5CEOA

Dlk in complex with inhibitor 2-((6-(3,3-difluoropyrrolidin-1-yl)-4-(1-(oxetan-3-yl)piperidin-4-yl)pyridin-2-yl)amino)isonicotinonitrile
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
269
Chain Sequence
LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 12
total genus 85
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ceoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ceoA01
3IONA 2C68A 4RFYA 5DRDA 5DVRA 4BICA 5LMKA 2BILB 3M11A 3ROCA 5BUJA 4RJ3A 1PXOA 4FV6A 2HY81 3KRLA 5M57A 4YURA 3NEWA 2QKWB 5KMKA 5IDNA 3I5NA 3IW5A 3KVWA 2XNOA 1NXKA 2XKCA 4IQ6A 4C3RA 4IX4A 2WQNA 4G3FA 4TY1A 3VS7A 2B0QA 3R63A 2CN5A 3AOXA 2VTLA 2XF0A 4Y85A 5DNRA 4ZTSA 3DZQA 5M4UA 5DEWA 3ZS5A 3G5DA 2H96A 2ITXA 4C58A 5DEYA 5HD4A 4U45A 3R8VA 4AOIA 4EZ3A 4O21A 4BI2A 3TNWA 3UDBA 3BQCA 3DBFA 4FGRA 4PRJA 4MVFA 4H05A 1YI3A 3I4BA 3SXFA 3NVKI 3GC8A 4PMTA 1V1KA 4QMOA 3A99A 3BX5A 3C13A 4M0YA 4Z3VA 5FTOA 4V05A 5CF8A 4F6WA 1UWJA 5EG3A 2QLUA 3OUNB 5AX3A 5KKRC 4NYEA 3FY0A 3POOA 4K9YA 4FSTA 5B2KA 3WYYA 3KXHA 2WMRA 4FIHA 4JG7A 4O6EA 4JI9A 4E6CA 1DM2A 2YZAA 4CZTA 4X6QC 4IB1A 3PXQA 4CFVA 5AFVA 1UU8A 4Y46A 4O7TA 4DBXA 3WI6A 2XCHA 3LCOA 3TZ7A 2XNGA 3PA4A 3QLFA 3AC8A 2CCHA 4KBAA 1W0XC 3I7CA 3EFWA 2I40A 2YABA 3OWPA 2X2MA 2YCSA 5CANA 4I21A 4LUDA 5C4LA 4FKUA 4FL3A 4F4PA 4R6VA 3R73A 3FLZA 1SYKA 2UV2A 5AP7A 3TZ8A 5AUZA 4C02A 4DYMA 5D41A 4EI4A 5A14A 2BHEA 2YDKA 4FICA 3R1NA 2RL5A 2X8EA 3O51A 4MNEA 2HZIA 4JBQA 3MFRA 2HW6A 4DH1A 4BYJA 4FL2A 5E90A 4WT6A 4M67A 4HNIA 2VNWA 5HEZA 5IA5A 4ZTLA 3NIZA 3NWWA 2ITVA 2C3KA 4QMLA 3MIYA 3MW1A 4YPSA 3ZSGA 2YIWA 4UXLA 3NSZA 3FY2A 3LFQA 1R0PA 3ORNA 3R30A 2QI8A 3G6GA 3KL8A 4WIHA 3TG1A 4F9WA 2UW7A 5E8YA 2VD5A 3OCBA 2CGUA 5FEEA 5J8IA 1IAHA 2P4IA 4CMTA 2OJ9A 3ZSHA 1U59A 3BU5A 3QQLA 3W1FA 4GUEA 4IZAA 2VTQA 2JDTA 3JUHA 4DAWA 4GKIA 5JK3A 3MPMA 4XV9A 2VNYA 1BI8A 3L8VA 2BZHB 3EYHA 4BCQA 2GNIA 3MBLA 4HZRA 4X7QA 3P4KA 5IDPA 1H25A 1M17A 3F6XA 2B55A 4QD6A 4EUUA 3A8XA 5DR2A 3MYGA 4AF3A 3ZRKA 4RX8A 5CSHA 4O83A 2B4SB 1XBAA 2UZVA 2C3IB 3DK3A 2WFYA 2WOTA 2YM8A 4O0RA 4DGOA 3GU4A 2HWOA 2YACA 2VTOA 5H3QA 3LMGA 3R2BA 5A4EA 2VWZA 1WBWA 3F3TA 1NY3A 2V0DA 4RWLA 4FEUA 2OW3A 3QD3A 4Z55A 3LFEA 3ZTXA 1H24A 2XKEA 3B2WA 3MVMA 3P0MA 3SRVB 3ZC5A 2OIBA 1JKLA 4QMUA 3QTQA 2JITA 3R04A 5TO8A 5AUYA 4RLKA 4NCTA 2GQRA 2BFXA 2ITQA 4IZYA 4E4NA 2QOBA 5M06A 4BGGA 5ICPA 2YFXA 2ZMDA 2NO3A 3QCYA 2P33A 2WTDA 4W8DA 4QMTA 4XG9A 4A4LA 4FV0A 3G9NA 4HVIA 3K3JA 4PTCA 4CYJA 5L2WA 4EH2A 1FBNA 3GBZA 4XHKB 2C5YA 4DLJA 3E3PA 3P5KA 3UODA 3PVGA 4O7VA 3HX4A 3Q96A 5KBRA 4DTBA 2CKEA 4E93A 1YXXA 4Y95A 2J90A 1JSUA 2Y9QA 4RZWA 5F95A 5IA4A 3O71A 3ORZA 4MXYA 4U6RA 5FM3A 2Z02A 4O96A 2ETRA 5E1EA 3GCQA 3NW6A 2RFSA 2YAKA 4BIDA 3HEGA 3I81A 4FSNA 4YJQA 1J1CA 3E8CA 3MFTA 4PV0A 5ANDA 5EK7A 4LL5A 3ULZA 3IOPA 4B0GA 5HU9A 5LWMA 4QTAA 4LL0A 3V3VA 4A9RA 5DG5A 5I9VA 1OB3A 2HZ0A 2VZ6A 4D0WA 2B52A 3D15A 3HL7A 3EZVA 4MK0A 2X7FA 2R3HA 3BBTB 3KXGA 4M69B 3WF6A 3LMHA 2XK9A 2XNBA 3FQSA 4RJ4A 4J53A 1JKSA 4CG9A 2R7BA 4TPTA 4O7NA 5AP6A 1MQ4A 3T3VA 2QC6A 2EB3A 1FMOE 4EL9A 4JBVA 3JXWA 4G3EA 3EMGA 4CV9A 3F88A 2EUFB 2PZRA 1ZYSA 4JR3A 4A9YA 2W4JA 3D9VA 2QR8A 3FYJX 2UZOA 3ODYX 3LFAA 4IVAA 4X6RA 4HVGA 1M14A 2YEXA 2GSFA 3ROYA 2YM5A 1XBCA 2OZOA 4TYIA 1Z5MA 3JVSA 1UNHA 4G1WA 4IAKA 4I6HA 3NNVA 3ACKA 4MF1A 4F9AA 4YTFA 4D58A 1Q61A 2WEVA 5DRBA 4RA4A 5J9YA 4TT7A 5ITAA 2Y6OA 2UW3A 3MY5A 3ZUVA 4BN1A 4PY1A 4AZSA 3OROA 1H1RA 4W4VA 4FBXA 3LCSA 3CY2A 4EK8A 4J71A 4G9RA 2R3IA 5AA9A 1O6KA 1GIIA 3BPRA 3ANRA 3ZRLA 3I0QA 2YZLA 3DS6A 4IVDA 4LFIA 4DHFA 1CKPA 4XOZA 4DFNA 3C9WA 3KGAA 3VBYA 4BDBA 5L2IA 3R8LA 1FVTA 3TT0A 4IB5A 4V0GB 1M7QA 3IQ7A 2O8YA 1L3RE 3QFVA 3R2YA 5CQUA 2R3LA 5HQ0A 4FKOA 3QCQA 4CTBA 2CJMA 3MGYA 5DWRA 3KULA 4QO9A 3UIXA 4O7YA 4Z16A 2G9XA 4RQVA 4EQCA 2BIKB 4ASEA 4U41A 1XH9A 3K5VA 2ITWA 4FZAB 5EDQA 1WBTA 2Y8OA 4IACA 4RBLA 3LXKA 5AAFA 3T9TA 1PF8A 2ITOA 3A7FA 4ZSJA 4ERWA 4CQGA 4M69A 4QYFA 4USDA 4YMJA 3EQFA 1NT2A 3GENA 3N9XA 4QP2A 3UQGA 4HGSA 4EH5A 2BIYA 5AV1A 1Q99A 1U54A 3OBJA 4FTNA 1KOBA 1SVEA 4EONA 3W8QA 1QPJA 3EQHA 2C6MA 2BTSA 4P2KA 4MXAA 4A4OA 2YERA 2X0GA 3TWJA 2SRCA 3FUPA 4GT4A 3VC4A 3ZXTA 4CFMA 5G6VA 4AFEA 4QMMA 5HHWA 4ALUA 3FE3A 4IFCA 4C4IA 3LKMA 4X3JA 1OL7A 4KRDA 4PPBA 4RLLA 4YR8A 4WNKA 3WILA 4FT7A 2YDIA 4F7LA 3UPXA 3U6JA 3HNGA 2BKZA 5J7BA 3TNHA 4M12A 5E7RA 4FKJA 3BWJA 1PXLA 3MS9A 1KV2A 5FBNC 5HIEA 3SG9A 4A4XA 2E9UA 5IQBA 4UEUA 3LXNA 3QKMA 4ITIA 4O2PA 4BCFA 1Q8YA 3A7HA 4TYJA 2CHLA 2EWAA 3PWYA 3ORIA 3S95A 4RJ5A 1PXNA 4FTAA 1RQQA 2XNNA 1ZMVA 2ITYA 4OBOA 1FGKA 2WTVA 3A8WA 3SXRA 5EKNA 2OIDA 5IA1A 3Q9ZA 4W4WA 2NNWB 4BBEA 1Q8WA 3R21A 5A4QA 4IC8A 3FQEA 2PVRA 5HZNA 4E6AA 4BDHA 3MV5A 5L8JA 2GHLA 4MXZA 2HIWA 4IH8A 3QYWA 4LYNA 3HUBA 3WIGA 4RJ7A 5HI2A 2R3KA 2W9FB 5LMAA 2EXMA 3KK8A 4APPA 4BBFA 2P2IA 4BI1A 4ZMFA 1BL6A 1U5RA 3PJ8A 4EOMA 1ZOHA 1PXPA 5IEYA 2HCKA 2VTHA 4FKPA 1OPKA 4IADA 