5CEOA

Dlk in complex with inhibitor 2-((6-(3,3-difluoropyrrolidin-1-yl)-4-(1-(oxetan-3-yl)piperidin-4-yl)pyridin-2-yl)amino)isonicotinonitrile
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
269
Chain Sequence
LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 12
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ceoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ceoA01
3BV2A 2UVZA 1A06A 4G3EA 4KB8A 1LUFA 4L52A 5T3QA 3R8LA 5FDPA 2PULA 2JIIA 2O63A 1KSWA 3OEFX 4EK3A 1IA9A 4FEXA 3D5VA 4JR3A 3U54A 3TACA 3PSBA 4O7LA 4YBJA 4BDAA 4JBVA 3BWFA 4II5A 4QMMA 5M4CA 4KKEA 3BIZA 3B2TA 3Q53A 4XV1A 4QP9A 5K3YA 5HNIX 1GZKA 3Q9XA 2J50A 3EN5A 2UW5A 4V01A 4NEUA 4FKQA 3AQVA 3T9TA 3HP2A 5ACKA 4JR7A 3OCGA 3FLYA 5KMOA 3O8UA 4FEQA 1B39A 2ZAZA 3AGMA 4IE9A 4PL5A 3ZTXA 3ZO1A 2HCKA 5HVYA 5HLNA 5BUEA 5AUXA 4I4FA 4AZEA 2G9XA 4C0TA 4AXAA 2PVLA 3DK7A 4FTNA 4GUEA 3KCFA 3UZPA 1JOWB 1Q8WA 4AP7A 4GT5A 3VULA 1GIHA 3EFJA 3TNPC 2PZ5A 2PVNA 4FI1A 4QP2A 4ZTNA 5A6NA 4ASEA 4XRLA 4NM5A 3DBDA 5HD4A 3ROCA 4U41A 5DE2A 2Z02A 4DFZE 3VJOA 3Q4ZA 2FA2A 1KE8A 4WRSA 3MPMA 2QQ7A 3KRWA 4ACGA 2X7FA 2VTLA 4U3ZA 4ZTSA 1Y57A 5EHOA 4ZTHA 2HXQA 4BCKA 4TYJA 4PPCA 5JK3A 2KULA 4PPAA 3VN9A 3PY3A 1YHVA 2Z7SA 5J95A 5JEBA 4RJ4A 5GZ9A 2X2LA 4XJ0A 5L2QA 5IMEA 2YITA 5KO1A 3Q52A 4JI9A 4YUQA 4L45A 4Y95A 3V5WA 5LJJA 4M69A 3TUDA 1G8SA 4O7RA 3TV4A 4WOVA 5BMSA 4APPA 1Q8YA 4ANNA 4O0XA 4O38A 2J51A 5ANJA 5CSVA 5CS6A 5J8IA 3ZBFA 4MXAA 4NUSA 5HU3A 2YA9A 2X6DA 4G5JA 1I09A 2YJSA 2OJJA 3RTPA 5AR3A 2VNWA 2R3OA 3FBVA 3LAUA 5E91A 5J9YA 5GIOE 3R0TA 2WB8A 3TKUA 4FOCA 5AV3A 2UUEA 5EHYA 3W10A 4RLLA 2W05A 1XHAA 3CSVA 4FTQA 3ZO3A 3R8UA 4UBAA 4MD7E 4JBPA 4IAIA 2YAKA 4RJ6A 4IAYA 3RJCA 4HVDA 5KUPA 3VUMA 4QTAA 1BUHA 4QPMA 4ANOA 2YZLA 3BI6A 3DQWA 4ZSLA 3VBYA 3VHKA 2PVJA 4DC2A 5M57A 3FKOA 3RP9A 5BVDA 2YCRA 3PA4A 4K9YA 4UMUA 2J6MA 5AEPA 3AC4A 4IB1A 4FE2A 4XOYA 5HE0A 3D7TA 2YIRA 4FVQA 3KVWA 5CI7A 2OZOA 2XIRA 3BGQA 1M2PA 4BCMA 4L53A 1Q8UA 4XP2A 1QPDA 1E9HA 3NVKI 3DGKA 2XJ0A 2DWBA 3BLQA 3T8OA 4EBWA 5I9WA 5FWKK 3RWQA 3W2QA 3M11A 2FSOX 2BUJA 1FQ1B 3VF9A 4PTGA 3IK3A 4YJSA 4PTEA 1M52A 4O27B 4YTCA 1YDRE 4P4CA 2WTJA 4KD1A 2GQRA 2W1EA 2EUFB 2I0EA 1YI3A 4C34A 1ZZLA 3TUBA 5AV4A 4QNAA 5IZFA 2XK6A 5AIRA 2CGWA 5FLFA 3GU6A 1UKHA 4UN0C 1R3CA 2UVXA 2ZB0A 4OTHA 5EM7A 4EH8A 4MTAA 3TT0A 4MBIA 4AN2A 3UQFA 3BCEA 5E8WA 4DE4A 1Q97A 4XV2A 2PVHA 4ZSEA 3NYXA 4CT2A 5EOBA 5M4FA 2PL0A 1BLXA 2X9FA 5IUGA 3OTUA 3WOWA 4IX6A 3PIYA 3MJ1A 5KHWA 2X2KA 4AGWA 3B8QA 5CEOA 4NM7A 1Q3DA 4JOAA 1LEWA 3CQEA 4QQCA 3GGFA 3TZ9A 5CXZA 3W33A 1UKIA 2VU3A 4J99A 3IDBA 4BN1A 4O86A 2WOTA 3COIA 5KMMA 5M4UA 1KE5A 3BHHA 3PRFA 4GH2A 4EJ7A 3I7CA 2C69A 2WXVA 5JQ5A 3NW6A 1BMKA 4GV1A 3RZBA 4F0FA 2CKOA 2WTKB 3L9PA 3FPQA 4CFVA 4ZZOA 3LQ3A 1PYEA 1Q41A 3LQ5A 4D2WA 4RZWA 3FZPA 5JKGA 2BKKA 5ANOA 5CEKA 3PE2A 2NP8A 2OK1A 4IX3A 5IQBA 2WO6A 3U9NA 4DN5A 4AE6A 3R63A 4TXCA 3GCVA 4EH4A 2DUVA 4QMXA 1K9AA 2R3LA 2B9FA 3QYWA 4X3FB 4YP8A 3PP1A 3UPXA 1J3HA 2YM5A 4YTFA 1RE8A 3DT1A 1WBNA 4TNDA 2PMLX 2X2MA 5HO6A 3EQFA 2YFXA 2JKKA 3OFMA 4IB5A 2Y8OA 4FKPA 4YHFA 4DTKA 4ZY4A 2XK3A 4TTHB 4BDIA 5LVLA 3NSZA 3R8ZA 4FODA 1J7LA 4G31A 1FGIA 3A60A 4QTCA 3EQBA 2C6OA 3FMHA 3LXKA 3ZHPC 2R3MA 3PXKA 2ZV2A 2JAMA 3PA5A 3ZUTA 4C4FA 4AF3A 3FY2A 4HVIA 1VEBA 3FC2A 1SNXA 4FX3A 2BRGA 2JDRA 3IW4A 4CEGA 3PZEA 4UXLA 4HCUA 4R5SA 1KE6A 2GU8A 4FSRA 4USDA 3DNEA 5HOAA 3DV3A 2H96A 2C5YA 2W5BA 4RWLA 4Y5QA 2XJ1A 1FMKA 2ACXA 3DCVA 2X8EA 1GIIA 1URWA 2WU7A 4QT1A 2R7BA 3JR1A 2QVSE 2PZRA 3I0QA 5CEIA 4YZDA 4JIAA 1STCE 3MH2A 3PY0A 3UVRA 4PQNA 5IQGA 3O0GA 4FIEA 5KKRB 2VAGA 4R3PA 3W1FA 5G6VA 3PXZA 4QRCA 3DQXA 1Q62A 1FVRA 4G5PA 4V04A 2FVDA 2H8HA 2VO0A 5AM7A 3K54A 3NCGA 5BYYA 3QTUA 2XM9A 3P7AA 2ERKA 3TKIA 2B9JA 3PYYA 3QHRA 4PMSA 3TL8A 4FV7A 3TNWA 2BTSA 3OWJA 3IO7A 5IDPA 1H1PA 3HMNA 4RX7A 4WUAA 1Y8GA 2XNBA 1DAWA 3EQHA 5EM5A 4CVAA 3FKLA 4EQUA 2G2HA 1M2QA 3ZSHA 2XRWA 4Z9LA 4C37A 4U80A 3FDNA 3RHKA 2PVMA 4TWNA 4KIOA 3R01A 2C6LA 4MK0A 4NL0A 1IA8A 3A4OX 4MBLA 4XHKB 4HVSA 4G6LA 3LOKA 1K3AA 4GJ3A 4YNEA 4FNXA 5B7VA 3MVJA 4HGSA 4JQEA 4NIFA 4CTBA 2XIYA 5HNGA 1I44A 3UTOA 3F3WA 3C4CA 3UNKA 3WIGA 4PDPA 1YQJA 2GNFA 4FKVA 2FYSA 4F08A 4EYMA 4E26A 4QMZA 1FBNA 3BLRA 5BPYA 2CGXA 2PUIA 4EHEA 4JIKA 4YBKA 4UWYA 2UW9A 2VGOA 4YO4A 3F6XA 2GNLA 4I21A 2XCKA 2NNWB 1KV2A 3QCXA 4IAZA 3NNXA 4ZSJA 2A2AA 3GCUA 3UODA 2VO3A 3ERKA 3L9LA 1H1RA 1WVXA 4L6QA 5DRDA 3VBXA 3PWDA 2VN9A 3EFLA 4ALWA 1PXNA 4FT7A 4NT4A 1JVPP 1QPJA 4GT4A 4J71A 2GSFA 1SNUA 5BVKA 5FGKA 5JH6A 4BDKA 2GS6A 2EWAA 4IW0A 5K9IA 1NA7A 2ITWA 4FIHA 4ALVA 3ANRA 3FLSA 4HPUE 4LMUA 4MAOA 5E8TA 4ACHA 4BTKA 2VWYA 3GQLA 4G2FA 1PXKA 2VUWA 2P2HA 4WBOA 4C35A 5LQFA 1PRYA 2XKDA 3HMIA 4IB3A 2OXDA 4UY9A 4E20A 5HQ0A 1OBDA 3C0IA 3MW1A 2R2PA 3V8TA 3ALNA 3D5WA 4GMYA 3KQ7A 3ZMMA 1DI8A 4JG8A 4BWPA 2R5TA 5I5ZA 4JX7A 3V6SA 3EZVA 4BDBA 3FAAA 1MQ4A 3TM0A 4L42A 3QQLA 5IQIA 4O2ZA 4L00A 1ZYLA 5ETIA 4WG5A 5A4TA 4Z7HA 5L2TA 2CPKE 4FSZA 1P5EA 4RIOA 2E2BA 5HZNA 4DLJA 2IVUA 3COMA 4L46A 2V55A 2W5AA 4M12A 4W8EA 3S2PA 1VJYA 5J79A 4O82A 