5CEOA

Dlk in complex with inhibitor 2-((6-(3,3-difluoropyrrolidin-1-yl)-4-(1-(oxetan-3-yl)piperidin-4-yl)pyridin-2-yl)amino)isonicotinonitrile
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
269
Chain Sequence
LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 12
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ceoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ceoA01
5J5TA 5HD4A 3EN4A 3SD0A 2QR7A 3G6GA 5CANA 2PVKA 4IW0A 3R00A 4U81A 4F9WA 1ZRZA 4HGTA 3UJGA 3RMFA 5CNNA 3WARA 1H1SA 2HELA 2R3NA 3FYKX 2BMCA 5M57A 4DLJA 3CKWA 2C5VA 3F5XA 5H8EA 5AFVA 5DOSA 4BYJA 4D0XA 1OUYA 2ITXA 4A9YA 5A4TA 1PMUA 4DEGA 4YJSA 4DT8A 4IB3A 5C4KA 4WSYA 3QWJA 4AA0A 4E6CA 5HBHA 3P7CA 4QYGA 3LFAA 4D58A 2ITNA 4G3FA 3QQLA 2VTRA 3DK7A 2PMIA 1REKA 3QALE 3ZUTA 4H1MA 1ZOGA 4L53A 5HBJA 3HKOA 4DFNA 1M2PA 4UMTA 3W8QA 3HRCA 4FV6A 4AW0A 3DK6A 1IAHA 5EW8A 3JVRA 2ITYA 3G33A 3DXNA 4JDHA 3TN8A 4E7WA 4O7SA 4MNEB 3A7HA 2GS2A 4O7ZA 2CN8A 3DBFA 4M97A 3U8WA 1XH6A 3MH1A 4I6HA 4ZLYA 5L4QA 1XBBA 3DOGA 4W4YA 5T68A 4OBQA 3QCSA 3NUPA 3TIZA 3Q2MA 1Q5KA 5IDPA 3BV3A 2EXCX 3HECA 4YJOA 5J7HA 2GNFA 3NNXA 5JFWA 1ZLTA 5L2IA 3LPBA 3Q5ZA 3QTQA 4R77A 3V5PA 5AUYA 4F64A 3TJDA 5ETIA 3JYAA 2BRBA 5CVGA 3WIGA 2PVRA 2XMYA 4IX3A 4D2SA 3GU7A 4XLIA 3UOHA 3OOMA 4GRBA 2R4BA 3L8VA 3ZZEA 2EB3A 1P4FA 3UQFA 3ALNA 5DYJA 2GQGA 2C6DA 3C4XA 2ITOA 2VTHA 3OVVA 5L2QA 1DI8A 4PPAA 5BQ0A 4PTGA 2P0CA 4QMYA 4YJPA 2VX0A 5LMAA 4JQ7A 1TQMA 3NUXA 2OW3A 2WEIA 2RFDA 3NNWA 4TW9A 3B2TA 5AWMA 1G8AA 3JS2A 3LLAA 3T3UA 2IVSA 4YTHA 3TUDA 4YSJA 4QMZA 5EYDA 4U97A 3QRUA 3VBWA 2WTDA 4W9WA 5JRQA 5M4CA 4JR3A 5HVKA 3Q4ZA 3DA6A 3UIMA 2BAQA 2XK6A 1U5RA 5AAEA 4IB1A 4M66A 1XJDA 4ZZOA 3D7ZA 2RSVA 4IJPA 1OL1A 3BU3A 4DFYA 5JH6A 3U6HA 4FEUA 3RVGA 1H1PA 2XF0A 4FK6A 2RGPA 3MB7A 3V5LA 1SMHA 3L8SA 4R8QA 4A4OA 2R3OA 3MTLA 2YM6A 1YDSE 3BZ3A 4I5MA 5K4IA 4UX9A 3GNIB 3AGLA 1WBNA 4NWMA 4UYNA 3ORKA 2PUIA 3OC1A 3QQGA 4IAIA 3GGFA 3WE8A 3FEGA 3RZFA 3TXOA 4AACA 4H58A 1Q3DA 5D9HA 3N51A 2RF9A 5HEZA 5AUUA 1OECA 5FGKA 3MESA 2P55A 1FGKA 3OD6X 4DITA 3Q53A 4F7SA 5FEQA 2IZTA 3WILA 4ACMA 2C69A 4FKPA 4H39A 3S1HA 3OOGA 4O0UA 4O7VA 3G2FA 2PUPA 2XRUA 3UOKA 4DCAA 4W8EA 2X81A 4EBWA 5J1VA 4F1TA 4GW8A 2NRUA 4AZTA 3AC4A 3V01A 3DTCA 4JBQA 1AQ1A 4BWPA 4EQMA 3LQ3A 3OCTA 5HICA 2WMBA 2X8IA 4FKWA 5F20A 5KCVA 2XIRA 4GU6A 4PY1A 3D14A 1PXJA 3RI1A 3P1AA 2XH5A 4C59A 3F5PA 1ZZ2A 3D5VA 5HD7A 5DR2A 2HWOA 3E63A 2JKQA 3FBVA 4QYEA 4Q9SA 2BZKB 4C0TA 3O23A 2PVJA 3ZLYA 3T3VA 1DM2A 1SZMA 2O65A 4TWPA 1URCA 2GNGA 3UG1A 1J91A 3OEFX 3G5DA 3HV6A 3H0ZA 4KABA 4ALWA 3WF6A 4MF0A 5GIPE 3LIJA 1B39A 2BHEA 3Q04A 5CAPA 2YCRA 4FV8A 4MK0A 4S34A 3TTJA 3GCUA 5IQGA 2OXYA 4JJRA 2CPKE 2EB2A 4BDFA 2BCJA 3RAKA 1XBCA 2XVDA 2A4LA 3D4QA 4GH2A 4AT4A 1Z57A 4RJ3A 1FMOE 4O0VA 4XOYA 4Z9LA 2PVMA 5HNIX 4IB5A 5CALA 5EFQA 1UKHA 4XBRA 4CXAA 2VTQA 1JBPE 4N0SA 5JEBA 3KF4A 5EW3A 2HENA 4TT7A 3F5UA 4FI1A 3D2KA 4RIWB 2XKEA 2PVHA 4EOLA 4QMMA 3VUKA 1QPJA 4QQTA 5J87A 3EYHA 2EU9A 2PZYA 4LOPA 3RZBA 4I23A 4ACCA 5B2LA 2PZ5A 1VJYA 3ACKA 3UNJA 3BELA 3O50A 3SDJA 4APCA 1F5QA 3R73A 2IW8A 4FSTA 1OKZA 5KNJA 2BIYA 3NDMA 4M67A 4C34A 2JKMA 2QKWB 3PVBA 1OPKA 1YXUA 4LMUA 4BIBA 3VAPA 4EI4A 3IONA 1GZ8A 1KE9A 3CGFA 4BDDA 4E5WA 2H34A 2GHLA 3BGQA 4X2FA 4RFMA 5JRSA 3WZUA 2PTKA 4ACGA 3I5NA 4KIKA 4E6AA 3VBYA 3VUDA 1XHAA 4HGSA 2X7GA 1JSTA 3ANRA 3D7TB 3OS3A 4ZTQA 3RPVA 3ZO1A 3ZOSA 1QPEA 2REIA 2QG7A 3U9NA 4F9BA 5M4FA 3EQCA 3TZ8A 2BR1A 4NCTA 2R3JA 4FSWA 5CAQA 3FAAA 1V0BA 1GZNA 4YZ9A 3PYYA 2PUUA 4I5PA 4JT3A 3VUHA 3S4QA 1AGWA 2EWAA 4A4LA 1CKPA 3PRFA 4DGGA 4LUDA 5C9CA 4IVDA 3R7VA 2FSOX 3RCJA 2VWYA 3FZ1A 1PF8A 2JIIA 3QFVA 4WA9A 3V8SA 4ASEA 5M06A 5CASA 3R9OA 4FV5A 5E8UA 3UP2A 3KA0A 4H1JA 3I0OA 4FNXA 2X2LA 2C6TA 3ID6C 3O8PA 1YOLA 1JSVA 2QI8A 4RJ4A 2C0TA 4EH9A 2CSNA 3H3CA 2YA9A 2XA4A 3EL7A 1W0XC 4CFNA 2JAMA 2BTRA 1P5EA 2WAJA 3WYYA 5EDPA 4XG4A 4R1YA 4ZSEA 3MH0A 4IC8A 4QTEA 5K0KA 3LQ8A 3WZKA 4BDKA 4N57A 4FSUA 2R3RA 4F09A 4LV8A 1S9IA 3TI1A 2VO0A 1KUTA 4ANMA 2F2UA 2RL5A 3AD4A 4IFGA 4RC4A 4Z55A 4BI0A 2YITA 4X6QC 2ZV9A 2BAJA 4D5KA 4F9CA 3LFSA 2X2KA 1OIUA 2HYYA 2W05A 3LFBA 1QMZA 5CYIA 4RWIA 4YZMA 2XKFA 5KE0A 1OI9A 5DNRA 3FSKA 3NLBA 5BVDA 5D41A 3K3IA 3RNYA 4DBNA 4LOOA 3UC3A 2GNJA 3R7EA 4FV4A 2WMWA 5D11A 4FUXA 2ITZA 2J5EA 2XNBA 3QD4A 1BX6A 4AOJA 4O0RA 4EH3A 5K0XA 4RIXB 4KIPA 5AUWA 5GZ9A 1XR1A 2P2IA 4MWHA 2W99B 4DF3A 5TE0A 4CQGA 4D9TA 5EHLA 3IECA 2OXXA 2VNYA 2HAKA 3KEXA 3NYNA 4RJ6A 4D1SA 2BIKB 4ZS4A 2AC5A 2UVXA 4L46A 5L8KA 2J6MA 2XIYA 2QG5A 3DQWA 3F69A 3GP0A 3WIKA 2OJFE 2XCHA 3AT4A 4M13A 2ITQA 3Q32A 2QR8A 2I0YA 2F4JA 4IFCA 4BC6A 4C58A 5J8IA 5ITAA 4UY9A 3UBDA 5M07A 5DIAA 3KXMA 1WVXA 3H10A 3E8EA 3RPYA 2BDFA 4B8MA 2GCDA 3MN3A 4IWOA 4B8LA 4EK5A 2ERZE 3GU4A 4HCUA 1BMKA 5JK3A 1JKSA 2OO8X 4BI2A 3KGAA 3OP5A 1ZYDA 4U6RA 4D2TA 5AP4A 3FXWA 4FEVA 3DAKA 2ZM3A 2QVSE 2YDKA 4FVRA 3RNIA 3MY1A 4L8MA 4C61A 3UO5A 4AWIA 5M44A 3MWUA 3HMPA 4JLCA 1PHKA 3DQXA 3VS1A 4C3FA 4CT1A 4EHGA 3P5KA 1SNXA 5IA3A 4AT5A 2R9SA 2VWWA 4YR8A 3QCQA 3P23A 4USDA 4HVIA 3T9IA 4IZYA 3VS3A 1JPAA 