5CEOA

Dlk in complex with inhibitor 2-((6-(3,3-difluoropyrrolidin-1-yl)-4-(1-(oxetan-3-yl)piperidin-4-yl)pyridin-2-yl)amino)isonicotinonitrile
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
269
Chain Sequence
LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 12
total genus 85
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ceoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ceoA01
3WARA 1RE8A 1YDTE 2PZYA 1RQQA 4NIFB 4QPMA 4MBIA 1B6CB 4TPTA 4C38A 5CU4A 5H3QA 2WAJA 4NIFA 1OIUA 4QPSA 4AW2A 3NR9A 5CI7A 3B8QA 4K2RA 3SLSA 3ZM4A 2BAQA 4CQGA 1R3CA 1SNUA 4C62A 2YIYA 5HIBA 2X8IA 3I7BA 3QQLA 4MWIA 5AP3A 4ZLOA 3THBA 5EQPA 3BYSA 4BIDA 3W55A 2IWIA 1KV1A 1RJBA 2XMYA 3QA8A 1YOMA 2WOUA 1HOWA 4MBJA 4X2JA 4ZJIA 4EZ5A 3DK6A 2W9ZB 4RQVA 4NH1A 4YJVA 3ZUVA 4QNAA 2YIXA 4M15A 4B8MA 2WQBA 4FX3A 4IAKA 4NFMA 4YJOA 1GOLA 2QO7A 5HLNA 2JIIA 2WQOA 3FHRA 1ATPE 2ZB0A 4ORKA 5FEDA 3KA0A 4BDGA 3V5PA 2KULA 1IA9A 3OEZA 3FEGA 5EM7A 1Z5MA 4DA5A 3HAMA 1CDKA 4FKOA 5JN2A 5EK7A 3O2MA 4FV4A 2VN9A 3RCDA 3ATSA 2XM8A 5KHXA 1F5QA 3TNIA 3H9RA 3FQHA 4RPVA 4YJRA 1ZY4A 2PUUA 5ANDA 4ZTSA 5L6WL 3EQPA 4UMPA 2XVDA 1V1KA 3R7VA 3UYTA 3V01A 3ZC5A 2ZAZA 4BDFA 4FVPA 4F9CA 1G8AA 2PPQA 3GC8A 4FTOA 2XK6A 1JLUE 3LFBA 4FTJA 3F5PA 1OKWA 4QTBA 4Y46A 5LWNA 3UO4A 3DDPA 4RWJA 5C1QB 3BHUA 4IEBA 1K2PA 3TI1A 2RG5A 1JPAA 3UIBA 1MP8A 5IZFA 1PRYA 5CSWA 4ENXA 4R7BA 2C1BA 4UZDA 2GS2A 1X8BA 1FGIA 3BWJA 1LEZA 5J79A 4O7ZA 5EKOA 2W4KA 2WHBA 3BYVA 3DQXA 4TYJA 4WA9A 1MQBA 3TJCA 4C37A 3C9WA 5IA0A 5DGZA 3RK7A 2XK4A 3CTJA 3A7JA 4NJDA 2OF2A 2XKCA 3ZS5A 2C4GA 4O2PA 1CSNA 4ZAUA 5GIOE 3BV3A 4ITJA 3I60A 4J53A 4AOIA 5JGAA 5J1VA 3OG7A 4BBEA 3RAIA 3GT8A 4U40A 5DWRA 4WG4A 4EC8A 2VTOA 3H4JA 4NM5A 4ZY4A 4USFA 4O81A 2IW8A 4TW9A 2CGWA 5KZIA 4GK3A 4DGMA 1BUHA 3FZPA 4DGNA 3CQEA 5L8LA 3CE3A 3QQHA 2XJ2A 3VRZA 1Q3WA 2I0EA 2O5KA 2VX3A 3HRBA 3O51A 4MF1A 3A8XA 2QOLA 3QTXA 2WKMA 3TKHA 3AOXA 5CTPA 1OI9A 2VWVA 4GK4A 3Q04A 4ACMA 2IW9A 2OZAA 3UQGA 3CP9A 4YZDA 3OT8A 3VBWA 4ANMA 3NEWA 4CSVA 1E1XA 3S95A 2E9VA 2OKRA 5E91A 3OMVA 3QF9A 1VJYA 1Y8GA 3FKNA 4C58A 3VS5A 4NTSA 4MEDA 3PJCA 4F09A 2PVJA 3HUBA 2F2UA 1PKGA 2QNJA 3M42A 3S4QA 3DAKA 4DEIA 4ZLZA 3KMWA 3NUPA 3FKLA 3OCTA 3ZRKA 3F6XA 4M84A 4F63A 2ESMA 2VGPA 5JFWA 2B9JA 2C0OA 4FNZA 3MDYA 5DA3A 5FEEA 5IU2A 4C59A 4RIWB 3HGKA 3TCPA 3ANRA 3II5A 3OY1A 1PMNA 5A4CA 4OBQA 4MVFA 4WNMA 2XIYA 4M3QA 4BCOA 4MXOA 2WEIA 3D9VA 4ZK5A 3KEXA 3WE4A 3DKGA 5GJGA 5CAUA 4O83A 2C6EA 3K5VA 1PJKA 4XCUA 2REIA 4OTGA 2WXVA 4FT9A 4I92A 2ONLA 1KE5A 4NW6A 2BDJA 4XBUA 3VIDA 3KCKA 3EKNA 3NNWA 4HGLA 4XRJA 3V5LA 4RJ4A 5BUIA 2ITYA 1B39A 2CCIA 2YISA 3LXLA 4PDPA 3ZBXA 3LKMA 3EN4A 2WFYA 3MB6A 4FKRA 4IFGA 2DQ7X 5CU3A 3UP7A 3F5GA 4UXLA 4CTCA 1L8TA 2CNVA 4GFMA 4H1JA 1UV5A 3UC4A 1NXKA 2YABA 1UU7A 2HZNA 2ITOA 3OTUA 3KK9A 3FSFA 1RW8A 3ZC6A 2R3NA 1KUTA 5HVKA 5K5NA 3O71A 2BFXA 1FINA 2VZ6A 3PE2A 5CVGA 4II5A 2ITTA 3DLSA 3CS9A 5IQBA 4KSQA 3AC5A 3NW5A 4FKWA 3MA6A 3DKOA 4EOKA 3DNDA 2W5BA 4I4EA 4ID7A 3LCKA 1ZAOA 4S32A 4QQJA 3GNIB 3LQ3A 3NYNA 1XH4A 4AACA 4EONA 4ASEA 3DXPA 2BUJA 4JBVA 3C5UA 5I0BA 4EH4A 3LFCA 3N4TA 2GNJA 4FV1A 3V8SA 3UZPA 2DYLA 2C5XA 2VTLA 3UNJA 3UYSA 4DHFA 1VZOA 3FI4A 2EVAA 4OTIA 3QTQA 2C5NA 4QP9A 5EDPA 2XIKA 1A48A 5IUGA 2OJ9A 3H0ZA 4LFIA 4RA4A 1PW2A 3HV4A 4DEHA 3HRCA 5L2IA 4YMJA 2QLQA 4FTAA 5L2SA 4F1MA 2X81A 4FT0A 4BC6A 5TOZA 2WIPA 4ANNA 3ZDIA 4YTFA 2PU8A 4F0GA 4BGHA 3NUAA 5LVNA 2RFSA 2QONA 1XBAA 3C51A 4BR3A 2C6IA 4R8QA 3KXHA 3QHWA 4IDTA 2ZMCA 2AC3A 1MRYA 3GB2A 2WQMA 4EHZA 2YIWA 5IH5A 3VQHA 2JDVA 3E8EA 3Q9XA 4YJUA 3UE4A 2J0IA 5D1JA 3TACA 3D7ZA 4FBXA 4YZMA 3QU0A 3K5UA 3WE8A 2JKQA 4FTTA 4V0GA 3CTQA 3ORIA 3UBDA 2FB8A 4DEDA 3FLWA 4ZSJA 2ITNA 1AGWA 3R9HA 4TYIA 4XYFA 3WF5A 4LI5A 4G2FA 4GW8A 4YO6A 2R64A 4IVDA 2OIQA 1WVXA 3ZMMA 4B6LA 4BCPA 3TZMA 3QX4A 2ITQA 2CGXA 2VTMA 5D7VA 4NYEA 4CKJA 1ZZLA 3WZDA 4D2RA 1IASA 3DY7A 5DBXA 3IKAA 4XS2A 4AP7A 1G5SA 3L9LA 3PPJA 3UO5A 1F0QA 4K8AA 1WAKA 4TYHA 1UU8A 2EWAA 3P79A 4IZ5A 1YVJA 2OH0E 4E3CA 1GIJA 2C5OA 4UEUA 5KX8A 5LVOA 3AD6A 2P33A 2CHLA 2V5QA 5IUIA 5E8SA 2BTSA 5L2WA 3E93A 3F3VA 4BKJA 3TNQB 4EZ3A 1APME 3JY9A 2GMXA 3Q6WA 4WKQA 3AC3A 2EXMA 2XK7A 3KL8A 3P9JA 4WRGA 3LCSA 4LOQA 2VO7A 4OTPA 4BHZA 3FL5A 5EI2A 1PY5A 4AFEA 4DT9A 2R3FA 2PZPA 4IM3A 2PVKA 5GZ9A 4NL0A 1DM2A 3FUPA 2C47A 1U5RA 4R7IA 4BWXA 3TV4A 1OKYA 1YDRE 4RT7A 2QG5A 4IX6A 4JDJA 1J1CA 4YLLA 2YZAA 3VNTA 4Z16A 3PXFA 2UZLA 3DK3A 3IQ7A 2C1AA 5M53A 4ZMEA 5BVWA 1A06A 2OFVA 2YM4A 3RINA 4FV6A 1W98A 4M66A 3HA6A 1JQHA 4L42A 3UZTA 2YHVA 2RF9A 4WNKA 3TNHA 4C4JA 1PF8A 2QOCA 5BX0A 3ZHPC 4CKIA 2G15A 4WSYA 1URCA 3BKBA 3MFSA 4TY1A 3VHKA 2Q0NA 3V5TA 4AW0A 1H28A 2OZOA 2I0VA 5JZNA 4PL4A 1YXUA 3HMMA 3QQUA 3FI8A 4HGTA 4V04A 5BPYA 4F65A 4QYHA 3PLSA 4NEUA 4ZY5A 2UW7A 4ACGA 3C0HA 4J1RA 4YSJA 4IJPA 3W32A 3CQUA 2P3GX 5A3XA 4FF8A 3OOGA 3IK3A 4PMSA 3KXMA 2WPAA 5GJFA 5HTIA 3QTSA 2WNTA 4ANOA 4O7LA 4ZMFA 4RJ6A 3Q4UA 2C69A 1I09A 4RC3A 4QMXA 3DZQA 3BBTB 4X2NA 4ANBA 4AZFA 4PNKA 1UKHA 1GZKA 2JKMA 4Y85A 3IG7A 4EWHA 2NNWB 3R04A 5AV1A 1E9HA 2I6LA 3ZRLA 