5IUIA 4E5WA 5EQEA 2ONLC 4TWNA 4MXXA 5J87A 4D9TA 5AP3A 4A06A 3NW7A 3SQQA 3HA6A 5HNBA 3C4XA 2PZPA 4GFOA 4YJUA 1HOWA 3BYMA 2WMVA 5CVHA 5BQ0A 3FI8A 1PMVA 1JSVA 2E2BA 2NP8A 3OBGA 5DI1A 5J95A 3PPZA 4BDCA 2Z8CA 4L68A 3Q32A 2QKRA 1ZYLA 3MA3A 3TEIA 4CV8A 3FEGA 2WTCA 2R3FA 2W05A 1FQ1B 1XH5A 4ZS4A 4BCJA 4BTFA 2OXXA 2WMXA 4CFNA 1OIYA 3ENMA 2CCIA 2UZTA 4X0MA 1WVWA 5ETIA 3OXZA 5TR6A 3VUHA 5HG9A 3RI1A 3QRTA 5KMIA 3MWUA 4S31A 3VUDA 4OBPA 4L3LA 2R64A 5LVMA 3FI4A 4NL0A 4G3CA 2DWBA 2OI4X 5AV4A 4R7BA 1I44A 3UE4A 3DDPA 3BLHA 2A19B 3BLQA 1SM2A 3P78A 5J5SA 4R1VA 3ZZEA 3F61A 5BVWA 3BHHA 3CC6A 4BDGA 1YRPA 3RTPA 3IDCA 3QA8A 3PIYA 4EBVA 3TTJA 2W0JA 3ZBFA 4YZNA 2OLCA 2E9NA 2F7EE 4CNHA 1X8BA 3V5QA 3GCPA 3KXZA 2X4FA 4PNKA 1MP8A 4KBCA 2VWBA 2XYUA 3POZA 4O91A 3ZEPA 3TUBA 2PUNA 2RF9A 4H3PA 4RVLA 4UMRA 4FNWA 4XBRA 5DLSA 3LXPA 4EUTA 3QD0A 2WMAA 3LFNA 4O7RA 5C4KA 1XBBA 1ZZLA 2C6KA 2C0TA 4JIAA 4U44A 4EBWA 5I9WA 4NTSA 3KMUA 4FKSA 3R1YA 3RZFA 3QKKA 2F2CB 5K9IA 1KE8A 2F7XE 3G6HA 4JR7A 3IW8A 4TW9A 3T9IA 3KREA 5E9EA 3H3CA 4I20A 4JLCA 3A2CA 1XHAA 4QP3A 2Y4IC 5EW3A 3M2WA 3DTWA 4DEHA 3ULIA 1YKRA 2W1FA 3NCGA 1Y8YA 2XK7A 4JJRA 4YJRA 2QO2A 4FG8A 3TZMA 4HGLA 3W2CA 4EH4A 3BYOA 3FC1X 4I24A 2PSQA 4FT5A 5E8ZA 4IB3A 5FD2A 2RSVA 3O23A 3IK3A 2I7QA 2Z2WA 4XG6A 4FTMA 5A4LA 4M84A 4CCBA 4U0IA 2JDOA 3ZM4A 1ZYJA 2C6OA 1J3HA 4FTOA 2BRGA 2JIUA 3WZKA 2QOLA 4LV5A 4X3FA 1XH4A 1JAMA 4G3DA 4YZ9A 3RHXA 4UMUA 4HNFA 2YM7A 4P90A 3K5UA 3FL4A 4OAUC 2X7GA 2WMWA 2ZDUA 3HRBA 3PZEA 4BDIA 4YC3A 4GIHA 3ZO3A 3EL8A 1T45A 1RJBA 4FG9A 2VWWA 4I94A 1IAJA 1YWVA 3OWLA 3VUIA 4BDEA 4O82A 3UNJA 4ZSAA 1YWNA 5AP0A 4RIXA 1H01A 2Y6MA 3FMDA 3ITZA 3KQ7A 3PUPA 3R9NA 5CF4A 5LMKC 3Q6WA 4FKWA 1Z9XA 4IAFA 4ZZNA 5JFSA 2I0EA 4GCJA 3P08A 3BHYA 5FTQA 5FXQA 3L9LA 4FTKA 5IA3A 3QZHA 3GNIB 4L7FA 2C69A 4HGTA 4C3PA 5E8SA 2QHNA 4FKRA 3DOGA 5KMNA 3F5XA 4U3ZA 4R7IA 1WBVA 2GNHA 3K2LA 2WQMA 3NRMA 3NNXA 3LOKA 5A6OA 3VHKA 4OT6A 3KCKA 5DBXA 1REJA 5AV2A 3RJCA 5JRSA 1DS5A 3DZOA 3RPOA 2XKDA 4AN9A 3QXOA 2C30A 4PL5A 5IH6A 1OI9A 2CLQA 3QQFA 4EYMA 2H34A 2UW5A 4BZNA 5GZ8A 3E88A 5KMOA 1UV5A 4O0TA 4LOOA 4ZP5A 3OXTA 4H3QA 4IIRA 2PE0A 2B53A 3R9RA 3Q9YA 5K0KA 1GIJA 2WELA 2UW0A 3Q2JA 4FIGA 3LXLA 4TYGA 1DI9A 2BROA 3QF9A 3SHEA 4JS8A 1Q4LA 2YWVA 3R9OA 1WZYA 4TZRA 4C3FA 3HV7A 1F5QA 2W5AA 4F9YA 3AD4A 3F7ZA 3QCXA 2J9MA 3VWAA 4MTAA 4U8ZA 3W2PA 4BCNA 3DKOA 5M53A 1VR2A 1OPJA 3KMMA 4L6QA 3TNIA 3HYHA 3JY0A 3PLSA 4YZCA 3UIUA 4BDAA 2VWIA 5CEIA 4H3BA 5AR3A 2BDWA 5AAEA 5ETCA 5BUEA 2R5TA 3ID6C 2XBAA 5M44A 4L53A 3QTWA 1DAYA 5LVLA 4OTPA 1U4DA 3RPYA 2O5KA 4DF3A 2VO6A 4DA5A 3DAKA 3EZRA 1KOAA 3HLLA 2HXQA 2ZV7A 4JQ7A 4DINA 1AD5A 3B2TA 4MBLA 1XH8A 4U97A 3RWQA 4N6YA 2H9VA 5CZHA 5BYZA 3FZSA 4AXAA 2RFEA 2W99B 4G9CA 2OFUA 2RFNA 2UZEA 1P4OA 2HW7A 4RC3A 3FMEA 3H9OA 2X9EA 3L8PA 4FT0A 3MIAA 4ARKA 1MRUA 5CXHA 4FTIA 5HCZA 3DBEA 4MYGA 4EZ5A 3LAUA 3HRFA 3P7AA 4CEGA 4D4YA 4F9BA 3TJDA 2VTAA 3OXIA 5CU0A 3BHVA 4DGLC 4LI5A 3MTLA 3NUYA 2PULA 1Q3WA 3PG1A 3ETAA 4R3CA 4WOVA 2UVXA 2YITA 2BKKA 4EJ7A 1H28A 4GG7A 1SMHA 5BVKA 4JG8A 1WVXA 4DN5A 3FZTA 1G8AA 1H1QA 1YI6A 2OZAB 4YTHA 5FWKK 2JEDA 3SW7A 3G51A 1ZZ2A 4GVAA 4Y8DA 5HVYA 3WOWA 1ZYDA 4A9UA 3R0TA 2VTRA 3TJCA 4C4HA 4Q5HA 4FSUA 4A9TA 3RK7A 4B8LA 4NM3A 4DEIA 4LRKA 4EK5A 2C3JA 1H1SA 5IG1A 3BZ3A 4MQ2A 4OTFA 3E5AA 5JFXA 1KE9A 3UQCA 2WB8A 2WKMA 2BALA 2GNGA 2R3RA 3MVJA 4PP9A 3QC4A 3BGZA 3KRRA 1P4FA 5GINE 3R7YA 2HXLA 3RK5A 2IVSA 1JSTA 3V6SA 3GU8A 2OU7A 2VWUA 4O0UA 3TXOA 4AQCA 5HO6A 5LVPA 4RGJA 4F0IA 3SA0A 3ZDUA 4N57A 1ZWSA 5DOSA 4YNEA 4AACA 2A4LA 3ZLYA 4YJNA 3FLWA 2WZJA 3KXNA 3PIZA 4J8MA 3UVRA 2YISA 4DE4A 2HENA 3A4PA 2YM3A 3O8UA 4LOQA 4LMNA 3ZBXA 2FSLX 3O8PA 4BIBA 4QQJA 4O0VA 1XH6A 4V01A 3PTGA 4I92A 3FLSA 4ONAA 2W17A 3DNDA 4FKGA 4AW0A 4MHAA 4MEDA 1GAGA 4S30A 3KN6A 4E8AA 4ID7A 2CSNA 5GJFA 2JDVA 4D4SA 1CKIA 4NCTC 2AC3A 1VEBA 4DEAA 4U42A 4CT1A 3TIYA 2VX0A 2UVYA 4CFUA 2F4JA 1Y57A 2VN9A 3KCFA 1ZAOA 4F0GA 3VUTA 2PE2A 1YDSE 4WBBB 2R4BA 2BZJA 3UYSA 2ZVAA 4DITA 1JPAA 2UZNA 4X3FC 2VO7A 4TNBA 2HZ4A 3E87A 3HMPA 4ITHA 3VO3A 3THBA 4R5YA 4C37A 4K77A 3EKKA 2H6DA 2WPAA 2BCJA 3L9PA 4BGQA 4Z7HA 1YVJA 4FTCA 5AEPA 4ZEGA 3RM6A 3RCJA 5ACKA 3EN4A 2WMSA 4GUBA 5I5ZA 5H9BA 3U4UA 3BU6A 3VS0A 3PPKA 3N4UA 5M55A 2Y4IB 2WIPA 3ZO4A 5K4JA 2ZOQA 5IA0A 2GMXA 2PMOX 2R3MA 4ZY6A 5LARA 4KSQA 3QBNA 3QRIA 4MD9E 4Y5HA 3A62A 3QTXA 4ANBA 4DGMA 5CU2A 2OXDA 5EI8A 4RRVA 4U81A 3EQRA 4E3CA 4QP1A 3HV3A 2J5EA 3OG7A 4FEXA 1JBPE 2OG8A 1J1BA 2R3QA 3BYSA 5AA8A 1APME 2XVDA 4YHJA 2REIA 3QCSA 4D28A 5C1QB 4YJPA 3AC3A 5JGAA 3PXRA 4FTQA 1TQIA 4BYIA 2PU8A 2CKQA 5I3RA 3FKOA 4RA5A 3OCTA 5HX8A 2BAKA 3MSSA 5HBHA 2QCSA 4EK4A 3NVMB 2PVKA 2EB2A 1VYWA 3CKXA 2Z7QA 3RPRA 4KWPA 4PWNA 4WSQA 3ZCLA 4A9SA 4DEGA 5I3OA 3SD0A 3VBWA 5F9EA 1E1XA 5KCVA 2X6DA 1O6YA 2QO7A 1SVGA 2GHGA 2W7XA 4IX6A 4PF4A 5CSWA 2G2IA 3C50A 3WZEA 3EL7A 3MB6A 3UO4A 3LFDA 4V04A 3PDTA 2W1ZA 3O8TA 2V7AA 