3DBCA 4BI1A 2C6IA 4TYHA 3NLBA 3FSKA 1PY5A 4RT7A 3IPHA 3P23A 3QRKA 5EI6A 3BZ3A 2QHMA 3K5UA 3WF5A 3LKMA 4XLVA 2UZEA 3LFDA 1OECA 2B54A 4YLLA 1MUOA 1OKZA 3GI3A 5DLSA 4EWHA 5K5XA 4FYOA 4FTLA 3WILA 3CCNA 3LJ0A 3VUTA 3F7ZA 5JZNA 4H3QA 4QMWA 1KWPA 4LRKA 2UVYA 5DR6A 3R7VA 3MN3A 1OUKA 4FZ6A 4IFGA 3TJCA 1V0BA 2AYPA 3D0EA 4GT3A 2CN5A 4R3CA 3ET7A 4ACCA 5AUZA 3FYKX 3L8SA 4CYJA 5KMLA 3FYJX 5CF8A 4R5YA 1XKKA 2XM8A 4G17A 2WIHA 3QZFA 3R00A 4JDJA 4WSYA 4AA5A 2VO7A 5KBRA 3CR0A 3CD3A 3TCPA 4RZVA 5L6OA 3FMEA 4CKIA 4AGUA 3PPKA 2RGPA 4FT5A 2O2UA 2UZWE 3CS9A 3A8XA 3DZQA 3KULB 1F5QA 4IH8A 4W9XA 3QZIA 1LR4A 4C2WA 3RAHA 3UVPA 4I22A 4AW1A 4FTTA 3A4PA 3ORZA 4XG3A 5J1WA 5L4QA 3CXWA 2R3JA 4Z55A 2OF4A 3GP0A 4RVMA 3P78A 3A7IA 3M2WA 5E90A 2YM8A 4U79A 2HY0A 3HKOA 3QUPA 4GCJA 3RPVA 4O0WA 4F1MA 1XWSA 5C8NA 2J90A 4FL2A 4I93A 4HJOA 2VTIA 4RJ3A 1Q3WA 3LJ2A 2OIDA 5FTQA 1ZRZA 2XS0A 2R3HA 4DH7A 2ZB1A 1KE7A 4A9YA 3D5UA 2VWUA 4D9UA 1OIQA 5EM6A 4AFEA 4AW2A 2GDOA 4FTJA 1W84A 2BZIB 3TIYA 4FEUA 3SLSA 3IS5A 4I1ZA 3WZDA 4EZ7A 5C4LA 1NVRA 4IXPA 4PL3A 3E64A 1BX6A 3R1QA 4NM3A 3GENA 2IW8A 2C5XA 4ASDA 5M51A 3IOPA 4I24A 2HYYA 3TZ7A 1PXJA 1WBWA 4EOLA 2YM4A 2W4OA 3E3BX 2F7ZE 4ZEGA 1H1WA 4KSPA 3SG8A 1H27A 4J97A 4N70A 4EK4A 2GNGA 3IGGA 4JX3A 3SG9A 3TIZA 4EEVA 3W8LA 4L7FA 4AOJA 1H01A 3PJ2A 3JS2A 5HBEA 4BYIA 3VUHA 2WTVA 4F9CA 3AC1A 3WYXA 2OICA 5AUWA 3PPJA 2W96B 5E92A 4ZLOA 4BYJA 1ZMVA 2QO2A 3FQSA 3U4UA 2CLQA 3MPTA 2YHVA 2XIZA 4IACA 5L2WA 2FSTX 3SXFA 3DAJA 1ERKA 4L3LA 5HCZA 4MQ2A 2XEZA 4NFNA 1KE9A 5CNNA 5DR9A 3WZEA 4D1XA 3QZGA 5IEVA 4EJNA 3TG1A 5FP5A 1PXOA 1H0WA 3ITZA 1OPJA 2C6KA 2XF0A 4FR4A 2OIQA 3QUDA 5F94A 3FY0A 3QXPA 3WI6A 1IRKA 5TR6A 3ZXZA 3QQFA 4HYHA 4YC6A 2OZAA 1JPAA 3R2YA 5A46A 4OR5A 4TW9A 3RALA 2XRUA 1XH4A 4RLKA 4QYGA 2OF2A 4BTJA 2XJ2A 5AX3A 3ZUVA 2X9EA 1FINA 4IM2A 2BRMA 4O6EA 3PZHA 5CLPA 1MRYA 2RL5A 4J8MA 4JVGA 3R30A 1O9UA 3O8PA 1ZXEA 1E1VA 1J91A 2IO6A 3FZTA 4FIJA 4L9IA 4OTFA 3GC9A 4KBCA 1WBOA 5E8UA 2XK4A 2YAAA 4D2PA 3SVVA 3ORKA 4U40A 1BL6A 3FZRA 4EH6A 3CPBA 5M56A 5FDXA 4DGGA 2XMYA 2I40A 3SKCA 2W0JA 2B9HA 4O84A 5D12A 4CFUA 2W1DA 4IM3A 4F99A 2GNJA 3U8WA 4HPTE 4I0RA 3DLSA 3ZS5A 3F5UA 4DEHA 2VTTA 4QPAA 3HRBA 1JAMA 4B9DA 4EZ5A 5J9LA 4DFBA 3KXNA 4YJOA 3OC1A 3KREA 3QC9A 3VS7A 2A4LA 3TEIA 5IH5A 4Z7GA 2Y6OA 4EC8A 2XIXA 2XP2A 3UIMA 3NGAA 1OPKA 2RIOA 3C50A 5TT7A 3ETAA 5IA4A 2CKPA 1T45A 3GEQA 3LCDA 3R22A 3MV5A 4B8LA 2GNIA 4H3BA 2X1NA 5KBQA 1YKRA 2ETKA 3O8TA 3PIXA 4WIHA 3F2RA 3P9JA 5T68A 4E6QA 5IG1A 1YDSE 2C3LA 5GJGA 2OJFE 2QR8A 2W1CA 2VWWA 2WPAA 3K3IA 3VBVA 4CD0A 4PNKA 2WMTA 4ANQA 4F0IA 5I9XA 2IZUA 2R3IA 3CC6A 4A07A 3HDMA 1JKLA 5K5NA 2WAJA 4FUXA 5B0XA 4C4EA 5JQ8A 4BIBA 2R3QA 1S9IA 1TVOA 4FV4A 3QWJA 4IZ5A 2OJGA 4GIHA 3QTZA 3NNWA 4YJPA 2VTMA 3R8VA 5DN3A 3H4JA 4P5ZA 2UZOA 3I5ZA 4NTTA 4S31A 2R0IA 4AT4A 4O7ZA 2OWBA 4FEVA 4O81A 4FTCA 2BFXA 4BCJA 3ODYX 1TQMA 3MY0A 2CGVA 4I0TA 4XUFA 2XCHA 5AR4A 4HNFA 3V3VA 3RGFA 4A4OA 4I3ZA 5EK7A 3ZEPA 1AGWA 3CTJA 4AAAA 1PXIA 2GHMA 2XZSA 4EH5A 2NPQA 4P2KA 3U51A 3F9NA 3EQIA 3NUUA 3MFUA 5J9ZA 4RFYA 1KUTA 4G3DA 1APME 3D4QA 2WEIA 3DLZA 4I4EA 3SW7A 3Q96A 3IQ7A 1QPEA 1YXXA 3NIEA 3BLHA 4IVCA 3A7HA 3QLGA 5CU3A 4LOQA 5FEEA 3VO3A 4I6FA 3MA3A 3VBWA 2V62A 4RFZA 4EHZA 3RCDA 3PSCA 4YC8A 4J8NA 5BUIA 1YXTA 4OW8A 1MRUA 5DT0A 4ZJIA 3ZUUA 4FTUA 1GZOA 3FC1X 4XP3A 2DS1A 4MWIA 4EH7A 3NWWA 4L43A 4WO5A 1JKTA 4Y73A 2C3KA 4DF3A 2HW6A 4AS0A 4FK3A 4YZBA 4ZXTA 5K0KA 4DGLC 5L6PA 2CKQA 2OH0E 3NVMB 3AOXA 3C51A 2PVKA 3D83A 1OB3A 4R78A 3QC4A 3A7FA 2RKUA 3E8EA 3LFFA 4J53A 4DYMA 1TQIA 3LPBA 3HGKA 4FKTA 3LXPA 4I20A 3KXZA 4HYIA 3P7BA 3VS6A 1W83A 4ANMA 1L8TA 3A8WA 1ND4A 5EW9A 3BU6A 3UNZA 5LVMA 4U7ZA 3TXOA 4MEDA 3U55A 5FXRA 2YM6A 2UZTA 4OTQA 3AXWA 3LXNA 4IWQA 5FXQA 4P5QA 2XBAA 3RM6A 5E8VA 2E9VA 4ANBA 2RG6A 2J0JA 4EOPA 2OGVA 4YJVA 1TQPA 4FICA 1LP4A 3ORMA 3QFVA 5F1ZA 1GNGA 4C57A 3A99A 4DGOA 4EORA 4FF8A 5CSHA 3UJGA 5HO7A 2WD1A 1Q99A 4NZWB 4GVAA 3PWYA 1H8FA 4KIKA 5DNRA 3DTWA 5DG5A 2WQOA 2HZNA 5FQDC 4E5AX 2BAKA 4RQKA 4QP6A 4I23A 4Y83A 3RPRA 4ENXA 5LXMA 3QD3A 4YLJA 3UO4A 3EHAA 4RVTA 1U54A 2QOOA 4D5KA 2VRXA 3UZRA 4FTKA 2PE1A 3VC4A 2WKMA 1YVJA 2W1HA 5CZHA 3VQHA 5AP7A 3E8CA 1DM2A 4F6UA 2BAQA 5LWMA 2P2IA 3FZ1A 3LFQA 4M8TA 2R3PA 3QQGA 2Q83A 3FLWA 4QYEA 4JLCA 4UYNA 4WKQA 3MVMA 4TWPA 5AAGA 5M44A 3HUBA 1W7HA 4BZOA 3IECA 4FSQA 2F7EE 3WF7A 4X2GA 1YRPA 5H3QA 4RIYB 3RNYA 5DYJA 4XBRA 4YJUA 5LMAA 2YJRA 4ALUA 4RIWB 5FM3A 4LYNA 3UVQA 3DB8A 4DFXE 2XNNA 5J7HA 1ZOHA 4JRNA 1Y8YA 2PHKA 5EYKA 2C47A 3FKNA 3H3CA 3LLAA 4GSBA 4C33A 3F66A 4PL4A 4JG6A 3AC5A 1X8BA 5IUIA 3C4EA 4JRVA 1J7IA 4QQTA 4MX9A 4R7IA 1JLUE 4CV8A 1WBVA 4HZRA 3FXXA 3Q9WA 3BEGA 3GU7A 1PXMA 2G2FA 4YZ9A 5GNKA 4CRLA 5JGAA 3G9NA 4XYFA 2Y4IC 5KX8A 5DBXA 2BTRA 3QTXA 4APCA 4IZYA 2BZHB 5CENA 4DA5A 3D7ZA 3HA8A 3P4KA 4LL0A 4QPSA 1UNLA 4PP9A 1PMNA 2ITTA 3QQUA 2FO0A 4V0GA 2VTPA 2X8IA 3NR9A 3H30A 2C0IA 4DCEA 4BIEA 5D41A 3NEWA 3F3VA 3AT2A 4OBPA 3TNHA 5HU9A 4IEBA 4W8DA 4BKJA 4O6LA 1U4DA 2O64A 5M07A 4BGQA 3N4UA 3EN9A 2C4GA 4O0TA 1MP8A 4BVUA 1OVEA 1PJKA 2YLFA 3OWPA 