4DEGA 4S30A 5AP6A 3QRJA 4DGLC 5E4HA 3ZO3A 4RVTA 1TQIA 4EJNA 2R4BA 3KMUA 2QO9A 3W2SA 4XV1A 3GCUA 2HCKA 4I41A 4LOPA 3PPZA 3UMWA 5JFSA 3A7HA 2X9EA 2FSMX 4KS8A 3A7GA 4E5WA 1JNKA 5KMIA 5L6OA 3DBFA 3LFAA 4XLVA 2PVNA 5TE0A 3WZJA 3PDTA 3RBWA 2PHKA 4D5HA 3LJ2A 3N4UA 3Q4CA 1CMKE 3PA4A 3WZUA 3U8WA 2VWIA 2Q0BA 4F9BA 4NU1A 5EM6A 2VNWA 2WGJA 3ZU7A 4W4VA 5KMNA 4Y8DA 4BRXA 4CLJA 5A4TA 4QMZA 3H10A 3PP0A 4ZTMA 1M17A 3AD4A 2R5TA 5IH6A 2JDSA 2GSFA 5FDPA 3GFWA 3Q2JA 2XNOA 3L8PA 2GU8A 4CTBA 3PRIA 5A4EA 3BLRA 3PFQA 4LG4A 4FKLA 5DH3A 2IVTA 3UIUA 5JSMA 5M07A 4OW8A 2ZVAA 3E3BX 2GNHA 3L9PA 4MD7E 4BYIA 4HOKA 4U9AA 4YBKA 3UDBA 4GFGA 3FBVA 4TTHB 2VTSA 3H9OA 5HKMA 4AA5A 3LE6A 4DGOA 2B7AA 4XHKB 1K3AA 2OJGA 3LCDA 3LFDA 2CN8A 2VTIA 4PMPA 3ZFYA 1V0OA 3D4QA 5AJQA 4L52A 4RMZA 1TQPA 1YXSA 3MFTA 3P08A 3BYMA 5AP0A 3G33A 2XJ0A 4XV2A 5GZ8A 4LRMA 4ZZNA 2J51A 2JITA 4NKAA 4TNBA 5DLSA 4IZ7A 3HDMA 4E4MA 3O17A 4HZRA 2CKPA 3DNEA 5A14A 3KFAA 3MVJA 5J7BA 2OJIA 3CXWA 3RMFA 1Q99A 5CWZA 3FSKA 3D5XA 5E8YA 1TQMA 3OCSA 4PPCA 4QYYA 5C27A 4RGJA 1H8FA 5AFVA 4RVKA 3D7TB 4NCTC 4GU6A 4D1XA 1BI8A 3V6RA 3R9RA 4CMOA 2IN6A 1P14A 4IFCA 2QOHA 4L9IA 4BI2A 2F7XE 3Q60A 2W1ZA 2W1DA 1GZOA 2RKUA 3DPKA 3GOPA 3JXWA 1UA2A 4NUSA 5HG8A 2B53A 3NIEA 3VW6A 3WYXA 5AUXA 5DNRA 5HBEA 2IPXA 3A60A 5AAGA 2SRCA 4CFFA 4YUQA 4QMPA 1WCCA 2H34A 2YA9A 4U42A 4YNOA 4IM0A 1PMVA 2PVHA 2G1TA 3OHTA 5LMAA 1SVGA 1PYEA 3SOAA 2HAKA 3HLLA 3P5KA 4Y83A 3E8DA 2BVAA 3LFFA 3OW4A 4IAIA 4C57A 3RM7A 4DC2A 3ZLXA 3I7CA 2HZIA 1YHSA 3POOA 5LVMA 4FE2A 1OITA 2HWPA 4FUYA 3FMNA 5BVDA 3I5ZA 4TNDA 3COMA 3QKKA 4BHNA 2BHEA 4U6RA 5HVJA 5HBJA 3FY0A 4J95A 3KRXA 3H0YA 3LCTA 4GMYA 4F6UA 2PK9A 1GY3A 4FEQA 4GJ3A 2R3IA 4UV0A 5DRDA 3HECA 4I23A 4AGWA 3MH3A 5AUZA 3ZBFA 4BCGA 2GQRA 3FMDA 4EH2A 1YXVA 5DIAA 2WMBA 5BMSA 4FIJA 2QODA 5GHVA 3R7YA 4RJ7A 5HD4A 4DH5A 3UNKA 4YSMA 2CKEA 5I5ZA 3R8VA 5AR7A 3QD0A 5C8MA 2WMWA 2Y4IB 5KBQA 3KCFA 4HYHA 3E87A 2VWZA 4X2KA 3MPTA 4XJ0A 2FYSA 3CC6A 4LRKA 5CAOA 3EQFA 4W9WA 4EBVA 3P1AA 4Z9LA 4GJ2A 5EYDA 2R3QA 3WZKA 2YZLA 1ZARA 4XG9A 2E2BA 2I40A 3P7CA 3VUKA 4UN0C 5A9UA 4DT8A 3RM6A 2HXLA 3KRWA 4HW7A 2B52A 2O2UA 1IA8A 2R0UA 2RFDA 5AWMA 3UODA 2GHLA 2JIUA 3OUNB 4DFXE 2C6OA 3CY2A 4QMTA 4LUDA 4P5QA 3NUNA 1FGKA 2ETRA 3C4CA 3PJ2A 3R1QA 5LVLA 4ARKA 2E9UA 3HV5A 3SHEA 5CEKA 3LXPA 3A4PA 3COHA 4Y95A 4O7RA 4DAWA 1WBPA 4U97A 3RALA 5JFXA 3I5NA 4XRLA 4FG7A 1JKKA 2VWXA 4FKUA 2YCFA 3D15A 1BMKA 3D2IA 4A4OA 3GCQA 1LPUA 3MN3A 5JH6A 1LR4A 5C26A 1L3RE 4XX9A 4NM3A 4BTFA 5I9UA 4P90A 1RDQE 2CGVA 3R7IA 4XP0A 3TNWA 4L53A 4AFJA 4FEUA 1H26A 1U54A 1WBSA 2JKKA 1XKKA 2JBPA 3W2PA 4DH1A 4RSSA 3PXKA 5LVPA 1KV2A 1OL6A 4O7VA 4V01A 3QKLA 4G31A 3UOHA 4HVDA 4XV3A 4UMTA 4F0IA 3KY2A 3NRMA 3DTWA 1HCKA 5F4NA 3FV8A 3ZDUA 5JKGA 3LFEA 3ORTA 4EK8A 4JBPA 3BCEA 2WTKB 2BIYA 3KULB 2HW6A 3MBLA 5CVHA 2J50A 3KRLA 4L8MA 4EOIA 3VBVA 5KKRC 1H08A 3F2RA 2Z7LA 2R2PA 3G6GA 4AW5A 3E88A 3G9NA 4R5SA 4CZYB 2Z7SA 4IB5A 5BNJA 5M57A 4O0YA 4I5PA 3Q96A 4EORA 4BYJA 2G2HA 3NWWA 5JQ5A 2CKOA 4QRCA 3M1SA 4AE9A 2Y7JA 4ZZMA 2XNNA 3DBEA 1M7QA 4EYJA 4F9WA 1O6YA 3QQJA 4A9UA 3AMAA 2VTQA 4FKQA 3ZFMA 3EHAA 3ZH8A 4R3PA 2A0CX 2B54A 3DKCA 5AM6A 3BU6A 3BWFA 3RNYA 3BBWA 4GIHA 4EHVA 2FSTX 4YHFA 3TM0A 5L8JA 1TKIA 3MVHA 3MTFA 5EM5A 5CZIA 1OB3A 5HHWA 4KIKB 3T9TA 4KBAA 4KNBA 5DEWA 3AC1A 4EH5A 2VO6A 3MY5A 1JKLA 2EUFB 4Q9SA 4XP2A 3UIXA 4BDBA 3NNVA 5HX8A 1OZ1A 2XP2A 3ET7A 3FYKX 3AC4A 3OVVA 3RKBA 3T3UA 3VQUA 1V0BA 5JGBA 3L1SA 3FMLA 5F94A 1ZMUA 2WOTA 4J7BA 5IA5A 1VR2A 4EQMA 4F1OA 5L3AA 2JBOA 3KGAA 3QQFA 4X3FA 3QYWA 4AS0A 2W1GA 4IAAA 3SVVA 3VS1A 3Q9WA 4X3FB 1H07A 1PKDA 4HVSA 4C2VA 4BGQA 3OCGA 5F95A 4E20A 4UALA 2BRBA 1H27A 5AV2A 4FA2A 4GUBA 5CF8A 4DFBA 2W9FB 4L43A 3BGZA 3Q5IA 5EG3A 4C36A 2EU9A 1M2QA 4FG8A 5AA9A 4L3PA 4D5KA 4JXFA 4N6YA 5HU3A 5I9YA 3OZ6A 3EL7A 4CG9A 4S33A 2Z7RA 5BVNA 2RFNA 3HV6A 4JNWA 2ONLC 4F7JA 2G2IA 4TWPA 5CQWA 4I21A 5IQEA 1J3HA 4JDIA 4XV9A 3R63A 3VS7A 4AOTA 4U45A 4NTTA 3IS5A 4PP9A 2X2MA 4WOVA 3VAPA 5DR2A 3W8QA 1FMKA 4E26A 1Q8TA 4Z7HA 2C6LA 1Y91A 4IBMA 4CEGA 3EQDA 4PP7A 1OPLA 4O96A 3PIZA 4KIQA 3QWKA 5E8TA 3QC4A 1OUYA 5ETCA 3T9IA 3CD3A 3D14A 4O91A 4FZDB 2PMOX 1HCLA 4PY1A 3W1FA 2BZJA 3GCSA 2XKEA 3PJ8A 2ZV8A 4PTGA 4DEEA 2HZ0A 2GHMA 3PG3A 4YC8A 2YDJA 3ENMA 5HORA 1M7NA 4L67A 3FHIA 3ZLWA 4A06A 2QC6A 4YURA 3DBDA 4U44A 4GEOA 3MH0A 4QOXA 5KNJA 4JG7A 3GU4A 3PSBA 3U4UA 4DFUA 5LOHA 3QLGA 3GQLA 1J1BA 4ANQA 4F08A 4LL5A 4Z7GA 3DLZA 4K11A 1AQ1A 5EW8A 4FTKA 3R73A 4F7NA 2QOOA 4P2KA 5B0XA 4QTEA 4Z55A 5DFPA 1Y6AA 4QMSA 1OL2A 3S1HA 2GQSA 2VTNA 2X8DA 1XH9A 2RG6A 1VYWA 4XH6A 3BU5A 1YI6A 3A4OX 3VUDA 3MWUA 4YLKA 5IQGA 3BYUA 4IAFA 1H00A 3R28A 5HVYA 3ZXTA 1JSTA 3G9LX 4KKEA 4PTCA 4WBBB 2VTRA 3ORMA 5IDPA 3AT4A 2WTVA 1URWA 3OWLA 1O6KA 4FODA 3TEIA 1VEBA 2C6MA 3OF0A 2B1PA 3OXZA 4RIXA 3UG1A 5CSXA 3DAEA 4X6RA 5T6KA 3P4KA 4PDSA 5A54A 3GU8A 3BYOA 3WZEA 2WMAA 4CMTA 3G90X 1PHKA 2H6DA 3FI2A 3OT3A 4OTWA 5G6VA 4RIYA 5HTCA 3FPMA 4O1PA 3LHJA 5JFVA 2E9NA 3CJGA 3FLYA 5DYJA 4I0TA 4FK3A 3GQIA 5CQUA 4HPUE 5E8ZA 2Y4IC 1BYGA 5D41A 3PUPA 4TT7A 4BGGA 5DT0A 