4EOJA 3KFAA 4QQCA 1TVOA 3GOPA 3UNKA 1PW2A 4FVQA 4I0SA 4YLJA 4M0ZA 4RJ6A 2WEIA 2UW8A 2X2LA 1V0OA 4XMOA 5D9HA 4DC2A 5FXRA 5L6WL 5I0BA 5FDXA 3CJFA 4QMPA 3AMAA 4HVSA 5EM6A 4G17A 5CEMA 4HCTA 2R3JA 1REKA 4FYNA 4WA9A 4IMYA 2R2PA 2QU6A 4DG2E 4FI1A 4S33A 1Y6BA 3PXZA 5IISA 4CRSA 1OBGA 3WZDA 5TOZA 3EN5A 3I1AA 3GP0A 4J99A 3GXLA 3DY7A 4RJ8A 4X2FA 4ACDA 4QMVA 5BVFA 4MWIA 1MRVA 4FSWA 4H1MA 3P7CA 4BI0A 4XP2A 3L1SA 3FMKA 3VVHA 5CI6A 4G5PA 4RVTA 1JWHA 2Z7SA 2XB7A 5F20A 1LR4A 4E6QA 3TCPA 3G33A 4KKGA 3W8LA 4O1PA 3DAJA 3OHTA 3PRFA 3U51A 4YP8A 4FTLA 2C5OA 2WTJA 1Q97A 5FRIA 4GK3A 3R83A 3DAEA 1BUHA 4IFGA 4FF8A 3IDPA 4FV3A 1Q8TA 3OT3A 5KKRB 1BX6A 1QPCA 3UZPA 3PFQA 2HYYA 3UMXA 4EC8A 3RM7A 5C9CA 3R7OA 4TWCA 1JLUE 3UOJA 4PDYA 4MAOA 1FOTA 3QUPA 2Q0NA 3V8TA 2IPXA 1H1PA 3R1SA 4AZTA 5K5XA 3CTHA 1YHWA 5AUXA 3C4FA 1M7NA 2UVZA 3CR0A 2AYPA 1YHVA 3PP1A 1WCCA 4I93A 4IJ9A 4KB8A 4X2JA 1URWA 1OL5A 2KULA 2QOCA 2WD1A 2HWPA 1GZNA 4E4LA 2XP2A 4X21A 2OSCA 3ZLWA 3EQDA 1PXIA 2XCKA 4C38A 4QYGA 2G1TA 1IA8A 1IG1A 2JGZA 1RDQE 2B9JA 2QOHA 5EHOA 2BZKB 3FSFA 5LVNA 3FDNA 3PXFA 4YJSA 4BFMA 3UZTA 2P2HA 5AM7A 4FTTA 3PE2A 2ZB0A 3OZ6A 3SX9A 2OZAA 3TDVA 2OJGA 2Q0BA 5HO8A 4C0TA 4XEYA 3QRKA 2CGWA 5HBJA 4DCAA 3D2KA 2O64A 4N4SA 2ZYBA 3FHRA 3DBCA 5CVFA 3HMOA 4XOYA 4A7CA 4B6LA 2CPKE 4O0YA 2VV9A 3C0GA 3I6UA 5DIAA 1PMUA 4O84A 2VU3A 2IWIA 2O3PA 3JYAA 4YUQA 4GT3A 2WU6A 1LEZA 2ZM1A 4FNYA 2ITPA 4WRGA 4DCEA 4LOPA 4C4GA 4UV0A 4NEUA 1YXVA 3MH2A 4Z9LA 2G2HA 4D1SA 3WIKA 4G34A 5HG8A 1OIQA 4FZ6A 2FSTX 2V7OA 4S34A 1UU3A 3NNWA 4FC0A 4Y83A 4ACCA 2WTKB 2QG5A 4HGEA 3R00A 2UZDA 2VAGA 2Y4PA 1FMKA 4O38A 2XM9A 3KRWA 1R1WA 4XUFA 3UOHA 1GIHA 1BMKA 4X2GA 3ZHPC 1MRYA 3WF8A 4ACMA 4XG4A 2WO6A 1R3CA 3VUMA 2DUVA 3R9DA 3IW4A 1YOLA 3HV4A 4FV5A 5HLPA 5CAVA 3OF0A 3CEKA 4CFWA 4LUEA 2IW8A 2RG6A 3EN9A 3RPVA 4H1JA 3VW8A 4F7JA 4AW2A 4BDJA 3KXMA 2JDRA 4RC4A 5M51A 4QNAA 4OW8A 4GL9A 5E92A 3ZONA 3O17A 1NVRA 3Q5ZA 4NIFB 3CQWA 3WE4A 4ZTRA 2XRWA 1H8FA 4MXOA 3GCSA 3DT1A 3LVPA 2CNVA 4J7BA 3MA6A 2NRYA 2YJSA 2XEYA 1GZ8A 3HAMA 2GNLA 4BWXA 3BKBA 4YBJA 3RNIA 3FPQA 1OL6A 2Z60A 3R9HA 4YU2A 2BZIB 5CAQA 2YIXA 3FKLA 3PSCA 4M66A 2VWYA 4D2SA 4D9UA 5EI2A 3Q5IA 1PXKA 4GK4A 4DFZE 5EOBA 4USEA 5KHWA 2G2FA 2WMUA 5ANGA 3QA0A 4I23A 4AZFA 4R77A 4KBKA 2WTKC 4GYGA 4H39A 5CSPA 3HRCA 1HCLA 3HA8A 4RIXB 3LFSA 3H0YA 4XH6A 2QD9A 4CMOA 3L8XA 2CKOA 4RWJA 1XJDA 5TE0A 5IUHA 3FI2A 3TL8A 3P9JA 2FH9A 4IVBA 1W7HA 2UW9A 4ZZOA 4TNDA 3BHUA 1P14A 4YJOA 3VS4A 1XQZA 4MBIA 3ZFXA 2X2KA 4OLIA 2X8IA 4BWKA 5BNJA 4ZY4A 3LW0A 4F7NA 3TUCA 4F99A 2QG7A 4QMNA 4BHZA 4YJTA 2VGOA 4E26A 4XLVA 4TYHA 4IWDA 2J51A 5C8MA 5DPVA 2Q83A 4M97A 4FV2A 4AZWA 3UGCA 2XBJA 4OTIA 4O7ZA 2YM6A 5CNOA 4AA4A 4XNEA 4UWBA 2PZIA 1NW1A 3UO5A 1YXSA 4CSVA 1KE6A 3MH1A 3QC9A 4YC6A 4UMPA 2LGCA 4GRBA 4UWYA 3SDJA 3V01A 4R1YA 2I0YA 2WU7A 4U40A 4ZMEA 2W1HA 3OOGA 4FMQA 1OMWA 4AP7A 4DTKA 4DFXE 4QOXA 2W1CA 3T3UA 4CD0A 4ORKA 5CEKA 5D7AA 2WXVA 3UQFA 5L6PA 3QRUA 3Q60A 3MY1A 3W2SA 5IEVA 5CZIA 3A7IA 3R22A 4L44A 4PL4A 3MY0A 4FTRA 3WF5A 4CMUA 4FR4A 2JIVA 3MVLA 2OF4A 3C4CA 2GPHA 4ITJA 4FIFA 3ZU7A 2JIIA 4G3GA 3RWPA 4O0WA 4TL0A 2PUIA 4UN0C 3Q2MA 4YC8A 4BTKA 3EQPA 2VUWA 3HP2A 5BX0A 5E8XA 5AP2A 4IAIA 4FKIA 5JZNA 2GS7A 2OGVA 3DU8A 4K1BA 3W33A 1OVEA 4BCIA 2WQEA 4PX6A 4WKQA 2X81A 2FSOX 3OT8A 2R3NA 2YM4A 3QD4A 1IRKA 4KKHA 4NM7A 4IM3A 4PMSA 5J7HA 4JRVA 4G2FA 3R8ZA 4FVRA 2F9GA 4IX5A 3E7VA 3CQUA 5CS6A 4IB0A 4XJ0A 4Q5EA 3GFWA 5LXMA 3TDWA 2IZSA 2OIQA 3DGKA 4WRSA 5K0XA 5CSXA 2CGXA 4L67A 3G0EA 2PE1A 3FMLA 4RMZA 2JC6A 3MESA 1XR1A 4YJVA 1UU7A 4BCHA 4OGRA 2IVTA 4PMMA 1DAWA 4FT3A 4O86A 2QODA 5IZFA 3FXZA 3TTIA 4EJNA 3FXWA 3F5UA 4QMZA 1FINA 1M52A 3RPSA 3C51A 3AC1A 3Q04A 5TF9A 3COKA 2OWBA 3VW6A 2AC5A 2YLEA 2PYWA 4MWHA 3QTZA 5DR6A 4NZWB 3ZSIA 4HJOA 4EOSA 4EHVA 4EK6A 5AJQA 4FV1A 5ANIA 3PIXA 4RPVA 4KABA 1H26A 5IMEA 2VTPA 3ENHA 2EU9A 3NAXA 5BMMA 4BL1A 1UWHA 1JKTA 3EQGA 5CU6A 4L3JA 5HTCA 2R9SA 5AWMA 4ZLYA 1GY3A 3SGCA 3FZPA 3MJ2A 4EOPA 5T6KA 4CZYB 3DKGA 2W1EA 1UKIA 3D5XA 3DQXA 5DFPA 5DN3A 5EW9A 5AUVA 5CF6A 5GZ9A 3Q4TA 3EN7A 5HCXA 4GH2A 4HVDA 5AV3A 2BRBA 3LQ3A 5KMMA 1P2AA 4FK6A 4JT3A 4YTIA 4XG8A 1BYGA 3RK9A 2XMYA 4RZVA 3UTOA 2BTRA 1H4LA 5D12A 3VBQA 5CAUA 4AA0A 2XIXA 4EHEA 1H08A 5E8VA 3AC2A 3EN6A 3ZLSA 4EKLA 5KZ0A 5TKDA 1A9UA 4IZ7A 4L42A 4BZDA 5I9YA 2BRNA 3RGFA 3BGQA 4J52A 2WNTA 3T8OA 3NUSA 5C27A 2V55A 1H0WA 2XJ1A 1LEWA 3DBDA 3FLYA 3FLNC 3FYKX 4I22A 4YO6A 5HLWA 3OCGA 4WO5A 1YW2A 2QURA 3E62A 4FV7A 4Q2AA 2ZAZA 4ZSEA 2W5BA 3KKVA 4DBNA 3NYNA 4LM5A 4HPTE 2VGPA 4FIIA 1T46A 2IVUA 3OD6X 4AWIA 4ASDA 4QNYA 3V5JA 3S0OA 4ZJVA 3OMVA 1U54B 5EM7A 4TN6A 2OJIA 2W06A 2XK8A 1AGWA 3LM5A 3CBLA 4QPSA 1OIRA 4NH1A 4KUJA 3LHJA 5AUTA 2C3LA 4FTUA 3O7LD 5KX8A 1A48A 3NUPA 4GJ3A 3QQGA 4FK3A 2R7IA 4CXAA 1AQ1A 3OEZA 3OS3A 4PPAA 4W8EA 1VJYA 3MPTA 3RKBA 4KINA 5IQDA 4FTJA 3BLRA 3SRVA 5AR5A 4H58A 2RFDA 2WAJA 4BCGA 2HOGA 4FZ7A 1IASA 5HIBA 