4U0IA 4F70A 3KN6A 1BYGA 4JG7A 4JAJA 2E9NA 3JY0A 3IDCA 3RM7A 3TJDA 4EHGA 1CTPE 3PJ8A 3SAYA 3U6IA 3OZ6A 3QD0A 3SDJA 5DH3A 2XB7A 3C0GA 4A7CA 1YOMA 4WNPA 3W2CA 4LUDA 4ZSGA 4RG0A 5DPVA 3UP7A 2WNTA 5GJFA 1UU8A 2X81A 4AZTA 4EQMA 2V0DA 4KS7A 2UW4A 1OITA 4Z16A 4PF4A 4YZMA 4WRGA 1YDTE 3R73A 4IZAA 4RRVA 3HMPA 3KRRA 5KZIA 3VWAA 3CPCA 3SRVA 2OI4X 2WIPA 4RWJA 3II5A 2PK9A 4GEOA 4AT3A 2ITZA 2QOBA 4L67A 2JBOA 3SX9A 3DFAA 1VYZA 3MESA 3HDNA 2ZV8A 3NUAA 1WBPA 4UMTA 2PVRA 4RA4A 2QOCA 3QA0A 4PDSA 2QLUA 1W98A 2GHLA 5FEDA 5CEPA 1BL7A 4TNBA 1IAHA 2G15A 2VTOA 2BPMA 2C5OA 4O21A 4Q5EA 4BKYA 3UO6A 4AACA 3LM5A 4O0YA 3ACKA 1Y6BA 4NTSA 4YR8A 3KVXA 4C4JA 4DEDA 5AP5A 1XBAA 4BBFA 3H0ZA 4CKJA 3OEZA 1WZYA 4RWKA 5CT0A 3R9HA 3F7WA 4P7EA 2QOLA 5IMXA 3R28A 3ZC5A 4BDHA 3F5GA 5CQUA 1A9UA 4WA9A 3MB6A 3MTLA 3VBQA 3NDMA 3MTFA 4ERWA 2HAKA 5KMKA 4EYJA 3HYHA 3MVLA 2PUNA 1KOBA 2BFYA 2JIUA 4MF0A 5KMNA 2WMRA 1ZYDA 4EKKA 3MWUA 3QCYA 4GFGA 4MXXA 5E1SA 4GYIA 2HY81 3FMMA 3UGCA 3KB7A 4RIXB 4D0XA 2J0IA 3C5IA 2VTSA 5J1VA 3V5QA 5CEQA 4YC3A 4NW6A 4FL1A 4RJ8A 4BDJA 5HD7A 5EKNA 1GAGA 5IEYA 2PVYA 3UPZA 4E3CA 2G01A 5KMJA 1OIYA 4M84A 3VS0A 5FUTA 3P0MA 4DH8A 4O0RA 4FA2A 1YXSA 4X0MA 2WMAA 5IQDA 2BRNA 5HX8A 3VVHA 5BVOA 4UX9A 3G2FA 1FPUA 3Q04A 2ZVAA 3DAEA 3FMDA 4EOOA 3FSFA 4JDHA 3KL8A 5K4IA 3V5JA 4Y5HA 2QG5A 1J1CA 3SQQA 3O17A 3N4VA 2WMQA 1OL6A 4EQCA 4YMJA 1HCLA 3T9IA 4E8AA 4N4SA 4AN9A 4J98A 2OLCA 3FLZA 4S30A 4FT9A 2R3NA 5CU6A 5DOSA 4IIRA 3RINA 5JGBA 2I0VA 4U8ZA 3E88A 3LMGA 4FYNA 5B2KA 4BCFA 4C59A 3VRYA 3TZ8A 1UV5A 2YISA 5BVEA 1PKGA 4G3CA 4BI0A 3UIXA 2ZDUA 1UU7A 4MNEA 2WQNA 3E7VA 3FUPA 5AR5A 2J4ZA 3AC3A 3UP2A 3HRCA 4HVGA 1R0EA 2XKCA 1L3RE 4YZNA 5HG7A 4GKIA 3MIAA 1OL5A 3UDBA 4O0VA 4CFFA 4U42A 5CVGA 3E3PA 2XEYA 4LMNA 5CY3A 2F9GA 5AR7A 3ZOSA 5EI2A 5E4HA 2EXCX 4USFA 5ETFA 3V5TA 4DLIA 5BX0A 3TV6A 1O6YA 2JGZA 3MFSA 2FGIA 2GCDA 2YN8A 3OXIA 2WELA 3NW7A 4IDTA 3O7LD 3LFBA 2VWBA 4O22A 1ATPE 4F6SA 2B9IA 4LQMA 4FV0A 4FNYA 4IDVA 4RSSA 4HYSA 2QLQA 3OWKA 4YZCA 5AP3A 4QMQA 3NYOA 4XG9A 4CLIA 3OT3A 4XEYA 4M0YA 4WG4A 4D1SA 3NYVA 2IG7A 4AU8A 3LJ1A 4AZWA 5LOHA 4KRCA 4BB4A 2WMSA 4FKOA 5JFWA 3AD6A 5IPJA 2YZAA 5CAPA 5HGIA 2XYNA 1JWHA 5EM8A 2QKRA 3F61A 2BKZA 5EDQA 4FT3A 4RVLA 3GC0A 1H00A 4ENYA 1WBSA 4ITJA 3GCQA 1YOJA 2EVAA 4G16A 5C03A 3RBWA 3EL7A 5CX9A 4FZFB 1ZAOA 3DZOA 5FM2A 3R71A 4IX4A 1JSTA 3U4WA 2GMXA 4QTDA 5JFXA 2VGPA 4O2PA 3BEAA 4C61A 3VF8A 3EIDA 2C1BA 2R3FA 3FZSA 3MBLA 4OTIA 3NZ0A 2F2CB 2ZV9A 5CAVA 4BF2A 4GU6A 3EH9A 5IA1A 3VUIA 3BYSA 3ELJA 1PW2A 3GBZA 5FP6A 3UMWA 3FQEA 3OP5A 2OIBA 2Z8CA 2RSVA 4UYAA 5JMSA 5HIBA 4AT5A 5A6OA 4KWPA 1SYKA 4ZZNA 3BHYA 3P7CA 1ZLTA 1IG1A 2JFMA 4A9UA 4AA0A 3CGOA 2J0KA 3DJ7A 3IW7A 2BALA 2Q0BA 2R64A 3R7OA 4EH2A 4B99A 3UOHA 2W1IA 3OCSA 5E8ZA 3JPVA 4QOXA 1LPUA 1WAKA 4U81A 4FKWA 4J1RA 5D11A 5AWMA 3W2RA 3JVRA 5A3XA 4IFCA 4CFXA 3S0OA 3GU5A 3OT8A 4GU9A 2RG5A 4IBMA 3UNJA 4ANLA 1V1KA 1SVGA 1OKYA 3REPA 2J5FA 2LGCA 3OHTA 1IR3A 5LVNA 3FMKA 5AX9A 2XUUA 3PIZA 4UZDA 3A62A 4AW5A 1HOWA 3POZA 3DBFA 5KE0A 4CSVA 4DINA 1H28A 2JDSA 2VWIA 1GY3A 4E5BA 1Y91A 4DCAA 4FKGA 3C0HA 3EJ1A 3QX4A 4U9AA 2XVDA 4Y72A 1R78A 2NRYA 3AMBA 5HE2A 3Q6WA 4AG8A 2PMIA 2QOIA 2BZJA 4NKAA 3TTIA 2QC6A 3R2BA 4GW8A 4O7WA 3PFQA 3OTVA 1H08A 4MH7A 5T6KA 4M15A 4TWCA 1NY3A 3VHEA 4ZOGA 3VBTA 5TOZA 5D9HA 3DK3A 4IWOA 3MFTA 4X7QA 5D7AA 5HKMA 3BGPA 4O7YA 1Q4LA 4M68A 4FV3A 3E8NA 5DHJA 4BDEA 3QUEA 3TKHA 2P33A 1R39A 2OH4A 3D94A 4PMMA 4DGMA 1IAJA 1M14A 3MYGA 2H6DA 2X4ZA 4C62A 2J0LA 3I0OA 3ZDUA 4DFYA 3H9OA 3LXLA 4ACDA 4AA4A 5I9VA 5H2UA 4ZJJA 4L8MA 2PVFA 4W9WA 3GOKA 3F3UA 4PTCA 4XCUA 2BILB 5AP0A 2V7AA 4NSTA 1G3NA 1OZ1A 2AC5A 4HYUA 4X2NA 2OJIA 4DFLA 3OMVA 4I94A 1G8AA 2PUPA 2UZNA 2PTKA 3FZOA 4HW7A 2VWXA 4FSMA 4X21A 2QO7A 4FIGA 3F82A 4BICA 3HECA 2YIXA 3DOGA 5ANEA 4J96A 1NVQA 2QNJA 3VS2A 2C3IB 3PLSA 4LV8A 1JKSA 5LVPA 2FB8A 1H4LA 1PMVA 1EH4A 5M53A 1OMWA 3CY3A 3P86A 2OU7A 1Q8TA 3TI1A 4IADA 4CCBA 3C4ZA 4MHAA 2WQEA 3FHIA 3IONA 5EW3A 5H8GA 4PUZA 4CFNA 4GG7A 2PZYA 2QI8A 5DGZA 2JEDA 3AD5A 3S1HA 4ZMEA 1PXLA 4EHVA 1PF8A 1E1XA 3QF9A 4IVDA 1UWHA 5F4NA 5FXSA 4EUUA 1Z9XA 3LFCA 4H3PA 5JSMA 3FLQA 3IGOA 3IKAA 4GYGA 3UBDA 2W99B 2I0HA 3DXQA 4M69B 3NYNA 3MIYA 1GZNA 1IEPA 2YIWA 5M09A 3ATTA 4OTRA 3EN6A 4Q5HA 5HEZA 1H24A 4BGHA 4U43A 4IAFA 5DEYA 2REIA 3RAWA 2J5EA 2ONLA 4FUYA 3OOMA 4QNYA 4CT1A 4F1TA 4DTBA 2ZM3A 2Q0NA 3IDPA 5GJDA 3DDQA 4KIPA 4FG8A 4XNEA 4MVFA 4GS6A 3CY2A 2GTNA 3KU2A 4YLKA 4AE9A 2A27A 4MD8E 4Y8DA 4EKLA 2BRBA 3TDWA 4E93A 4FKJA 2A1AB 4R3RA 3WZUA 4DBXA 3ZLXA 5A14A 3EQCA 4ZP5A 4M97A 5C8KA 2WGJA 3HAVA 3AMAA 4JJRA 2PMNX 4ITIA 2QKWB 4MQ1A 5KHXA 5HESA 1MQBA 3F88A 3U9CA 4DEGA 4OAVB 3LLTA 1OM1A 3O50A 4FV6A 5IA0A 4KS8A 5TE0A 3ENMA 5EYCA 3D7TB 4UALA 3V8SA 5CSWA 4I5CA 4FK6A 3BYUA 1UA2A 4JQ7A 5JRQA 5EDPA 4FVRA 4PDYA 4DEIA 4ZS4A 3R8MA 3DXPA 4QYYA 3ZYAA 2W9FB 3EOCA 1PKDA 4FSWA 2PWLA 4W4VA 1WVWA 2OXXA 3P08A 5AUYA 4N6ZA 3PXQA 3QKMA 4D28A 2W1ZA 3M1SA 4G9CA 2B55A 3R7YA 3G0FA 1M7QA 3OG7A 3LCTA 3FMJA 3OWLA 3C4XA 4FTAA 3HA6A 3M42A 4FSNA 2JIVA 1W8CA 3L1SA 3R21A 4F64A 4ZTMA 