2GNFA 4FKSA 5K0KA 4E93A 2UZUE 4M13A 5KMOA 1FVRA 4JAJA 3WF8A 4NM0A 1ZYLA 4AZTA 3ROYA 4ALUA 2BAJA 5DI1A 3LLTA 2C3JA 4BCIA 4RBLA 4AU8A 5CLPA 4HCTA 5CSHA 2NP8A 1ERKA 2VO3A 3EL8A 4ACCA 1OKVA 4AT4A 5FG8A 3GVUA 3O8UA 4IADA 4ASXA 4AGUA 5AP1A 4U41A 4LGDA 1YQJA 2F7EE 4EOLA 4YBJA 4I20A 2XKDA 2JGZA 3P7AA 1DS5A 3I6UA 2IO6A 4R3RA 4RJ8A 5AUTA 2C3IB 1Q4LA 2PY3A 5D11A 3QYZA 5KHWA 2IVVA 2X6EA 3BE9A 5CEQA 3UGCA 5EQEA 1WBWA 1GJOA 1PXOA 1KE8A 4M69B 4XBRA 4EOMA 5CEPA 1OBGA 3UOKA 5ANKA 2ZM1A 5AA8A 5AUWA 2FGIA 3HDNA 4CXAA 2X8EA 2UZTA 3NUYA 1IEPA 1ZYJA 4ZEGA 4KS7A 3W33A 2ITXA 5C4KA 4G5JA 3ENHA 2JAVA 1G8SA 2OJJA 1GZ8A 1OMWA 2B9IA 1JKTA 2ZJWA 3G51A 4O82A 3NYVA 2GNIA 2YM7A 3QD3A 2BR1A 2QOKA 2JDTA 5CSPA 5CI6A 1FQ1B 2HW7A 3EQHA 2BKKA 3QRKA 3LVPA 4YNEA 5BMMA 2PVFA 1QPCA 2Z8CA 4ZTHA 4AGCA 4C4GA 1H1PA 4DITA 4H3QA 5H8BA 4DH8A 4YTCA 5CAVA 4EOOA 4GS6A 4M0ZA 4DFNA 4BBMA 2W4JA 3PXZA 2H96A 4K1BA 5DN3A 4O21A 4A07A 1M2PA 4L46A 4D4VA 3ZTXA 2R3LA 4I3ZA 3RAKA 4EH7A 2P2HA 4QQTA 3CJFA 3Q3BA 3WILA 4UX9A 1Q8WA 4XG3A 3W2OA 3VF9A 3MVMA 2BAKA 5C01A 4FV7A 2PUNA 1W84A 5AMNA 4FV3A 4ACDA 2Y9QA 3DU8A 2O63A 4L3JA 1Y6BA 4C61A 4BFMA 3PSDA 3ORNA 3CD8A 3ZYAA 4ZTNA 2WTWA 4AT5A 5D12A 2YLFA 3RPRA 2X6DA 1Q8UA 4EWQA 1PXMA 4JIAA 4YR8A 3GCVA 4R3CA 5CF5A 4PPAA 3DJ7A 1WBVA 5JGDA 4QMUA 4B99A 3OBJA 4BZNA 3F82A 2R3HA 2OU7A 3ZO2A 5AUYA 4QMVA 1SMHA 2YIRA 4MQ2A 4DYMA 4HJOA 5HG9A 3G0EA 5ETAA 1GZNA 5EQYA 3RPOA 5JT2A 4ZP5A 2V62A 3MPMA 3ZXZA 2XIXA 4O0XA 5AADA 4YP8A 3R7EA 1NA7A 4JS8A 1S9IA 4QMLA 3PSCA 5J95A 5B2MA 1H0VA 4E5BA 5FGKA 4KIPA 2C68A 2XBJA 2GS6A 4JIKA 3MGYA 4G3GA 3ACKA 3DBQA 3EZVA 4G3FA 3EFLA 5DOSA 5ETFA 4FKPA 4XNEA 2YWVA 3TKIA 3P86A 4EUUA 3EFJA 5AR8A 4IVBA 3BEGA 4PNIA 3VULA 5LXMA 4FKGA 3ULIA 5FWKK 2Z2WA 2W1IA 4NZWB 4BZOA 4EH8A 3D7TA 4O6EA 4F1TA 1H1QA 2W1HA 4EZ7A 4P7EA 3OP5A 3CTHA 4RWIA 2YACA 1KOAA 3GC0A 3F88A 4DLJA 4KSPA 2Y6OA 3LW0A 5KMMA 3FXXA 4BCHA 5GIPE 1OPKA 4M69A 4APPA 1JWHA 3CKXA 4KB8A 1QPDA 2JEDA 4WUNA 4OUCA 2RL5A 3C4WA 4M12A 3NDMA 2OGVA 4Y5HA 4S34A 5LWMA 4GCJA 3DZOA 1MQ4A 4BL1A 3BE2A 4RRVA 1Z57A 4PUZA 4PDOA 4RFZA 3UOLA 1SYKA 2WTCA 4EJ7A 2E9PA 2J0KA 2PZIA 4C02A 1KE6A 4FIHA 2XJ1A 1Q8YA 4IM2A 1REKA 3Q2MA 3QKMA 4BI0A 3MH2A 2CJMA 4UWYA 5LJJA 5TR6A 2PMLX 1W8CA 4EK3A 4F7LA 1G3NA 3DCVA 3RPVA 3VWAA 3FPQA 4FR4A 3HL7A 3OTVA 4BWKA 5K9IA 5FRIA 5E8WA 4ANLA 3QUEA 3PRFA 4KIKA 4I6BA 5F1ZA 1XWSA 5CEMA 4PWNA 4E6CA 5LMKC 2UW5A 4CT2A 3W16A 4BY9E 1PXJA 4J96A 2PE2A 2W4OA 3UIMA 3UC3A 5M56A 3BELA 4UMUA 4ZS0A 4CFMA 3VBXA 1M2RA 2B9FA 1FVVA 2W1CA 3FQEA 3QCXA 1H1WA 2UVZA 3W2CA 4C0TA 5M55A 1U4DA 4MYGA 4AXAA 1UNLA 1MRUA 3E63A 3GU5A 3F7ZA 3V5JA 4CGAA 2PVYA 3FC1X 2OG8A 2V55A 3KC3A 4OT5A 2XNEA 4C4IA 3AG9A 3ZO1A 3FMKA 3G5DA 4YHJA 3DB6A 4IX4A 4I5HA 3GC7A 2Y0AA 3R8LA 2PSQA 3G2FA 3RP9A 4QD6A 5GINE 2Z02A 4O0UA 4DCAA 4IB0A 3RK9A 5CALA 1V0PA 3ORKA 4E5AX 1OECA 1KWPA 2C6TA 1H25A 4G16A 2PE0A 3UMXA 5IEYA 4GVJA 3NYXA 5DPVA 4O22A 3VUMA 4ANSA 4J98A 3F5UA 4U0IA 5ETIA 3U9NA 4E6QA 4DINA 3LMIA 3B8RA 3D5WA 5AR3A 3OXTA 4O0RA 1J7IA 2J7TA 4LRJA 5EYMA 4PPBA 2J90A 4E1ZA 5DE2A 3U51A 3V51A 2OFUA 1OVEA 5EHYA 5DVRA 4BDAA 3KREA 4FG9A 4L7FA 4MD9E 1WVYA 3DDQA 3U6IA 3FKOA 3HUCA 5L8KA 5AV4A 3DXQA 4RA5A 3VW8A 4O7NA 4LMNA 5CF4A 3QXOA 2XEYA 3DFAA 3EB0A 4G3CA 1NY3A 1O9UA 2VX1A 3MH1A 5H8GA 4O84A 2QURA 3DB8A 1DI9A 1U59A 4IB3A 5EYKA 3VC4A 5HTBA 2X2LA 4GU9A 4P5ZA 4DGGA 3SW7A 1B38A 4F9YA 3TNPC 1DAWA 3R9NA 3E8CA 3RHXA 2JAMA 2IZTA 4QMMA 5G1XA 2PMIA 3C1XA 2FA2A 3EIDA 3QZFA 2ERKA 4I5MA 4D0WA 5F20A 5EOLA 2EB2A 3K3JA 2OW3A 4PF4A 4QTDA 4FVRA 4MNFA 4YJQA 4YPSA 4KRCA 3QCSA 3CPBA 4C8BA 4FV2A 4E6AA 5HO7A 2J0MB 1OM1A 3I0QA 2KTYA 4JT3A 1XR1A 3W10A 4FEWA 4A9RA 3MV5A 3PZHA 3VS0A 4JDHA 4BKZA 1J91A 2JDOA 1ZY5A 2QLUA 4DFYA 3AMYA 3BU3A 4CCUA 4W9XA 3UTOA 5KCVA 1YWVA 2HELA 2J9MA 4RC2A 4J99A 4ZS4A 4MH7A 4CQEA 3EQIA 3O96A 1YI3A 5HOAA 3W18A 4JBQA 3GI3A 1SM2A 5M4FA 3MY1A 5HI2A 3IW8A 4YHTA 4PDYA 3OUKA 1ZXEA 4TN6A 4BTKA 5GZAA 4FSMA 2IVUA 2F2CB 3NAYA 3AGLA 1OBDA 4CV8A 4G3DA 4GUEA 3LLAA 1Q41A 5CU2A 5EW9A 3BEAA 5EH0A 4EOQA 4F70A 5ANIA 3RZBA 4RLLA 4CRLA 4EOJA 4OTRA 4UB7A 5IA1A 3DV3A 4AN9A 3R8UA 4I1ZA 2CPKE 4XG4A 3C7QA 2BFYA 3ZZWA 3MFRA 4JR7A 2V7OA 4BKYA 5KUPA 4N6ZA 4Y73A 5HIDA 5B7VA 2QO2A 2GCDA 3HEGA 4OR5A 2VNYA 3AC8A 4FTUA 2Y8OA 4ONAA 4WNPA 5HGIA 4NWMA 4BCQA 3TUBA 2PULA 2QOFA 2YCRA 4PMTA 3E7OA 4PX6A 3ATTA 2ZV2A 4FIFA 4N70A 2BRNA 3FYJX 4QYEA 3TJDA 4GT5A 4I6FA 2F9GA 4FGRA 2W1FA 3O8TA 4YC3A 4EKKA 3ORPA 3TUDA 3SQQA 2YEXA 5CXZA 2FUMA 4QO9A 2VV9A 3C4XA 4A4XA 5KE0A 3LQ5A 2UW3A 3KVXA 1SZMA 3MJ1A 3ETAA 2W06A 2BZHB 3RHKA 4EEVA 4O7TA 1OL5A 2O0UA 4FV9A 4DTAA 4RVLA 3E92A 4CCBA 4XG6A 2VU3A 1UKIA 2XS0A 4LL0A 3BV2A 4ZY6A 1MUOA 4GSBA 3VVHA 3MTLA 3VBTA 3ZUTA 4GKHA 1OPJA 5TT7A 1PYXA 2PWLA 3HMNA 3TIZA 5J5SA 3CGOA 3NNXA 3RWQA 4ENYA 4Q9ZA 1OIRA 4AAAA 3G6HA 3NW6A 5IQAA 2OF4A 3KRJA 4GG7A 3BPRA 4FUXA 4BF2A 3MA3A 3VJOA 4MXXA 3GP0A 4KA3A 3R8MA 3PZEA 4PTEA 4ZIMA 4MWHA 2BMCA 3JS2A 5HICA 4O7YA 4AN2A 4Y5QA 3E3PA 5CVFA 5EI6A 4YJNA 2XCKA 4IB1A 4GYGA 2WU7A 3CY3A 3TG1A 1W82A 4L3LA 4X21A 5E9EA 4ERKA 4LYNA 