2HAKA 4F0FA 4FEVA 4QP7A 2J0MB 3Q9XA 3VF8A 1Q3DA 2UZBA 2ACXA 4EH8A 4HVHA 4JBOA 1YOJA 3DJ6A 3FZOA 1CMKE 3VQHA 3MN3A 4WG4A 5M4IA 2ITUA 3L9MA 3OW3A 2VWXA 2YIQA 4NT4A 3F2NA 4CKRA 1IA9A 3BRBA 3D5WA 3G9LX 4CG8A 3FI3A 1PKGA 3V5LA 4U9AA 4IDTA 3OFMA 4FKLA 4W4XA 5JZJA 3ALNA 2XJ0A 1H07A 3BBWA 3NNUA 2FUMA 3QTUA 4I5HA 3COIA 3RAWA 4F09A 3TKIA 4BCMA 5CT7A 3M1SA 3NYOA 3LLTA 4XV2A 1XWSA 5DT4A 4XG7A 2YJRA 4OTQA 4IM0A 4RIOA 4Y5QA 4YZMA 5EH0A 3R8PA 4BTJA 4C4EA 3UJGA 3SOCA 5B7VA 2QHMA 4MX9A 4WD5A 3UC4A 3QLGA 2OJJA 1NA7A 1Q62A 4I6FA 4C36A 1CM8A 3FMNA 4FEQA 5IQIA 1OM1A 2J50A 3C5IA 4XP0A 3GC7A 4WG3A 3LPBA 2FSMX 3CXWA 4D2WA 4ZIMA 2XIYA 3PJ3A 1GZKA 5A3XA 4W9XA 4K2RA 4BF2A 3CTJA 4GS6A 4CFXA 5CALA 3W32A 1M2RA 1Q8ZA 4HYUA 2UZWE 5HORA 4QYHA 3OW4A 5FGKA 3NUNA 4BCPA 3KXXA 4FEWA 1K2PA 1OKVA 4JL9A 4R7HA 4ZTNA 3U6HA 2F57A 5GIPE 5D10A 5JN2A 5M08A 5ETAA 4U79A 3R8MA 3EWHA 4OTDA 1OBDA 5EQYA 4AT5A 5IQCA 4WNOA 2CKPA 2HELA 2VTIA 4NW5A 4ZSGA 2IZRA 2Y0AA 2QOOA 4JXFA 1ZMWA 3EQIA 4R3RA 4YNOA 5CX9A 5BYLA 4LG4A 3GU7A 2QU5A 4ACGA 4EH6A 5L8LA 5DT0A 3RZBA 4PDOA 3TI1A 1ZOEA 4IX3A 3PLAE 2GQGA 4BCOA 4NTTA 2IZUA 3GC9A 3ZLXA 3F2RA 2QO9A 3CTQA 2R0UA 4II5A 4NSTA 4X2NA 1FGIA 3IDBA 4NM0A 1ZOGA 2WTIA 4YHTA 3COMA 5AMNA 3NLBA 5ACBC 3QALE 5EHLA 4I5CA 4RFZA 4AGCA 4ENYA 1ZMUA 2B9HA 4J97A 3RP9A 3LCTA 3R02A 3MH3A 2UUEA 4AG8A 3ZO2A 4AZEA 3U8WA 3VBXA 4I1ZA 4F1OA 5L6OA 2XNMA 5KMLA 3D7TB 4FE2A 2VWVA 4IJPA 3NMUF 3DK7A 3V5WA 2ONLA 4JAIA 5L4QA 5K5NA 3QGWA 3G90X 1Q41A 1ZY5A 1JOWB 3F3VA 2C47A 4GV1A 5F4NA 2XKFA 3KF4A 4JQEA 4IC7A 2BPMA 2DS1A 4XLIA 1R39A 4BKYA 4QTEA 1ZLTA 4N6ZA 4TKSA 4DT9A 2QVSE 3ELJA 3UNZA 1HCKA 4AOTA 5D1JA 2V5QA 4UZHA 3W10A 1PY5A 3H9RA 3FL5A 3QXPA 4UWCA 3VRYA 3F9NA 1TQPA 3QTSA 3QZFA 3JS2A 5CF5A 2X7OA 4C2WA 2VTMA 4GFMA 1B39A 5K4IA 5LCKA 2XRUA 3LJ1A 3LFCA 2JLDA 4KNBA 3EFJA 1VYZA 3SV0A 4QPAA 2BHHA 3PJCA 1JVPP 2BR1A 5CQWA 3AT4A 2C5VA 2QOQA 1BL7A 1LUFA 2NRUA 4GG5A 4QT1A 5ANJA 5AUUA 2YCRA 5HTIA 3GC0A 3E3BX 4BIEA 3WYXA 3P7BA 5IPJA 5GNKA 2IVVA 1CDKA 3Q9WA 2C5XA 4RWIA 1PRYA 1OITA 2PPQA 4FIJA 5HVKA 2I1MA 1WMKA 4ERKA 3PY1A 4FUXA 2PHKA 4F7SA 5CASA 4FX3A 5JSMA 1IR3A 1P5EA 5DHJA 3OOMA 3D94A 1W83A 4FSYA 4WNPA 4PNIA 5EYCA 3PG3A 4NJDA 3P79A 5JRQA 3FMHA 4XCUA 1OPLA 1E9HA 3F3UA 1FPUA 2RKUA 1CTPE 4XG3A 5E8TA 5T68A 3VF9A 4CVAA 4YBKA 3N51A 4WUNA 3HKOA 4FV9A 5BVOA 5C8KA 1LP4A 3EYGA 4B99A 4D5HA 3DB8A 5DMZA 4B9DA 2BMCA 2GCDA 5I9ZA 4QTCA 1YHSA 3QQKA 1STCE 4HPUE 1BI7A 4MNEB 4M68A 4C4JA 3LM0A 5HG5A 5CU4A 3MFUA 5CSVA 3HV5A 5CTPA 3DTCA 3C0IA 3BU3A 3KA0A 1J7LA 3BHTA 5EM5A 4BCKA 2IG7A 3CS9A 4O7WA 4MBJA 2E9VA 3PXYA 3UIMA 4EHGA 5C26A 2DQ7X 3C4ZA 5JGBA 4S32A 4FKVA 1J91A 2IJMA 2ERZE 4GMYA 5L3AA 4DEEA 3UPZA 3GCUA 1KE5A 2VO3A 2JKQA 2WHBA 3KRXA 4FT9A 4WHZA 3SKCA 5JT2A 5L2TA 4K0YA 3BEGA 4Z7GA 1ERKA 4DH3A 1UU9A 4TXCA 4JRNA 4C33A 3WBLA 4QQ5A 4MD8E 3K3IA 3REPA 5ANKA 5IMXA 4NK9A 2PWLA 4JDJA 2YCFA 3AC5A 4O0SA 4F08A 3PSDA 4MQ1A 2JFMA 4FIEA 3RBWA 3FV8A 4OUCA 3B8RA 3VAPA 1TKIA 3P86A 3FBVA 3IW6A 5FXSA 4ALVA 4GYIA 4NFMA 1Q24A 5CY3A 4D2RA 5GIOE 3UOKA 5CNNA 4YZDA 4UBAA 1SZMA 3ZFMA 4CTCA 4BY9E 4D0XA 4GK2A 4GIIA 4QPMA 2C6DA 3V5TA 3ZDIA 2Z7RA 2J0KA 3FQHA 3W2QA 5AP4A 2Z7LA 3GEQA 4EQMA 3ZUUA 3DLSA 4LV8A 3MB7A 4DGNA 4J98A 2PL0A 3AMYA 4LMUA 1UKHA 3GU6A 2QQ7A 3CD8A 4DFBA 3CJGA 3VIDA 5IQGA 5IQFA 4QMWA 4FYOA 3SVVA 1QPDA 5A4TA 4ENXA 3S2PA 4ANOA 4NFNA 4IAZA 4ACHA 2JKMA 5FM2A 1KV1A 4F64A 3GUBA 3S00A 2GFSA 3CGOA 1O6LA 2BVAA 4KIKA 3ZH8A 3IPHA 4L52A 3AG9A 5GJGA 3DKFA 4HZSA 4J96A 4YSMA 1BKXA 1OIUA 3KEXA 5HO7A 5E8WA 2VX3A 2X8DA 2YDJA 4IE9A 1R78A 4JNWA 4BDDA 4WBOA 2VX1A 3BYUA 4BVUA 1NVQA 5JH6A 2PMLX 4OBQA 4L00A 4E5AX 4EQUA 2ITTA 4DH8A 5IA2A 4DH7A 3H9FA 4K33A 3P1AA 4X2KA 3F66A 5BUIA 3ORLA 4UY9A 4UYAA 5E8UA 4C8BA 4D1XA 2B9FA 2C6IA 3MTFA 3PP0A 3WZJA 4BC6A 5KNJA 3DJ7A 2PVFA 4I5PA 3S4QA 4M7IA 2ZB1A 4LRMA 3PY0A 4IW0A 2C5NA 5C01A 4L01A 3ORTA 4V0GA 2R0IA 3F82A 3KF7A 4MNFA 4LGHA 1W84A 1RW8A 3SW4A 2B9IA 5J1WA 4BKJA 2XZSA 5IKWA 3R7GA 4NIFA 3EQCA 2GS6A 2JKKA 3RNYA 4B8MA 1PXJA 1UVRA 2OK1A 4DLIA 2J6MA 2CGVA 5AAGA 3WZUA 3BGPA 2UW4A 2XH5A 3A7GA 4I4FA 4RX7A 5BPYA 5JGDA 3Q4CA 3QUDA 3BV3A 3Q4UA 4ZLZA 4G31A 1H1WA 3Q52A 3U9CA 2QOIA 5CLPA 4AGUA 1W98A 4Q9SA 3VS2A 5FUTA 5HVJA 3R1QA 1I09A 5T3QA 1U46A 3OTUA 5A54A 4GU6A 2WIHA 5BYYA 4ZK5A 4I6BA 2GTNA 3G0FA 3IG7A 3PY3A 4LQMA 2ZDTA 2XEZA 4RVKA 3UYTA 2PVYA 4BB4A 4O2ZA 1B38A 2OFVA 5EW8A 3NS9A 3H4JA 3UMWA 1CKJA 2PMNX 3D14A 4ZOGA 5DA3A 3ORXA 3U9NA 4BDFA 3DXNA 4FG7A 4L43A 2GNFA 2RG5A 1S9JA 3AGMA 3D83A 3V6RA 4IWQA 3FAAA 2C4GA 5C8NA 2OH0E 4AAAA 1OZ1A 1SVHA 4DGGA 1UA2A 5AP5A 4AS0A 4DG0E 4EZ7A 5IU2A 3HAVA 5IQHA 1PYEA 2OICA 5HG7A 3FMJA 3KU2A 4RIYB 4CKJA 4YHFA 2W4KA 4JIKA 3H10A 1OECA 4E6DA 3R6XA 3GVUA 4KIPA 3PSBA 4MH7A 3IO7A 5CENA 4GEOA 3AD6A 3E92A 3PE1A 3FWQA 4C62A 3CLYA 2A2AA 4FODA 5J79A 3DBQA 4WSYA 5J5TA 2OH4A 3LQ8A 4XV3A 5KO1A 2R3GA 3BQRA 4UZDA 3S3IA 5J1VA 1MQBA 2VTSA 3DLZA 