1GOLA 5JFVA 2RFDA 2PE2A 3DKFA 1XH5A 3G33A 3P79A 3KXGA 2W4JA 2UW8A 4RMZA 3HRFA 4BTMA 4D2RA 2ONLC 3L9MA 3FXZA 3AC2A 3KF4A 2OXYA 4EL9A 2WOUA 4A06A 1SVHA 3ZBXA 2C30A 4IANA 3DBEA 4H1MA 3EQDA 4R8QA 4N6YA 4ZAUA 3DKCA 4YJQA 4Q9SA 1JSUA 2EXEA 3O96A 2JKQA 4D4RA 3B2WA 2VV9A 4UMPA 2BCJA 4NCTA 3HAMA 4NWMA 2VD5A 4G6NA 1RJBA 2XA4A 2ZMDA 1WCCA 1CKIA 4QQJA 5CT7A 3NNUA 2GNHA 1BI8A 3PSDA 1QMZA 5DEWA 3UIBA 2ZOQA 3AMYA 5ANIA 4ZS0A 4CFWA 3NAXA 5IEXA 2R7IA 5GZAA 3GCPA 4JNWA 3GC7A 4TL0A 3FI3A 3PG1A 4IC7A 4UB7A 3RWPA 1GZ8A 4BCHA 5DT3A 4YU2A 5CAOA 1UNHA 5H9BA 4UXQA 4CYIA 3KN5A 2F4JA 5EYMA 3SA0A 2PUUA 3ODZX 5GHVA 3COKA 3QCQA 5I9ZA 4EONA 4JXFA 2R0UA 2Y9QA 3KCKA 4D2VA 5TKDA 3DY7A 4NJ3A 4QMPA 5CVFA 3F69A 4EC9A 5ETAA 4PX6A 5CF5A 3A7JA 3KRJA 3WF8A 3WYYA 3KMWA 3MH3A 4CZTA 1VZOA 2AC3A 1ZMWA 1YWRA 3BBTB 1OGUA 4C3RA 4AOIA 1UNGA 2FUMA 3LCSA 1G5SA 3OW4A 5E1EA 3H9FA 3RPOA 4D2TA 5BMMA 3BRBA 5TF9A 4KKGA 3W2PA 1R1WA 4BRXA 4CNHA 4DEAA 3DKGA 4F7JA 3WF9A 2W06A 2ITVA 4KIQA 3T3VA 3BELA 2HWPA 4M13A 2X39A 2P4IA 3GCSA 4DH5A 2YDJA 2C6MA 2IWIA 4NCTC 4YPSA 1DI9A 3JY9A 3PRIA 4IAKA 2XKFA 5CU4A 4RJ7A 4RX9A 4HVHA 2YCQA 4DBNA 5AA8A 4WD5A 1RW8A 3UO5A 4L7SA 4FNZA 4MXZA 2PE0A 4LG4A 4N0SA 3BHTA 5DRBA 5DR2A 5HHWA 1DAYA 4BCGA 3WE4A 3GNIB 4NYEA 3NUPA 5CNOA 4BCNA 2YACA 2YWPA 3G0EA 2CNVA 3SGCA 4OAUC 4R7BA 1OKWA 2WQMA 3C7QA 5EDRA 5DIAA 5AFVA 2CJMA 2P3GX 1KOAA 3PPZA 4ERKA 5CAUA 3BX5A 4FV1A 1J7UA 4WNOA 3AT4A 1ZY4A 4LFIA 4PP7A 1O6KA 3CIKA 3OCBA 3NW5A 4TKSA 4U3YA 3I7BA 5HBHA 1B38A 4ZSAA 3I6UA 3MY5A 5HLWA 4I6QA 3R1SA 1PYXA 4F4PA 3PA3A 5A9UA 1ZYSA 2XK9A 3LMIA 2JFLA 4X3FA 5IQAA 2C0TA 5JZJA 3SXSA 1ZYJA 2ZM4A 3IW6A 3ULZA 4BWKA 5CSPA 4CZYB 5L2SA 3RNIA 1Y6AA 3HV7A 4W4WA 2ITXA 4G3FA 4BFMA 4WSQA 3R9RA 4A9TA 4GRBA 4BKZA 1FOTA 3RHXA 5EHLA 3V6RA 3PUPA 2QG7A 3FI8A 2OW3A 4IM0A 4RGJA 4CFMA 4NIFB 3QD2B 4LRMA 4D4SA 4C4IA 2GQGA 4GUBA 4EZ3A 5LARA 5I9YA 5ICPA 5E8SA 3ZC6A 4OT5A 4HGEA 2CNQA 3RPYA 3BKBA 4B8MA 3I60A 2FSLX 3GC8A 5JGDA 1XBBA 2UZVA 2JLDA 4CV9A 4D58A 3DPKA 2QD9A 1YHWA 1SVEA 3VRZA 3QQJA 4BZNA 4OTDA 3LCKA 3GT8A 1XH7A 5HCXA 3CKXA 1P4FA 4KABA 4WNKA 2WQBA 2WTKC 3DNDA 4M66A 5AR8A 3ALOA 3RVGA 3V5PA 3RMFA 3WZJA 4DG3E 4FV2A 3ZLWA 4ORKA 3IW5A 2WMBA 4IVBA 3DDPA 1M17A 2GS7A 4E6CA 4QTEA 3PY1A 3RK5A 5L3AA 2QOQA 1BI7A 4EOIA 5JFSA 3E5AA 2CSNA 2XNPA 4X3FC 3E93A 3FE3A 3MJ2A 1H1QA 4CTCA 3GXLA 3LHJA 4CGAA 2C5VA 3LFEA 4IJ9A 1URCA 3SOAA 5LWNA 4XV9A 2QURA 3UG1A 1U46A 3VNTA 3ORPA 3DS6A 3KFAA 3QTQA 3ZSGA 2WMXA 4IMYA 2DYLA 4TY1A 3VJNA 3NNVA 3ENHA 3ZFYA 5EYDA 5CTPA 5CF4A 5J5SA 3N9XA 3SHEA 2CCHA 3FJQE 2ZV7A 3QKLA 2J7TA 1OIRA 4E1ZA 3LCOA 1FVVA 4QMVA 4IWPA 5KCVA 4H58A 4U6RA 5HLPA 5HG5A 5H8EA 4YURA 5IQCA 3PG3A 1MRVA 5C4KA 5AV2A 4FGBA 3R7EA 4G3GA 4TYHB 5D1JA 4DFNA 5CASA 5IUHA 3P1AA 2UW7A 4HCTA 4YSMA 5HCYA 3UZTA 4JT3A 3MGYA 4F7SA 4BHNA 2HW7A 4DEEA 4XG7A 3CJFA 3TTJA 4YJTA 3WE8A 3MI9A 4IZ7A 2HENA 3EWHA 2W4KA 4XMOA 5KKRC 4USEA 3QQKA 4FSUA 5E7RA 1SZMA 3L8XA 1REJA 2AUHA 4ZTRA 5C27A 2HOGA 2XNEA 1PHKA 2BRHA 2ETRA 3Q2JA 3UC4A 4J95A 3KF7A 3NUSA 3O23A 3ZM9A 4QMYA 3HVCA 4BCPA 4A9SA 4O0UA 3VS5A 4F9YA 2UZDA 4KKHA 5K4JA 2CNUA 2WU6A 3IOKA 2H9VA 5CWZA 2VTQA 5EFQA 3PJ1A 4QO9A 1YW2A 3T3UA 2G2IA 1OL2A 3ZEWA 4D0WA 3KY2A 3E8DA 5I3RA 4H1JA 4F7LA 5FRIA 2LAVA 3QAME 2BIKB 4XG2A 3QKKA 5CSXA 3AT3A 3I1AA 4I5PA 4LV5A 2PPQA 3H0YA 3QTRA 4K11A 3RK9A 1H1SA 4EH9A 4TT7A 5F9EA 4XH6A 5D7VA 4B0GA 3FWQA 4P90A 4C7TA 3DU8A 4M14A 4PY1A 4F65A 3L8PA 1JBPE 5D10A 1YWVA 3S00A 1HCKA 3VUGA 2E9PA 2EB3A 4E6AA 2C6TA 2JAVA 2CGUA 3JUHA 4QMUA 3PDTA 3VS1A 1CSNA 4KBKA 3GU8A 5AUVA 5CEMA 4B4LA 2B53A 3QTSA 4FL3A 3I4BA 2RFSA 3D9VA 2BDFA 2IJMA 4L68A 3PVWA 4YTHA 3UIUA 2I1MA 3PVUA 4OUCA 5CXHA 3HUCA 4KA3A 4PMPA 2C5NA 5AR2A 2ITUA 4I6BA 4OBOA 4WT6A 5IH6A 1XBCA 3G15A 4X2FA 5ITAA 2FSMX 2UV2A 2UZBA 3R1NA 3QD4A 2VX0A 3ZRMA 3PVGA 3H9RA 4H39A 4K77A 3GFWA 4S32A 5AAFA 4IAAA 4AZFA 4TRLA 5AP6A 5H8BA 2BAJA 2B52A 2Y0AA 2HIWA 4MXOA 4G34A 4PV0A 5F95A 4F7NA 5B2MA 4GKHA 4GK4A 4QMOA 5ACBC 2W1FA 3MPAA 3QCSA 3E92A 4GK3A 4GVJA 4TWOA 3UOKA 3OY1A 2VX1A 5HIDA 5CZIA 3WF6A 4BDCA 2C1AA 2WTCA 3NUYA 3Q4TA 4MF1A 4RPVA 4YPDA 4HNIA 3ROYA 2HXLA 4RA5A 3BYVA 4FSTA 4AGDA 2YDIA 3TDVA 4GK2A 2BR1A 4Y46A 3W55A 3KULA 3S4QA 3F3TA 4BGGA 2R3GA 4GFMA 4W4XA 3TN8A 3D14A 3EB0A 3GVUA 2UW6A 1ZZ2A 3DBQA 4X2KA 3U87A 4K0YA 4FZDB 1B6CB 2E9OA 4GFOA 3HMMA 4XG6A 3CGFA 2A19B 3V5LA 4KINA 1W0XC 4EOSA 1NXKA 4FV9A 3OOGA 4LI5A 5K0XA 3I5NA 5L6WL 4FV5A 2OZAB 3EZRA 3RCJA 3BQCA 4CKRA 4O96A 4XOZA 3A7GA 2H34A 1OI9A 4YHJA 1NT2A 3UOLA 2XH5A 2HZ0A 2X6EA 4E5WA 5DMZA 2XNGA 2YIYA 4QP1A 1U59A 4RFMA 1YOLA 2WZJA 3LQ8A 3VUDA 5CALA 3QGWA 3LMHA 2B0QA 2QONA 2WEVA 1W82A 1YXUA 2R3KA 2Y7JA 3JXWA 4FIIA 3ZFMA 3R8PA 2PU8A 3SW4A 4A9RA 5IU2A 5GINE 4FKUA 3D15A 3LE6A 3FEGA 4CG8A 2F7XE 4RC4A 1CDKA 2GS2A 3Q32A 4M0ZA 5LMKA 3G51A 3W2OA 3MS9A 4QMTA 2WTDA 3CD8A 5AP4A 1NW1A 4OT6A 5E8YA 3EYHA 3HV6A 2JBPA 3B8RA 1P4OA 2PZIA 4EOQA 3TZMA 3ACJA 3QX2A 4I92A 4JDIA 2GPHA 4BWXA 4L3JA 1WFCA 5JN2A 2BDJA 3CE3A 4X3JA 4OLIA 4F6WA 2JDVA 2Z7LA 1Z57A 3KXHA 2Z7QA 3KGAA 4JAIA 3FQHA 3ZSIA 5B2LA 5LCJA 