3IONA 4GT4A 1MRVA 5CZHA 4BN1A 5KMLA 2UVXA 4YPDA 4TWCA 2WZJA 3HA8A 1NVSA 3PY3A 3QGWA 3R83A 5FP6A 3U55A 2XUUA 3K54A 1JBPE 5IISA 4NKSA 3GFEA 5CYIA 2YIQA 4I93A 5JZJA 5IQFA 3OROA 4QPAA 1Q24A 4B7TA 1XH5A 1O6LA 2V22A 4IVCA 4JL9A 4UMRA 4R6VA 4RZWA 4CT1A 3FLSA 4LMUA 4BDDA 2V0DA 4BDEA 4BWPA 3ANQA 1H1SA 5BUEA 3A2CA 5IDNA 3KULA 2XNPA 3QC9A 3CSVA 2BRMA 3JY0A 3KF4A 3QRUA 4AF3A 2P0CA 3FMMA 4DTKA 4EK5A 4ZTLA 4FTQA 4FC0A 5IQHA 5CAQA 2IJMA 1P2AA 1UNGA 4BCKA 2GHGA 5E8VA 3NPCA 2ZM3A 5AM7A 3RWPA 1KE9A 5HNIX 1VYZA 4DG2E 2XNGA 5CEOA 3N9XA 4YZBA 1GNGA 3BIZA 5AV3A 3FZSA 3U54A 2QKRA 3O8PA 4FMQA 3GXLA 4JQEA 3HVCA 4UWCA 2CMWA 3KN5A 4RIYB 4YZCA 4D9UA 4EH3A 4E7WA 5FP5A 3R7UA 4IE9A 5EHLA 2VRXA 2P55A 4O0WA 2OIDA 3NVKI 5HG7A 2ZMDA 3AGMA 2GFSA 4FL2A 2VTPA 1CM8A 2ERZE 3QXPA 5CU6A 4EH6A 1ZOGA 2AUHA 2DWBA 2LAVA 3QHRA 4OBPA 3NAXA 3FXWA 4FKJA 2ZV7A 1DAYA 3F2NA 3OS3A 3QZHA 3EZRA 4F4PA 3LFQA 4FL1A 3POZA 2Z7QA 4YU2A 5KO1A 5TO8A 2OBJA 4Y72A 3LJ1A 2X2KA 2JLDA 3KXGA 4DE4A 1JOWB 2RFEA 1P5EA 4KABA 4O7WA 4IANA 1U46A 4F99A 4U43A 3V3VA 4DBXA 3BI6A 1JSUA 3FY2A 2H8HA 3GU7A 2XK8A 3PA3A 4LV8A 5M09A 4IWPA 2XYUA 4M97A 5M44A 3TDWA 3QALE 4GG5A 4O0SA 4EQUA 2YAAA 3QUPA 4RJ3A 4C7TA 3VRYA 1ZWSA 3JVRA 1GAGA 4N0SA 2QOBA 3PY1A 3HYHA 5L4QA 3W2RA 5KBRA 3PJ3A 4K0YA 3MSSA 1XHAA 2O64A 2YFXA 4JQ8A 3FZRA 3FC2A 3KQ7A 4OTFA 4FL3A 4M68A 2HK5A 3QTRA 5CT7A 3R6XA 2ACXA 3R01A 5ANJA 4JRVA 4IVAA 3VUGA 5I4NA 5DR9A 3QLFA 4ZSGA 5FUTA 5B2KA 3OWPA 1JVPP 3QRIA 4ASZA 2BDFA 3BLQA 3EWHA 1S9JA 1BX6A 4KWPA 4JG8A 5HIEA 4D4RA 4BB4A 4MHAA 4JI9A 3V8WA 3QZGA 3FDNA 1AD5A 1P4FA 3QTWA 3E64A 4W4WA 4BCJA 2C6KA 4H36A 5AEPA 5TKDA 4HYUA 5K0XA 2O3PA 3R22A 4MTAA 3HMIA 2HY0A 3R0TA 2VGOA 3QD2B 4I94A 4KINA 3SGCA 4J8MA 4C3FA 1Q5KA 5HE3A 3KXXA 3VUTA 4CYJA 2PVLA 5AV0A 2I7QA 1IRKA 5F9EA 1XH6A 1OL1A 4FSRA 3IOKA 2R3GA 2HY81 4FOBA 3GBZA 4FV5A 3ZM9A 3U6JA 1TVOA 4QP8A 3S00A 3BX5A 5I3RA 4S31A 2QU6A 3ALOA 5EKNA 2NRYA 2C5VA 3UP2A 2NRUA 4QQCA 3QBNA 4MF0A 4B8LA 5A4LA 1U5QA 3BGPA 2BRHA 4B9DA 3C4FA 5HNGA 4FKVA 1J7LA 4XMOA 3QQGA 2UZBA 4OTQA 4QT1A 2PZ5A 1BLXA 2PVRA 3QX2A 4RX9A 5CY3A 4YC6A 3ZSIA 3CQWA 4XLIA 1W7HA 3C50A 5FEQA 3LFNA 5FDXA 3HP2A 5HQ0A 5IH4A 2NPQA 3PWDA 4KIOA 4USEA 3R2BA 2WQNA 5I9WA 2OO8X 1WFCA 4O2ZA 2R3JA 4R1YA 3V5WA 3OWJA 3MIAA 4OTDA 4FSUA 5IEVA 3G15A 4QTCA 1NT2A 2WD1A 5HLPA 2VWUA 2HZ4A 3IDCA 4GV1A 5CS6A 3GUBA 3GGFA 3Q32A 5DRBA 4P4CA 4WHZA 3K2LA 5FLFA 3JR1A 5BYZA 3R9DA 4ACHA 4HCVA 1W0XC 4D2SA 4O1OA 1OGUA 4AX8A 4FI1A 5K5XA 5IA2A 3RPYA 4YJTA 2XK3A 5CAPA 2R3RA 1H01A 3NGAA 4IH8A 3P7BA 3Q4TA 3MESA 1H24A 1UVRA 1YHVA 5AX9A 3PVUA 1UU9A 2XRWA 4YZ9A 4JRNA 5HU9A 4CMUA 3AD5A 5CT0A 3LOKA 2RIOA 3AQVA 3ERKA 4BDIA 4EOPA 2QOIA 4QMYA 3RAWA 4QP1A 2A2AA 4U81A 4XG8A 2NO3A 2YERA 4TWOA 4D1SA 4D2WA 2C5YA 4IMYA 2ITZA 4NW5A 1PXKA 3VJNA 1PXIA 4WBOA 1XBCA 4EQCA 2YDIA 1F3MC 3LMHA 1CTPE 1FOTA 5LARA 3MI9A 3F69A 3PYYA 4TXCA 4U3ZA 5FM3A 4CKRA 3L8VA 3QD4A 3QTUA 3KK8A 5FTOA 4JG6A 4EL9A 4AG8A 4LGHA 2ITVA 1OIQA 1ZMWA 5FXSA 4U80A 4BCFA 1XH7A 3EN5A 3AT2A 3F9NA 3LXKA 3F3ZA 3TZ8A 4UMQA 2EXCX 2GTNA 3IW4A 3JPVA 3H9FA 4FVQA 4LM5A 5EM8A 3IGOA 2OXYA 2FVDA 2XKFA 4H39A 3BGQA 3F3TA 3IECA 3EQCA 5E8UA 5J9YA 2J4ZA 2WIHA 3M11A 4L01A 2YDKA 3CLYA 2W0JA 4FV0A 4QYGA 5A6NA 1R39A 5HEZA 3R1NA 4W8DA 3FL4A 3EJ1A 2CCHA 3L9MA 4CV9A 5DEYA 3D0EA 4UYNA 4CNHA 4CFXA 4EH9A 5E8XA 3TDVA 2EB3A 4A9TA 4AZWA 1R1WA 2ZYBA 4YO4A 4M0YA 4D0XA 2UW9A 3SXSA 2XEZA 3DJ5A 3I81A 3JUHA 4O27B 5IPJA 3DOGA 4JX7A 3ZSHA 4B4LA 2X4ZA 4G6OA 1WBTA 4YTIA 5EDQA 2G9XA 4MXZA 3GCPA 4FOCA 4DH3A 3D5UA 4MKCA 4PL3A 3U9CA 4D2TA 5AR2A 4WT6A 4WUAA 3T3VA 5EDRA 4J71A 1H4LA 3C4EA 1ZYSA 3NW7A 4I0SA 3ZOSA 5E90A 1H1RA 3MYGA 4FYOA 3R00A 2BILB 5C03A 5E7RA 4GKIA 4DBNA 1YI4A 2OWBA 5T3QA 3UOJA 4QP7A 2BPMA 2WTDA 2XNBA 3LPBA 2C0TA 2HOGA 1ZLTA 2QHNA 4LQMA 3V8TA 4FIIA 5BVFA 3D5VA 1Q97A 3C5IA 5FXQA 3DJ6A 2X7OA 4FKIA 4R5YA 2GTMA 3EQRA 3ZCLA 2UZVA 1R0PA 1YDSE 3ZRMA 1FPUA 2ZDTA 5HG5A 1M14A 4GK2A 5AR5A 3DK7A 3KXZA 4DH7A 1WBNA 4JLCA 3LCOA 2CKQA 3F66A 2OXXA 2W17A 1P4OA 3MY0A 3NIZA 1UU3A 3ACJA 3NUXA 5HNBA 4ZZOA 4K6ZA 4QQ5A 3UPZA 4CYIA 3PP1A 3A7FA 2QD9A 3TV6A 5J1WA 4PV0A 4OAUC 4F6WA 1H0WA 2VTAA 3VS3A 5JRQA 4FSZA 3NS9A 4A9SA 2UW8A 2R9SA 2P4IA 3NSZA 1WVWA 4FZFB 4I0RA 2JC6A 3ZFXA 3HP5A 4C3RA 2GFCA 2XIRA 3SC1A 1PMEA 3QL8A 1ZZ2A 3NNUA 3DFCB 1EH4A 3C0GA 3GOKA 4BTJA 2XH5A 1BL7A 3EFKA 5I9ZA 3C0IA 5ANEA 3ZEPA 4L45A 3PJ1A 3SD0A 4F0FA 3KN6A 4ZJJA 3DQWA 3LIJA 3LZBA 4KAOA 3VS2A 4H1MA 1UWHA 4USDA 4RIOA 4FNYA 1Z9XA 3FXZA 3SRVA 3AXWA 3JVSA 4AA0A 2W96B 4ITHA 4D4YA 3HRFA 2HYYA 3EN9A 3H3CA 1DI8A 2X4FA 3ZZEA 3EN7A 3SRVB 1ZOHA 4B0GA 4TYHB 4BBFA 4F64A 2OK1A 2O8YA 4QP4A 4RX5A 5KKRB 4YJPA 3I6WA 4O6LA 3BHTA 2QVSE 3NVMB 2RGPA 3RGFA 4M7IA 4FSNA 2W5HA 2YM3A 3BQRA 5H9BA 3EH9A 4AZSA 2V7AA 2IG7A 5FXRA 1YRPA 2B4SB 3LM0A 3QWJA 3R1SA 1WBOA 4HVHA 4IZAA 4RIWA 4C2WA 4C4FA 4HVGA 4WD5A 2PL0A 2X7GA 3LFSA 3IDPA 4WG3A 4X6QC 2IW6A 2VD5A 3OY3A 4RX7A 2J5EA 2PE1A 3GEQA 2VX0A 2A1AB 4I6QA 4R7HA 4ZOGA 4BIEA 4Q5EA 4FZ7A 4R77A 1QCFA 4PL5A 2R3PA 3F3UA 2B9HA 3F2AA 3SW4A 2UW4A 5BVOA 4MAOA 4LUEA 5FTQA 3LMGA 