5FP6A 3R7UA 3IOKA 3WF9A 3OCSA 4RQKA 1YXTA 2YCQA 1WFCA 3TV7A 4OT5A 4DFYA 4U3YA 2XYNA 3RAIA 4AE9A 3CPBA 4EEVA 4O27B 3C1XA 4BHNA 2ZM4A 3GT8A 1ZARA 4ZSLA 4AGWA 4EH3A 4L9IA 5FTGA 3UG1A 3W2RA 1KUTA 5EM8A 3NPCA 3F5GA 4BTMA 3E8DA 1PMEA 5M4CA 2FA2A 3OY1A 2VO0A 3HUCA 4RX9A 4CYIA 2WMQA 2QOFA 5HKMA 4AUAA 4JAJA 3EQBA 5AR8A 4K8AA 4C7TA 3DFAA 2WGJA 3GGFA 4PDPA 4ZJJA 5ETFA 1Z57A 5A4CA 3BCEA 2PVHA 4H36A 1XKKA 3CIKA 4AOJA 3F69A 5EDPA 4QP9A 5LWNA 5LVOA 3QHWA 5EQPA 1ZRZA 4AZVA 4R8QA 5EDRA 1VZOA 3EH9A 4HYSA 2G15A 4AN3A 2UW6A 4K11A 4D55A 4KIKB 3S1HA 3ZMMA 3TZ9A 4KRCA 4F65A 1TQMA 4Q9ZA 1ZYCA 3BI6A 4FGBA 1DI8A 2VTTA 5AV0A 5KE0A 3O0GA 1W8CA 4CKIA 3COHA 2KTYA 2P0CA 3DK6A 1KE7A 4RC2A 4RT7A 4F6SA 3QL8A 5FEDA 3VS1A 5CVGA 3MFSA 2F49A 2PZ5A 3EJ1A 4W9WA 5HE2A 4EORA 3PYYA 4UALA 1PMNA 3Q6UA 4RIWA 4D2TA 4PUZA 4BRXA 5A9UA 3FJQE 5AR7A 1SNXA 5EI6A 3SXSA 1RE8A 2PVJA 3JY9A 3WE8A 1WBNA 5H2UA 5DGZA 4GT5A 4L45A 3TNPC 2J0LA 3NW5A 5LMBA 3HMMA 4O81A 4QYYA 5J9ZA 5JMSA 2OO8X 3ORKA 3OY3A 4JVGA 4TYHB 5F94A 3TKUA 5CT0A 5CAOA 2RIOA 4FNZA 3ZXZA 4NU1A 5IUGA 5KBQA 2XS0A 4OR5A 4U5JA 5HE0A 2QLQA 3MVHA 5FP5A 4JX7A 3R01A 4E4XA 2XNPA 3ORMA 4JX3A 5I9XA 2W4OA 4PTEA 3I6WA 5DR9A 2XJ2A 3Q3BA 3UP7A 3VS3A 3ZRMA 4ZAUA 1YXUA 3KRJA 4FNXA 2X39A 3DJ5A 5HCYA 5AUWA 1OL1A 1A06A 3D5VA 3BWFA 3LCDA 4N70A 4S2ZA 3EB0A 4XP3A 4ASZA 2JAMA 2PUUA 4C34A 4FVPA 3QZIA 2AUHA 2GFCA 2B7AA 3IS5A 4AA5A 3PPJA 2ITZA 2X6EA 5EHYA 1OUYA 4O7LA 4C59A 3CKWA 3G15A 3F7WA 4G6OA 4QP8A 4I41A 5BMSA 5EYMA 4L8MA 4JDHA 3VJNA 4D4RA 1EH4A 3D5UA 3RVGA 4I0RA 3D2IA 2PK9A 3JPVA 2QONA 2F2UA 4QRCA 1QL6A 2JAVA 2BDFA 4CZUA 3ZZWA 4PL3A 3CP9A 1JNKA 3DPKA 4PDSA 3W18A 3C0HA 4WUAA 3GQLA 3TACA 5B0XA 1F3MC 4ZTQA 5IH4A 4J1RA 3F5PA 3NAYA 4TTHB 5AX9A 4K18A 3QX2A 5HBEA 1K3AA 3VS5A 3TM0A 1URCA 3O2MA 4KA3A 2H8HA 4OTGA 4R5SA 3V5PA 5I9UA 3ZC6A 3EIDA 3OEFX 3OWJA 5BVEA 3BV2A 4FV4A 3UG2A 4EC9A 4IHPA 1B6CB 3NZ0A 4LGGA 5AIRA 5GHVA 4AT3A 4D2PA 4E20A 3DV3A 1WBSA 3BYVA 3UIBA 1UNGA 5CU3A 3VS6A 3L8SA 3CGFA 5HNGA 2QOKA 4CFFA 1YQJA 5BVNA 2PVMA 3PVWA 4TRLA 5E91A 3CSVA 2BAJA 2B1PA 1PXMA 3TIZA 2O0UA 4IZ5A 5FLFA 4FUYA 2FGIA 1MUOA 5LJJA 3DA6A 2ERKA 4NKAA 2C1AA 2C6LA 4NJ3A 4XX9A 5HNIX 3GOKA 2PVLA 3LQ5A 4BR3A 4KIQA 1KSWA 3RAHA 4Y73A 4BKZA 1PHKA 1G3NA 4EOLA 2W5HA 3LFFA 2W9ZB 4O0XA 5JKGA 3HV6A 3UC3A 4PQNA 4CQEA 5LOHA 3U55A 4HCUA 3W2OA 5CEQA 4TWOA 3DXQA 2QNJA 5ANOA 3NUAA 4YSJA 2QR7A 4CT2A 4TYEA 4XRJA 3ACJA 4AU8A 4GSBA 3D7ZA 2BAQA 3DNEA 5AP1A 2Y7JA 2YAAA 2O65A 4EKKA 3QGYA 5CEPA 3IKAA 5E4HA 2W1DA 1ATPE 4KIOA 3ZYAA 2WQBA 2I6LA 4IAYA 4KSPA 3LIJA 4FL1A 4ANMA 3LJ0A 4JDIA 2ZV8A 4ANQA 4HOKA 2W96B 1SNUA 3LFBA 4EWHA 2J0JA 2OBJA 4ZZMA 3PA5A 3NR9A 5FQDC 4YZBA 2DYLA 3II5A 3TV6A 3C5UA 4EOKA 2XK6A 2F7ZE 3HMNA 3BIZA 3D7TA 3GQIA 3FMMA 3QWKA 2CN8A 2UZLA 3NDMA 3V51A 5IQEA 4EHZA 4EYJA 3E64A 1Q5KA 3I60A 5JEBA 4XS2A 1FVRA 4F1MA 5KUPA 2J5FA 1OUKA 4DFLA 2IZTA 3FZRA 5CI7A 3VUKA 4ALWA 2GDOA 4EOIA 4FOBA 4EH7A 2ZV9A 3KK9A 2CLXA 4MCVA 4ZS0A 3SLSA 1ZXEA 4M3QA 4U80A 5HGIA 2IW9A 3I7BA 1J7UA 3LMIA 1OKZA 3UZRA 3EKNA 4NKSA 4APCA 5I4NA 2O2UA 4D1ZA 1OGUA 3AMBA 5EOLA 1FVVA 2ESMA 3C4WA 1OKWA 2W1IA 3O96A 3KB7A 3QUEA 4GFGA 2EVAA 3TKHA 4LGDA 2CMWA 3KN5A 4RIWB 3ANQA 4MXCA 4GVJA 4O7SA 5CEOA 5EYDA 3FC2A 5AIKA 2XIRA 2ZMCA 4ZLOA 2J4ZA 4FV8A 4D5KA 3GCVA 3HDNA 4P5QA 3FPMA 2R3PA 2C1BA 3IW7A 3QQJA 5M4FA 3IGOA 3E8NA 3DFCB 3RALA 3ATTA 5EYKA 3CQEA 2FYSA 1M2QA 2XIZA 3DB6A 3KULB 4IEBA 1UNLA 3VNTA 4U7ZA 4O6LA 5G1XA 3VBVA 4ANLA 4DH5A 2RGPA 4W4YA 4FA2A 1YOMA 4YPDA 2BDJA 5HD7A 1GNGA 1ZY4A 2E9PA 3FHIA 3AT3A 2J0IA 2HK5A 4QMQA 4QTBA 3SC1A 3SOAA 4YO4A 4RG0A 4I4EA 3U87A 4RSSA 3MH0A 3NIEA 4M13A 3VUGA 4RFMA 4BBMA 1V0PA 4FZFB 4O22A 4DEDA 2GU8A 4EK3A 3R7IA 4BGHA 3BEAA 3QX4A 2BRHA 4JQ8A 3NYXA 3PA3A 4PPCA 3MPAA 2CNUA 3WF7A 3Q4ZA 4AX8A 4NUSA 3PJ2A 3W55A 3A7JA 4OAVB 4ZJIA 4J8NA 5GZAA 3F2AA 5KHXA 3M42A 3LZBA 3BE9A 4DTAA 2P55A 3LJ2A 4IWPA 3DCVA 2VTNA 3FKNA 1YI4A 3AGLA 3VBTA 4G6NA 3R8UA 4BZOA 5JQ8A 2P3GX 1JQHA 2CNQA 3OTVA 3N4TA 3DQWA 4M15A 3FLQA 5IQAA 3O7LB 3N4VA 2YHVA 4HYIA 3SG8A 3TV4A 3QU0A 2WOUA 4I6QA 3GFEA 1J7IA 5DYJA 4RWKA 3KVXA 3AXWA 1PKDA 4I0TA 4ANNA 2FVDA 2J7TA 2EXCX 2ZV2A 3HGKA 4F70A 3NCZA 3QAME 3R71A 4IVCA 1KWPA 3EFKA 4M14A 1LPUA 4BWPA 5A46A 2G01A 3ZEWA 3ET7A 4K6ZA 4HCVA 1M2PA 3QYZA 5F1ZA 2OJFE 3UBDA 3UVQA 3QWJA 5L2SA 2X1NA 2JFLA 3C7QA 2A27A 4FSRA 4E5BA 4IDVA 4PTGA 5HE1A 5EFQA 3NUUA 4DG3E 5AR2A 2NPQA 5HIDA 2I0HA 4G6LA 5H8GA 4E7WA 3Q53A 5BVDA 4X3FB 2ETKA 2W1GA 2YN8A 1V0BA 2O63A 3IECA 3PVUA 4DT8A 3BELA 4MF0A 3G2FA 5H8BA 5M09A 4MKCA 5C03A 4P5ZA 4YLLA 5EKOA 3I5ZA 1K9AA 1WBPA 1XO2B 4FSQA 5FG8A 3ZOSA 3ZUTA 2WTWA 4AW5A 1PYXA 3GU5A 3TNQB 3QZGA 4I5MA 3TN8A 3UO6A 1OL2A 2C0IA 2C6EA 3PXKA 4RVMA 2PUPA 5HICA 2GHMA 4ASXA 3DKCA 4IM2A 5HE3A 5FEQA 4KS7A 3LE6A 2WQOA 3ODZX 4QTDA 4YGAA 3RCDA 4XBUA 3CY3A 4XRLA 4AFJA 4F63A 4QP6A 2BUJA 3B8QA 1YDTE 3KY2A 2ZM3A 3VN9A 3QQUA 3CCNA 4ANSA 5L8KA 4ZY5A 5HX6A 3U6IA 