4CMUA 4FTRA 4FTMA 1AD5A 3CBLA 2UW3A 3ZO4A 5CVHA 2EB2A 3Q9ZA 4GL9A 3ZXTA 5EQEA 4E4MA 2V7OA 3GQIA 1FVTA 4BL1A 3ANQA 4JQ8A 4OTPA 4FG7A 2XNMA 3ORTA 5FTGA 1P14A 1PMUA 3PP0A 4CG9A 3UYTA 1WMKA 2CKEA 4XG8A 5I9UA 4BC6A 5IQEA 3G9LX 3LFNA 4HGLA 3HEGA 4ASZA 4LRJA 4QTBA 2VTHA 4LUEA 1XQZA 2ITOA 2P0CA 2UW0A 2W5HA 3BHUA 3V04A 3BGZA 1XR1A 4ID7A 2BMCA 2WHBA 5BYLA 1UU9A 3HV4A 4UWCA 5LMKC 4D5HA 4RVKA 3FI4A 3EKNA 1ZWSA 2PY3A 2R4BA 3Q3BA 4BDFA 2HWOA 5HO8A 1OL7A 2XKEA 4OTGA 4K2RA 1CMKE 3VIDA 3AC8A 3BWJA 3FMNA 4I0SA 4X6RA 2HK5A 4HGTA 5HICA 3OUNB 4EI4A 3OBJA 3QALE 4A4LA 4NJDA 4XLIA 4ZTLA 1SMHA 4S33A 3VUKA 4W4YA 4EBVA 3BQRA 4I41A 4TPTA 3F2AA 2CN8A 2OJ9A 2IVVA 3S95A 3EQGA 4I5HA 4HCVA 3THBA 2JC6A 5DWRA 5E9EA 5GZ8A 2JKOA 3L9NA 4H05A 4NU1A 4R7HA 5LVOA 4G6OA 2W7XA 2VZ6A 4KNBA 4MWHA 4PDOA 4XS2A 3R9DA 4IB0A 4O83A 2VWVA 3QQHA 3EL8A 4MCVA 5CU0A 4CLJA 4QMNA 4LOOA 4IQ6A 3KXXA 2X7OA 4RBLA 1SM2A 5DA3A 3EFWA 5IH4A 2X8DA 5A4EA 3C9WA 5TO8A 5C01A 4KBAA 4MXYA 4R1VA 4E4XA 2JITA 4EK6A 5IQFA 4OGRA 3HV5A 4KSQA 4QP3A 4YO6A 1OPLA 2XYUA 4ZIMA 3KKVA 4ZTQA 1XO2B 5AV0A 3FLNC 2F2UA 3MA6A 4FSYA 4KRDA 1H25A 3WBLA 5IA2A 3UQCA 2QCSA 5EOLA 2I7QA 3N4TA 1Z5MA 3DAKA 1UWJA 3JYAA 3EYGA 1ZOEA 4XG4A 4E4LA 1JQHA 3HZTA 3NUXA 1WBTA 5EG3A 2W1GA 5IKWA 3G90X 2UZUE 3NPCA 1F3MC 2CDZA 2ESMA 3ORXA 4ACMA 1REKA 4C02A 5EQPA 3P5KA 4QQ5A 3I79A 3K3JA 5EKOA 1A48A 5JRSA 5HTCA 4WG3A 3K5VA 4ARKA 3CTHA 4BBMA 3DA6A 4GJ2A 5HG8A 2QR7A 4BY9E 2O5KA 3CKWA 3ZFXA 4EH3A 4FZAB 4DT9A 2GFCA 4E4NA 1RDQE 3R02A 4DG0E 5M08A 4EUTA 4IJPA 1CKJA 2BHEA 3R6XA 4O91A 5FBOA 1FGKA 5AJQA 3QGYA 3BYMA 3TV7A 3Q2MA 3VW6A 3POOA 4B6LA 4KUJA 1GIJA 2B1PA 2QHNA 3MSSA 3RK7A 2RFNA 2YEXA 4DEBA 4AGCA 4EOMA 4L3PA 2B7AA 3R9OA 3EQRA 4LOPA 1CM8A 2BIYA 1YHSA 3EN7A 5CU2A 4KIKB 3OW3A 3ZRLA 2Y4IB 3MDYA 3ZM4A 5GIPE 5DI1A 4QMLA 4R1YA 4E7WA 1H0VA 1H07A 4O1PA 1U54B 1V0PA 2ZYBA 1VR2A 1RQQA 4MD9E 4NH1A 2HZIA 1LEZA 4BZDA 3D2IA 5HE3A 2V5QA 3PTGA 4BDDA 4S34A 2F49A 3U6HA 2C6DA 3CJGA 3FXWA 3LFAA 5C9CA 4B7TA 2YLEA 4K18A 3G6HA 5I0BA 5L8JA 3RAKA 5CF6A 3Q6UA 4ZY6A 3KEXA 4BTFA 2VTRA 2W17A 4FKSA 4O1OA 2OO8X 3OVVA 4J52A 3KK9A 4C4HA 3PLAE 3QRUA 2B4SB 3QBNA 3CLYA 3O7LB 3KC3A 3R1YA 1ZYCA 5AIKA 5EH0A 3WIKA 5M4IA 4ZK5A 2OFUA 1V0OA 3NX8A 1YWNA 4FOBA 3VS3A 3W8QA 3PVBA 1YI6A 2YIQA 2IN6A 2O0UA 1T46A 2IVSA 4H36A 4JBQA 5C26A 2JDOA 3R04A 4X6QC 4XX9A 4C58A 4D9TA 3HNGA 4MBJA 3C1XA 5CANA 3ZH8A 4BR3A 2QO9A 3UMXA 4WHZA 3GUBA 4OBQA 4FIFA 3G6GA 2XBJA 3AD4A 2IW9A 2CLXA 5FEQA 4DITA 3BE2A 4I6HA 5DT4A 3UC3A 2O8YA 5IA3A 1BKXA 4UEUA 4I5MA 5AMNA 3UOJA 4FGRA 3EMGA 4FZ7A 4MKCA 3FPMA 4V0GB 5J5TA 2YDKA 4HZSA 4AN3A 2ITYA 5FBNC 4DH3A 4D2SA 4FT0A 4NM0A 3N51A 3QU0A 4DT8A 4ONAA 5HE1A 2KTYA 3BBWA 2IZSA 4XBUA 1XH8A 4YTIA 3GFEA 5BNJA 4MNFA 3U6JA 5IISA 4YNOA 4JS8A 2A0CX 4BBEA 2X4FA 5CAQA 4LGHA 4ZJVA 4O0SA 2WTWA 2Y6MA 4Z3VA 3QL8A 4XP0A 3CTQA 3ATSA 3TNIA 4CCUA 3BHVA 2SRCA 5C8MA 1OKVA 1GJOA 3BPRA 3HL7A 3L8VA 3VS4A 4BIDA 4C2VA 4PRJA 5EI8A 4RIYA 2O3PA 3HMOA 3FHRA 4UZHA 2VTJA 4RIWA 4ITHA 3MH0A 4CQEA 1H26A 3I6WA 3SRVB 3QHWA 2YCFA 4S2ZA 4AWIA 3NAYA 3C4FA 3DKOA 4TYEA 3MY1A 4WUNA 5AAEA 2BZKB 4PNIA 4AQCA 3PXFA 4PWNA 2FH9A 3NMUF 2YABA 3KK8A 4R77A 4Y85A 3ID6C 3HV3A 4AOTA 2QU5A 4PPBA 3COHA 2V22A 3ZLYA 4UMRA 2IZTA 5AP1A 4TZRA 1KV1A 5HTBA 3SV0A 3R7GA 3E87A 2C68A 2PZPA 2CCIA 3R7IA 4IWDA 3CEKA 3PJCA 4RQVA 4AZVA 5AV1A 3C4WA 4F09A 5IF1A 5BVWA 3KMUA 3CQUA 2IVTA 2I0YA 2BROA 2C3JA 4EK8A 4F1OA 1XJDA 5IQHA 2EU9A 2NO3A 4G1WA 5ETCA 3JVSA 3LW0A 2J0MB 2IZRA 3A61A 1QCFA 2J2IB 3O71A 5M06A 1XH9A 4R6VA 3BV3A 4O7TA 4FC0A 2CHLA 3KA0A 4WBBB 4FMQA 2Z2WA 2ZMCA 2X0GA 5L8KA 3ZCLA 2BHHA 3QLFA 4QYFA 5HVKA 5LMBA 1VYWA 5AADA 5HVJA 4E6DA 2JD5A 2WMUA 1WVYA 2O65A 3BU5A 3D5XA 1U5QA 2C0OA 3F2NA 4QP7A 3E62A 1Q8ZA 2ZJWA 5HBJA 4RC2A 2G1TA 4NKSA 3RI1A 3PXRA 3QRJA 3QRTA 3TUCA 3TNQB 3LZBA 5AUUA 3ZZWA 3W2SA 4XRJA 4M7IA 4FKRA 5A4CA 1J1BA 3QZHA 3FL5A 2W9ZB 3IW8A 2PMOX 3AG9A 4PMTA 3ZDIA 4EOKA 4QMSA 3TWJA 4WNMA 3QTWA 4IHPA 3S3IA 3BYOA 4IVAA 4Q9ZA 2XK7A 2X7GA 3LIJA 3MFRA 5HI2A 4A4XA 4FBXA 4RX5A 4ZLZA 3HP5A 4BI2A 3OD6X 2YCSA 4F9WA 4FTOA 5KZ0A 2ITNA 2HZ4A 2IW6A 5BVNA 5L2IA 5DVRA 3DTCA 4JL9A 5F20A 3EFKA 4L44A 2PYWA 2WFYA 3C5UA 3MB7A 4F0GA 3ZRKA 3Q5ZA 3EKKA 4D55A 3NIZA 4MYGA 2ITPA 4C3FA 4K1BA 2WMVA 2BVAA 2QU6A 1K2PA 4MNEB 4TYIA 5HORA 3LVPA 3OXZA 2YERA 3GU4A 3QA8A 3CQWA 5AP2A 5A4QA 4CMOA 2RF9A 4TYGA 2GFSA 4RX8A 3RPSA 2OKRA 2GHGA 4BCIA 4O7NA 3PJ3A 4EK5A 2VX3A 4MXCA 3OBGA 5ANDA 4E73A 5FD2A 4C3PA 3ZO2A 4FG9A 3R7UA 1ZMUA 3WARA 4DH1A 4AFJA 2DQ7X 1TKIA 4FNWA 4RIXA 4YHTA 5ANKA 3DFCB 1AQ1A 1CKPA 3E63A 3VW8A 2CMWA 2ZDTA 3OY3A 1OUYA 2F57A 4U97A 2QOHA 1U5RA 3QWKA 4YJRA 3SC1A 3PXYA 4K33A 4QYHA 1IASA 5AM6A 1P2AA 3LM0A 4KAOA 3F5PA 5CI6A 3UYSA 5FG8A 4JBOA 4EOJA 4CZUA 5BVFA 2XK8A 2JDTA 3V51A 3F5XA 3ORIA 4ANSA 5L8LA 3GOPA 2QOFA 4U5JA 2E9UA 4LGDA 3K2LA 3KRLA 4FEWA 3FI2A 4CMTA 3R83A 1FMOE 4F9BA 5I3OA 4BDGA 1JNKA 4K8AA 1DS5A 5C1QB 2VTAA 5J87A 1O6LA 3KXMA 2VO6A 1M7NA 5BYZA 5CQWA 2XNOA 3IG7A 4CXAA 5BUJA 1NVSA 1QL6A 4ASXA 4N57A 3W18A 1OIUA 4L01A 3ZZEA 2YWVA 1F0QA 4RC3A 5E8XA 3E7OA 4LL5A 