4M67A 4DLIA 4UYAA 4FZAB 4YJSA 4RFMA 3F3WA 4UXQA 4U7ZA 2OH4A 2YCSA 1JAMA 2AYPA 4QMWA 5J9LA 1GIIA 1OKZA 2W1EA 4GYIA 5IMEA 3Q9ZA 4NFNA 2GS7A 3VUHA 5ICPA 4EOSA 2DUVA 3W2QA 3MIYA 3SXRA 3PWYA 2W05A 3FLQA 2WTIA 3BHYA 4ERWA 5J87A 3SX9A 4K18A 3N4VA 5AX3A 2X7FA 4IDVA 4UWBA 4MNEB 4A9YA 4RWKA 4X7QA 2QCSA 5BYLA 4X3FC 4UY9A 2ITPA 3QZIA 4C4HA 3FMJA 2JD5A 4K77A 4RZVA 4XG2A 5ANOA 4XEYA 5E92A 5FD2A 3SA0A 4CG8A 4JDKA 1A9UA 5KMJA 3TT0A 4NK9A 1XBBA 5IG1A 5L2QA 1BKXA 3IOPA 4X2FA 3AC2A 3O7LB 5FBNC 4AQCA 4DEAA 4IAYA 2YM6A 3PVGA 3TTIA 2Q83A 4BDKA 2C30A 5H2UA 4XUFA 2YJRA 4FTLA 5AAFA 3COKA 5GJDA 4JVGA 2C6DA 2R3KA 3MVLA 2DS1A 1IAJA 3UPXA 3PXYA 4LV5A 4YLJA 3A8WA 1BL6A 5DG5A 5A4QA 4BICA 3PXRA 3R02A 4R1VA 4TRLA 2AC5A 2B55A 4WO5A 4J8NA 5IF1A 2CLQA 2YCQA 2UZOA 4I24A 3ZUUA 2QU5A 5HCYA 3PPKA 3QTIA 3UVRA 5HE2A 1NVRA 2C3KA 4IWDA 4OBOA 4IC8A 3TN8A 2I1MA 1LUFA 5AIRA 3ZLSA 2WMSA 4X0MA 4A7CA 2C3LA 3BHVA 3HX4A 2FO0A 1FVTA 3I1AA 4UBAA 4CFNA 3RNIA 4GH2A 2A27A 2J6MA 1Y57A 2WO6A 3Q53A 1QPEA 3O50A 4OT6A 3RZFA 4NM7A 4KBCA 3LQ8A 1BI7A 4GRBA 3VUIA 2Z60A 4H05A 3EQGA 3HNGA 4FNWA 2GDOA 1STCE 1ZMVA 4OLIA 2I0HA 2QR7A 5AAEA 3NYOA 3B2WA 2F4JA 1Q62A 3FMEA 5IMXA 4Z3VA 4FYNA 3PVWA 3FE3A 3Q4ZA 1ND4A 1WZYA 3I4BA 1T45A 2OICA 5EHOA 3WF7A 4KUJA 3PLAE 3O23A 3NCZA 5AR4A 4EKLA 2OI4X 2ZDUA 2WTJA 4XOZA 2XNMA 3E62A 4GT3A 2BZIB 4DG0E 4RWLA 4HZSA 3K3IA 5JK3A 2HENA 3IW5A 4O7SA 1YOLA 4JQ7A 3ZEWA 3F61A 3QTZA 4C34A 4BDCA 1KE7A 2VO0A 4FNXA 1NW1A 3SDJA 4EYMA 4IACA 1XO2B 3V6SA 5D9HA 2G01A 4GFOA 3PE1A 1YW2A 4I22A 3FZ1A 3OXIA 4Q2AA 4BVUA 3ELJA 2G2FA 3OW3A 5AP4A 2QOQA 3IPHA 4G9CA 3UVPA 5K3YA 2F49A 2A4LA 2CDZA 5FBOA 2F7ZE 1E1VA 4AE6A 2HIWA 4QMOA 4BCNA 4FT7A 3R7GA 2BRGA 4QP6A 3OCBA 3VO3A 3E8NA 4IX3A 2J0LA 4E4LA 4G1WA 4IHPA 5J7HA 5AIKA 2X0GA 3IGGA 4O0VA 2ITWA 4UZHA 2BZKB 4I4FA 4ZLYA 1YHWA 3A99A 3A7IA 3R8ZA 5BUJA 2WMXA 2UVYA 3F5XA 4EI4A 2OLCA 1PMUA 4K9YA 4NT4A 4KRDA 3HMOA 4RFYA 1QMZA 4HNIA 2X9FA 4IWQA 3HKOA 2FSOX 4TWNA 3UQCA 2W5AA 3O0GA 4CZUA 2X1NA 2CNQA 4PQNA 3WOWA 2PTKA 2UV2A 4MNEA 3CGFA 4JOAA 4RG0A 1IAHA 4JAIA 3O7LD 4AW1A 3COIA 4C33A 4Q5HA 3DTCA 2ITUA 4FICA 5LQFA 3N51A 3NX8A 5IQDA 4N57A 3AMBA 2WB8A 2JIVA 4BCMA 5FM2A 2P2IA 1ZYCA 2PUPA 4IWOA 2BDWA 5LMBA 2XCHA 5I9VA 3WF6A 2BIKB 4XG7A 1PXPA 3DGKA 4QYFA 4CVAA 2J2IB 2R3OA 4RX8A 4TZRA 3CPCA 3TZ9A 3UNZA 3P23A 2IZSA 3KRRA 2W7XA 1R78A 4WIHA 5GNKA 4YTHA 5CXHA 3RJCA 5FTGA 2UW0A 4FZ6A 3DA6A 4CLIA 4E6DA 3ROCA 3NCGA 3TWJA 5BVKA 2QHMA 3QUDA 4O0TA 3JYAA 5BVEA 3LXNA 4FT3A 5KZ0A 4RJ5A 3UJGA 4G3EA 4TYEA 4ALVA 4YZNA 3S2PA 2IZUA 2XBAA 3OOMA 4KD1A 4NSTA 4EK4A 1FBNA 2CN5A 1YXXA 2PVMA 3NUSA 4ZSEA 5HO6A 5TF9A 3SXFA 5D7AA 3CKWA 4BIBA 3MW1A 1ZYDA 3TIYA 3UG2A 2YN8A 1QPJA 3WIGA 2UZWE 5KMKA 3D2KA 2YITA 4HGSA 4U79A 5JMSA 5C9CA 3BLHA 4WSQA 4DCEA 5M08A 2GNLA 3PVBA 1PXLA 2UZDA 2UUEA 4RVMA 4D1ZA 3LAUA 5HCZA 3CCNA 3BZ3A 3R21A 4GVAA 1XJDA 3FWQA 4L68A 4W4XA 3S3IA 3VBYA 3G0FA 4D58A 3NMUF 4FTRA 2JFMA 3UVQA 5J9ZA 4S2ZA 4ZJVA 4J52A 3U4WA 3IW7A 4E73A 2BKZA 5CNOA 4AZEA 2CNUA 3EYGA 5IEXA 4MD8E 4QP2A 4O86A 4OTHA 5ANGA 3KF7A 3GU6A 5J8IA 2VTTA 3ULZA 3WBLA 3FJQE 2PYWA 2WELA 3Q9YA 3QFVA 4X3JA 2FSLX 3Q5ZA 5C4LA 3REPA 4M8TA 2LGCA 3IO7A 4D55A 5M4UA 3S0OA 3Q52A 4EBWA 4BI1A 4H3PA 3E5AA 3MB7A 1YXTA 5M06A 5HESA 4ZTQA 3ALNA 2R3MA 2Y6MA 3W8LA 3WIKA 4L7SA 5ACKA 1CKJA 5M51A 4H58A 1OUKA 3CEKA 3ITZA 3OWKA 3NLBA 2WQEA 3MS9A 3PY0A 4HNFA 3TL8A 2ETMA 3HMPA 3HV7A 4MXAA 4X2GA 4FKTA 4AWIA 5EW3A 4APCA 3OBGA 4KKGA 5JQ8A 4GIIA 2WU6A 5AP2A 4LOOA 4F7SA 4CD0A 3UZRA 5CSVA 1KSWA 2QG7A 1T46A 2Y4PA 2CGUA 4U8ZA 3VS4A 4DTBA 3DXNA 4L00A 3FLZA 2OZAB 4MXCA 4O38A 3KU2A 3PIXA 3U87A 2OIBA 3MJ2A 4MXYA 4R78A 3ORXA 1M52A 3ORZA 1IR3A 1W83A 3FMHA 5IQIA 4A4LA 5FQDC 5B2LA 2QR8A 4FSYA 5ITAA 3R8PA 2XK9A 2BROA 2IVSA 4NCTA 4IAZA 4D9TA 4G5PA 4RC4A 5I3OA 4G9RA 3DBCA 4CZTA 4CRSA 4EHEA 2QQ7A 4RIXB 4HPTE 4BDHA 3QA0A 3MPAA 2XF0A 2WEVA 3DT1A 3R30A 5EFQA 4PRJA 2JFLA 5HD7A 4DEBA 5IUHA 5J5TA 4FEXA 1ZRZA 3F7WA 4FV8A 1SVHA 4FK6A 1UNHA 3GC9A 2GPHA 4G6NA 2H9VA 4IC7A 4WG5A 4WNOA 4FIEA 4WRSA 4C35A 4EHGA 3VS6A 3DS6A 3HZTA 4FTNA 5JRSA 4IQ6A 3CR0A 2ZB1A 4IZYA 2OJFE 3HV3A 4W8EA 4ZXTA 1XQZA 4RLKA 5JEBA 4IXPA 2OXDA 4MX9A 5EOBA 1YWRA 2XZSA 4QP3A 2F57A 3ODZX 2WTKC 3CBLA 2BCJA 5LCKA 3OFMA 5HX6A 2R0IA 4MCVA 2I0YA 1CKIA 1GIHA 2XIZA 4D2VA 3ORLA 3P78A 2IZRA 2VAGA 1YOJA 3UQFA 1REJA 2GNGA 4DG3E 3C4ZA 2R7IA 2VWBA 2YM8A 3KKVA 2X39A 2HXQA 4TKSA 4AOJA 4BTMA 4W4YA 3R1YA 3I0OA 1Y8YA 3L8SA 3FQSA 4JBOA 4PMMA 4ZSLA 1LP4A 3LJ0A 4HYIA 3RTPA 3EOCA 3EQBA 4QMQA 4TL0A 2XA4A 3DKFA 3R2YA 2CLXA 4U5JA 2O65A 4MBLA 1PXNA 2OSCA 1QL6A 3D83A 3WF9A 5BQ0A 3FLNC 4J97A 3QQKA 2PMNX 5DR6A 4HVIA 4HYSA 4JJRA 2WMRA 5HCXA 4FTMA 4I6HA 2A19B 4TYGA 3V5QA 5CANA 5IKWA 2WMQA 1SVEA 3RVGA 3ZONA 5AUVA 3TXOA 2VWYA 3A61A 5CNNA 1OL7A 3DAJA 4ZTRA 3SOCA 2QI8A 3C13A 3QGYA 3QRTA 3RI1A 3SKCA 1YKRA 2PZRA 2UZEA 2VTHA 2FH9A 3EFWA 2ZM4A 5E1SA 5LCJA 3P0MA 3ZSGA 4D2PA 4V05A 5M4IA 3OC1A 3R71A 5AP5A 5AP7A 3KB7A 4JX3A 3VHEA 1KOBA 3QAME 4FTCA 4IX5A 5CX9A 4L6QA 4E4NA 2YM5A 4HCUA 5A6OA 4FGBA 1OIYA 5A46A 2WMTA 3V04A 5C8KA 4F6SA 