4IAAA 3DXPA 1CSNA 2X9FA 1WAKA 3QTIA 3D0EA 4L7SA 3FZ1A 3E93A 4GJ2A 2XM8A 4NM5A 3OVVA 3KC3A 4QMSA 3P23A 5CAPA 3OC1A 5M07A 3V8SA 2JBOA 5HU3A 4UXQA 2HY0A 4BDKA 3EFLA 2GS2A 3QKLA 3R7VA 4IBMA 4PMPA 2VTJA 4FSMA 4D4VA 3PVBA 4TWPA 4FKQA 5IF1A 2ZJWA 4M8TA 5KZIA 2XK4A 2EXEA 2YWPA 4QMYA 2OXYA 3PZHA 1QMZA 1Y8GA 3E8EA 4YTCA 2FO0A 4AE6A 5H8EA 3AD5A 4EH9A 3R7EA 4UMQA 3A61A 3UP2A 3QD2B 5B2MA 4KD1A 5CWZA 2X4ZA 4JBPA 4EOQA 4R78A 4O1OA 3ZFYA 5L2QA 4GKHA 3RAKA 4DEBA 1H00A 1R0EA 2GNJA 2ITNA 2YA9A 2IN6A 3AQVA 3F3ZA 3GB2A 4KS8A 3ZM9A 4YLKA 2WMBA 5IH5A 3PRIA 3I79A 2JBPA 3EHAA 2XIKA 3RMFA 4QYEA 3PJ1A 3HP5A 4D2VA 1XH7A 3HECA 3WARA 1WVYA 5M56A 3HVCA 2B54A 3UOLA 2XK3A 1H0VA 5DH3A 4E4MA 2IW6A 2JKOA 3BE2A 4OTWA 2V62A 4LRJA 3E7OA 5HOAA 5B2LA 5HTBA 2PTKA 3ORPA 4C57A 3OP5A 3U4WA 3H0ZA 3RHKA 4OTHA 4F9CA 4AW1A 2HZNA 3E63A 5LCJA 2J2IB 2OF2A 4RIYA 4FOCA 2GTMA 3O50A 3UVPA 5DT3A 5TT7A 4HW7A 5JQ5A 2OKRA 3VHEA 2ETMA 4U43A 1G8SA 4WNMA 4F1TA 3ALOA 3CD3A 1S9IA 3LCKA 4P4CA 4RX5A 4R3PA 4I3ZA 3VJOA 3VULA 4PP7A 4UX9A 2FB8A 1YDRE 1GZOA 1U5QA 3GI3A 5DE2A 3ERKA 2CDZA 2PMIA 4FKTA 4G16A 4AT4A 4MD7E 3MI9A 3NGAA 2V22A 4C2VA 3LLAA 1YWRA 2E9OA 2YIRA 2YIYA 1L8TA 3ATSA 3MJ1A 4WG5A 1W82A 4Y72A 4J95A 1Q8UA 2BRMA 4EOOA 2VRXA 3QHRA 4FZDB 4IANA 2GQSA 4B7TA 3F3WA 5E1SA 2PZYA 5FDPA 1NVSA 3KMWA 4IWOA 4UYNA 5ANEA 3DDQA 3D4QA 4GW8A 3VQUA 3CE3A 3EOCA 4B4LA 4ZTHA 3V8WA 3RINA 3NUXA 3HDMA 3H30A 3PWDA 5D7VA 1BLXA 3U54A 3HZTA 3JR1A 1QCFA 4GU9A 4JG6A 5AR4A 1IEPA 1JKKA 3VRZA 4CLIA 5FBOA 1F0QA 5CXZA 2I0VA 3QRJA 4FSZA 4AGDA 4IXPA 2R3OA 4CGAA 1Y6AA 1Y91A 3NYVA 4KKEA 4L46A 1WBOA 3FXXA 4XG2A 2WMTA 5HLNA 3AT2A 5JFVA 2IO6A 2A1AB 5LQFA 4ZXTA 3R28A 4USFA 3MDYA 3FSKA 4QP4A 2LAVA 3W16A 4A07A 4OTRA 4NWMA 2XUUA 4C35A 3OWKA 4EWQA 1O9UA 2JD5A 3OUKA 4UMTA 3C4EA 2XNEA 4KAOA 4P7EA 5A6NA 3IGGA 3HMIA 3CPCA 1GOLA 2YLFA 4CRLA 4JOAA 5JFWA 5D11A 1ND4A 1H27A 4E73A 5GJDA 4QMXA 5AM6A 1GJOA 3AC4A 1OKYA 2A0CX 4L3PA 3QQHA 4XV1A 4C61A 4F6UA 5HESA 2C6TA 2PY3A 1G5SA 5CYIA 5KMJA 3A60A 5J9LA 3K54A 2BFYA 3V04A 3NX8A 2PVNA 4XYFA 5AADA 3ZO1A 3A4OX 5K3YA 4N0SA 3L9NA 3JVRA 4HYHA 2JDSA 4QQTA 5IEXA 4DFUA 2C0OA 4C4FA 4CCUA 4G5JA 4E1ZA 4UB7A 4AN2A 3TUDA 4CLJA 2UZUE 1PJKA 4NW6A 3I0OA 3QTRA 4JDKA 3SAYA 1QPEA 2XA4A 4ZTMA 1E1VA
chains in the Genus database with same CATH superfamily
3IONA 2C68A 4RFYA 5DRDA 5DVRA 4BICA 5LMKA 2BILB 3M11A 3ROCA 5BUJA 1W2FA 4RJ3A 1PXOA 4FV6A 2HY81 3KRLA 5M57A 4YURA 3NEWA 2QKWB 5KMKA 5IDNA 3I5NA 3IW5A 3KVWA 2XNOA 1NXKA 2XKCA 4IQ6A 4C3RA 4IX4A 2WQNA 4G3FA 4TY1A 3VS7A 2B0QA 3R63A 2CN5A 3AOXA 2X0OA 2VTLA 2XF0A 4Y85A 5DNRA 4ZTSA 3DZQA 5M4UA 5DEWA 3ZS5A 3G5DA 2H96A 2ITXA 4C58A 5DEYA 5HD4A 4U45A 3R8VA 4AOIA 4EZ3A 4O21A 4BI2A 3TNWA 3UDBA 3BQCA 3DBFA 4FGRA 4PRJA 4MVFA 4H05A 1YI3A 3I4BA 3SXFA 2ZFYA 3NVKI 3GC8A 4PMTA 1V1KA 4QMOA 3A99A 3BX5A 3C13A 4M0YA 4Z3VA 5FTOA 4V05A 5CF8A 4F6WA 1UWJA 5EG3A 2QLUA 3OUNB 5AX3A 5KKRC 4NYEA 3FY0A 3POOA 4K9YA 4FSTA 5B2KA 3WYYA 3KXHA 2WMRA 4FIHA 4JG7A 4O6EA 4JI9A 4E6CA 1DM2A 2YZAA 4CZTA 4X6QC 4IB1A 3PXQA 4CFVA 5AFVA 4AXFA 1UU8A 4Y46A 4O7TA 4DBXA 3WI6A 2XCHA 3LCOA 3TZ7A 2XNGA 3PA4A 3QLFA 3AC8A 2CCHA 4KBAA 1W0XC 3I7CA 3EFWA 2I40A 2YABA 3OWPA 2X2MA 2YCSA 5CANA 4I21A 4LUDA 5C4LA 4FKUA 4FL3A 4F4PA 4R6VA 3R73A 3FLZA 1SYKA 2UV2A 5AP7A 3TZ8A 5AUZA 4C02A 4DYMA 5D41A 4EI4A 5A14A 2BHEA 2YDKA 4FICA 3R1NA 2RL5A 2X8EA 3O51A 4MNEA 2HZIA 4JBQA 3MFRA 2HW6A 4DH1A 4BYJA 4FL2A 5E90A 4WT6A 4M67A 4HNIA 2VNWA 5HEZA 5IA5A 4ZTLA 3NIZA 3NWWA 2ITVA 2C3KA 3AKKA 4QMLA 3MIYA 3MW1A 4YPSA 3ZSGA 2YIWA 4UXLA 3NSZA 3FY2A 3LFQA 1R0PA 3ORNA 3R30A 2QI8A 3G6GA 3KL8A 4WIHA 3TG1A 4F9WA 2UW7A 5E8YA 2VD5A 3OCBA 2CGUA 5FEEA 5J8IA 1IAHA 2P4IA 4CMTA 2OJ9A 3ZSHA 1U59A 3BU5A 3QQLA 3W1FA 4GUEA 4IZAA 2VTQA 2JDTA 3JUHA 4DAWA 4GKIA 5JK3A 3MPMA 4XV9A 2VNYA 1BI8A 3L8VA 2BZHB 3EYHA 4BCQA 2GNIA 3MBLA 4HZRA 4X7QA 3P4KA 5IDPA 1H25A 1M17A 3F6XA 2B55A 4QD6A 4EUUA 3A8XA 5DR2A 3MYGA 4AF3A 3ZRKA 4RX8A 5CSHA 4O83A 2B4SB 1XBAA 2UZVA 2C3IB 3DK3A 2WFYA 2WOTA 2YM8A 4O0RA 4DGOA 3GU4A 2HWOA 2YACA 2VTOA 5H3QA 3LMGA 3R2BA 5A4EA 2VWZA 1WBWA 3F3TA 1NY3A 2V0DA 4RWLA 4FEUA 2OW3A 3QD3A 4Z55A 3LFEA 3ZTXA 1H24A 2XKEA 3B2WA 3MVMA 3P0MA 3SRVB 3ZC5A 2OIBA 1JKLA 4QMUA 3QTQA 2JITA 3R04A 5TO8A 5AUYA 4RLKA 4NCTA 2GQRA 2BFXA 2ITQA 4IZYA 4E4NA 2QOBA 5M06A 4BGGA 5ICPA 2YFXA 4I6LA 2ZMDA 2NO3A 3QCYA 2P33A 2WTDA 4W8DA 4QMTA 4XG9A 4A4LA 4FV0A 3G9NA 4HVIA 3K3JA 4PTCA 4CYJA 5L2WA 4EH2A 1FBNA 3GBZA 4XHKB 2C5YA 4DLJA 3E3PA 3P5KA 3UDSA 4O4EA 3UODA 3PVGA 4O7VA 3HX4A 3Q96A 5KBRA 4DTBA 2CKEA 4E93A 1YXXA 4Y95A 2J90A 1JSUA 2Y9QA 4RZWA 5F95A 5IA4A 3O71A 3ORZA 4MXYA 4O4FA 4U6RA 5FM3A 4O96A 2Z02A 2ETRA 5E1EA 3GCQA 3NW6A 2RFSA 2YAKA 4BIDA 3HEGA 3I81A 4FSNA 4YJQA 1J1CA 3E8CA 3MFTA 4PV0A 5ANDA 5EK7A 4LL5A 3ULZA 3IOPA 4B0GA 5HU9A 5LWMA 4QTAA 4LL0A 3V3VA 4O4DA 4A9RA 5DG5A 5I9VA 1OB3A 2HZ0A 2VZ6A 4D0WA 2B52A 3D15A 3HL7A 3EZVA 4MK0A 2X7FA 