3TL8A 2BZJA 3OG7A 2YIRA 4ONAA 2YAKA 4L7FA 2QOBA 5AV4A 1T45A 3LMGA 3RK9A 3FC2A 5CSWA 4L00A 2QQ7A 2VO6A 3DDPA 4FC0A 3UIXA 3FLZA 4EZ7A 5DT4A 5KBQA 1J7IA 4AA4A 3R2YA 3LQ5A 3L9MA 4JS8A 3LFDA 4RVTA 2IN6A 1BL6A 3A60A 3GCQA 3MA3A 4YBKA 3BE9A 4XUFA 4ZSLA 3UYSA 4C02A 2Y7JA 4WNKA 4MCVA 4DT9A 4EORA 3PPKA 4L3JA 3ROYA 3PFQA 3GT8A 2XNNA 3EL8A 5EDQA 1ZMVA 3R7OA 4X3FA 5H9BA 4EHZA 3E3BX 1FBNA 3ZDIA 2GS6A 1M7QA 4YHTA 2YM5A 1OL7A 1WCCA 2C5NA 2OI4X 5KZ0A 3ZHPC 4EOIA 3TEIA 3PJ1A 3TZMA 3ETAA 4G3CA 4CT2A 3HDNA 4BTFA 3M1SA 4QMSA 4L3PA 2WO6A 4GIHA 1KE6A 3DS6A 3MS9A 4GVJA 3SAYA 4MBJA 3U55A 2WFYA 4XRJA 3VUGA 3AG9A 4EONA 2VTJA 3SG8A 2BZIB 3IDPA 3QQFA 4ZZMA 4WSQA 3VHEA 4O0YA 4TYHA 2YFXA 2Q0BA 3PY1A 3NUSA 4QO9A 4FT9A 2I0EA 4YLJA 4CKJA 4DEHA 1KOAA 2WU6A 4HNFA 4IMYA 4USFA 4U44A 2E9OA 4TPTA 3CY2A 3FPQA 4QP8A 3FZTA 4FL3A 3HLLA 4NJDA 3VC4A 3EH9A 1UNHA 3GC8A 3KRJA 2YWVA 4QMTA 5K3YA 4DEEA 3A8WA 2I1MA 2AUHA 4QPSA 5HE1A 2UW3A 3BBWA 4BKYA 4EOSA 5A54A 3SA0A 3EHAA 5CXHA 3RK7A 4FV2A 4C3PA 5CF4A 4CGAA 3W33A 2Y6MA 2J0MB 5ACBC 4BCQA 1QL6A 2YISA 4K0YA 2OZAA 4IACA 4EH7A 2BAKA 1ERKA 4AAAA 1JWHA 4BCOA 3DPKA 3F7ZA 4XLVA 5B7VA 1BUHA 2GMXA 3NAXA 3KVWA 3ZRLA 1U54A 1VR2A 4R78A 2R3HA 4LOQA 3LW0A 2X9EA 3AC2A 3R21A 3QU0A 3F3VA 4U79A 1PXKA 3G51A 2IZUA 2Y0AA 3BLQA 4FIFA 1OBDA 3BV2A 4YMJA 3R22A 1YWVA 2WMAA 2C5XA 4ZEGA 5BMSA 5HIEA 5IH4A 2QHNA 4RVLA 4XV1A 2XBJA 2XK7A 4JNWA 4OTPA 4BTKA 4KRCA 5K5XA 3VBQA 3RBWA 5F95A 4QTAA 1LEWA 1ZAOA 4MXYA 4GT5A 3ROCA 4PMPA 3R8VA 2BFYA 4TWOA 4I5HA 4IAAA 3FMEA 3FLYA 4QPMA 4QYHA 3C1XA 3TKHA 2UW4A 4NH1A 4K9YA 3UO4A 4C2VA 1PXIA 4ZJIA 5CF8A 5IA5A 4QYYA 3FV8A 2XJ2A 3H9OA 5FTOA 3U4UA 3EKNA 5E1SA 3ATTA 1OKVA 4GUEA 4AZSA 5M51A 5KMLA 5ANOA 3TWJA 3QQUA 4EK3A 4PRJA 1PXMA 5HGIA 5A6NA 3F7WA 2OZOA 2QU6A 4FT0A 3RPRA 5LJJA 1XBAA 2CGVA 3PSBA 4L52A 4M8TA 3DJ6A 4WHZA 5E8WA 4BBEA 3ZUVA 2CNUA 4EQCA 4DTBA 4CZUA 4O0WA 2R3IA 2OWBA 4BDJA 3MB6A 4C62A 5CEPA 3HAMA 4M14A 3CKXA 3Q9YA 4ZS0A 3TDVA 2Q0NA 2ITWA 1URWA 4FTOA 4U40A 1ZARA 2KULA 4C4HA 4RWLA 4YGAA 5M4UA 4D28A 4K77A 4LL5A 4O7TA 3TM0A 4FZ7A 4U43A 4IC7A 5DA3A 3COHA 5EKOA 4R7BA 2C6IA 4FTKA 5HCZA 3V6SA 4J96A 1JQHA 3QCYA 3A7GA 5EW9A 2AC3A 3HRBA 4BZOA 4OBPA 3RWQA 1BI8A 5IQEA 4IANA 5E1EA 5JN2A 5AP3A 3HV7A 4CYIA 4YC8A 3ZC6A 4EZ3A 4IAYA 4FTUA 5FQDC 5FTGA 4FV3A 3RINA 5HTBA 3S00A 4PP9A 2IZRA 3NPCA 2J50A 4HYUA 3TV4A 4D4YA 3FQSA 3KFAA 4V0GA 5CAUA 4AX8A 3MIAA 3PIXA 4N6YA 4XG7A 4ENYA 5CI7A 2P4IA 4UN0C 4YJTA 2UW7A 2W06A 1XH4A 3D15A 4FT3A 4E6QA 4R1VA 2VWXA 3ZEPA 5EM6A 5TKDA 3FLWA 3QKMA 2OFVA 3R8LA 1WBVA 4FVQA 4HZRA 5DG5A 3DDQA 3OXZA 4P5QA 4W4WA 4EH8A 4FKVA 3D0EA 3BCEA 3D5UA 4F7NA 1PXPA 1UNLA 3WZEA 1UVRA 1YHVA 4FTCA 4GS6A 3AT3A 3DTWA 3FMDA 5GINE 3VN9A 1MP8A 4QNYA 4JX3A 5H3QA 3ZBXA 1E1XA 2C3KA 5AR7A 5CF5A 2WMTA 5BMMA 4D4VA 4BR3A 3EQGA 2W7XA 3FQEA 3FI8A 3FDNA 2VX1A 4FX3A 3AC5A 4QPAA 3ZLXA 5FWKK 3IQ7A 3MGYA 2H96A 3FI2A 4F0IA 5I3RA 2OICA 5AV1A 2BROA 3UZRA 5I5ZA 5KMMA 2EVAA 4LQMA 5D1JA 4AGUA 5EOBA 4F9AA 3R1YA 4PDSA 5IQDA 3GI3A 5L8JA 4I21A 4O1OA 4ASZA 3C7QA 4M0YA 4PV0A 4CFXA 5GZ8A 5HO7A 5DGZA 4FODA 3E88A 4AW2A 3Q4UA 3QRKA 3EN7A 3HMOA 4BCPA 2J90A 5IUIA 3VIDA 1PMNA 2DS1A 2W4OA 3PVWA 3V5JA 2XEYA 1PYEA 3JVSA 3PDTA 1EH4A 3PG1A 4LUEA 2V0DA 4QMNA 3QKKA 5AAFA 4FKTA 1XH7A 2PL0A 3POOA 4ZSGA 5G1XA 2C1BA 3O17A 4M15A 4Y8DA 2R0UA 5LVLA 3MPTA 2OIBA 4MH7A 2JFMA 3H9FA 1H24A 1L8TA 1GZOA 4P4CA 1PKDA 2HZNA 1R1WA 1ZY4A 2VO3A 3MH2A 4U42A 3Q96A 2CGXA 5L6WL 3MPAA 2UZLA 4JRVA 4O0SA 4YSMA 3HVCA 2XK4A 2F7ZE 2HZ4A 4ZY5A 3AD5A 3C0GA 4AZWA 1H25A 4KRDA 5AUZA 3NCZA 4DYMA 1NVQA 3WYXA 5JFSA 5HLNA 3F3TA 4L68A 4DBXA 5HIDA 3ACJA 3A62A 1Y8GA 4QQ5A 3PPJA 1J1BA 5A6OA 3A61A 5CEMA 4IZ7A 4XCUA 5HLWA 4RA4A 2GFCA 5AP6A 5HOAA 2WTCA 5LCJA 1MRYA 4OLIA 3Q9WA 3FHRA 3OT8A 4BB4A 4GMYA 5M4IA 1OMWA 4I22A 4E4XA 3HDMA 4ZJVA 2YAAA 2YJSA 3DZOA 1YKRA 4AUAA 5FM3A 4F4PA 2OF4A 5CF6A 2W4KA 5DFPA 2ZDUA 1IR3A 4FNZA 4KKHA 3BWJA 1CDKA 4N6ZA 2GHMA 4EWQA 4Z3VA 3PJCA 5A4EA 2W1FA 4OAUC 3MW1A 4R7IA 4RFYA 2ZMCA 2WMQA 5CTPA 4O2PA 3TCPA 4II5A 5HIBA 4W8DA 4HVGA 4JX7A 2R3LA 4MQ1A 2WMUA 4QD6A 3GU5A 4KKGA 2XRWA 5HG9A 3Q2JA 4XBUA 3VJOA 2UZOA 3B8QA 5J9YA 3CGOA 1M14A 4DHFA 4FTJA 3LJ2A 3UTOA 1WBWA 1R0PA 4FOCA 1G5SA 3EFJA 4NCTC 5AR2A 4GL9A 3ULZA 5AEPA 2OJIA 2CN5A 3NEWA 2P33A 4ORKA 3UP7A 1E9HA 4FSQA 4I6QA 2PMOX 4J1RA 5CEIA 2KTYA 4N4SA 4PL3A 5KMIA 3SW7A 4HCVA 3FMNA 3OTUA 2LAVA 3Q60A 3IKAA 5CU6A 3ZFYA 2YM4A 3BYSA 4HPTE 4J7BA 2OJJA 3P0MA 3GENA 4IZ5A 3R8ZA 2BPMA 4FTTA 4FSRA 4LRMA 5JGDA 2CNQA 2WOTA 2ITUA 4O7NA 4UB7A 4OTRA 3GEQA 5KUPA 4FT5A 1WFCA 2VTSA 5JFVA 2XK9A 3HA8A 3H0YA 4E4LA 3V5QA 1YVJA 3AGMA 2V62A 4J99A 4RJ8A 2ZMDA 2HXQA 2PULA 4BBFA 4APPA 4OTQA 4LGDA 1LUFA 5AM7A 2P3GX 1OB3A 3FI4A 5CZIA 4MVFA 3GQLA 4XEYA 2WMSA 3UVRA 3DAJA 3LFQA 5HE3A 2J7TA 3I7CA 3O0GA 4L44A 3ZSGA 1CKIA 2Z60A 3EFLA 4CSVA 5C8KA 5HORA 4QP6A 3G6HA 4D9UA 3M11A 2XS0A 1QPDA 3VUTA 3SOAA 2XUUA 4YJUA 2CJMA 4YZBA 2GTMA 2QU5A 4W4VA 4ZOGA 4C37A 3CTJA 4RVMA 3AC3A 1Q8ZA 4EOOA 3SGCA 3KCFA 1FPUA 4F0FA 1NVRA 4FIHA 4IAZA 1UWHA 4NTTA 4Y85A 3G15A 2F49A 5EM8A 3UIBA 1GAGA 