5HLWA 3PTGA 2XYNA 4AT3A 2RSVA 2YAKA 5DT3A 1K9AA 3VF8A 3R7OA 1LEWA 2JKOA 3HAVA 1Q61A 5T68A 4L44A 1ZOEA 4KBKA 4NJ3A 4HGEA 4XOYA 4AZVA 4E4XA 5IQCA 3IDBA 2J0JA 2VTJA 1J7UA 1CKPA 3ID6C 1IG1A 3EYHA 1U54B 5CF6A 2JDRA 4FSQA 5CU0A 3CIKA 3FAAA 5HO8A 4LGGA 3QCQA 4D4SA 2PUIA 3I79A 3SV0A 4ITIA 3FZTA 4CFUA 5DMZA 4YGAA 2BTRA 4DFZE 2VWWA 3OEFX 4OGRA 4V0GB 2WMVA 4FTIA 5EYCA 1XH8A 3FI3A 2YJSA 3BHHA 1WMKA 2BALA 3R9OA 4ASDA 5CASA 4N4SA 3IW6A 1NVQA 4C4EA 2XRUA 2UW6A 4FT5A 4MK0A 2XB7A 3ZLYA 3OD6X 4AN3A 4C3PA 4DFLA 5IA4A 5I9XA 1JKSA 1R0EA 5LMKA 1Q3DA 5H8EA 3E7VA 4QMNA 4AUAA 4D28A 4K33A 2YLEA 3VBQA 2J5FA 4AGDA 3NZ0A 2B0QA 1Q8ZA 3TV7A 3WYYA 3M2WA 2GQGA 5M4CA 2ETKA 4ALWA 4QTAA 1SNXA 2EXEA 5K4IA 4IW0A 3L9NA 5HBHA 5K4JA 4FEVA 4GL9A 2YWPA 3MFUA 3PXQA 3T8OA 3Q6UA 5CEIA 3KXNA 2R7BA 4DN5A 2C0IA 2W99B 3LM5A 4FIGA 5EI8A 4IIRA 4G6LA 3L8XA 2WMUA 2XM9A 3RPSA 4FSWA 4G34A 2E9OA 3RAHA 3SG8A 3UO6A 2BHHA 4E8AA 4QNYA 3EN6A 1UWJA 2CSNA 3VN9A 2UZNA 4DF3A 1I44A 4BDJA 4H3BA 3TTJA 3A62A 5BYYA 2HWOA 4I5CA 5L6PA 2VUWA 3EKKA 4F9AA 5D10A 5HE1A 3NUUA 3PA5A 5DT4A 5IA3A 5AUUA 3ZO4A 4M14A 3TZ7A 4AA4A 3ODYX 2ZOQA 3FZOA 1YWNA 3KMMA 3PG1A 4U3YA 3B2TA 4CFWA 4OAVB 4FSTA 5DHJA 4RQKA 4EUTA 4IJ9A 4G17A 4XP3A 5CENA 5L2TA 4EC9A 2ZV9A 5E1EA 3BQCA 3BRBA 5HZNA 4JR3A 3QCYA 1JSVA 3EMGA 3D94A 4KKHA 3U6HA 3RCJA 4BZDA 3TUCA 3PIYA 4MQ1A 3AT3A 3RK5A 3SG9A 3SAYA 3KVWA 3WI6A 3H30A 5ACBC 5HE0A 4CFVA 3GENA 3TKUA 5C8NA 1FMOE 2QKWB 4EK6A 4ZSAA
chains in the Genus database with same CATH superfamily
3WARA 1RE8A 1YDTE 2PZYA 1RQQA 4NIFB 4QPMA 4MBIA 1B6CB 4TPTA 4C38A 5CU4A 5H3QA 2WAJA 4NIFA 1OIUA 4QPSA 4AW2A 3NR9A 5CI7A 3B8QA 4K2RA 3SLSA 3ZM4A 2BAQA 4CQGA 1R3CA 1SNUA 4C62A 2YIYA 5HIBA 2X8IA 3I7BA 3QQLA 4MWIA 5AP3A 4ZLOA 3THBA 5EQPA 3BYSA 4BIDA 3W55A 2IWIA 1KV1A 1RJBA 2XMYA 3QA8A 1YOMA 2WOUA 1HOWA 4MBJA 4X2JA 4ZJIA 4EZ5A 3DK6A 2W9ZB 4RQVA 4NH1A 4YJVA 3ZUVA 4QNAA 3PFYA 2YIXA 4M15A 4B8MA 2WQBA 4FX3A 4IAKA 4NFMA 4YJOA 1GOLA 2QO7A 5HLNA 2JIIA 2WQOA 3FHRA 1ATPE 2ZB0A 4ORKA 5FEDA 3KA0A 4BDGA 3V5PA 2KULA 1IA9A 3OEZA 3FEGA 5EM7A 1Z5MA 4DA5A 3HAMA 1CDKA 4FKOA 5JN2A 5EK7A 3O2MA 4FV4A 2VN9A 3RCDA 3ATSA 2XM8A 5KHXA 1F5QA 3TNIA 3H9RA 3FQHA 4RPVA 4YJRA 1ZY4A 2PUUA 5ANDA 4ZTSA 5L6WL 3EQPA 4UMPA 2XVDA 1V1KA 3R7VA 3UYTA 3V01A 3ZC5A 2ZAZA 4BDFA 4FVPA 4F9CA 1G8AA 1XMMA 2PPQA 3GC8A 4FTOA 2XK6A 1JLUE 3LFBA 4FTJA 3F5PA 1OKWA 4QTBA 4Y46A 5LWNA 3UO4A 3DDPA 4RWJA 5C1QB 3BHUA 4IEBA 1K2PA 3TI1A 2RG5A 1JPAA 3UIBA 1MP8A 5IZFA 1PRYA 5CSWA 4ENXA 4R7BA 2C1BA 4UZDA 2GS2A 1X8BA 1FGIA 3BWJA 1LEZA 5J79A 4O7ZA 5EKOA 2W4KA 2WHBA 3BYVA 3DQXA 4TYJA 4WA9A 1MQBA 3TJCA 4C37A 3C9WA 5IA0A 5DGZA 3RK7A 2XK4A 3CTJA 3A7JA 4NJDA 2OF2A 2AEGA 2XKCA 3ZS5A 2C4GA 4O2PA 1CSNA 4ZAUA 5GIOE 3BV3A 4ITJA 3I60A 4J53A 4AOIA 5JGAA 5J1VA 3OG7A 4BBEA 3RAIA 3GT8A 4U40A 5DWRA 4WG4A 4EC8A 2VTOA 3H4JA 4NM5A 4ZY4A 4USFA 4O81A 2IW8A 4TW9A 2CGWA 5KZIA 4GK3A 4DGMA 1BUHA 3FZPA 4DGNA 3CQEA 5L8LA 3CE3A 3QQHA 2XJ2A 3VRZA 1Q3WA 2I0EA 2O5KA 2VX3A 3HRBA 3O51A 4MF1A 3A8XA 2QOLA 3QTXA 2WKMA 3TKHA 3AOXA 5CTPA 1OI9A 2VWVA 4GK4A 3Q04A 4ACMA 2IW9A 2OZAA 3UQGA 3CP9A 4YZDA 3OT8A 3VBWA 4ANMA 3NEWA 4CSVA 1E1XA 3S95A 2XARA 2E9VA 2OKRA 5E91A 3OMVA 3QF9A 3NFGB 1VJYA 1Y8GA 3FKNA 4C58A 3VS5A 4NTSA 4MEDA 3PJCA 4F09A 2PVJA 3HUBA 2F2UA 1PKGA 2QNJA 3M42A 3S4QA 3DAKA 4DEIA 4ZLZA 3KMWA 3NUPA 3FKLA 3OCTA 3ZRKA 3F6XA 4M84A 4F63A 4AXFA 2ESMA 2VGPA 5JFWA 2B9JA 2C0OA 4FNZA 3MDYA 5DA3A 5FEEA 5IU2A 4C59A 4RIWB 3HGKA 3TCPA 3ANRA 3II5A 3OY1A 1PMNA 5A4CA 4OBQA 4MVFA 4WNMA 2XIYA 4M3QA 4BCOA 4MXOA 2WEIA 3D9VA 4ZK5A 3KEXA 3WE4A 3DKGA 5GJGA 5CAUA 4O83A 2C6EA 3K5VA 1PJKA 4XCUA 2REIA 4OTGA 2WXVA 4FT9A 4I92A 2ONLA 1KE5A 4NW6A 2BDJA 4XBUA 3VIDA 3KCKA 3EKNA 3NNWA 4HGLA 4XRJA 3V5LA 4RJ4A 5BUIA 2ITYA 1B39A 2CCIA 2YISA 3LXLA 4PDPA 3ZBXA 3LKMA 3EN4A 2WFYA 3MB6A 4FKRA 4IFGA 2DQ7X 5CU3A 3UP7A 3F5GA 4UXLA 4CTCA 1L8TA 2CNVA 4GFMA 4H1JA 1UV5A 3UC4A 1NXKA 2YABA 1UU7A 2HZNA 2ITOA 3OTUA 3KK9A 3FSFA 1RW8A 3ZC6A 2R3NA 1KUTA 5HVKA 5K5NA 3O71A 2IEWA 2BFXA 1FINA 2VZ6A 3PE2A 3W0MA 5CVGA 4II5A 2ITTA 3DLSA 3CS9A 5IQBA 4KSQA 3AC5A 3NW5A 4FKWA 4AXDA 3MA6A 3DKOA 4EOKA 3DNDA 2W5BA 4I4EA 4ID7A 3LCKA 1ZAOA 4S32A 4QQJA 3GNIB 3LQ3A 3NYNA 1XH4A 4AACA 4EONA 4ASEA 3DXPA 2BUJA 4JBVA 3C5UA 5I0BA 1VLRA 4EH4A 3LFCA 3N4TA 2GNJA 4FV1A 3V8SA 3UZPA 2DYLA 2C5XA 2VTLA 3UNJA 3UYSA 4DHFA 1VZOA 3FI4A 2EVAA 4OTIA 1ST4A 3QTQA 2C5NA 4QP9A 5EDPA 2XIKA 1A48A 5IUGA 2OJ9A 3H0ZA 4LFIA 4RA4A 1PW2A 3HV4A 4DEHA 3HRCA 5L2IA 4YMJA 2QLQA 4FTAA 5L2SA 2NYAA 4F1MA 2X81A 4FT0A 4BC6A 5TOZA 2WIPA 4ANNA 3ZDIA 4YTFA 2PU8A 4F0GA 3TMOA 4BGHA 3NUAA 5LVNA 2RFSA 2QONA 1XBAA 3C51A 4BR3A 2C6IA 4R8QA 3KXHA 3QHWA 4IDTA 2ZMCA 2AC3A 1MRYA 3GB2A 2WQMA 4EHZA 2YIWA 5IH5A 3VQHA 2JDVA 3E8EA 3Q9XA 4YJUA 3UE4A 2J0IA 5D1JA 3TACA 3D7ZA 4FBXA 4YZMA 3QU0A 3K5UA 3WE8A 2JKQA 4FTTA 4V0GA 3CTQA 3ORIA 3UBDA 2FB8A 4DEDA 3FLWA 4ZSJA 2ITNA 1AGWA 3R9HA 4TYIA 4XYFA 3WF5A 4LI5A 4G2FA 4GW8A 4YO6A 2R64A 4IVDA 2OIQA 1WVXA 3ZMMA 4B6LA 4BCPA 3TZMA 3QX4A 2ITQA 2CGXA 2VTMA 5D7VA 4NYEA 4CKJA 1ZZLA 3WZDA 4D2RA 1IASA 3DY7A 