2R3HA 3BBTB 3KXGA 4M69B 3WF6A 3LMHA 2XK9A 2XNBA 3FQSA 4RJ4A 4J53A 1JKSA 4CG9A 2R7BA 4TPTA 4O7NA 5AP6A 1MQ4A 3T3VA 2QC6A 2EB3A 1FMOE 4EL9A 4JBVA 3JXWA 4G3EA 3EMGA 4CV9A 3F88A 2EUFB 2PZRA 1ZYSA 4JR3A 4A9YA 2W4JA 3D9VA 2QR8A 3FYJX 2UZOA 3ODYX 3LFAA 4IVAA 4X6RA 4HVGA 1M14A 2YEXA 2GSFA 3ROYA 2YM5A 1XBCA 2OZOA 4TYIA 1Z5MA 3JVSA 1UNHA 4G1WA 4IAKA 4I6HA 3NNVA 3ACKA 4MF1A 4F9AA 4YTFA 4D58A 1Q61A 2WEVA 5DRBA 4RA4A 5J9YA 4TT7A 5ITAA 2Y6OA 2UW3A 3MY5A 3ZUVA 4BN1A 4PY1A 4AZSA 3OROA 1H1RA 4W4VA 4FBXA 3LCSA 3CY2A 4EK8A 4J71A 4G9RA 2R3IA 5AA9A 1O6KA 1GIIA 3BPRA 3ANRA 3ZRLA 3I0QA 2YZLA 3DS6A 4IVDA 4LFIA 4DHFA 1CKPA 4XOZA 4DFNA 3C9WA 3KGAA 3VBYA 4BDBA 5L2IA 3R8LA 1FVTA 3TT0A 4IB5A 4V0GB 1M7QA 3IQ7A 2O8YA 1L3RE 3QFVA 3R2YA 5CQUA 2R3LA 5HQ0A 4FKOA 3QCQA 4CTBA 2CJMA 3MGYA 5DWRA 3KULA 4QO9A 3UIXA 4O7YA 4Z16A 2G9XA 4RQVA 4EQCA 2BIKB 4ASEA 4U41A 1XH9A 3K5VA 2ITWA 4FZAB 5EDQA 1WBTA 2Y8OA 4IACA 4RBLA 3LXKA 5AAFA 3T9TA 1PF8A 2ITOA 3A7FA 4ZSJA 4ERWA 4CQGA 4M69A 4QYFA 4USDA 4YMJA 3EQFA 1NT2A 3GENA 3N9XA 4QP2A 3UQGA 4HGSA 4EH5A 2BIYA 5AV1A 1Q99A 1U54A 3OBJA 4FTNA 1KOBA 1SVEA 4EONA 3W8QA 1QPJA 3EQHA 2C6MA 2BTSA 4P2KA 4MXAA 4A4OA 2YERA 2X0GA 3TWJA 2SRCA 3FUPA 4GT4A 3VC4A 3ZXTA 4CFMA 5G6VA 4AFEA 4QMMA 5HHWA 4ALUA 3FE3A 4IFCA 4C4IA 3LKMA 4X3JA 1OL7A 3W0SA 4KRDA 4PPBA 4RLLA 4YR8A 4WNKA 3WILA 4FT7A 2YDIA 4F7LA 3UPXA 3U6JA 3HNGA 2BKZA 5J7BA 3TNHA 4M12A 5E7RA 4FKJA 3BWJA 1PXLA 3MS9A 1KV2A 5FBNC 5HIEA 3SG9A 4A4XA 2E9UA 5IQBA 2X0PA 4UEUA 3LXNA 3QKMA 4ITIA 4O2PA 4BCFA 2X0QA 3A7HA 1Q8YA 4TYJA 2CHLA 2EWAA 3PWYA 3ORIA 3S95A 4RJ5A 1PXNA 4FTAA 1RQQA 2XNNA 1ZMVA 2ITYA 4OBOA 1FGKA 2WTVA 3A8WA 3SXRA 5EKNA 2OIDA 5IA1A 3Q9ZA 4W4WA 2NNWB 4O4CA 4BBEA 1Q8WA 3R21A 5A4QA 4IC8A 3FQEA 2PVRA 5HZNA 4E6AA 4BDHA 3MV5A 5L8JA 2GHLA 4MXZA 2HIWA 4IH8A 3QYWA 4LYNA 3HUBA 3WIGA 4RJ7A 5HI2A 2R3KA 2W9FB 3W0PA 5LMAA 2EXMA 3KK8A 4APPA 4BBFA 2P2IA 4BI1A 4ZMFA 1BL6A 3O5AA 1U5RA 3PJ8A 4EOMA 1ZOHA 1PXPA 5IEYA 2HCKA 2VTHA 4FKPA 1OPKA 4IADA 5IUIA 4E5WA 5EQEA 2ONLC 4TWNA 4MXXA 5J87A 4D9TA 5AP3A 4A06A 1XMLA 3NW7A 3SQQA 3HA6A 5HNBA 3C4XA 2PZPA 4GFOA 4YJUA 1HOWA 3BYMA 2WMVA 5CVHA 5BQ0A 3FI8A 1PMVA 1JSVA 2E2BA 2NP8A 3OBGA 5DI1A 5J95A 3PPZA 4BDCA 2Z8CA 4L68A 3Q32A 2QKRA 1ZYLA 3MA3A 3TEIA 4CV8A 3FEGA 2WTCA 2R3FA 2W05A 1FQ1B 1OGYA 1XH5A 4ZS4A 4BCJA 4BTFA 2OXXA 2WMXA 4CFNA 1OIYA 3ENMA 2CCIA 2UZTA 4X0MA 1WVWA 5ETIA 3OXZA 5TR6A 3VUHA 5HG9A 3RI1A 3QRTA 5KMIA 3MWUA 4S31A 3VUDA 4OBPA 4L3LA 2R64A 5LVMA 3FI4A 4NL0A 4G3CA 2DWBA 2OI4X 5AV4A 4R7BA 1I44A 3UE4A 3DDPA 3BLHA 2A19B 3BLQA 1SM2A 3P78A 5J5SA 4R1VA 3ZZEA 3F61A 5BVWA 3BHHA 3CC6A 4BDGA 1YRPA 3RTPA 3IDCA 3QA8A 3PIYA 4EBVA 3TTJA 2W0JA 3ZBFA 4YZNA 2OLCA 2E9NA 2F7EE 4CNHA 1X8BA 3V5QA 3GCPA 3KXZA 2X4FA 4PNKA 1MP8A 4KBCA 2VWBA 2XYUA 3POZA 4O91A 3ZEPA 3TUBA 2PUNA 2RF9A 4H3PA 4RVLA 4UMRA 4FNWA 4XBRA 5DLSA 3LXPA 4EUTA 3QD0A 2WMAA 3LFNA 4O7RA 5C4KA 1XBBA 1ZZLA 2C6KA 2C0TA 4JIAA 4U44A 4EBWA 5I9WA 4NTSA 3KMUA 4FKSA 3R1YA 3RZFA 3QKKA 2F2CB 5K9IA 1KE8A 2F7XE 3G6HA 4JR7A 3IW8A 4TW9A 3T9IA 3KREA 5E9EA 3H3CA 4I20A 4JLCA 3A2CA 1XHAA 4QP3A 2Y4IC 5EW3A 3M2WA 3DTWA 4DEHA 3ULIA 1YKRA 2W1FA 3NCGA 1Y8YA 2XK7A 4JJRA 4YJRA 2QO2A 4FG8A 3TZMA 4HGLA 3W2CA 4EH4A 3BYOA 3FC1X 4I24A 2PSQA 4FT5A 5E8ZA 4IB3A 5FD2A 2RSVA 3O23A 3IK3A 2I7QA 2Z2WA 4XG6A 4FTMA 5A4LA 4M84A 4CCBA 4U0IA 2JDOA 3ZM4A 1ZYJA 2C6OA 1J3HA 4FTOA 2BRGA 2JIUA 3WZKA 2QOLA 4LV5A 4X3FA 1XH4A 1JAMA 4G3DA 4YZ9A 3RHXA 4UMUA 4HNFA 2YM7A 4P90A 3K5UA 3FL4A 4OAUC 2X7GA 2WMWA 2ZDUA 3HRBA 3PZEA 4BDIA 4YC3A 4GIHA 3ZO3A 3EL8A 1T45A 1RJBA 4FG9A 2VWWA 4I94A 1IAJA 1YWVA 3OWLA 3VUIA 4BDEA 4O82A 3UNJA 4ZSAA 1YWNA 5AP0A 4RIXA 1H01A 2Y6MA 3FMDA 3ITZA 3KQ7A 3PUPA 3R9NA 5CF4A 5LMKC 3Q6WA 4FKWA 1Z9XA 4IAFA 4ZZNA 5JFSA 4DDGA 2I0EA 4GCJA 3P08A 3BHYA 5FTQA 5FXQA 3L9LA 4FTKA 5IA3A 3QZHA 3GNIB 4L7FA 2C69A 4HGTA 4C3PA 5E8SA 2QHNA 4FKRA 3DOGA 5KMNA 3F5XA 4U3ZA 4R7IA 1WBVA 2GNHA 3K2LA 2WQMA 3NRMA 3NNXA 3LOKA 5A6OA 3VHKA 4OT6A 3KCKA 5DBXA 1REJA 5AV2A 3RJCA 5JRSA 1DS5A 3DZOA 3RPOA 2XKDA 4AN9A 3QXOA 2C30A 4PL5A 5IH6A 1OI9A 2CLQA 3QQFA 4EYMA 2H34A 2UW5A 4BZNA 5GZ8A 3E88A 5KMOA 1UV5A 4O0TA 4LOOA 4ZP5A 3OXTA 4H3QA 4IIRA 2PE0A 2B53A 3UDZA 3R9RA 3Q9YA 5K0KA 1GIJA 2WELA 2UW0A 3Q2JA 4FIGA 3LXLA 4TYGA 1DI9A 2BROA 3QF9A 3SHEA 4JS8A 1Q4LA 2YWVA 3R9OA 1WZYA 4TZRA 2XAOA 4C3FA 3HV7A 1F5QA 2W5AA 4F9YA 3AD4A 3F7ZA 3QCXA 2J9MA 3VWAA 4MTAA 4U8ZA 3W2PA 4BCNA 3DKOA 3AKLA 1XMMA 5M53A 1VR2A 1OPJA 3KMMA 4L6QA 3TNIA 3HYHA 3JY0A 3PLSA 4YZCA 3UIUA 2XARA 4BDAA 2VWIA 5CEIA 4H3BA 5AR3A 2BDWA 5AAEA 5ETCA 5BUEA 2R5TA 3ID6C 3BL7A 2XBAA 5M44A 4L53A 3QTWA 1DAYA 5LVLA 4OTPA 1U4DA 3RPYA 2O5KA 4DF3A 2VO6A 4BJJB 4DA5A 3DAKA 3EZRA 1KOAA 3HLLA 2HXQA 2ZV7A 4F78A 4JQ7A 4DINA 1AD5A 3B2TA 4MBLA 1XH8A 4U97A 3RWQA 3P5JC 4N6YA 2H9VA 5CZHA 5BYZA 3FZSA 4AXAA 2RFEA 2W99B 4G9CA 2OFUA 2RFNA 2UZEA 1P4OA 2HW7A 4RC3A 3FMEA 3H9OA 2X9EA 3L8PA 4FT0A 3MIAA 4ARKA 