2V7OA 4EL9A 3ZU7A 4E4NA 4MD7E 5JGAA 4ZTSA 5HHWA 3DAEA 3BPRA 4MXAA 4DGNA 4EOQA 4XS2A 3UOJA 2GPHA 3GOPA 2IVTA 3ULIA 5LVNA 5FUTA 4BCHA 3PXZA 2WZJA 4ZJJA 3CY3A 2BKKA 4RLKA 5HX8A 3LHJA 4JQEA 4L45A 4FTLA 3G90X 1B38A 4DFXE 4Z16A 5K4JA 3P4KA 2R5TA 3GXLA 1LPUA 2QOCA 3RCDA 4PDOA 3UDBA 3WF8A 4AG8A 4NL0A 4JBPA 5BNJA 3M42A 4TYJA 3BQRA 2G01A 3R2BA 4E3CA 5CT0A 4DGMA 1J1CA 5LCKA 4IAFA 1WBPA 4AW5A 3CD8A 3TV6A 5F9EA 2PE1A 3F5GA 3O51A 2QURA 4QMWA 2ZV2A 5A4QA 4E8AA 3PRIA 3KVXA 1OIYA 4O6EA 4EYJA 5DT0A 4AE6A 1CSNA 3VHKA 3OBJA 3EFWA 4C4GA 3T9TA 1YOMA 3FKNA 3MJ2A 3I5ZA 5D10A 3ZC5A 2HZIA 5FD2A 4DA5A 3EMGA 3FPMA 4R7HA 4JG6A 1WZYA 2XCKA 3BBTB 2RG6A 3QTZA 2JDVA 3NVMB 2YDIA 5FXSA 5GJGA 3L9PA 4ANLA 5FLFA 2W5AA 3C4EA 2X1NA 3MVLA 1ZWSA 2BRMA 2Y6OA 2IJMA 4I24A 2E9VA 5CI6A 3OUNB 4AGCA 3HNGA 3QLFA 4G6OA 2Z02A 4ASXA 5HCXA 2W1DA 5HG7A 3NUYA 3W55A 3KCKA 4G5JA 3FC1X 3RM6A 1W98A 5IMEA 2JKOA 1MUOA 3RGFA 3TACA 4BGQA 3FZPA 4IEBA 5I9VA 5J79A 3KMMA 5CVHA 2UW6A 4QTCA 5CU0A 3DBDA 4BZNA 3DZQA 2W9FB 3EN9A 4V04A 5FP5A 5J5SA 4KA3A 3UPZA 3LJ1A 3AMBA 4X3FC 3QRIA 2C3LA 4YHJA 5I3OA 2HW7A 5ETCA 4ANOA 2QO7A 4ZP5A 1Y6AA 1STCE 2C47A 4WBBB 3BGZA 3DJ5A 4GV1A 3BHVA 2ZM1A 2HZ0A 2XKCA 4AGDA 2CLXA 5HQ0A 3C5IA 4I5CA 3HAVA 3QTUA 4RQKA 5KMNA 3UO6A 4M69A 5I4NA 1M17A 1E1VA 1XO2B 4Q5EA 1KV2A 5ICPA 3LXKA 3FY0A 3POZA 3NYVA 4IVAA 3PXRA 4PUZA 4EHEA 4CV9A 3F66A 5HTCA 4HOKA 3F82A 2W17A 5IQHA 4I92A 3E5AA 3EN6A 4I0RA 3DU8A 5FP6A 1X8BA 1UKIA 2C0OA 3OXIA 3QQKA 3QUPA 3RM7A 4ZMFA 3D94A 4MEDA 4ENXA 2QLUA 1WBOA 1BKXA 2BUJA 5EDRA 3IOKA 1KOBA 4JIAA 5DH3A 5AX9A 1O9UA 4UXQA 3QBNA 2YZLA 3WI6A 1PRYA 2XM9A 5L6PA 4JQ8A 4TKSA 4FKQA 1U46A 2ETMA 3K3JA 3LCDA 3QZHA 3A4PA 2R3PA 2XB7A 4HYHA 5E91A 3NVKI 4DEAA 2QONA 4X3FB 2CKEA 3L8PA 2OIDA 4PPCA 5M08A 1UU8A 4XX9A 5CQWA 5HCYA 2XNGA 4NM5A 1GIIA 1HCKA 4ITHA 5D7AA 5BUIA 3ZO2A 4FMQA 3QGYA 3I6UA 4U80A 3FY2A 3OCGA 5ANGA 5FBNC 3GC0A 2WIPA 2XYNA 4RX8A 4ZIMA 2JAVA 3KXXA 3V5WA 4E5AX 2UZBA 4BI1A 4JBVA 3W1FA 2BFXA 1YHSA 2PY3A 4KSQA 2GNHA 3LAUA 3SQQA 2XIKA 4EJ7A 1RJBA 4FL1A 1FGIA 5AV2A 3RJCA 1ZZLA 4FZ6A 2VTTA 5M53A 3UZTA 4YC3A 5TR6A 4DLIA 2F57A 4TYHB 4L3LA 4JL9A 4XG9A 2PHKA 3ZCLA 3UE4A 4C3RA 2W1GA 2CLQA 4QMVA 5IISA 4BCNA 3F3ZA 5CY3A 4AOTA 3I0QA 4X7QA 3C4WA 4FR4A 2XKDA 5KMKA 1WAKA 3NS9A 2JIUA 4BCFA 2C68A 5JKGA 4E73A 1YOJA 3BLRA 3JY0A 4EOKA 3PJ2A 4JDJA 2QO9A 4NYEA 2B52A 3QZIA 4O2ZA 4H05A 4UWCA 4NUSA 1R78A 3ELJA 4O21A 1Q99A 2DUVA 5DRBA 4NFNA 4V05A 4U3YA 3PE1A 3NZ0A 3ORMA 4RBLA 2QOQA 4MKCA 4UXLA 2OZAB 2G2IA 2JDOA 3VUMA 2PK9A 3CR0A 1ZXEA 3AC8A 1H27A 4XV2A 3PA5A 2YM3A 3VBXA 4KS7A 4CLJA 5FM2A 4JAIA 3NNVA 2R7BA 2VTAA 3VRYA 4ZMEA 1U54B 2ZVAA 1QPCA 2PMNX 2QHMA 2UW0A 4TXCA 2B9IA 4IWPA 2CHLA 3UGCA 4R5YA 1PYXA 3HL7A 2PZIA 1Y91A 1OL6A 3ZLSA 2HCKA 1WVYA 2OXDA 3OBGA 3BYUA 4PL4A 3SV0A 2CKOA 5DN3A 3ZSHA 1U4DA 2WNTA 3PTGA 2HY81 4JAJA 4BZDA 3I4BA 2JIVA 2Y4IC 3E7VA 4ZTRA 3JUHA 4QMPA 2DQ7X 3R9DA 4GG5A 4FIGA 1H00A 4P90A 3OTVA 4Q2AA 5EYMA 4KB8A 4R3PA 4EUTA 4GYGA 3TTIA 4WNPA 3GCPA 2J0LA 5CU2A 3EJ1A 2FVDA 5AV3A 3P78A 3VJNA 4B7TA 1UU7A 2XZSA 3FMMA 2BILB 1OIRA 2IW9A 5B2MA 2YDJA 3UNZA 3OUKA 4FZAB 3A7FA 4OAVB 3Q4CA 4FBXA 5TOZA 3H30A 3F2RA 4MD9E 3EOCA 2ETRA 3JY9A 2FO0A 4RVKA 3LZBA 5HNBA 4CCUA 3ODYX 3TZ9A 4K8AA 3Q52A 3NMUF 1IG1A 2OF2A 3KN5A 4OUCA 2C6MA 3A4OX 2BTSA 2E9UA 3K5UA 2YZAA 4GFOA 3F2NA 4XHKB 5KKRC 4YTFA 3EQDA 3I6WA 2C4GA 2XNPA 4QQCA 3W2OA 3NYXA 4BN1A 3F6XA 3E93A 4FTAA 4QP9A 2Y4IB 1VZOA 2YACA 3HV4A 4I0TA 3VNTA 1CTPE 4FEWA 4FKRA 1G8SA 5CZHA 5FBOA 5LVMA 4GT4A 5BUJA 3IO7A 2B4SB 3CIKA 4BVUA 3MPMA 3P08A 4TWCA 4CNHA 5ANJA 1NA7A 3SOCA 3HX4A 5ETAA 3HA6A 1BYGA 1SNUA 3BEGA 4UMRA 4YPDA 5D12A 3RPOA 5DI1A 2B7AA 4QMQA 1H07A 1LEZA 4DH3A 4BCGA 4XP2A 3P9JA 3ZLWA 4IM0A 3Q5IA 4KIOA 5LVOA 4RPVA 4V0GB 2XYUA 3W8LA 4FICA 4C35A 1J7UA 4E6DA 4MHAA 4NTSA 2F2CB 3MFSA 4G31A 4J97A 3R1QA 4RFZA 4FF8A 4U8ZA 2RG5A 5HG5A 4FIEA 4AXAA 4FZDB 5E8XA 3UQGA 3MJ1A 2XNEA 4YJRA 2J0IA 4DH1A 2BZHB 4CZYB 4G3DA 4ZAUA 2CCIA 5KKRB 5DPVA 5CEQA 2X9FA 3ORPA 3DB8A 3V8WA 4O7RA 3MFRA 3N9XA 3U6IA 1M2QA 4U41A 1H1WA 2WKMA 3HUBA 5BVNA 3N4UA 2ESMA 4C38A 3UC4A 4DAWA 4F7JA 3SRVA 5LOHA 2UV2A 3H9RA 3CP9A 2P2HA 4GSBA 3Q3BA 5CWZA 5HLPA 1Y6BA 4EJNA 1PKGA 4G6NA 3PG3A 4ANNA 2WMVA 4CFMA 3C0IA 2WXVA 3PP0A 4WG5A 3ORIA 3FE3A 4B0GA 3KK8A 3V5TA 3PZEA 5IU2A 3NW7A 4HGEA 3HP5A 1GY3A 2NP8A 2CDZA 3NUAA 3R7YA 3O8TA 2AYPA 4P5ZA 5HI2A 4DTKA 1JKLA 3PE2A 5EQPA 2GNLA 3PPZA 2PWLA 4XP3A 4G34A 3VS0A 4E20A 3V3VA 4ZSAA 4ZTMA 3CLYA 4F7LA 1W83A 2C0IA 5IG1A 4EKLA 5I9YA 3EQRA 4HVHA 4L6QA 5C01A 5KHXA 4WG4A 5AIKA 3DKFA 4NZWB 4EQUA 3IDBA 4OTDA 4FTNA 3P79A 3PSDA 4YZDA 3GCSA 5HX6A 3GC9A 1OZ1A 3IG7A 2HW6A 4O38A 4FV9A 5AUXA 5T3QA 4RX9A 4AF3A 4MQ2A 3LE6A 4RIYA 1ZMUA 3AC1A 4OTGA 4YURA 3LMHA 3IPHA 4OTHA 5KHWA 1UU3A 3BI6A 3P86A 4AP7A 5IQAA 1U59A 3MFTA 4IQ6A 2R3QA 5C1QB 5ANKA 5LMKC 2VWBA 4PX6A 4GK3A 3FUPA 3GQIA 4GG7A 3HV3A 5F4NA 3KXHA 3OHTA 3CSVA 4UWYA 4D0WA 1H8FA 2PZRA 2C6KA 3FQHA 3LFFA 2CGUA 3NWWA 4FV0A 4NT4A 2RFSA 3B2WA 3IGGA 4UZHA 5CU4A 4GJ3A 5IH6A 5CNOA 4A9UA 4JIKA 4CV8A 3KN6A 4DG2E 1YI4A 5FXRA 