4U45A 1M2RA 3Q4CA 5ANGA 2WTIA 1UU3A 3NS9A 1UVRA 3W32A 1QPCA 4DHFA 4FTIA 4G9RA 3Q4UA 3W16A 3ZLSA 1PMEA 3D2KA 3H10A 5KMIA 4UMQA 2OFVA 3QXOA 3NCZA 4M3QA 4AZSA 4FVPA 4J7BA 4D4YA 3FV8A 5M55A 2PSQA 2P55A 2I6LA 3LFSA 1R0PA 3OXTA 4D4VA 4O7VA 2ITQA 3QRIA 4O7SA 1Q61A 5HX6A 3C13A 4K6ZA 3RAIA 2BDWA 4GIIA 3UQGA 1PXPA 2QODA 2OSCA 3OCTA 3FL4A 3HLLA 5HTIA 3R9NA 3O2MA 4BHZA 2WMWA 2VWZA 4QP4A 2C6EA 4JDKA 1YXVA 5I4NA 3MH1A 4QP8A 5HNBA 4U44A 3WZKA 2XIKA 3OF0A 4V05A 4C4GA 3QYZA 4M67A 2ERZE 4FKLA 3RZFA 1Q24A 4AW0A 4BCQA 3HX4A 4XV3A 5HIEA 3GB2A 3FMLA 3NRMA 5J7BA 3BE9A 4GG5A 4QD6A 2J9MA 5A54A 2YM3A 2VTNA 2QOKA 3DJ5A 4C8BA 5BQ0A 2Z60A 4DGNA 3F3ZA 3EQPA 3RKBA 1Q5KA 4YJNA 3EN4A 1S9JA 2JKMA 4AX8A 3UE4A 5G1XA 1XH6A 5CYIA 3SOCA 4EWQA 2OBJA 3SD0A 3I81A 4YSJA 1OL1A 2ETMA 3DJ6A 5FTOA 2GTMA 4DFUA 4HOKA 3QTIA 4CRSA 2RFEA 1JKKA 3PE1A 3SXRA 3BU3A 4D1ZA 4DG2E 4CQGA 3A2CA 3DB6A 5HG9A 3Q60A 4F9AA 3UG2A 4Q2AA 3Q9YA 5DFPA 4RWIA 2ZM1A 1ZOGA 4IX5A 2HELA 4ZZMA 2UZLA 5LCKA 2R9SA 3DK6A 3Q5IA 4C38A 5A4LA 4ZMFA 1ZY5A 3G5DA 4NW5A 2OG8A 4IC8A 4X2JA 3ZU7A 2IPXA 3OS3A 4AUAA 4LGGA 3ORLA 5EQYA 4DAWA 3KRXA 3OUKA 4UWBA 4FV8A 2Y4PA 4BCOA 1ZARA 3ORNA 3ULIA 3VAPA 2YM7A 4TN6A 2NRUA 3O51A 5AA9A 2R3RA 2EXMA 2Z7RA 1YI4A 4NK9A 5EW8A 4OTWA 3V01A 3ZONA 4DTAA 3OROA 4C36A 5JT2A 4FKIA 3AGLA 3KMMA 4YGAA 3DXNA 1JSVA 3VQUA 4UV0A 4F63A 4NFMA 2GQSA 3V8WA 4ZY5A 5IA5A 3CP9A 5AUTA 3NUNA 5KNJA 5IDNA 4LM5A 1OBGA 3MVHA 4ZLYA 4RJ5A 2VNYA
chains in the Genus database with same CATH superfamily
1TFFA 3BV2A 2UVZA 1A06A 4G3EA 4KB8A 1LUFA 4L52A 5T3QA 3R8LA 5FDPA 2PULA 2JIIA 2O63A 1KSWA 3OEFX 4EK3A 1IA9A 4FEXA 3D5VA 4JR3A 3U54A 3TACA 3PSBA 4O7LA 4YBJA 4BDAA 4JBVA 3BWFA 4II5A 4QMMA 5M4CA 4KKEA 3BIZA 3B2TA 3Q53A 4XV1A 4QP9A 5K3YA 5HNIX 1GZKA 3Q9XA 2J50A 3EN5A 2UW5A 4V01A 4NEUA 4FKQA 3AQVA 3T9TA 3HP2A 5ACKA 4JR7A 3OCGA 3FLYA 5KMOA 3O8UA 4FEQA 1B39A 2ZAZA 3AGMA 4IE9A 4PL5A 3ZTXA 3ZO1A 2HCKA 5HVYA 5HLNA 5BUEA 5AUXA 4I4FA 4AZEA 2G9XA 4C0TA 4AXAA 4DHJA 2PVLA 3DK7A 4FTNA 4GUEA 3KCFA 3UZPA 1JOWB 1Q8WA 4AP7A 4GT5A 3VULA 1GIHA 3EFJA 3TNPC 2PZ5A 2PVNA 4FI1A 4QP2A 4ZTNA 5A6NA 4ASEA 4XRLA 4NM5A 3DBDA 5HD4A 3ROCA 4U41A 5DE2A 2Z02A 4DFZE 3VJOA 3Q4ZA 2FA2A 1KE8A 4WRSA 3MPMA 2QQ7A 3KRWA 4ACGA 2X7FA 2VTLA 4U3ZA 4ZTSA 1Y57A 5EHOA 4ZTHA 2HXQA 4BCKA 4TYJA 4PPCA 5JK3A 2KULA 4PPAA 3VN9A 3PY3A 1YHVA 2Z7SA 5J95A 5JEBA 4RJ4A 5GZ9A 2X2LA 4XJ0A 5L2QA 5IMEA 2YITA 5KO1A 3Q52A 4JI9A 4YUQA 4L45A 4Y95A 3V5WA 5LJJA 4M69A 3TUDA 1G8SA 4O7RA 3TV4A 4WOVA 5BMSA 4APPA 1Q8YA 4ANNA 4O0XA 4O38A 2J51A 5ANJA 5CSVA 5CS6A 5J8IA 3ZBFA 4MXAA 4NUSA 5HU3A 2YA9A 2X6DA 4G5JA 1I09A 2YJSA 2OJJA 3RTPA 5AR3A 2VNWA 2R3OA 3FBVA 3LAUA 5E91A 5J9YA 5GIOE 3R0TA 2WB8A 3TKUA 4FOCA 5AV3A 2UUEA 5EHYA 3W10A 4RLLA 2W05A 4FJVA 1XHAA 3CSVA 4FTQA 3ZO3A 3R8UA 4UBAA 4MD7E 4JBPA 4IAIA 2YAKA 4RJ6A 4IAYA 3RJCA 4HVDA 5KUPA 3VUMA 4QTAA 1BUHA 4QPMA 4ANOA 2YZLA 3BI6A 3DQWA 4ZSLA 3VBYA 3VHKA 2PVJA 4DC2A 5M57A 3FKOA 3RP9A 5BVDA 2YCRA 3PA4A 4K9YA 4UMUA 2J6MA 5AEPA 3AC4A 4IB1A 4FE2A 4XOYA 5HE0A 3D7TA 2YIRA 4FVQA 3KVWA 5CI7A 2OZOA 2XIRA 3BGQA 1M2PA 4BCMA 4L53A 1Q8UA 4XP2A 1QPDA 1E9HA 3NVKI 3DGKA 2XJ0A 2DWBA 3BLQA 3T8OA 4EBWA 5I9WA 5FWKK 3RWQA 3W2QA 3M11A 2FSOX 2BUJA 1FQ1B 3VF9A 4PTGA 3IK3A 4YJSA 4PTEA 1M52A 4O27B 4YTCA 1YDRE 4P4CA 2WTJA 4KD1A 2GQRA 2W1EA 2EUFB 2I0EA 1YI3A 4C34A 1ZZLA 3TUBA 5AV4A 4QNAA 5IZFA 2XK6A 5AIRA 2CGWA 5FLFA 3GU6A 1UKHA 4UN0C 1R3CA 2UVXA 2ZB0A 4OTHA 5EM7A 4EH8A 4MTAA 3TT0A 4MBIA 4AN2A 3UQFA 3BCEA 5E8WA 4DE4A 1Q97A 4XV2A 2PVHA 4ZSEA 3NYXA 4CT2A 5EOBA 5M4FA 2PL0A 1BLXA 2X9FA 5IUGA 3OTUA 3WOWA 4IX6A 3PIYA 3MJ1A 5KHWA 2X2KA 4AGWA 3B8QA 5CEOA 4NM7A 1Q3DA 4JOAA 1LEWA 3CQEA 4QQCA 3GGFA 3TZ9A 5CXZA 3W33A 1UKIA 2VU3A 4J99A 3IDBA 4BN1A 4O86A 2WOTA 3COIA 5KMMA 5M4UA 1KE5A 3BHHA 3PRFA 4GH2A 4EJ7A 3I7CA 2C69A 2WXVA 5JQ5A 3NW6A 1BMKA 4GV1A 3RZBA 4F0FA 2CKOA 2WTKB 3L9PA 3FPQA 4CFVA 4ZZOA 3LQ3A 1PYEA 1Q41A 3LQ5A 4D2WA 4RZWA 3FZPA 5JKGA 2BKKA 5ANOA 5CEKA 3PE2A 2NP8A 2OK1A 4IX3A 5IQBA 2WO6A 3U9NA 4DN5A 4AE6A 3R63A 4TXCA 3GCVA 4EH4A 2DUVA 4QMXA 1K9AA 2R3LA 2B9FA 3QYWA 4X3FB 4YP8A 3PP1A 3UPXA 1J3HA 2YM5A 4YTFA 1RE8A 3DT1A 2A98A 1WBNA 4TNDA 2PMLX 2X2MA 5HO6A 3EQFA 2YFXA 2JKKA 3OFMA 4IB5A 2Y8OA 4FKPA 4YHFA 4DTKA 4ZY4A 2XK3A 4TTHB 4BDIA 5LVLA 3NSZA 3R8ZA 4FODA 1J7LA 4G31A 1FGIA 3A60A 4QTCA 3EQBA 2C6OA 3FMHA 3LXKA 3ZHPC 3VONA 2R3MA 3PXKA 2ZV2A 2JAMA 3PA5A 3ZUTA 4C4FA 4AF3A 3FY2A 4HVIA 1VEBA 3FC2A 1SNXA 4FX3A 2BRGA 2JDRA 3IW4A 4CEGA 4JMQA 3PZEA 4UXLA 4HCUA 4R5SA 1KE6A 2GU8A 4FSRA 4USDA 3DNEA 5HOAA 3DV3A 2H96A 2C5YA 2W5BA 4RWLA 4Y5QA 2XJ1A 1FMKA 2ACXA 3DCVA 2X8EA 1GIIA 1URWA 2WU7A 4QT1A 2R7BA 3JR1A 2QVSE 3UDSA 2PZRA 3I0QA 5CEIA 4YZDA 4JIAA 1STCE 3MH2A 3PY0A 3UVRA 4PQNA 5IQGA 3O0GA 4FIEA 5KKRB 2VAGA 4R3PA 3W1FA 5G6VA 3PXZA 4QRCA 3DQXA 1Q62A 1FVRA 4G5PA 4V04A 4QDVA 2FVDA 2H8HA 2VO0A 5AM7A 3K54A 3NCGA 5BYYA 3QTUA 2XM9A 3P7AA 2ERKA 3TKIA 2B9JA 3PYYA 3QHRA 4PMSA 3TL8A 4FV7A 3TNWA 2BTSA 3OWJA 3IO7A 5IDPA 1H1PA 3HMNA 4RX7A 4WUAA 1Y8GA 2XNBA 1DAWA 3EQHA 5EM5A 4CVAA 3FKLA 4EQUA 2G2HA 