2HW6A 5C1QB 3QUEA 4BYJA 3UDBA 4RFYA 3NYVA 3P79A 3FV8A 1CKIA 3G0FA 3OOMA 4YC8A 3F2AA 4U97A 3DNDA 1PMNA 3CSVA 3OS3A 2QKRA 3B2TA 3NGAA 4J99A 4PL4A 3VBXA 2WAJA 4M66A 1ZRZA 3LFBA 4A9RA 4E1ZA 1YRPA 5EHOA 5GZ9A 5HE3A 3IDBA 4ZLOA 5AAEA 3RNYA 2C47A 3IW5A 1XH4A 3P23A 4FK6A 5D9HA 3R01A 5EI8A 3RI1A 4O7LA 4IB3A 4BCOA 2X0PA 4ZZNA 2YCRA 3L8VA 4I93A 3FXZA 4ALVA 2EB3A 2C3KA 1PKGA 3DB6A 3H9FA 4FZ6A 4JR7A 3TNIA 2CLQA 3NS9A 3JVSA 4XLVA 2W0JA 5IKWA 1J3HA 5HKMA 2I0YA 2C0OA 3BE9A 3A99A 2LAVA 4WBBB 3FPMA 2OH0E 4TYHA 3L8PA 2ZV9A 3FMLA 3FZPA 2C68A 4FIEA 4XV3A 5CSWA 5M44A 5AUWA 5M55A 4O0RA 3I0QA 4R3PA 5BYZA 4DLJA 2E2BA 4IE9A 4QYYA 3QRTA 4RC2A 2Z02A 4XP3A 4I6BA 5JQ5A 3T9TA 4FEVA 4E5WA 3D5WA 3RK5A 1DI9A 4AT3A 4OBOA 4MXAA 2IW6A 3HL7A 1WBVA 4O38A 2CKQA 3RWPA 1KOBA 4L42A 3V04A 4OTPA 3QWKA 4IACA 2YISA 3NNXA 1Q61A 3W2CA 3UP7A 5KMMA 4L9IA 4HYUA 3WZEA 3H4JA 4TYGA 5KKRC 4D1SA 2CLXA 2B9HA 2JDRA 3VUGA 4F0GA 2CNQA 1J1CA 2ZYBA 2WMTA 4RIXB 4ERWA 3PRIA 3ACJA 1HCKA 5A4CA 4CZUA 2ZB0A 4G6OA 4H3QA 4D0WA 4AXCA 4RA5A 5AR5A 4BI0A 3CLYA 2UUEA 1YWRA 3FYKX 4LOQA 5IH4A 4MWHA 4F78A 4DFXE 1QMZA 1XMLA 3HAMA