2ZDTA 1BLXA 4F65A 4QNAA 3ZFMA 4F6UA 3QHWA 4HYSA 3COIA 4BDEA 3UZPA 5FXQA 3WZDA 3ZRMA 5FRIA 4CZTA 3MVJA 3DKOA 2Y4PA 2UVYA 2HOGA 2IG7A 5CLPA 2CMWA 1YHWA 2VTOA 1Q62A 3UOLA 4GVAA 5I9ZA 4NM3A 4O86A 4K6ZA 3WE4A 3CJFA 4GJ2A 2ZM4A 5CSVA 5IUGA 3UVQA 3LJ0A 4DFZE 5EYCA 4FL2A 3KREA 5DLSA 3MDYA 3VQHA 3Q6UA 1XQZA 2W1HA 3ZO3A 4FIJA 3AMYA 1Q8TA 2O64A 5EI6A 4BTMA 1JKKA 5C27A 3TNWA 5ANIA 4D2RA 4G9RA 3FL4A 2ERKA 3L1SA 2O63A 4KKEA 4WG3A 5A14A 4YJVA 4YBJA 2C6OA 5IQCA 4ZXTA 3AXWA 1UA2A 1A9UA 3KU2A 3AD6A 4F70A 3SG9A 2YCSA 3QKLA 2YJRA 1XWSA 2IVVA 2R0IA 5CX9A 4FNYA 3UYTA 4BF2A 3OW3A 3LCKA 4FEXA 5C03A 4CFFA 3C13A 2XEZA 5GJDA 4ALVA 5M56A 3W32A 2UZTA 5J95A 4F9YA 4KINA 2RFEA 1W82A 3GC7A 2XJ0A 4C33A 2ITTA 3BE2A 4XP0A 1OKWA 2G2FA 2C5OA 2UZEA 1YI3A 4GT3A 5DR6A 3R8MA 5J9LA 4XV9A 4NU1A 5AP5A 4A06A 2PPQA 3ORXA 4O7YA 4RX7A 3DK3A 4IBMA 1H28A 1L3RE 2H9VA 4TNDA 4FOBA 1JKTA 3LOKA 4GUBA 4L9IA 5TF9A 4B6LA 4MF1A 4UYAA 4TY1A 4PMTA 3ZRKA 4PDYA 1A06A 3PSCA 4AFJA 5FDPA 4UMQA 4BIEA 4C2WA 4E1ZA 2ZB1A 1OIQA 4Y46A 5F94A 4LV5A 2Z8CA 2RIOA 1PXNA 4QP3A 4K11A 3D2IA 2WTVA 4O0TA 4FG9A 2F9GA 5AM6A 1ND4A 2X4FA 5LWMA 4O91A 5CXZA 2R3GA 3W2QA 4OR5A 2F7XE 3EQBA 4PNIA 3WF5A 4DEDA 3U9CA 1ZYCA 1GIJA 4ITJA 2WTJA 5BUEA 5EI8A 2X8EA 2GQSA 2VTNA 4TN6A 5KMJA 1Y57A 2F7EE 1V0OA 4KBAA 5AP7A 4I6FA 5LARA 1SVEA 4BIDA 4E93A 4EK4A 5L2WA 1Z9XA 3U54A 2JKKA 3DJ7A 4Y5QA 2OH4A 1KV1A 1P14A 3R01A 4N70A 3SVVA 2CGWA 3KRXA 4L7SA 2PVFA 2PU8A 5IA0A 5TO8A 3DY7A 3R1SA 2FUMA 2FB8A 5L2SA 5T6KA 3RTPA 2G1TA 3VS2A 4FSZA 4YU2A 4IX5A 5CENA 4O84A 4H3BA 3E62A 3BU5A 2WPAA 1H1RA 5M55A 4BFMA 1R3CA 1KE7A 4JXFA 1OBGA 4UBAA 2WTKC 3GU8A 3R04A 4XG3A 4TZRA 5L6OA 4YP8A 1M2RA 3BGPA 3FMKA 4IJ9A 2I0VA 3C4CA 4CYJA 4YLLA 5BVEA 4AW1A 3E7OA 3QTWA 4KS8A 2VTLA 3A8XA 2VZ6A 5BVKA 4Y72A 2FGIA 2WMRA 4GIIA 4ZTNA 1B6CB 1RE8A 3HRFA 3NNUA 3W2SA 2A19B 3D5XA 2C1AA 1F0QA 3I81A 1XH5A 4DGOA 3SXRA 4EZ5A 3PIYA 1PXLA 4G2FA 2WTWA 3PIZA 4QMOA 3MTFA 2C6LA 3F9NA 2XK3A 4IXPA 5AR3A 3CQWA 2YIWA 1HOWA 1CM8A 3G9LX 4RJ7A 1DI9A 3PUPA 2JDRA 4R3RA 4BICA 4LYNA 3R9NA 4MNFA 3TUCA 4HGLA 2W0JA 4O96A 2OG8A 3GFEA 3Q9ZA 5E90A 3VO3A 4PPBA 3ZONA 5CEOA 2WELA 4UV0A 4FSNA 3KKVA 5FDXA 3ZM4A 2UZUE 3B8RA 4A07A 3QZGA 1RW8A 3R71A 1CMKE 2O2UA 4S33A 4BDIA 4IM2A 5CVFA 2X6EA 3MI9A 3EWHA 5B2KA 3Q4TA 2VRXA 2C6EA 3UODA 4Y95A 2WTKB 4ZTLA 3HZTA 4RWKA 2J5FA 4X6RA 3DV3A 2X2MA 2WQNA 4BL1A 4EKKA 4B99A 5IA1A 3DLZA 3JXWA 5FTQA 3KXGA 2I7QA 1VEBA 4M84A 2GQRA 2ZV7A 3GU6A 5DHJA 3OCBA 2PSQA 2QO2A 2O0UA 4BTJA 2R2PA 1Q61A 3OWLA 3SXSA 1HCLA 4HCTA 3FMJA 3COMA 4XG6A 5H8BA 4QMXA 2VWZA 4MYGA 5DE2A 3WF9A 3ORTA 2RKUA 4YJNA 2ZAZA 3FMHA 4MWIA 3KC3A 2XIZA 4IDTA 5IMXA 2VGPA 1OUKA 5CQUA 4AN3A 5E8YA 5FEDA 2FSLX 4RZWA 4YNOA 2A0CX 2EXEA 3RP9A 3VRZA 5TT7A 4G5PA 3ORLA 4CMTA 2YIYA 3R30A 4D1ZA 4MBIA 4R5SA 5K5NA 4MXZA 2HY0A 4QYFA 4BCIA 4USEA 3GVUA 3BYOA 3K54A 4F6WA 2QOIA 5G6VA 3BHYA 1T46A 2BRNA 5C8MA 5LQFA 5EQYA 2YWPA 1UU9A 2X39A 3EQHA 3KRLA 4RZVA 4BCKA 5GNKA 5FG8A 4H3QA 2JBPA 4M69B 3OXTA 3QRTA 1IRKA 4G6LA 4FGRA 4ZY4A 1P2AA 2E2BA 3CC6A 2UZDA 1YDRE 5EHOA 2XIXA 4XV3A 4FK3A 2H6DA 5JGBA 5BVOA 2YEXA 3TT0A 3DBCA 4Y83A 1WBSA 5GZAA 5KX8A 2XNMA 3QD2B 4DH8A 2A1AB 4LG4A 1APME 3LXPA 4X21A 4IX6A 5I9XA 4IDVA 5JT2A 3QTXA 3BWFA 4LL0A 1F3MC 1GOLA 2DYLA 1OPJA 2VTIA 4EOJA 2PE2A 4JR7A 5IF1A 3A7JA 1ATPE 4IAKA 4L42A 3F61A 3DNDA 3QQHA 3L8XA 1SM2A 2UZVA 4JRNA 5AADA 5LVPA 2Y9QA 4R3CA 4WRGA 4KIKB 3E8CA 4UMPA 5IH5A 4EUUA 1OGUA 3MY5A 3FLQA 4TNBA 3UPXA 3ODZX 5DT3A 3ZXZA 3S0OA 3VS7A 3ZSIA 2Z7QA 5LMBA 4OT5A 2WD1A 5EYKA 1VYZA 3BX5A 3FWQA 2PYWA 2FH9A 4KD1A 4RX5A 3N4VA 4FKSA 3SXFA 4WNMA 2UZWE 2X0GA 3IW7A 2BRHA 3R8PA 1SVHA 4GK4A 4NIFA 2HXLA 3RWPA 4C36A 3HMNA 5HU9A 4WBOA 3BQCA 4FYNA 5HBEA 1S9JA 3NSZA 4ERWA 3QYZA 4GKHA 4QMLA 5KBRA 3PWDA 5LXMA 4YPSA 3VBTA 4FVPA 4UWBA 4G16A 2J0JA 4YNEA 2J0KA 4HW7A 2UUEA 3ZH8A 5IEXA 3LVPA 3BKBA 4QP7A 4ANSA 2XJ1A 3QWKA 2QLQA 3S3IA 2W9ZB 4OT6A 2RFNA 4G3GA 4J98A 1P4OA 2SRCA 4FTIA 2C30A 4YJQA 1M52A 2R3MA 4ZLZA 5J7BA 4G3EA 2ONLA 4JG7A 3C9WA 4D55A 5ANEA 4DFBA 3KULA 5ETFA 4IH8A 5AAGA 2YERA 4ARKA 4CRLA 4AN2A 3BYVA 4FGBA 5E92A 4YHFA 3FXXA 3KXZA 5HG8A 2VD5A 3FL5A 4DCEA 3L9NA 3H4JA 2BRGA 4IIRA 2Z7SA 4BGGA 3LFNA 2VV9A 4IVBA 4KIQA 3HP2A 4QT1A 4X3JA 4DG3E 5IQFA 3BEAA 3W2CA 5KZIA 4RJ5A 1Q8YA 2R64A 1Q3WA 1BL7A 1OM1A 2R7IA 3NX8A 3PXKA 5CSXA 2A27A 3TDWA 4A9RA 4BCJA 3AT2A 4TYIA 4BKJA 4WIHA 4ITIA 4C8BA 3QF9A 5A4CA 3ZTXA 3BRBA 3FJQE 4C4FA 3QXOA 4O0XA 4LGHA 5HO8A 4EH5A 4HZSA 1KE5A 4WOVA 3CTHA 1W8CA 3O71A 4ZY6A 2GS7A 2OJ9A 1LR4A 4CCBA 2VX3A 1UV5A 3NGAA 4YTIA 3VQUA 4YUQA 1SVGA 2C3IB 3KXNA 4FEQA 3MY0A 2DWBA 4K33A 5ACKA 3IS5A 5LWNA 2XM8A 4RMZA 3KMUA 1JSUA 5A4LA 3BLHA 4CTBA 3S95A 1H4LA 4CFWA 3LFEA 2WHBA 3QTIA 4K1BA 4BCMA 3DB6A 3P7BA 1A48A 4FTMA 2I6LA 4EOMA 3PLSA 4IZAA 4DINA 3CD3A 3DCVA 4U9AA 3MVMA 5L3AA 2LGCA 4RA5A 3REPA 3MH3A 4OW8A 4W9XA 1DAWA 3EQFA 3KRWA 1WMKA 3C51A 1Q24A 2ACXA 4FKGA 2B1PA 2R3FA 3PZHA 3V51A 3OF0A 4KSPA 3UG2A 1FVVA 4NKAA 4IADA 3CEKA 4QTBA 4J71A 4O22A 5GJFA 3DT1A 4OTIA 3JPVA 1YQJA 4FKJA 3R1NA 4BDGA 3ANQA 3GOKA 2JITA 2WGJA 4JOAA 