1M2QA 3ZSHA 2XRWA 4Z9LA 4C37A 4U80A 3FDNA 3RHKA 2PVMA 4TWNA 4KIOA 3R01A 2C6LA 4MK0A 4I6LA 4NL0A 1IA8A 3A4OX 4MBLA 4XHKB 4HVSA 4G6LA 3LOKA 1K3AA 4GJ3A 4YNEA 4FNXA 5B7VA 3MVJA 4HGSA 4JQEA 4NIFA 4CTBA 2XIYA 5HNGA 1I44A 3UTOA 3F3WA 3C4CA 3UNKA 3WIGA 4PDPA 1YQJA 2GNFA 4FKVA 2FYSA 4F08A 4EYMA 4E26A 4QMZA 1FBNA 3BLRA 5BPYA 2CGXA 2PUIA 4EHEA 4JIKA 4YBKA 4UWYA 2UW9A 2VGOA 4YO4A 3F6XA 2GNLA 4I21A 2XCKA 2NNWB 1KV2A 3QCXA 4IAZA 3NNXA 4ZSJA 2A2AA 3GCUA 3UODA 2VO3A 3ERKA 3L9LA 1H1RA 1WVXA 4L6QA 5DRDA 3VBXA 3PWDA 2VN9A 3EFLA 4ALWA 1PXNA 4FT7A 4NT4A 1JVPP 1QPJA 4GT4A 4J71A 2GSFA 1SNUA 5BVKA 5FGKA 5JH6A 4BDKA 2GS6A 2EWAA 4IW0A 5K9IA 1NA7A 2ITWA 4FIHA 4ALVA 3ANRA 3FLSA 4HPUE 4LMUA 4MAOA 5E8TA 4ACHA 4BTKA 2VWYA 3GQLA 4G2FA 1PXKA 2VUWA 2P2HA 4WBOA 4C35A 5LQFA 1PRYA 2XKDA 3HMIA 4IB3A 2OXDA 4UY9A 4E20A 5HQ0A 1OBDA 3C0IA 3MW1A 2R2PA 3V8TA 3ALNA 3D5WA 4GMYA 3KQ7A 3ZMMA 4LDTA 1DI8A 4JG8A 4BWPA 2R5TA 5I5ZA 4JX7A 3V6SA 3EZVA 4BDBA 3FAAA 1MQ4A 3TM0A 4L42A 3QQLA 5IQIA 4O2ZA 4L00A 1ZYLA 5ETIA 4WG5A 5A4TA 4Z7HA 5L2TA 2CPKE 4FSZA 1P5EA 4RIOA 2E2BA 5HZNA 4DLJA 2IVUA 3COMA 4L46A 2V55A 2W5AA 4M12A 4W8EA 3S2PA 1VJYA 5J79A 4O82A 3DBCA 4BI1A 2C6IA 4TYHA 3NLBA 3FSKA 1PY5A 4RT7A 3IPHA 3P23A 3QRKA 5EI6A 3BZ3A 2QHMA 3K5UA 3WF5A 3LKMA 4XLVA 2UZEA 3LFDA 1OECA 2B54A 4YLLA 1MUOA 1OKZA 3GI3A 5DLSA 4EWHA 5K5XA 4FYOA 4FTLA 3WILA 3CCNA 3LJ0A 3VUTA 3F7ZA 5JZNA 4H3QA 4QMWA 1KWPA 4LRKA 2UVYA 5DR6A 3R7VA 3MN3A 2AEGA 1OUKA 4FZ6A 4IFGA 3TJCA 1V0BA 2AYPA 3D0EA 4GT3A 2CN5A 4R3CA 3ET7A 4ACCA 5AUZA 3FYKX 3L8SA 4CYJA 5KMLA 3FYJX 5CF8A 4R5YA 1XKKA 2XM8A 4AAYA 4G17A 2WIHA 3QZFA 3R00A 4JDJA 4WSYA 4AA5A 2VO7A 5KBRA 3CR0A 3CD3A 3TCPA 4RZVA 5L6OA 3FMEA 4CKIA 4AGUA 3PPKA 2RGPA 4FT5A 2O2UA 2UZWE 3CS9A 3A8XA 3DZQA 3KULB 1F5QA 4IH8A 4W9XA 3QZIA 1LR4A 4C2WA 3RAHA 3UVPA 4I22A 4AW1A 4FTTA 3A4PA 3ORZA 4XG3A 5J1WA 5L4QA 3CXWA 2R3JA 4Z55A 2OF4A 3GP0A 4RVMA 3P78A 3A7IA 3M2WA 5E90A 2YM8A 4U79A 2HY0A 3HKOA 3QUPA 4GCJA 3RPVA 4O0WA 4F1MA 1XWSA 5C8NA 2J90A 4FL2A 4I93A 4HJOA 2VTIA 4RJ3A 1Q3WA 3LJ2A 2OIDA 5FTQA 1ZRZA 2XS0A 2R3HA 4DH7A 2ZB1A 1KE7A 4A9YA 3D5UA 2VWUA 4D9UA 1OIQA 5EM6A 4AFEA 4AW2A 2GDOA 4FTJA 1W84A 2BZIB 3TIYA 2ZFYA 4FEUA 3SLSA 3IS5A 4I1ZA 3WZDA 4EZ7A 3BL9A 5C4LA 1NVRA 3TMOA 4IXPA 4PL3A 3E64A 1BX6A 3R1QA 4NM3A 3GENA 2IW8A 2C5XA 4ASDA 5M51A 3AKKA 3IOPA 4I24A 2HYYA 3TZ7A 1PXJA 4QEBA 1WBWA 4EOLA 2YM4A 2W4OA 3E3BX 2F7ZE 4ZEGA 1H1WA 4KSPA 3SG8A 1H27A 4J97A 4N70A 4EK4A 2GNGA 3IGGA 4JX3A 3SG9A 3TIZA 4EEVA 3W8LA 3W0QA 4L7FA 4AOJA 1H01A 3PJ2A 3JS2A 5HBEA 4BYIA 3VUHA 2WTVA 4F9CA 3AC1A 3WYXA 2OICA 5AUWA 3PPJA 2W96B 5E92A 4ZLOA 4BYJA 1ZMVA 2QO2A 3FQSA 3U4UA 2CLQA 3MPTA 2YHVA 2XIZA 4IACA 5L2WA 2FSTX 3SXFA 3DAJA 1ERKA 4L3LA 5HCZA 4MQ2A 2XEZA 4NFNA 1KE9A 5CNNA 5DR9A 3WZEA 4D1XA 3QZGA 5IEVA 4EJNA 3TG1A 5FP5A 1PXOA 1H0WA 3ITZA 1OPJA 2C6KA 2XF0A 4FR4A 2OIQA 3QUDA 5F94A 3FY0A 3QXPA 3WI6A 1IRKA 5TR6A 3ZXZA 3QQFA 4HYHA 4YC6A 2OZAA 1JPAA 3R2YA 5A46A 4OR5A 4TW9A 3RALA 2XRUA 1XH4A 4RLKA 4QYGA 2OF2A 4BTJA 2XJ2A 5AX3A 3ZUVA 2X9EA 1FINA 4IM2A 2BRMA 4O6EA 3PZHA 5CLPA 1MRYA 2RL5A 4J8MA 4JVGA 3R30A 1O9UA 3O8PA 1ZXEA 1E1VA 1J91A 2IO6A 3FZTA 4FIJA 4L9IA 4OTFA 3GC9A 4KBCA 1WBOA 5E8UA 2XK4A 2YAAA 4D2PA 3SVVA 3ORKA 4U40A 1BL6A 3FZRA 4EH6A 3CPBA 5M56A 4O4FA 5FDXA 4DGGA 2XMYA 2I40A 3SKCA 2W0JA 2B9HA 4O84A 5D12A 4CFUA 2W1DA 4IM3A 4F99A 2GNJA 3U8WA 4HPTE 4I0RA 3DLSA 3ZS5A 3F5UA 4DEHA 2VTTA 4QPAA 3HRBA 1JAMA 4B9DA 4EZ5A 5J9LA 4DFBA 3KXNA 4YJOA 3OC1A 3KREA 3QC9A 3VS7A 2A4LA 3TEIA 5IH5A 4Z7GA 3NFGB 2Y6OA 4EC8A 2XIXA 2XP2A 3UIMA 3NGAA 1OPKA 2RIOA 3C50A 5TT7A 3ETAA 5IA4A 2X0QA 2CKPA 1T45A 3GEQA 3LCDA 3R22A 3MV5A 4B8LA 2GNIA 4H3BA 2X1NA 5KBQA 1YKRA 2ETKA 3O8TA 3PIXA 4WIHA 3F2RA 3P9JA 5T68A 4E6QA 5IG1A 1YDSE 2C3LA 5GJGA 2OJFE 2QR8A 2W1CA 2VWWA 2WPAA 3K3IA 3VBVA 4CD0A 1OGYA 4PNKA 2WMTA 4ANQA 4F0IA 5I9XA 2IZUA 2R3IA 3CC6A 4A07A 3HDMA 4AXFA 1JKLA 5K5NA 2WAJA 4FUXA 5B0XA 4C4EA 5JQ8A 4BIBA 2R3QA 1S9IA 1TVOA 4FV4A 3QWJA 4IZ5A 2OJGA 4GIHA 3QTZA 3NNWA 4YJPA 2VTMA 3R8VA 5DN3A 3H4JA 3W0NA 4P5ZA 2UZOA 3I5ZA 4NTTA 4S31A 2R0IA 4AT4A 4O7ZA 2OWBA 4FEVA 4O81A 4FTCA 2BFXA 4BCJA 3ODYX 1TQMA 3MY0A 2CGVA 4I0TA 4XUFA 2XCHA 5AR4A 4HNFA 3V3VA 3RGFA 4A4OA 4I3ZA 5EK7A 3ZEPA 1AGWA 3CTJA 4AAAA 1PXIA 2GHMA 2XZSA 4EH5A 2NPQA 4P2KA 3U51A 3F9NA 3EQIA 3NUUA 3MFUA 5J9ZA 4RFYA 1KUTA 4G3DA 1APME 3D4QA 2WEIA 3DLZA 4I4EA 3SW7A 3Q96A 3IQ7A 1QPEA 1YXXA 3NIEA 3BLHA 4IVCA 3A7HA 3QLGA 5CU3A 4LOQA 5FEEA 3VO3A 4I6FA 3MA3A 3VBWA 2V62A 4RFZA 4EHZA 3RCDA 3PSCA 4YC8A 4J8NA 5BUIA 1YXTA 4OW8A 1MRUA 5DT0A 4ZJIA 3ZUUA 4FTUA 1GZOA 3FC1X 4XP3A 2DS1A 4MWIA 4EH7A 5BV3A 3NWWA 4L43A 4WO5A 1JKTA 4Y73A 2C3KA 4DF3A 2HW6A 4AS0A 4FK3A 4YZBA 4ZXTA 5K0KA 4DGLC 5L6PA 2CKQA 2OH0E 3NVMB 3AOXA 3C51A 2PVKA 3D83A 1OB3A 4R78A 3QC4A 3A7FA 2RKUA 3E8EA 3LFFA 4J53A 4DYMA 1TQIA 3LPBA 3HGKA 4FKTA 3LXPA 4I20A 3KXZA 4HYIA 3P7BA 3VS6A 1W83A 4ANMA 1L8TA 3A8WA 1ND4A 5EW9A 3BU6A 3O5AA 3UNZA 5LVMA 4U7ZA 3TXOA 4MEDA 3U55A 5FXRA 2YM6A 2UZTA 4OTQA 3AXWA 3LXNA 4IWQA 5FXQA 4P5QA 2XBAA 3RM6A 5E8VA 2E9VA 4ANBA 2RG6A 