5DBXA 3IKAA 4XS2A 4AP7A 1G5SA 3L9LA 3PPJA 3UO5A 1F0QA 4K8AA 1WAKA 4TYHA 1UU8A 2EWAA 3P79A 4IZ5A 1YVJA 2OH0E 4E3CA 1GIJA 2C5OA 4UEUA 5KX8A 5LVOA 3AD6A 2P33A 2CHLA 2V5QA 5IUIA 5E8SA 2BTSA 5L2WA 3E93A 3F3VA 4BKJA 3TNQB 4EZ3A 1APME 3JY9A 2GMXA 3Q6WA 4WKQA 3AC3A 2EXMA 2XK7A 3KL8A 3P9JA 4WRGA 3LCSA 4LOQA 2VO7A 4OTPA 4BHZA 3FL5A 5EI2A 1PY5A 4AFEA 4DT9A 2R3FA 2PZPA 4IM3A 2PVKA 5GZ9A 4NL0A 1DM2A 3FUPA 2C47A 1U5RA 4R7IA 4BWXA 3TV4A 4DHJA 1OKYA 1YDRE 4RT7A 2QG5A 4IX6A 4JDJA 1J1CA 4YLLA 2YZAA 3VNTA 4Z16A 3PXFA 2UZLA 3DK3A 3IQ7A 2C1AA 5M53A 4ZMEA 5BVWA 1A06A 2OFVA 2YM4A 3RINA 4FV6A 1W98A 3W0SA 4AAYA 4M66A 3HA6A 1JQHA 4L42A 3UZTA 2YHVA 2RF9A 4WNKA 3TNHA 4C4JA 1PF8A 2QOCA 5BX0A 3ZHPC 4CKIA 2G15A 4WSYA 1URCA 3BKBA 3MFSA 4TY1A 3VHKA 2Q0NA 3V5TA 4AW0A 1H28A 2OZOA 2I0VA 5JZNA 4PL4A 1YXUA 3HMMA 3QQUA 3FI8A 4HGTA 4V04A 5BPYA 4F65A 3UDZA 4QYHA 3PLSA 4NEUA 4ZY5A 2UW7A 4ACGA 3C0HA 4J1RA 4YSJA 4IJPA 3W32A 3CQUA 2P3GX 5A3XA 4FF8A 3OOGA 3IK3A 4PMSA 3KXMA 2WPAA 5GJFA 5HTIA 3QTSA 2WNTA 4ANOA 4O7LA 4ZMFA 4RJ6A 3Q4UA 2C69A 1I09A 4RC3A 4QMXA 3DZQA 3BBTB 4X2NA 4ANBA 4AZFA 4PNKA 2X0QA 1UKHA 1GZKA 2JKMA 4Y85A 3IG7A 4EWHA 2NNWB 3R04A 4DHIB 5AV1A 1E9HA 2I6LA 3ZRLA 4DEGA 4S30A 5AP6A 3QRJA 4DGLC 5E4HA 3ZO3A 4RVTA 1TQIA 4EJNA 2R4BA 3KMUA 2QO9A 3W2SA 4XV1A 3GCUA 2HCKA 4QDEA 4I41A 4LOPA 3PPZA 3UMWA 5JFSA 3A7HA 2X9EA 2FSMX 4KS8A 3A7GA 4E5WA 1JNKA 5KMIA 5L6OA 3DBFA 3LFAA 4XLVA 2PVNA 5TE0A 3WZJA 3PDTA 3RBWA 2PHKA 4D5HA 3LJ2A 3N4UA 3Q4CA 1CMKE 3PA4A 3WZUA 3U8WA 2VWIA 2Q0BA 4F9BA 4NU1A 5EM6A 2VNWA 2WGJA 3ZU7A 4W4VA 5KMNA 4Y8DA 4BRXA 4CLJA 5A4TA 4QMZA 3H10A 3PP0A 4ZTMA 1M17A 3AD4A 2R5TA 5IH6A 2JDSA 2GSFA 5FDPA 3GFWA 3Q2JA 2XNOA 3L8PA 2GU8A 4CTBA 3PRIA 5A4EA 3BLRA 3PFQA 4LG4A 4FKLA 5DH3A 2IVTA 3UIUA 5JSMA 5M07A 4OW8A 2ZVAA 3E3BX 2GNHA 3L9PA 4MD7E 4BYIA 4HOKA 4U9AA 4YBKA 3UDBA 4GFGA 3P5JC 3FBVA 4TTHB 2VTSA 3H9OA 5HKMA 4AA5A 3LE6A 4DGOA 2B7AA 4XHKB 1K3AA 2OJGA 3LCDA 3LFDA 2CN8A 2VTIA 4PMPA 3ZFYA 1V0OA 3D4QA 5AJQA 4L52A 4RMZA 1TQPA 1YXSA 3MFTA 3P08A 3BYMA 5AP0A 3G33A 2XJ0A 4XV2A 5GZ8A 4LRMA 4ZZNA 2J51A 2JITA 4NKAA 4TNBA 5DLSA 4IZ7A 3HDMA 4E4MA 4QEBA 3O17A 4HZRA 2CKPA 3DNEA 5A14A 3KFAA 3MVJA 5J7BA 2OJIA 3CXWA 3RMFA 1Q99A 5CWZA 3FSKA 3D5XA 5E8YA 1TQMA 3OCSA 4PPCA 4QYYA 5C27A 4RGJA 1H8FA 5AFVA 4RVKA 3D7TB 4NCTC 4GU6A 4D1XA 1BI8A 3V6RA 3R9RA 4CMOA 2IN6A 1P14A 4IFCA 2QOHA 4L9IA 4BI2A 2F7XE 3Q60A 2W1ZA 2W1DA 1GZOA 2RKUA 3DPKA 3GOPA 3JXWA 1UA2A 4NUSA 5HG8A 4DDIA 2B53A 3NIEA 3VW6A 3WYXA 5AUXA 5DNRA 5HBEA 2IPXA 3A60A 5AAGA 2SRCA 4CFFA 4YUQA 4QDVA 4QMPA 1WCCA 2H34A 2YA9A 4U42A 4YNOA 4IM0A 1PMVA 2PVHA 2G1TA 3OHTA 5LMAA 1SVGA 1PYEA 3SOAA 2HAKA 3HLLA 3P5KA 4Y83A 3E8DA 2BVAA 3LFFA 3OW4A 4IAIA 4C57A 3W0NA 3RM7A 4DC2A 3ZLXA 3I7CA 2HZIA 1YHSA 3POOA 5LVMA 4FE2A 4DHZA 4TL0A 1OITA 2HWPA 4FUYA 3FMNA 5BVDA 3I5ZA 4TNDA 3COMA 3QKKA 4BHNA 2BHEA 4U6RA 5HVJA 5HBJA 3FY0A 4J95A 3KRXA 3H0YA 3LCTA 4GMYA 4F6UA 2PK9A 1GY3A 4FEQA 4GJ3A 2R3IA 4UV0A 5DRDA 3HECA 4I23A 4AGWA 3MH3A 5AUZA 3ZBFA 4BCGA 2GQRA 3FMDA 4EH2A 1YXVA 5DIAA 2WMBA 5BMSA 4FIJA 2QODA 5GHVA 3R7YA 4RJ7A 5HD4A 4DH5A 3UNKA 4YSMA 2CKEA 5I5ZA 3R8VA 5AR7A 3QD0A 5C8MA 2WMWA 2Y4IB 5KBQA 3KCFA 4HYHA 3E87A 2VWZA 4X2KA 3MPTA 4XJ0A 2FYSA 3CC6A 4LRKA 5CAOA 3EQFA 4W9WA 4EBVA 3P1AA 4Z9LA 4GJ2A 5EYDA 2R3QA 3WZKA 2YZLA 1ZARA 4XG9A 2E2BA 2I40A 3P7CA 3VUKA 4I6LA 4UN0C 5A9UA 4DT8A 3RM6A 2HXLA 3KRWA 4HW7A 2B52A 2O2UA 1IA8A 2R0UA 2RFDA 5AWMA 3UODA 2GHLA 2JIUA 3OUNB 4DFXE 2C6OA 3CY2A 4QMTA 4LUDA 4P5QA 3NUNA 1FGKA 2ETRA 3C4CA 3PJ2A 3R1QA 5LVLA 4ARKA 2E9UA 3HV5A 3SHEA 5CEKA 3LXPA 3A4PA 3COHA 4Y95A 4O7RA 4DAWA 1WBPA 4U97A 3RALA 5JFXA 3I5NA 4XRLA 4FG7A 1JKKA 2VWXA 4FKUA 2YCFA 3D15A 1BMKA 3D2IA 4A4OA 3GCQA 1LPUA 3MN3A 5JH6A 1LR4A 5C26A 1L3RE 4XX9A 4NM3A 4BTFA 5I9UA 4P90A 1RDQE 2CGVA 3R7IA 4XP0A 3TNWA 4L53A 4AFJA 4FEUA 1H26A 1U54A 1WBSA 4BJJB 2JKKA 1XKKA 2JBPA 3W2PA 4DH1A 4RSSA 3PXKA 5LVPA 1KV2A 1OL6A 4O7VA 4V01A 3QKLA 4G31A 3UOHA 4HVDA 4XV3A 4UMTA 4F0IA 3KY2A 3NRMA 3DTWA 1HCKA 5F4NA 3FV8A 3ZDUA 5JKGA 3LFEA 3ORTA 4EK8A 4JBPA 3BCEA 2WTKB 2BIYA 3KULB 2HW6A 3MBLA 5CVHA 2J50A 3KRLA 4L8MA 4EOIA 3VBVA 5KKRC 1H08A 3F2RA 2Z7LA 3NFFB 2R2PA 3G6GA 4AW5A 3E88A 3G9NA 4R5SA 4CZYB 2Z7SA 4IB5A 5BNJA 5M57A 4O0YA 4I5PA 3Q96A 4EORA 4BYJA 2G2HA 3NWWA 5JQ5A 2CKOA 4QRCA 3M1SA 4AE9A 2Y7JA 4ZZMA 2XNNA 3DBEA 1M7QA 4EYJA 4F9WA 1O6YA 3QQJA 4A9UA 3AMAA 2VTQA 4FKQA 3ZFMA 3EHAA 3ZH8A 4R3PA 2A0CX 2B54A 3DKCA 5AM6A 3BU6A 3BWFA 3RNYA 3BBWA 4GIHA 4EHVA 2FSTX 4YHFA 3TM0A 5L8JA 1TKIA 3MVHA 3MTFA 5EM5A 5CZIA 1OB3A 5HHWA 4KIKB 3T9TA 4KBAA 4KNBA 5DEWA 3AC1A 4EH5A 2VO6A 3MY5A 1JKLA 2EUFB 4Q9SA 4XP2A 3UIXA 4BDBA 3NNVA 5HX8A 1OZ1A 2XP2A 3ET7A 3FYKX 3AC4A 3OVVA 3RKBA 3T3UA 3VQUA 1V0BA 5JGBA 3L1SA 3FMLA 5F94A 1ZMUA 2WOTA 4J7BA 5IA5A 1VR2A 4EQMA 4F1OA 5L3AA 2JBOA 3KGAA 3QQFA 4X3FA 3QYWA 4AS0A 2W1GA 4IAAA 3SVVA 3VS1A 3Q9WA 4X3FB 1H07A 1PKDA 4HVSA 4C2VA 4BGQA 3OCGA 5F95A 4E20A 4UALA 2BRBA 1H27A 5AV2A 4FA2A 4GUBA 5CF8A 4DFBA 2W9FB 4L43A 3BGZA 3Q5IA 5EG3A 4C36A 2EU9A 1M2QA 4FG8A 5AA9A 4L3PA 4D5KA 4JXFA 