4CKIA 2XK8A 2ITVA 5AV0A 4LM5A 3ZDUA 5HE2A 4OTFA 2ZJWA 1H26A 3QHRA 2IWIA 3G0FA 1ZOHA 3OMVA 5A46A 3DGKA 3ALOA 4C4JA 5DMZA 3P7AA 2W96B 3L9LA 1GIHA 1K2PA 5IQIA 4X0MA 4UZDA 2QKRA 3VWAA 3PJ3A 5AX3A 3KK9A 3TKIA 4D2WA 3NW5A 3QGWA 5JZNA 3RALA 2B9JA 2C3JA 3Q9XA 4Y73A 3SC1A 4BHZA 4WNOA 3FXZA 4X2JA 4RC2A 1Q97A 2WQEA 3KL8A 4J53A 1R0EA 3D83A 3CS9A 3E64A 4M0ZA 4DH7A 2NNWB 4XG2A 2NO3A 3CPCA 3DFAA 3K2LA 1PXOA 2W1ZA 4RGJA 3PY3A 3VUIA 2O8YA 4MXXA 3EKKA 4HVDA 5IA4A 1O6LA 4FYOA 5HNGA 3OWJA 3LKMA 2VU3A 3E92A 4PF4A 4MNEA 1V1KA 4RSSA 3W16A 5IDNA 3G0EA 5I9WA 4BDAA 1CKJA 1UNGA 4F1OA 1Z5MA 4HVSA 4RRVA 3IW5A 3EYGA 3VULA 5CSPA 4QTDA 1ZYSA 2Y8OA 5HVYA 4G1WA 2QOKA 4FV7A 5L8LA 5IUHA 4XOZA 3NW6A 5K9IA 3HMMA 1XKKA 5HE0A 4YLKA 2JEDA 3SRVB 2IVUA 2GDOA 3AMAA 2VWIA 3NIEA 2GU8A 2PVNA 3QL8A 3PXYA 4J52A 4QP4A 3TNPC 1PY5A 2OSCA 4S31A 4U5JA 2PUNA 3GCVA 3OWKA 4LGGA 4MBLA 4XJ0A 3PLAE 2PVLA 3F2AA 4M12A 5EM7A 3RPSA 2OJGA 4A9TA 3DKGA 4GEOA 5HVJA 3G9NA 3NUUA 4U7ZA 4Q5HA 4Y5HA 2J51A 3DFCB 4IX4A 5D7VA 2FSMX 4AZEA 3R9HA 5JFXA 3K5VA 4RT7A 3FKLA 4EH4A 2JC6A 1YWRA 4DN5A 3BHUA 1KSWA 1I44A 3CQUA 3IW6A 4A9SA 1Q8WA 2IW6A 4PTEA 4U0IA 4BRXA 5AA9A 3FMLA 1YW2A 5AUVA 4DFLA 4G9CA 2V7AA 3FZOA 3LCTA 3VF8A 4MTAA 4D5HA 3IGOA 4FV1A 5AP0A 2O3PA 4Q9ZA 1IEPA 2X8DA 2WTIA 2W1EA 3HUCA 5J9ZA 4O83A 1IAJA 1GZKA 5J1WA 2B53A 2G15A 3R28A 4U45A 5EH0A 1BI7A 3FLSA 3LXLA 3EQPA 4DEBA 2J4ZA 4RIYB 3R9RA 3HV5A 2E9NA 4I41A 4C57A 4C4EA 5AJQA 4RC3A 5DRDA 4CMUA 4CFUA 3R7GA 3E87A 1J7LA 2OK1A 1MQ4A 2HIWA 2WEVA 4W4XA 3DXPA 5GHVA 1OL2A 4AZVA 3C4FA 4DG0E 1PMEA 5HZNA 2WQMA 3OT3A 4PMSA 5F1ZA 3LMIA 3QD0A 2OIQA 5FEEA 4AU8A 2BKZA 3E8DA 2C5YA 4F0GA 1JNKA 2G9XA 2W1CA 2WU7A 1KE8A 4AGWA 1V0PA 2VN9A 5AMNA 4JBOA 3LFCA 2Z2WA 3VS4A 3LCSA 4I20A 4F1MA 3CQEA 2OKRA 2VWUA 5KO1A 4MX9A 3ITZA 2CCHA 3W18A 5E7RA 5EI2A 2VTPA 4GK2A 3LCOA 4UEUA 3BYMA 3V04A 4D4SA 4ZZNA 5BX0A 2IZSA 5AP1A 5EOLA 4K2RA 1W84A 5AUTA 4NJ3A 1RQQA 5EM5A 3FHIA 5DR9A 3FLNC 1H1QA 4L67A 3D5WA 3NR9A 3OROA 5BVFA 4KUJA 3R83A 4BWKA 3DXQA 2IPXA 4FUYA 1YRPA 2VGOA 5CT7A 2YM7A 5C4LA 3R7UA 2W4JA 3TNQB 1PW2A 2GHGA 3ZXTA 3CBLA 3A2CA 1M7NA 3FYJX 4NEUA 2B9HA 4DH5A 5HKMA 5HTIA 4CEGA 3PY0A 2NRYA 2XBAA 3NRMA 4ZTHA 5B0XA 3V6RA 3W2RA 3WF7A 4IHPA 2CKQA 3KQ7A 4AQCA 5EK7A 3UMXA 3TNHA 2ZV8A 4YO6A 3OEZA 4EH2A 3EQIA 4D2VA 1OKYA 3QA8A 4QP2A 5JMSA 2YIXA 1NY3A 4DGLC 4CQEA 4J95A 3QQJA 4UMUA 2X7FA 5IA2A 2R3KA 3IOPA 2QCSA 4I93A 4EC8A 3RAHA 4K18A 4IWDA 4AS0A 4CTCA 3W10A 1FQ1B 3I79A 3PA4A 4EK6A 2NPQA 3IW8A 4RIOA 4Z7GA 5I9UA 4RIWA 3QRJA 2ZB0A 4ACHA 5JSMA 4J8MA 4NW6A 5BYZA 3EIDA 1U5QA 1YXTA 2ITPA 3FZSA 3QZFA 4QOXA 4DFUA 1TQPA 3OZ6A 4PL5A 1OITA 3DLSA 3EN5A 2YHVA 2YCQA 1IASA 4IM3A 4NKSA 2WMXA 4JDIA 4IVCA 4ACDA 3ENHA 2Z7LA 3MSSA 5E8VA 3RHKA 1PMVA 3QA0A 4H3PA 3I1AA 4XH6A 4CMOA 1YXXA 2GFSA 4EC9A 5CAOA 4NFMA 4YTCA 3C5UA 4RLLA 3N4TA 1QCFA 5IKWA 5HO6A 2PE0A 3U4WA 5CEKA 1H0WA 4J8NA 4P7EA 3LM5A 4U3ZA 4CLIA 4WUAA 3D7TA 4KWPA 3MVHA 4TL0A 3ET7A 4AZFA 5EKNA 4E26A 5GIOE 5IEVA 1GNGA 3MV5A 1OVEA 4NM7A 3GUBA 3O7LD 3WZJA 5JQ5A 3OW4A 1O6KA 3FKOA 2OU7A 1JLUE 1Q4LA 3O96A 3DKCA 3QCXA 3CJGA 3R0TA 5DBXA 5DEYA 3V8TA 1FINA 1IA9A 3AQVA 5CSHA 3OY1A 4P2KA 4XG8A 4FKOA 4ERKA 1AD5A 3KRRA 4I3ZA 2QNJA 3U51A 2QOOA 3PP1A 3FI3A 4XRLA 4AN9A 2B55A 4I4FA 4NSTA 4E4MA 2X6DA 3ZM9A 1O6YA 3NYOA 4RQVA 1ZOEA 4CG9A 4I94A 4CG8A 4A7CA 1MRVA 4GU9A 3R7IA 4FSMA 3C50A 2YLFA 3ZMMA 3UMWA 1PJKA 4WO5A 4JG8A 4OGRA 5BPYA 3DBQA 4YZCA 3VW8A 3IW4A 3PWYA 4C7TA 2BDJA 4X2GA 4RWJA 4FKUA 2UW9A 3A99A 3EZVA 1YXSA 4FSYA 3O7LB 4LI5A 1OL5A 4Z7HA 3ZS5A 4LMNA 1KWPA 1NVSA 2VO7A 4ZLOA 4CVAA 5A9UA 5DWRA 4ALUA 4C4IA 1FOTA 4ZK5A 3W2PA 4BGHA 1MQBA 4QQJA 3TNIA 3S2PA 2QOFA 4ZSJA 4B9DA 2QOHA 4YO4A 4PDPA 5IQBA 3IDCA 3TIYA 1H08A 3BHTA 3VW6A 3F3UA 5E9EA 3GBZA 1K3AA 3VBVA 4AA5A 3HYHA 4PP7A 4TRLA 4EK8A 1VYWA 5E8TA 4RIXA 1H0VA 4EH6A 4H36A 4EOPA 2EXMA 5E8ZA 4QMUA 2OFUA 3A7IA 3ENMA 1RDQE 2ETKA 2PVYA 3C0HA 2BVAA 4PQNA 3QUDA 3PXQA 3VS5A 5EQEA 1NXKA 2B9FA 1ZYLA 2XP2A 2YM8A 4TWNA 2PMLX 4ID7A 4WUNA 4EEVA 1G3NA 2H8HA 3VVHA 2O5KA 4CFVA 2I0HA 3QC9A 4FZFB 3TG1A 4O82A 1UWJA 5AIRA 3QLGA 1YI6A 4JI9A 2WQOA 4QP1A 4BWXA 1YWNA 3F88A 1TQIA 4V01A 3SX9A 3SW4A 4AOIA 1TKIA 4I4EA 4X2KA 3ORNA 3PXFA 3TKUA 5JZJA 3AOXA 4S30A 3RAWA 5H8GA 3LLTA 3O2MA 3O8UA 4FKLA 5IZFA 2WIHA 4O6LA 1Q8UA 1IA8A 3F3WA 1XH8A 4MAOA 5EG3A 3NCGA 5E8SA 4KAOA 3MIYA 3TUBA 2UW5A 3CXWA 2YN8A 3M2WA 3PA3A 4G17A 4XMOA 3GB2A 4DTAA 3KF7A 4O27B 2CKPA 5I0BA 4BYIA 1NT2A 1R39A 3HGKA 2W5HA 4GYIA 4FKIA 3ZO4A 4A4XA 5CAVA 4O7WA 4JVGA 2UW8A 5C8NA 1SYKA 1DAYA 3CPBA 3RHXA 4YC6A 2QC6A 4XYFA 2ZOQA 4DC2A 1YDTE 2Z7RA 3QAME 4FG8A 4IE9A 4XNEA 3VF9A 1JVPP 3R8UA 1YXVA 3ZFXA 3U6JA 4IWQA 4LRJA 3THBA 2I40A 4HYIA 4BHNA 2BHHA 4BKZA 2QOLA 4JDKA 4KBCA 3ORZA 4LRKA 3QTSA 4YZNA 5AR4A 4HPUE 2CNVA 2QODA 1JAMA 4D1XA 3ZYAA 2PZPA 1ZYJA 3EZRA 3QX2A 2XNOA 2YABA 1Q41A 3COKA 3RKBA 4GKIA 3U87A 5AP2A 3EFKA 3ZZWA 1K9AA 4AFEA 2ONLC 5A3XA 4AT3A 4BBMA 3FZRA 2Q83A 3OWPA 3PVGA 4I6BA 1TVOA 3WBLA 4GCJA 2JFLA 4HJOA 3ATSA 2JDSA 5AR5A 3UQCA 2B0QA 4S2ZA 1JOWB 4FG7A 4CD0A 4E5BA 4PWNA 2JDTA 3PJ8A 3T8OA 