2J0JA 4EOPA 2OGVA 4YJVA 1TQPA 4FICA 1LP4A 3ORMA 3QFVA 5F1ZA 1GNGA 4C57A 3A99A 4DGOA 4EORA 4FF8A 5CSHA 3UJGA 5HO7A 2WD1A 1Q99A 4NZWB 4GVAA 3PWYA 1H8FA 4KIKA 5DNRA 3DTWA 5DG5A 2WQOA 2HZNA 5FQDC 4E5AX 2BAKA 4RQKA 4QP6A 4I23A 4Y83A 3RPRA 4ENXA 5LXMA 3QD3A 4YLJA 3UO4A 3EHAA 4RVTA 1U54A 2QOOA 4D5KA 2VRXA 3UZRA 4FTKA 2PE1A 3VC4A 2WKMA 1YVJA 2W1HA 5CZHA 3VQHA 5AP7A 3E8CA 1DM2A 4F6UA 2BAQA 5LWMA 2P2IA 3FZ1A 3LFQA 3W0SA 4M8TA 2R3PA 3QQGA 2Q83A 3FLWA 4QYEA 4JLCA 4UYNA 4WKQA 3MVMA 4TWPA 5AAGA 1W2CA 5M44A 3HUBA 1W7HA 4BZOA 3IECA 4FSQA 2F7EE 3WF7A 4X2GA 1YRPA 5H3QA 4RIYB 3RNYA 5DYJA 4XBRA 4YJUA 5LMAA 2YJRA 4ALUA 4RIWB 5FM3A 4LYNA 3UVQA 3DB8A 4DFXE 2XNNA 5J7HA 1ZOHA 4JRNA 1Y8YA 2PHKA 5EYKA 2C47A 3FKNA 3H3CA 3LLAA 4GSBA 4C33A 3F66A 4PL4A 4JG6A 3AC5A 1X8BA 5IUIA 3C4EA 4JRVA 1J7IA 4QQTA 4MX9A 4R7IA 1JLUE 4CV8A 1WBVA 4HZRA 3FXXA 3Q9WA 3BEGA 3GU7A 1PXMA 2G2FA 4YZ9A 5GNKA 4CRLA 5JGAA 3G9NA 4XYFA 2Y4IC 5KX8A 5DBXA 2BTRA 3QTXA 4APCA 4IZYA 2BZHB 5CENA 4DA5A 3D7ZA 3HA8A 3P4KA 4LL0A 4QPSA 1UNLA 4PP9A 1PMNA 2ITTA 3QQUA 2FO0A 4V0GA 2VTPA 2X8IA 3NR9A 3H30A 2C0IA 4DCEA 4BIEA 5D41A 3NEWA 3F3VA 3AT2A 4OBPA 3TNHA 5HU9A 4IEBA 4W8DA 4BKJA 4O6LA 1U4DA 2O64A 5M07A 4BGQA 3N4UA 3EN9A 2C4GA 4O0TA 1MP8A 4BVUA 4BJJB 1OVEA 1PJKA 2YLFA 3OWPA 4U0IA 4F70A 3KN6A 1BYGA 4JG7A 4JAJA 2E9NA 3JY0A 3IDCA 3RM7A 3TJDA 4EHGA 1CTPE 3PJ8A 3SAYA 3U6IA 3OZ6A 3QD0A 3SDJA 5DH3A 2XB7A 2NYAA 3C0GA 4A7CA 1YOMA 4WNPA 3W2CA 4LUDA 4ZSGA 4RG0A 5DPVA 3UP7A 2WNTA 5GJFA 1UU8A 2X81A 4AZTA 4EQMA 2V0DA 4KS7A 2UW4A 1OITA 4Z16A 4PF4A 4YZMA 4WRGA 1YDTE 3R73A 4IZAA 4RRVA 3HMPA 3KRRA 5KZIA 3VWAA 3CPCA 3SRVA 2OI4X 2WIPA 4RWJA 3II5A 2PK9A 4GEOA 4AT3A 2ITZA 2QOBA 4L67A 2JBOA 3SX9A 3DFAA 1VYZA 3MESA 3HDNA 2ZV8A 2XANA 3NUAA 1WBPA 4UMTA 2PVRA 4RA4A 2QOCA 3QA0A 4PDSA 2QLUA 1W98A 2GHLA 5FEDA 5CEPA 1BL7A 4TNBA 1IAHA 2G15A 2VTOA 2BPMA 2C5OA 4O21A 4Q5EA 4BKYA 3UO6A 3PUFC 4AACA 3LM5A 4O0YA 3ACKA 1Y6BA 4NTSA 4YR8A 3KVXA 4C4JA 4DEDA 5AP5A 1XBAA 4BBFA 3H0ZA 4CKJA 3OEZA 1WZYA 4RWKA 5CT0A 3R9HA 3F7WA 4P7EA 2QOLA 5IMXA 3R28A 3ZC5A 4BDHA 3F5GA 5CQUA 1A9UA 4WA9A 3MB6A 3MTLA 3VBQA 3NDMA 3MTFA 4ERWA 2HAKA 5KMKA 4EYJA 3HYHA 3MVLA 2PUNA 1KOBA 2BFYA 2JIUA 4MF0A 5KMNA 2WMRA 2IF8A 1ZYDA 4EKKA 3MWUA 3QCYA 4GFGA 4MXXA 5E1SA 4GYIA 2HY81 3FMMA 3UGCA 3KB7A 4RIXB 4D0XA 2J0IA 3C5IA 2VTSA 5J1VA 3V5QA 5CEQA 4YC3A 4NW6A 4FL1A 4RJ8A 4BDJA 5HD7A 5EKNA 1GAGA 5IEYA 2PVYA 3UPZA 4E3CA 2G01A 5KMJA 1OIYA 4M84A 3VS0A 5FUTA 3P0MA 4DH8A 4O0RA 4FA2A 1YXSA 4X0MA 2WMAA 5IQDA 2BRNA 5HX8A 3VVHA 5BVOA 4UX9A 3G2FA 1FPUA 3Q04A 4DDIA 2ZVAA 3DAEA 3FMDA 4EOOA 3FSFA 4JDHA 3KL8A 5K4IA 3V5JA 4Y5HA 2QG5A 1J1CA 3SQQA 3O17A 3N4VA 2WMQA 1OL6A 4EQCA 4YMJA 1HCLA 3T9IA 4E8AA 4N4SA 4AN9A 4LV7A 4J98A 2OLCA 3FLZA 4S30A 4FT9A 2R3NA 5CU6A 5DOSA 4IIRA 3RINA 5JGBA 2I0VA 4U8ZA 3E88A 3LMGA 4FYNA 5B2KA 4BCFA 4C59A 3VRYA 3TZ8A 1VLRA 1UV5A 2YISA 5BVEA 1PKGA 4G3CA 4BI0A 3UIXA 2ZDUA 1UU7A 4MNEA 2WQNA 3E7VA 3FUPA 5AR5A 2J4ZA 4DHZA 3AC3A 3UP2A 3HRCA 4HVGA 1R0EA 2XKCA 1L3RE 4YZNA 5HG7A 4GKIA 3MIAA 1OL5A 3UDBA 4O0VA 4CFFA 4U42A 5CVGA 3E3PA 2XEYA 4LMNA 5CY3A 2F9GA 5AR7A 3ZOSA 5EI2A 5E4HA 2EXCX 4USFA 5ETFA 3V5TA 4DLIA 5BX0A 3TV6A 1O6YA 2JGZA 3MFSA 2FGIA 2GCDA 2YN8A 3OXIA 2WELA 3NW7A 4IDTA 3O7LD 3LFBA 2VWBA 4O22A 1ATPE 4F6SA 2B9IA 4LQMA 4FV0A 4FNYA 4IDVA 4RSSA 4HYSA 2QLQA 3OWKA 4YZCA 5AP3A 4QMQA 3NYOA 4XG9A 4CLIA 3OT3A 4XEYA 4M0YA 4WG4A 4D1SA 3NYVA 2IG7A 4AU8A 3LJ1A 4AZWA 5LOHA 4KRCA 4BB4A 2WMSA 4FKOA 5JFWA 3AD6A 5IPJA 2YZAA 5CAPA 5HGIA 2XYNA 1JWHA 5EM8A 2QKRA 3F61A 2BKZA 5EDQA 4FT3A 4RVLA 3GC0A 1H00A 4ENYA 1WBSA 4ITJA 3GCQA 1YOJA 2EVAA 4G16A 5C03A 3RBWA 3EL7A 5CX9A 4FZFB 1ZAOA 3DZOA 5FM2A 3BLAA 3R71A 4IX4A 1JSTA 3U4WA 2GMXA 4QTDA 5JFXA 2VGPA 4O2PA 3BEAA 4C61A 3VF8A 3EIDA 2C1BA 2R3FA 3FZSA 3MBLA 4OTIA 3NZ0A 2F2CB 2ZV9A 5CAVA 4BF2A 4GU6A 3EH9A 5IA1A 3VUIA 3BYSA 3ELJA 1PW2A 3GBZA 5FP6A 3UMWA 3FQEA 3OP5A 2OIBA 2Z8CA 2RSVA 4UYAA 5JMSA 5HIBA 4AT5A 5A6OA 4KWPA 4MUQA 1SYKA 4ZZNA 3BHYA 3P7CA 1ZLTA 1IG1A 2JFMA 4A9UA 4AA0A 3CGOA 2J0KA 3DJ7A 3IW7A 2BALA 2Q0BA 2R64A 3R7OA 4EH2A 4B99A 3UOHA 4DHIB 2W1IA 3OCSA 5E8ZA 3JPVA 4QOXA 1LPUA 1WAKA 4U81A 4FKWA 4J1RA 5D11A 5AWMA 3W2RA 3JVRA 5A3XA 4IFCA 4CFXA 3S0OA 3GU5A 3OT8A 4GU9A 2RG5A 4IBMA 3UNJA 4ANLA 1V1KA 1SVGA 1OKYA 3REPA 2J5FA 2LGCA 3OHTA 1IR3A 5LVNA 3FMKA 5AX9A 2XUUA 3PIZA 4UZDA 3A62A 4AW5A 1HOWA 3POZA 3DBFA 5KE0A 4CSVA 4DINA 1H28A 2JDSA 2VWIA 1GY3A 4E5BA 1Y91A 4DCAA 4FKGA 3C0HA 3EJ1A 3QX4A 4U9AA 2XVDA 4Y72A 1R78A 2NRYA 3AMBA 5HE2A 3Q6WA 4AG8A 2PMIA 2QOIA 2BZJA 4NKAA 3TTIA 2QC6A 3R2BA 4GW8A 4O7WA 3PFQA 3OTVA 1H08A 4MH7A 5T6KA 4M15A 4TWCA 1NY3A 3VHEA 4ZOGA 3VBTA 5TOZA 5D9HA 3DK3A 4IWOA 3MFTA 4X7QA 5D7AA 5HKMA 3BGPA 4O7YA 1Q4LA 4M68A 4FV3A 3E8NA 5DHJA 4BDEA 3QUEA 3TKHA 2P33A 1R39A 2OH4A 3D94A 4PMMA 4DGMA 1IAJA 1M14A 3MYGA 2H6DA 2X4ZA 4C62A 2J0LA 3I0OA 3ZDUA 4DFYA 3H9OA 3LXLA 4ACDA 4AA4A 5I9VA 5H2UA 4ZJJA 4L8MA 2PVFA 4W9WA 3GOKA 3F3UA 4PTCA 4XCUA 2BILB 5AP0A 2V7AA 4NSTA 1G3NA 1OZ1A 2AC5A 4HYUA 4X2NA 2OJIA 4DFLA 3OMVA 4I94A 1G8AA 2PUPA 2UZNA