4N6YA 5HU3A 5I9YA 3OZ6A 3EL7A 4CG9A 4S33A 2Z7RA 5BVNA 2RFNA 3HV6A 4JNWA 2ONLC 4F7JA 2G2IA 4TWPA 5CQWA 4I21A 5IQEA 1J3HA 4JDIA 4XV9A 3R63A 3VS7A 4AOTA 4U45A 4NTTA 3IS5A 4PP9A 2X2MA 4WOVA 3VAPA 5DR2A 3W8QA 1FMKA 4E26A 1Q8TA 4Z7HA 2C6LA 1Y91A 4IBMA 4CEGA 3EQDA 4PP7A 1OPLA 4O96A 3PIZA 4KIQA 3QWKA 5E8TA 3QC4A 1OUYA 5ETCA 3T9IA 3CD3A 3D14A 4O91A 4FZDB 2PMOX 1HCLA 4PY1A 3W1FA 2BZJA 3GCSA 2XKEA 3PJ8A 2ZV8A 4PTGA 4O4EA 4DEEA 2HZ0A 2GHMA 3PG3A 4YC8A 2YDJA 3ENMA 5HORA 1M7NA 4L67A 3FHIA 3ZLWA 4A06A 2QC6A 4YURA 3DBDA 4U44A 4GEOA 3MH0A 4QOXA 5KNJA 4JG7A 3GU4A 3PSBA 3U4UA 4DFUA 5LOHA 3QLGA 3GQLA 1J1BA 4ANQA 4F08A 4LL5A 4Z7GA 3DLZA 4K11A 1AQ1A 5EW8A 4FTKA 3R73A 4F7NA 2QOOA 4P2KA 5B0XA 4QTEA 4Z55A 5DFPA 1Y6AA 4QMSA 1OL2A 3S1HA 2GQSA 2VTNA 2X8DA 1XH9A 2RG6A 1VYWA 4XH6A 3BU5A 1YI6A 3A4OX 3VUDA 3MWUA 4YLKA 3AKLA 5IQGA 3BYUA 4IAFA 1H00A 3R28A 5HVYA 3ZXTA 1JSTA 3G9LX 4KKEA 4PTCA 4WBBB 2VTRA 3ORMA 5IDPA 3AT4A 2WTVA 1URWA 3OWLA 1O6KA 4FODA 3TEIA 3PUFC 1G8KA 1VEBA 2C6MA 3OF0A 2B1PA 3OXZA 4RIXA 3UG1A 5CSXA 3DAEA 4X6RA 5T6KA 3P4KA 4PDSA 5A54A 3GU8A 3BYOA 3WZEA 2WMAA 4CMTA 3W0RA 3G90X 1PHKA 2H6DA 3FI2A 3OT3A 4OTWA 5G6VA 4RIYA 5HTCA 3FPMA 4O1PA 3LHJA 5JFVA 2E9NA 3CJGA 3FLYA 5DYJA 4I0TA 4FK3A 3GQIA 5CQUA 4HPUE 5E8ZA 2Y4IC 1BYGA 5D41A 3PUPA 4TT7A 4BGGA 5DT0A 2GNFA 4FKSA 5K0KA 4E93A 2UZUE 4M13A 5KMOA 1FVRA 4JAJA 3WF8A 4NM0A 1ZYLA 4AZTA 3ROYA 4ALUA 2BAJA 5DI1A 3LLTA 2C3JA 4BCIA 4RBLA 4AU8A 5CLPA 4HCTA 5CSHA 2NP8A 1ERKA 2VO3A 3EL8A 4ACCA 1OKVA 4AT4A 5FG8A 3GVUA 3O8UA 4IADA 4O4FA 4ASXA 4AGUA 5AP1A 4U41A 4LGDA 1YQJA 2F7EE 4EOLA 4YBJA 4I20A 2XKDA 2JGZA 3P7AA 1DS5A 3I6UA 2IO6A 4R3RA 4RJ8A 5AUTA 2C3IB 1Q4LA 2PY3A 5D11A 3QYZA 5KHWA 2IVVA 2X6EA 3BE9A 5CEQA 3UGCA 5EQEA 1WBWA 1GJOA 1PXOA 1KE8A 4M69B 4XBRA 4EOMA 5CEPA 1OBGA 3UOKA 5ANKA 2ZM1A 5AA8A 5AUWA 2FGIA 3HDNA 4CXAA 2X8EA 2UZTA 3NUYA 1IEPA 1ZYJA 4ZEGA 4KS7A 3W33A 2ITXA 5C4KA 4G5JA 3ENHA 2JAVA 1G8SA 2OJJA 1GZ8A 1OMWA 2B9IA 1JKTA 2ZJWA 3G51A 4O82A 3NYVA 2GNIA 2YM7A 3QD3A 2BR1A 2QOKA 2JDTA 5CSPA 5CI6A 1FQ1B 2HW7A 3EQHA 2BKKA 3QRKA 3LVPA 4YNEA 5BMMA 2PVFA 3O5AA 1QPCA 2Z8CA 4ZTHA 4AGCA 4C4GA 1H1PA 4DITA 4H3QA 5H8BA 4DH8A 4YTCA 5CAVA 4EOOA 4GS6A 4M0ZA 4DFNA 4BBMA 2W4JA 3PXZA 2H96A 4K1BA 5DN3A 4O21A 4A07A 1M2PA 4L46A 4D4VA 3ZTXA 2R3LA 4I3ZA 3RAKA 4EH7A 2P2HA 4QQTA 3CJFA 3Q3BA 3WILA 4UX9A 1Q8WA 4XG3A 3W2OA 3VF9A 3MVMA 2BAKA 5C01A 4FV7A 2PUNA 1W84A 5AMNA 4FV3A 4ACDA 2Y9QA 3DU8A 2O63A 4L3JA 1Y6BA 4C61A 4BFMA 3PSDA 3W0PA 3ORNA 3CD8A 3ZYAA 4ZTNA 2WTWA 4AT5A 5D12A 2YLFA 3RPRA 2X6DA 1Q8UA 4EWQA 1PXMA 4JIAA 3AKJA 4YR8A 3GCVA 4R3CA 5CF5A 4PPAA 3DJ7A 1WBVA 5JGDA 4QMUA 4B99A 3OBJA 4BZNA 3F82A 2R3HA 2OU7A 3ZO2A 5AUYA 4QMVA 1SMHA 2YIRA 4MQ2A 4DYMA 4HJOA 5HG9A 3G0EA 5ETAA 1GZNA 5EQYA 3RPOA 5JT2A 4ZP5A 2V62A 3MPMA 3ZXZA 2XIXA 4O0XA 5AADA 4YP8A 3R7EA 1NA7A 4JS8A 1S9IA 4QMLA 3PSCA 5J95A 5B2MA 1H0VA 4E5BA 5FGKA 4KIPA 2C68A 2XBJA 2GS6A 4JIKA 3MGYA 4G3GA 3ACKA 3DBQA 3EZVA 4G3FA 3EFLA 5DOSA 5ETFA 4FKPA 4XNEA 2YWVA 3TKIA 3P86A 4EUUA 3EFJA 5AR8A 4IVBA 3BEGA 4PNIA 3VULA 5LXMA 4FKGA 3ULIA 5FWKK 2Z2WA 2W1IA 4NZWB 4BZOA 4EH8A 3D7TA 4O6EA 4F1TA 1H1QA 2W1HA 4EZ7A 4P7EA 3OP5A 3CTHA 4RWIA 2YACA 1KOAA 3GC0A 3F88A 4DLJA 4KSPA 2Y6OA 3LW0A 5KMMA 3FXXA 4BCHA 5GIPE 1OPKA 4M69A 4APPA 1JWHA 3CKXA 4KB8A 1QPDA 2JEDA 4WUNA 4OUCA 2RL5A 3C4WA 4M12A 3NDMA 2OGVA 4Y5HA 4S34A 5LWMA 4GCJA 3DZOA 1MQ4A 4BL1A 3BE2A 4RRVA 1Z57A 4PUZA 4PDOA 4RFZA 3UOLA 1W2DA 1SYKA 2WTCA 4EJ7A 2E9PA 2J0KA 2PZIA 4C02A 1KE6A 4FIHA 2XJ1A 1Q8YA 4IM2A 1REKA 3Q2MA 3QKMA 4BI0A 3MH2A 2CJMA 4UWYA 5LJJA 5TR6A 2PMLX 1W8CA 4EK3A 4F7LA 1G3NA 3DCVA 3RPVA 3VWAA 3FPQA 4FR4A 3HL7A 3OTVA 4BWKA 5K9IA 5FRIA 5E8WA 4ANLA 3QUEA 3PRFA 4KIKA 4I6BA 5F1ZA 1XWSA 5CEMA 4PWNA 4E6CA 5LMKC 2UW5A 4CT2A 3W16A 4BY9E 1PXJA 4J96A 2PE2A 2W4OA 3UIMA 3UC3A 5M56A 3BELA 4UMUA 4ZS0A 4CFMA 3VBXA 1M2RA 2B9FA 1FVVA 2W1CA 3FQEA 3QCXA 1H1WA 2UVZA 3W2CA 4C0TA 5M55A 1U4DA 4MYGA 4AXAA 1UNLA 1MRUA 3E63A 3GU5A 3F7ZA 3V5JA 4CGAA 2PVYA 3FC1X 2OG8A 2V55A 3KC3A 4OT5A 2XNEA 4C4IA 3AG9A 3ZO1A 3FMKA 3G5DA 4YHJA 3DB6A 4IX4A 4I5HA 3GC7A 2Y0AA 3R8LA 2PSQA 3G2FA 3RP9A 4QD6A 5GINE 2Z02A 4O0UA 4DCAA 4IB0A 3RK9A 5CALA 1V0PA 3ORKA 4E5AX 1OECA 1KWPA 2C6TA 1H25A 4G16A 2PE0A 3UMXA 5IEYA 4GVJA 3NYXA 5DPVA 4O22A 3VUMA 4ANSA 4J98A 3F5UA 4U0IA 5ETIA 3U9NA 4E6QA 4DINA 3LMIA 3B8RA 3D5WA 5AR3A 3OXTA 4O0RA 1J7IA 2J7TA 4LRJA 5EYMA 4PPBA 4AXEA 2J90A 4E1ZA 5DE2A 3U51A 3V51A 2OFUA 1OVEA 5EHYA 5DVRA 4BDAA 3KREA 4FG9A 4L7FA 4MD9E 1WVYA 3DDQA 3U6IA 1XMLA 3FKOA 3HUCA 5L8KA 5AV4A 3DXQA 4RA5A 3VW8A 4O7NA 4LMNA 5CF4A 3QXOA 2XEYA 3DFAA 3EB0A 4G3CA 1NY3A 1O9UA 2VX1A 3MH1A 5H8GA 4O84A 2QURA 3DB8A 1DI9A 1U59A 4IB3A 5EYKA 3VC4A 5HTBA 2X2LA 4GU9A 4P5ZA 4DGGA 3SW7A 1B38A 4F9YA 3TNPC 1DAWA 3R9NA 3E8CA 3RHXA 2JAMA 2IZTA 4QMMA 5G1XA 2PMIA 3C1XA 2FA2A 3EIDA 3QZFA 2ERKA 4I5MA 4D0WA 5F20A 5EOLA 2EB2A 3K3JA 2OW3A 4PF4A 4QTDA 4FVRA 4MNFA 4YJQA 4YPSA 4KRCA 3QCSA 3CPBA 1TZDA 4FV2A 4C8BA 4E6AA 5HO7A 2J0MB 1OM1A 3I0QA 2KTYA 4JT3A 1XR1A 3W10A 4FEWA 4A9RA 3MV5A 3PZHA 3VS0A 4JDHA 4BKZA