4I1ZA 3RAIA 4PMMA 3HEGA 3CTQA 4OTWA 4UALA 5HESA 5HU3A 3SHEA 3UVPA 5ANDA 2W5BA 2ZYBA 3QYWA 3QX4A 3EB0A 2V5QA 1I09A 4NW5A 2G2HA 4PNKA 4NIFB 4BY9E 5E4HA 2GTNA 2W1IA 4BDBA 2YCFA 4B4LA 1J3HA 3CE3A 5AA8A 3JR1A 3CCNA 4MXOA 4FE2A 3BU6A 2J2IB 4CRSA 4DE4A 2QD9A 4FIIA 1GJOA 2VNWA 5BYYA 1XH9A 4F99A 4FTRA 4LFIA 1W7HA 4NK9A 3D9VA 1OPLA 1H01A 3ERKA 4OBOA 1ZMWA 4WRSA 4GFMA 3VS6A 5C26A 2VWVA 3LXNA 4RG0A 3R63A 2WQBA 3KULB 3KMWA 4FT7A 4I0SA 4TYGA 4O81A 4ANBA 2VUWA 4WT6A 4R6VA 4KNBA 3HMIA 3TJCA 4S32A 3BHHA 3FSFA 4BDHA 2UVZA 3UNKA 4ASDA 4M3QA 3WOWA 3SKCA 3OFMA 4EHVA 3KY2A 2YLEA 4WKQA 4CKRA 1WVWA 1FMKA 3Q6WA 2OH0E 1LP4A 2A2AA 2V22A 2JD5A 4FA2A 2UZNA 3BIZA 4AE9A 3ZBFA 1ZY5A 5EHYA 2OBJA 2V55A 2X4ZA 2OLCA 4FNWA 2VTMA 3OCSA 4EBVA 2VAGA 4TYEA 3II5A 3QTRA 2FYSA 4M7IA 4PTCA 5AR8A 4M68A 4EWHA 2WOUA 4IB0A 2FSTX 4TTHB 5KMOA 3NUNA 3NAYA 5H2UA 4D2PA 4BDCA 1WBTA 2BALA 3TV7A 3ZUUA 3QUEA 4O1PA 5M09A 3MBLA 3E8NA 4F6SA 1FVTA 3E3PA 3IK3A 2GSFA 3TZ7A 4D4RA 3QC4A 2WB8A 3C4ZA 3I60A 3QXPA 5BVWA 3I7BA 5DEWA 1FVRA 3UIUA 2GNIA 3SLSA 4HNIA 4EYMA 1NW1A 2HWPA 2HK5A 3MYGA 5IEYA 2J9MA 3OY3A 1DS5A 1REJA 3MFUA 2B54A 3PVUA 5DVRA 5JQ8A 3R02A 2X7OA 5BYLA 2JGZA 4GFGA 2E9PA 4QRCA 4NM0A 2IO6A 4F08A 4F63A 4WD5A 3QD3A 3DNEA 4FTQA 4L01A 5L2TA 2FA2A 3MA6A 4MD8E 3RK5A 4O7LA 2YIQA 2JLDA 3GFWA 4DEIA 5CS6A 4MXCA 3DBEA 4ANQA 2OGVA 3R6XA 4X2NA 3NIZA 3LM0A 5CU3A 4L43A 1Y8YA 2JBOA 2EUFB 3ZEWA 2BDWA 4KBKA 5LMKA 5IPJA 3KB7A 1MRUA
chains in the Genus database with same CATH superfamily
5J5TA 5HD4A 3EN4A 3SD0A 2QR7A 3G6GA 5CANA 2PVKA 4IW0A 3R00A 4U81A 4F9WA 1ZRZA 4HGTA 1G8KA 3UJGA 3RMFA 5CNNA 3WARA 1H1SA 2HELA 2R3NA 3FYKX 2BMCA 5M57A 4DHIB 4DLJA 3CKWA 2C5VA 3F5XA 5H8EA 5AFVA 5DOSA 4BYJA 4D0XA 1OUYA 2ITXA 4A9YA 5A4TA 1PMUA 4DEGA 4YJSA 4DT8A 4IB3A 5C4KA 4WSYA 3QWJA 4AA0A 4E6CA 5HBHA 3P7CA 4QYGA 3LFAA 4D58A 2ITNA 4G3FA 3QQLA 2VTRA 3DK7A 2PMIA 1REKA 3QALE 3ZUTA 4H1MA 1ZOGA 4L53A 5HBJA 3HKOA 4DFNA 1M2PA 4UMTA 3W8QA 3HRCA 4FV6A 4AW0A 3DK6A 1IAHA 5EW8A 3JVRA 2ITYA 3G33A 3DXNA 4JDHA 3TN8A 4E7WA 4O7SA 4MNEB 3A7HA 2GS2A 4O7ZA 2CN8A 3DBFA 4M97A 3U8WA 1XH6A 3MH1A 4I6HA 4ZLYA 5L4QA 1XBBA 3DOGA 4W4YA 5T68A 4OBQA 3QCSA 3NUPA 3TIZA 3Q2MA 1Q5KA 5IDPA 3BV3A 2EXCX 3HECA 4YJOA 5J7HA 2GNFA 3NNXA 5JFWA 1ZLTA 5L2IA 3LPBA 3Q5ZA 3QTQA 4R77A 3V5PA 5AUYA 4F64A 3TJDA 5ETIA 3JYAA 2BRBA 5CVGA 3WIGA 2PVRA 2XMYA 4IX3A 4D2SA 3GU7A 4XLIA 3UOHA 3OOMA 4GRBA 2R4BA 3L8VA 3ZZEA 2EB3A 1P4FA 3UQFA 3ALNA 5DYJA 2GQGA 2C6DA 3C4XA 2ITOA 2VTHA 3OVVA 5L2QA 1DI8A 4PPAA 1W2DA 4PTGA 2P0CA 4QMYA 5BQ0A 4YJPA 4BJJB 2VX0A 5LMAA 4JQ7A 1TQMA 3NUXA 2OW3A 2WEIA 2RFDA 3NNWA 4TW9A 3B2TA 5AWMA 1G8AA 3JS2A 3LLAA 3T3UA 2IVSA 4YTHA 3TUDA 4YSJA 4QMZA 5EYDA 4U97A 3QRUA 3VBWA 2WTDA 4W9WA 5JRQA 5M4CA 4JR3A 5HVKA 3Q4ZA 3DA6A 3UIMA 2BAQA 2XK6A 1U5RA 5AAEA 4IB1A 4M66A 1XJDA 4ZZOA 3D7ZA 4O4CA 2RSVA 4IJPA 1OL1A 3BU3A 4DFYA 5JH6A 3U6HA 4FEUA 3RVGA 1H1PA 2XF0A 4FK6A 2RGPA 3MB7A 3V5LA 1SMHA 3L8SA 4R8QA 4A4OA 2R3OA 3MTLA 2YM6A 1YDSE 3BZ3A 3W0NA 4I5MA 5K4IA 4UX9A 3GNIB 3AGLA 1WBNA 4NWMA 4UYNA 3ORKA 2PUIA 3OC1A 3QQGA 4IAIA 3GGFA 3WE8A 3FEGA 3RZFA 3TXOA 4AACA 4H58A 1Q3DA 5D9HA 3N51A 2RF9A 5HEZA 5AUUA 1OECA 5FGKA 3MESA 2P55A 1FGKA 3OD6X 4DITA 3Q53A 4F7SA 5FEQA 2IZTA 3WILA 4ACMA 2C69A 4FKPA 4H39A 3S1HA 3OOGA 4O0UA 4O7VA 3G2FA 2PUPA 2XRUA 3UOKA 4DCAA 4W8EA 2X81A 4EBWA 5J1VA 4F1TA 4GW8A 2NRUA 4AZTA 3AC4A 3V01A 3DTCA 4JBQA 1AQ1A 4BWPA 4EQMA 3LQ3A 3OCTA 5HICA 2WMBA 2X8IA 4FKWA 5F20A 5KCVA 2XIRA 4GU6A 4PY1A 3D14A 1PXJA 3RI1A 3P1AA 2XH5A 4C59A 3F5PA 1ZZ2A 3D5VA 5HD7A 5DR2A 2HWOA 3E63A 2JKQA 3FBVA 4QYEA 4Q9SA 2BZKB 4C0TA 3PUFC 3O23A 2PVJA 3ZLYA 3T3VA 1DM2A 1SZMA 2O65A 4TWPA 1URCA 2GNGA 3UG1A 1J91A 3OEFX 3G5DA 3HV6A 3H0ZA 4KABA 4ALWA 3WF6A 4MF0A 5GIPE 3LIJA 1B39A 2BHEA 3Q04A 5CAPA 2YCRA 4FV8A 4MK0A 4S34A 3TTJA 3GCUA 5BV3A 2OXYA 5IQGA 4JJRA 2CPKE 2EB2A 4BDFA 2BCJA 3RAKA 1XBCA 2XVDA 2A4LA 3D4QA 4GH2A 4AT4A 1Z57A 4RJ3A 1FMOE 4O0VA 4XOYA 4Z9LA 2PVMA 5HNIX 4IB5A 5CALA 5EFQA 1UKHA 4XBRA 4CXAA 2VTQA 1JBPE 4N0SA 5JEBA 3KF4A 5EW3A 2HENA 4TT7A 3F5UA 4FI1A 3D2KA 4RIWB 2XKEA 2PVHA 4EOLA 4QMMA 3VUKA 1QPJA 4QQTA 5J87A 3EYHA 2EU9A 2PZYA 4LOPA 3RZBA 4I23A 4ACCA 5B2LA 2PZ5A 1VJYA 3ACKA 3UNJA 3BELA 3O50A 3SDJA 4APCA 1F5QA 3R73A 2IW8A 4FSTA 1OKZA 5KNJA 2BIYA 3NDMA 4M67A 4C34A 1G8JA 2JKMA 2QKWB 3PVBA 1OPKA 1YXUA 4LMUA 4BIBA 3VAPA 4EI4A 3IONA 1GZ8A 1KE9A 3CGFA 4BDDA 4E5WA 2H34A 2GHLA 3BGQA 4X2FA 4RFMA 5JRSA 3WZUA 2PTKA 4ACGA 3I5NA 4KIKA 4E6AA 3VBYA 3VUDA 1XHAA 4HGSA 2X7GA 1JSTA 3ANRA 3D7TB 3OS3A 4ZTQA 3RPVA 3ZO1A 3ZOSA 1QPEA 2REIA 2QG7A 3U9NA 4F9BA 5M4FA 3EQCA 3TZ8A 2BR1A 4NCTA 2R3JA 4FSWA 5CAQA 3FAAA 1V0BA 1GZNA 4YZ9A 3PYYA 2PUUA 4I5PA 4JT3A 3VUHA 3S4QA 1AGWA 2EWAA 4A4LA 1CKPA 3PRFA 4DGGA 4LUDA 5C9CA 4IVDA 3R7VA 2FSOX 3RCJA 2VWYA 3FZ1A 1PF8A 2JIIA 3QFVA 4WA9A 3V8SA 4ASEA 5M06A 5CASA 3R9OA 4FV5A 5E8UA 3UP2A 3KA0A 4H1JA 3I0OA 4FNXA 2X2LA 2C6TA 3ID6C 3O8PA 1YOLA 1JSVA 2QI8A 4RJ4A 2C0TA 4EH9A 2CSNA 3H3CA 2YA9A 1ST0A 2XA4A 3EL7A 1W0XC 4CFNA 2JAMA 2BTRA 1P5EA 2WAJA 3WYYA 5EDPA 4XG4A 4R1YA 4ZSEA 3MH0A 4IC8A 4QTEA 5K0KA 3LQ8A 3WZKA 4BDKA 4N57A 4FSUA 2R3RA 4F09A 4LV8A 1S9IA 4O4FA 3TI1A 2VO0A 3NFGB 1KUTA 4ANMA 2F2UA 2RL5A 3AD4A 4IFGA 4O4EA 4RC4A 4Z55A 4BI0A 2YITA 4X6QC 2ZV9A 2BAJA 4D5KA 4F9CA 3LFSA 2X2KA 1OIUA 2HYYA 2W05A 3LFBA 1QMZA 5CYIA 4RWIA 4YZMA 2XKFA 5KE0A 1OI9A 5DNRA 3FSKA 3NLBA 5BVDA 5D41A 3K3IA 3RNYA 4DBNA 4LOOA 3UC3A 2GNJA 3R7EA 4FV4A 2WMWA 5D11A 4FUXA 2ITZA 2J5EA 2XNBA 3QD4A 1BX6A 4AOJA 4O0RA 4EH3A 5K0XA 4RIXB 4KIPA 5AUWA 5GZ9A 1XR1A 2P2IA 4MWHA 2W99B 4DF3A 5TE0A 4CQGA 4D9TA 5EHLA 3IECA 2OXXA 2VNYA 2HAKA 3KEXA 3NYNA 4RJ6A 4D1SA 2BIKB 4ZS4A 2AC5A 2UVXA 4L46A 5L8KA 2J6MA 2XIYA 2QG5A 3DQWA 3F69A 3GP0A 3WIKA 2OJFE 2XCHA 3AT4A 4M13A 2ITQA 3Q32A 2QR8A 2I0YA 2F4JA 4IFCA 4BC6A 4C58A 5J8IA 5ITAA 4UY9A 3UBDA 5M07A 5DIAA 3KXMA 4F78A 1WVXA 3H10A 3E8EA 3RPYA 2BDFA 4B8MA 2GCDA 3MN3A 4IWOA 4B8LA 4EK5A 2ERZE 3GU4A 4HCUA 1BMKA 5JK3A 1JKSA 2OO8X 4BI2A 3KGAA 3OP5A 1ZYDA 4U6RA 4D2TA 5AP4A 3FXWA 4FEVA 3DAKA 2ZM3A 2QVSE 2YDKA 4FVRA 3RNIA 3MY1A 3U54A 4L8MA 4C61A 3UO5A 4AWIA 5M44A 3MWUA 3HMPA 4JLCA 1PHKA 3DQXA 3VS1A 4C3FA 4CT1A 4EHGA 3P5KA 1SNXA 5IA3A 4AT5A 2R9SA 2VWWA 4YR8A 3QCQA 3P23A 4USDA 4HVIA 3T9IA 4IZYA 3VS3A 1JPAA 3TL8A 2ZFYA 2BZJA 3OG7A 2YIRA 4ONAA 2YAKA 4L7FA 2QOBA 5AV4A 1T45A 3LMGA 3RK9A 3FC2A 5CSWA 4L00A 2QQ7A 2VO6A 3DDPA 4FC0A 3UIXA 3FLZA 4EZ7A 5DT4A 5KBQA 1J7IA 4AA4A 3R2YA 3LQ5A 3L9MA 4JS8A 3LFDA 4RVTA 2IN6A 1BL6A 3A60A 3GCQA 3MA3A 4YBKA 3BE9A 4XUFA 4ZSLA 3UYSA 4C02A 2Y7JA 4WNKA 4MCVA 4DT9A 4EORA 3PPKA 4L3JA 3ROYA 3PFQA 3GT8A 2XNNA 3EL8A 5EDQA 1ZMVA 3UDTA 3R7OA 4X3FA 5H9BA 4EHZA 3E3BX 1FBNA 3ZDIA 2GS6A 1M7QA 4YHTA 2YM5A 1OL7A 1WCCA 2C5NA 2OI4X 5KZ0A 3ZHPC 4EOIA 3TEIA 3PJ1A 3TZMA 3ETAA 4G3CA 4CT2A 3HDNA 4BTFA 3M1SA 4QMSA 4L3PA 2WO6A 4GIHA 1KE6A 3DS6A 3MS9A 4GVJA 3SAYA 4MBJA 3U55A 2WFYA 4XRJA 3VUGA 3AG9A 4EONA 2VTJA 3SG8A 2BZIB 3IDPA 3QQFA 4ZZMA 4WSQA 3VHEA 4O0YA 4QDVA 4TYHA 2YFXA 2Q0BA 3PY1A 3NUSA 4QO9A 4FT9A 2I0EA 4YLJA 4CKJA 4DEHA 1KOAA 2WU6A 4HNFA 4IMYA 4USFA 4U44A 2E9OA 4TPTA 3CY2A 3FPQA 4QP8A 3FZTA 4FL3A 3HLLA 4NJDA 3VC4A 3EH9A 1UNHA 3GC8A 3KRJA 2YWVA 4QMTA 5K3YA 4DEEA 3A8WA 2I1MA 2AUHA 4QPSA 5HE1A 2UW3A 3BBWA 4BKYA 4EOSA 5A54A 3SA0A 3EHAA 5CXHA 3RK7A 4FV2A 4C3PA 5CF4A 4CGAA 3W33A 2Y6MA 2J0MB 5ACBC 4BCQA 1QL6A 2YISA 4K0YA 2OZAA 4IACA 4EH7A 2BAKA 1ERKA 4AAAA 1JWHA 4BCOA 3DPKA 3F7ZA 4XLVA 5B7VA 1BUHA 2GMXA 3NAXA 3KVWA 3ZRLA 1U54A 1VR2A 4R78A 2R3HA 4LOQA 3LW0A 2X9EA 3AC2A 3R21A 3QU0A 3F3VA 4U79A 1PXKA 3G51A 2IZUA 2Y0AA 3BLQA 4FIFA 1OBDA 3BV2A 4YMJA 3R22A 1YWVA 2WMAA 2C5XA 4ZEGA 5BMSA 5HIEA 5IH4A 2QHNA 4RVLA 4XV1A 2XBJA 2XK7A 4JNWA 4OTPA 4BTKA 4KRCA 5K5XA 3VBQA 3RBWA 5F95A 4QTAA 1LEWA 1ZAOA 4MXYA 4GT5A 3ROCA 4PMPA 3R8VA 2BFYA 4TWOA 4I5HA 4IAAA 3FMEA 3FLYA 4QPMA 4QYHA 3C1XA 3TKHA 2UW4A 4NH1A 4K9YA 3UO4A 4C2VA 1PXIA 4ZJIA 5CF8A 2AQXA 5IA5A 4QYYA 3FV8A 2XJ2A 3H9OA 5FTOA 3U4UA 3BL9A 3EKNA 5E1SA 3ATTA 1OKVA 3O5AA 4GUEA 4AZSA 5M51A 5KMLA 5ANOA 3TWJA 3QQUA 4EK3A 4PRJA 1PXMA 5HGIA 5A6NA 3F7WA 2OZOA 2QU6A 4FT0A 3RPRA 5LJJA 1XBAA 2CGVA 3PSBA 4L52A 4M8TA 3DJ6A 4WHZA 5E8WA 4BBEA 3ZUVA 2CNUA 4EQCA 4DTBA 2NYAA 4CZUA 4O0WA 2R3IA 2OWBA 4BDJA 3MB6A 4C62A 5CEPA 3HAMA 4M14A 3CKXA 3Q9YA 4ZS0A 3TDVA 2Q0NA 2ITWA 1URWA 4FTOA 4U40A 1ZARA 2KULA 4C4HA 4RWLA 4YGAA 5M4UA 4D28A 4K77A 4LL5A 4O7TA 3TM0A 4FZ7A 4U43A 4IC7A 5DA3A 3COHA 5EKOA 4R7BA 2C6IA 4FTKA 5HCZA 3V6SA 4J96A 1JQHA 3QCYA 3A7GA 5EW9A 2AC3A 3HRBA 4BZOA 4OBPA 3RWQA 1BI8A 5IQEA 4IANA 5E1EA 5JN2A 5AP3A 3HV7A 4CYIA 4YC8A 3ZC6A 4EZ3A 4IAYA 4FTUA 5FQDC 5FTGA 4FV3A 3RINA 5HTBA 3S00A 4PP9A 2IZRA 3NPCA 2J50A 4HYUA 3TV4A 4D4YA 3FQSA 3KFAA 4V0GA 5CAUA 4AX8A 3MIAA 3PIXA 4N6YA 4XG7A 4ENYA 5CI7A 2P4IA 4UN0C 4YJTA 2UW7A 2W06A 1XH4A 3D15A 4FT3A 4E6QA 4R1VA 2VWXA 3ZEPA 5EM6A 5TKDA 3FLWA 3QKMA 2OFVA 3R8LA 1WBVA 4FVQA 4HZRA 5DG5A 3DDQA 3OXZA 4P5QA 4W4WA 4EH8A 4FKVA 3D0EA 3BCEA 3D5UA 4F7NA 1PXPA 1UNLA 3WZEA 1UVRA 1YHVA 4FTCA 4GS6A 3AT3A 3DTWA 3FMDA 5GINE 3VN9A 1MP8A 4QNYA 4JX3A 5H3QA 3ZBXA 1E1XA 2C3KA 5AR7A 5CF5A 2WMTA 5BMMA 4D4VA 4BR3A 3EQGA 2W7XA 3FQEA 3FI8A 3FDNA 2VX1A 4FX3A 3AC5A 4QPAA 3ZLXA 5FWKK 3IQ7A 3MGYA 2H96A 3FI2A 4F0IA 5I3RA 2OICA 5AV1A 2BROA 3UZRA 5I5ZA 5KMMA 2EVAA 4LQMA 5D1JA 4AGUA 5EOBA 4F9AA 3R1YA 4PDSA 5IQDA 3GI3A 5L8JA 4I21A 4O1OA 4ASZA 3C7QA 4M0YA 4PV0A 4CFXA 5GZ8A 5HO7A 5DGZA 4FODA 3E88A 4AW2A 3Q4UA 3QRKA 3EN7A 3HMOA 4BCPA 2J90A 5IUIA 4DDGA 3VIDA 1PMNA 2DS1A 2W4OA 3PVWA 3V5JA 2XEYA 1PYEA 3JVSA 3PDTA 1EH4A 3PG1A 4LUEA 2V0DA 4QMNA 3QKKA 5AAFA 4FKTA 1XH7A 2PL0A 3POOA 4ZSGA 5G1XA 2C1BA 3O17A 4M15A 4Y8DA 2R0UA 5LVLA 3MPTA 2OIBA 4MH7A 2JFMA 3H9FA 1H24A 1L8TA 1GZOA 4P4CA 1PKDA 2HZNA 1R1WA 1ZY4A 2VO3A 3MH2A 4U42A 3Q96A 2CGXA 5L6WL 3MPAA 2UZLA 4JRVA 4O0SA 4YSMA 3HVCA 2XK4A 2F7ZE 2HZ4A 4ZY5A 3AD5A 3C0GA 4AZWA 1H25A 4KRDA 5AUZA 3NCZA 4DYMA 1NVQA 3WYXA 5JFSA 5HLNA 3F3TA 4L68A 4DBXA 5HIDA 3ACJA 3A62A 1Y8GA 4QQ5A 3PPJA 1J1BA 5A6OA 3A61A 5CEMA 4IZ7A 4XCUA 5HLWA 4RA4A 2GFCA 5AP6A 5HOAA 2WTCA 5LCJA 1MRYA 4OLIA 3Q9WA 3FHRA 3OT8A 4BB4A 4GMYA 5M4IA 1OMWA 4I22A 4E4XA 3HDMA 4ZJVA 2YAAA 2YJSA 3DZOA 1YKRA 4AUAA 5FM3A 4F4PA 2OF4A 5CF6A 2W4KA 5DFPA 2ZDUA 1IR3A 4FNZA 4KKHA 3BWJA 1CDKA 4N6ZA 2GHMA 4EWQA 4Z3VA 3PJCA 5A4EA 2W1FA 4OAUC 3MW1A 4R7IA 4RFYA 2ZMCA 2WMQA 5CTPA 4O2PA 3TCPA 4II5A 5HIBA 4W8DA 4HVGA 4JX7A 2R3LA 4MQ1A 2WMUA 4QD6A 3GU5A 4KKGA 2XRWA 5HG9A 3Q2JA 4XBUA 3VJOA 2UZOA 3B8QA 5J9YA 3CGOA 1M14A 4AXEA 4DHFA 4FTJA 3LJ2A 3UTOA 4FRFA 1WBWA 1R0PA 4FOCA 1G5SA 3EFJA 4NCTC 5AR2A 4GL9A 3ULZA 5AEPA 2OJIA 2CN5A 3NEWA 2P33A 4ORKA 3UP7A 1E9HA 4FSQA 4I6QA 2PMOX 4J1RA 5CEIA 2KTYA 4N4SA 4PL3A 5KMIA 3SW7A 4HCVA 3FMNA 3OTUA 2LAVA 3Q60A 3IKAA 5CU6A 3ZFYA 2YM4A 3BYSA 4HPTE 4J7BA 4DDIA 2OJJA 3P0MA 3GENA 4IZ5A 3R8ZA 2BPMA 4FTTA 4FSRA 4LRMA 5JGDA 2CNQA 2WOTA 2ITUA 4O7NA 4UB7A 4OTRA 3W0SA 3GEQA 5KUPA 4FT5A 1WFCA 2VTSA 5JFVA 2XK9A 3HA8A 3H0YA 4E4LA 3V5QA 1YVJA 3AGMA 2V62A 4J99A 4RJ8A 2ZMDA 2HXQA 2PULA 4BBFA 4APPA 4OTQA 4LGDA 1LUFA 1W2FA 5AM7A 2P3GX 1OB3A 3FI4A 5CZIA 4MVFA 3GQLA 4XEYA 2WMSA 3UVRA 3DAJA 3LFQA 5HE3A 2J7TA 3I7CA 3O0GA 4L44A 3ZSGA 1CKIA 2Z60A 3EFLA 4CSVA 5C8KA 5HORA 4QP6A 3G6HA 4D9UA 3M11A 2XS0A 1QPDA 3VUTA 3SOAA 2XUUA 4YJUA 2CJMA 4YZBA 2GTMA 2QU5A 4W4VA 4ZOGA 4C37A 3CTJA 4RVMA 3AC3A 1Q8ZA 4EOOA 3SGCA 3KCFA 1FPUA 4F0FA 1NVRA 4FIHA 4IAZA 1UWHA 4NTTA 4Y85A 3G15A 2F49A 5EM8A 3UIBA 1GAGA 2V7OA 4EL9A 3ZU7A 4E4NA 4MD7E 5JGAA 4ZTSA 5HHWA 3DAEA 3BPRA 4MXAA 4DGNA 4EOQA 4XS2A 3UOJA 2GPHA 3GOPA 2IVTA 3ULIA 5LVNA 5FUTA 4BCHA 3PXZA 2WZJA 4ZJJA 3CY3A 2BKKA 4RLKA 5HX8A 2IF8A 3LHJA 4JQEA 4FTLA 3G90X 1B38A 4L45A 4DFXE 4Z16A 5K4JA 3P4KA 2R5TA 3GXLA 1LPUA 2QOCA 3RCDA 4PDOA 3UDBA 3WF8A 4AG8A 4NL0A 4JBPA 5BNJA 3M42A 4TYJA 3BQRA 2G01A 3R2BA 4E3CA 5CT0A 4DGMA 1J1CA 5LCKA 4IAFA 1WBPA 4AW5A 3CD8A 3TV6A 5F9EA 2PE1A 3F5GA 3O51A 2QURA 4QMWA 2ZV2A 5A4QA 4E8AA 3PRIA 3KVXA 1OIYA 3AKJA 4O6EA 4EYJA 5DT0A 4DHJA 4AE6A 1CSNA 3VHKA 3OBJA 3TYKA 3EFWA 4C4GA 3T9TA 1YOMA 3FKNA 3MJ2A 3I5ZA 5D10A 3ZC5A 2HZIA 5FD2A 2X0QA 3EMGA 3FPMA 4DA5A 4R7HA 4JG6A 1WZYA 2XCKA 3BBTB 2RG6A 3QTZA 4AQKA 2JDVA 3NVMB 2YDIA 5FXSA 5GJGA 3L9PA 4ANLA 5FLFA 2W5AA 3C4EA 2X1NA 3MVLA 1ZWSA 2BRMA 2Y6OA 2IJMA 4I24A 2E9VA 5CI6A 3OUNB 4AGCA 3HNGA 3QLFA 4G6OA 2Z02A 4ASXA 5HCXA 2W1DA 5HG7A 3NUYA 3W55A 3KCKA 4G5JA 3FC1X 3RM6A 1W98A 5IMEA 2JKOA 1MUOA 3RGFA 3TACA 3UDZA 4BGQA 3FZPA 4IEBA 3NFFB 5I9VA 5J79A 3KMMA 5CVHA 2UW6A 4QTCA 5CU0A 3DBDA 4BZNA 3DZQA 2W9FB 3EN9A 4V04A 5FP5A 5J5SA 4KA3A 3UPZA 3LJ1A 3AMBA 4X3FC 3QRIA 2C3LA 4YHJA 5I3OA 2HW7A 5ETCA 4ANOA 2QO7A 1XMLA 4ZP5A 1Y6AA 1STCE 2C47A 4WBBB 3BGZA 3DJ5A 4GV1A 3BHVA 2ZM1A 2HZ0A 2XKCA 4AGDA 2CLXA 5HQ0A 3C5IA 4I5CA 3HAVA 3QTUA 4RQKA 5KMNA 3UO6A 4M69A 5I4NA 1M17A 1E1VA 1XO2B 4Q5EA 1KV2A 5ICPA 3LXKA 3FY0A 3POZA 3NYVA 4IVAA 3PXRA 4PUZA 4EHEA 4CV9A 3F66A 5HTCA 4HOKA 3F82A 2W17A 5IQHA 4I92A 3E5AA 3EN6A 4I0RA 3DU8A 5FP6A 1TZDA 1X8BA 1UKIA 2C0OA 3OXIA 3QQKA 3QUPA 3RM7A 4ZMFA 3D94A 4MEDA 4ENXA 2QLUA 1WBOA 1BKXA 2BUJA 5EDRA 3IOKA 2XAOA 1KOBA 4JIAA 5DH3A 5AX9A 1O9UA 4UXQA 3QBNA 2YZLA 3WI6A 1PRYA 2XM9A 5L6PA 4JQ8A 4TKSA 4FKQA 1U46A 2ETMA 3K3JA 3LCDA 3QZHA 3A4PA 2R3PA 2XB7A 4HYHA 5E91A 3NVKI 4DEAA 2QONA 4X3FB 2CKEA 3L8PA 2OIDA 4PPCA 5M08A 1UU8A 4XX9A 5CQWA 5HCYA 2XNGA 4NM5A 1GIIA 1HCKA 4ITHA 5D7AA 5BUIA 3ZO2A 4FMQA 3QGYA 3I6UA 4U80A 3FY2A 3OCGA 5ANGA 5FBNC 3GC0A 2WIPA 2XYNA 4RX8A 4ZIMA 2JAVA 3KXXA 3V5WA 4E5AX 2UZBA 4BI1A 4JBVA 3W1FA 2BFXA 1YHSA 2PY3A 4KSQA 2GNHA 3LAUA 3SQQA 2XIKA 4EJ7A 1RJBA 4FL1A 1FGIA 5AV2A 3RJCA 1ZZLA 4FZ6A 2VTTA 5M53A 3UZTA 4YC3A 5TR6A 4DLIA 2F57A 4TYHB 4L3LA 4JL9A 4XG9A 2PHKA 3ZCLA 3UE4A 4C3RA 2W1GA 2CLQA 4QMVA 5IISA 4BCNA 3F3ZA 5CY3A 4AOTA 3I0QA 4X7QA 3C4WA 4FR4A 2XKDA 5KMKA 1WAKA 3NS9A 2JIUA 4BCFA 2C68A 5JKGA 4E73A 1YOJA 3BLRA 3JY0A 4EOKA 3PJ2A 2X0OA 4JDJA 2QO9A 4NYEA 2B52A 3QZIA 4O2ZA 4H05A 4UWCA 4NUSA 1R78A 3ELJA 4O21A 1Q99A 2DUVA 5DRBA 4NFNA 4V05A 4U3YA 3PE1A 3NZ0A 3ORMA 4RBLA 2QOQA 4MKCA 4UXLA 2OZAB 2G2IA 2JDOA 3VUMA 2PK9A 3CR0A 1ZXEA 3AC8A 1H27A 4XV2A 3PA5A 3VONA 2YM3A 3VBXA 4KS7A 4CLJA 5FM2A 4JAIA 3NNVA 2R7BA 2VTAA 3VRYA 4ZMEA 1U54B 2ZVAA 1QPCA 2PMNX 2QHMA 2UW0A 4TXCA 2B9IA 4IWPA 2CHLA 3UGCA 4R5YA 1PYXA 3HL7A 2PZIA 1Y91A 1OL6A 3ZLSA 3AKKA 2HCKA 1WVYA 2OXDA 3OBGA 3BYUA 4PL4A 3SV0A 2CKOA 5DN3A 3ZSHA 1U4DA 2WNTA 3PTGA 2HY81 4JAJA 4BZDA 3I4BA 2JIVA 2Y4IC 3E7VA 4ZTRA 3JUHA 4QMPA 2DQ7X 3R9DA 4GG5A 3TMOA 4FIGA 1H00A 4P90A 3OTVA 4Q2AA 5EYMA 4KB8A 4R3PA 4EUTA 4GYGA 3TTIA 4WNPA 3GCPA 2J0LA 5CU2A 3EJ1A 2FVDA 5AV3A 3P78A 3VJNA 4B7TA 1UU7A 2XZSA 3FMMA 2BILB 1OIRA 2IW9A 5B2MA 2YDJA 3UNZA 3OUKA 4FZAB 3A7FA 4OAVB 3Q4CA 4FBXA 5TOZA 3H30A 3F2RA 4MD9E 3W0OA 3EOCA 2ETRA 3JY9A 2FO0A 4RVKA 3LZBA 5HNBA 4CCUA 3ODYX 3TZ9A 4K8AA 3Q52A 3NMUF 1IG1A 2OF2A 3KN5A 4OUCA 2C6MA 3A4OX 2BTSA 2E9UA 3K5UA 2YZAA 4GFOA 3F2NA 4XHKB 2XALA 5KKRC 4YTFA 3EQDA 3I6WA 2C4GA 2XNPA 4QQCA 3W2OA 3NYXA 4BN1A 3F6XA 3E93A 4FTAA 4QP9A 2Y4IB 1VZOA 2YACA 3HV4A 4I0TA 3VNTA 1CTPE 4FEWA 4FKRA 1G8SA 5CZHA 5FBOA 5LVMA 4GT4A 5BUJA 3IO7A 2B4SB 3CIKA 4BVUA 3MPMA 3P08A 4TWCA 4CNHA 5ANJA 1NA7A 3SOCA 3HX4A 5ETAA 3HA6A 1BYGA 1SNUA 3BEGA 4UMRA 4YPDA 5D12A 3RPOA 5DI1A 2B7AA 4QMQA