1MRUA 5CXHA 4FTIA 5HCZA 3DBEA 4MYGA 4EZ5A 3LAUA 3HRFA 3P7AA 4CEGA 4D4YA 4F9BA 3TJDA 2VTAA 3OXIA 5CU0A 3BHVA 4DGLC 4LI5A 3MTLA 3NUYA 2PULA 1Q3WA 3PG1A 3ETAA 4R3CA 4WOVA 2UVXA 2YITA 2BKKA 4EJ7A 1H28A 4GG7A 1SMHA 5BVKA 4JG8A 1WVXA 4DN5A 3FZTA 1G8AA 1H1QA 1YI6A 2OZAB 4YTHA 5FWKK 2JEDA 3SW7A 3G51A 1ZZ2A 4GVAA 4Y8DA 5HVYA 3WOWA 1ZYDA 4A9UA 4O4BB 3R0TA 2VTRA 3TJCA 4C4HA 4Q5HA 4FSUA 4A9TA 3RK7A 4B8LA 4NM3A 4DEIA 4LRKA 4EK5A 2C3JA 1H1SA 5IG1A 3BZ3A 4MQ2A 4OTFA 3E5AA 5JFXA 1KE9A 3UQCA 2WB8A 2WKMA 2BALA 2GNGA 2R3RA 3MVJA 4PP9A 3QC4A 3BGZA 3KRRA 1P4FA 5GINE 3R7YA 2HXLA 3RK5A 2IVSA 1JSTA 3V6SA 3GU8A 2OU7A 2VWUA 4O0UA 3TXOA 4AQCA 5HO6A 5LVPA 4RGJA 4F0IA 3SA0A 3ZDUA 4N57A 1ZWSA 5DOSA 4YNEA 4AACA 2A4LA 3ZLYA 4YJNA 3FLWA 2WZJA 3KXNA 3PIZA 4J8MA 3UVRA 2YISA 4DE4A 2HENA 3A4PA 2YM3A 3O8UA 4LOQA 4LMNA 3ZBXA 2FSLX 3O8PA 4BIBA 4QQJA 4O0VA 1XH6A 4V01A 3PTGA 4I92A 3FLSA 4ONAA 2W17A 3DNDA 4FKGA 4AW0A 4MHAA 4MEDA 4AQKA 1GAGA 4S30A 3KN6A 4E8AA 4ID7A 2CSNA 5GJFA 2JDVA 4D4SA 1CKIA 4NCTC 2AC3A 1VEBA 4DEAA 4U42A 4CT1A 3W0RA 3TIYA 2VX0A 2UVYA 4CFUA 2F4JA 1Y57A 2VN9A 3KCFA 1ZAOA 4F0GA 3VUTA 2PE2A 1YDSE 4WBBB 2R4BA 2BZJA 3UYSA 2ZVAA 4DITA 1JPAA 2UZNA 4X3FC 2VO7A 2A98A 4TNBA 2HZ4A 3E87A 3HMPA 4ITHA 3VO3A 3THBA 4R5YA 4C37A 4K77A 3EKKA 2H6DA 2WPAA 2BCJA 3L9PA 4BGQA 4Z7HA 1YVJA 4FTCA 5AEPA 4ZEGA 3RM6A 3RCJA 5ACKA 3EN4A 2WMSA 4GUBA 5I5ZA 5H9BA 3U4UA 3BU6A 3VS0A 3PPKA 3N4UA 5M55A 2Y4IB 2WIPA 3ZO4A 5K4JA 2ZOQA 5IA0A 2GMXA 2PMOX 2R3MA 4ZY6A 5LARA 4KSQA 3QBNA 3QRIA 4MD9E 4Y5HA 3A62A 3QTXA 4ANBA 4DGMA 5CU2A 2OXDA 5EI8A 4RRVA 4U81A 3EQRA 4E3CA 4QP1A 3HV3A 2J5EA 3OG7A 4FEXA 1JBPE 2OG8A 1J1BA 2R3QA 3BYSA 5AA8A 1APME 2XVDA 4YHJA 2REIA 3QCSA 4D28A 5C1QB 4YJPA 3AC3A 5JGAA 5BV3A 3PXRA 4FTQA 1TQIA 4BYIA 2PU8A 2CKQA 5I3RA 3FKOA 4RA5A 3OCTA 5HX8A 2BAKA 3MSSA 5HBHA 2QCSA 4EK4A 3NVMB 2PVKA 2EB2A 1VYWA 3CKXA 2Z7QA 3RPRA 4KWPA 4PWNA 4WSQA 3ZCLA 4A9SA 4DEGA 5I3OA 3SD0A 3VBWA 5F9EA 1E1XA 5KCVA 2X6DA 1O6YA 2QO7A 1SVGA 2GHGA 2W7XA 4IX6A 4PF4A 5CSWA 2G2IA 3C50A 3WZEA 3EL7A 3MB6A 3UO4A 3LFDA 4V04A 3PDTA 2W1ZA 3O8TA 2V7AA 4EOJA 3KFAA 4QQCA 1TVOA 3GOPA 3UNKA 1PW2A 4FVQA 4I0SA 4YLJA 4M0ZA 4RJ6A 2WEIA 2UW8A 2X2LA 1V0OA 4XMOA 5D9HA 4DC2A 5FXRA 5L6WL 5I0BA 5FDXA 3CJFA 4QMPA 3AMAA 4FRFA 4HVSA 5EM6A 4G17A 5CEMA 4HCTA 2R3JA 1REKA 4FYNA 4WA9A 4IMYA 2R2PA 2QU6A 4DG2E 4FI1A 4S33A 1Y6BA 3PXZA 5IISA 4CRSA 1OBGA 3WZDA 5TOZA 2IF8A 3EN5A 3I1AA 3GP0A 4J99A 3GXLA 3DY7A 4RJ8A 4X2FA 4ACDA 3BLAA 4QMVA 4DDIA 5BVFA 4MWIA 1MRVA 4FSWA 4H1MA 3P7CA 4BI0A 4XP2A 3L1SA 3FMKA 3VVHA 5CI6A 4G5PA 4RVTA 1JWHA 2Z7SA 2XB7A 5F20A 1LR4A 4E6QA 3TCPA 3G33A 4KKGA 3W8LA 4O1PA 3DAJA 3OHTA 3PRFA 3U51A 4YP8A 4FTLA 2C5OA 2WTJA 1Q97A 5FRIA 4GK3A 3R83A 3DAEA 1BUHA 4IFGA 4FF8A 3IDPA 4FV3A 1Q8TA 3OT3A 5KKRB 1BX6A 1QPCA 3UZPA 3PFQA 2HYYA 3UMXA 4EC8A 3RM7A 5C9CA 3R7OA 4TWCA 1JLUE 3UOJA 4PDYA 4MAOA 1FOTA 3QUPA 2Q0NA 3V8TA 2IPXA 1H1PA 3R1SA 4AZTA 5K5XA 3CTHA 1YHWA 5AUXA 3C4FA 1M7NA 2UVZA 3CR0A 2AYPA 1YHVA 3PP1A 1WCCA 4I93A 4IJ9A 4KB8A 4X2JA 1URWA 1OL5A 2KULA 2QOCA 2WD1A 2HWPA 1GZNA 4E4LA 2XP2A 4X21A 2OSCA 3ZLWA 3EQDA 1PXIA 2XCKA 4C38A 4QYGA 2G1TA 1IA8A 1IG1A 2JGZA 1RDQE 2B9JA 2QOHA 5EHOA 2BZKB 3FSFA 5LVNA 3FDNA 3PXFA 4YJSA 4BFMA 3UZTA 2P2HA 5AM7A 4MUQA 4FTTA 3PE2A 2ZB0A 3OZ6A 3SX9A 2OZAA 3TDVA 2OJGA 2Q0BA 5HO8A 4C0TA 4XEYA 3QRKA 2CGWA 5HBJA 4DCAA 3D2KA 2O64A 4N4SA 2ZYBA 3VONA 3FHRA 3DBCA 5CVFA 3HMOA 4XOYA 4A7CA 4B6LA 2CPKE 4O0YA 2VV9A 3C0GA 3I6UA 5DIAA 1PMUA 4O84A 2VU3A 2IWIA 2O3PA 3JYAA 4YUQA 4GT3A 2WU6A 1LEZA 2ZM1A 4FNYA 2ITPA 4WRGA 4DCEA 4LOPA 4C4GA 3NFFB 4UV0A 4NEUA 1YXVA 3MH2A 4Z9LA 2G2HA 4D1SA 3WIKA 4G34A 5HG8A 1OIQA 4FZ6A 2FSTX 2V7OA 4S34A 1UU3A 3NNWA 4FC0A 4Y83A 4ACCA 2WTKB 2QG5A 4HGEA 3R00A 2UZDA 2VAGA 2Y4PA 1FMKA 4O38A 2XM9A 3KRWA 1R1WA 4XUFA 3UOHA 1GIHA 1BMKA 4X2GA 3ZHPC 1MRYA 3WF8A 4ACMA 4XG4A 4QDEA 2WO6A 1R3CA 3VUMA 2DUVA 3R9DA 3IW4A 1YOLA 3HV4A 4FV5A 5HLPA 3W0OA 5CAVA 3OF0A 3CEKA 4CFWA 4LUEA 2IW8A 2RG6A 3EN9A 3RPVA 4H1JA 3VW8A 4F7JA 4AW2A 4BDJA 3KXMA 2JDRA 4RC4A 5M51A 4QNAA 4OW8A 4GL9A 5E92A 3ZONA 3O17A 1NVRA 3Q5ZA 4NIFB 3CQWA 3WE4A 4ZTRA 2XRWA 1H8FA 4MXOA 3GCSA 3DT1A 3LVPA 2CNVA 4J7BA 3MA6A 2NRYA 2YJSA 2XEYA 1GZ8A 3HAMA 2GNLA 4BWXA 3BKBA 4YBJA 3RNIA 3FPQA 1OL6A 2Z60A 3R9HA 4YU2A 2BZIB 5CAQA 4LDTA 2YIXA 3FKLA 3PSCA 4M66A 2VWYA 4D2SA 4D9UA 5EI2A 3Q5IA 1PXKA 4GK4A 4DFZE 5EOBA 4USEA 5KHWA 2G2FA 2WMUA 5ANGA 3QA0A 4I23A 4AZFA 4R77A 4KBKA 2WTKC 4GYGA 4H39A 5CSPA 3HRCA 1HCLA 3HA8A 4RIXB 3LFSA 3H0YA 4XH6A 2QD9A 4CMOA 4AXCA 3L8XA 2CKOA 4RWJA 1XJDA 5TE0A 5IUHA 3FI2A 3TL8A 3P9JA 2FH9A 4IVBA 1W7HA 2UW9A 4ZZOA 4TNDA 3BHUA 1P14A 4YJOA 3VS4A 1XQZA 4MBIA 3ZFXA 2X2KA 4OLIA 2X8IA 4BWKA 5BNJA 4ZY4A 3LW0A 4F7NA 3TUCA 4F99A 2QG7A 4QMNA 4BHZA 4YJTA 2VGOA 4E26A 4XLVA 4TYHA 4IWDA 2J51A 5C8MA 5DPVA 2Q83A 4M97A 4FV2A 4AZWA 3UGCA 2XBJA 4OTIA 4O7ZA 2YM6A 5CNOA 4AA4A 4XNEA 4UWBA 2PZIA 1NW1A 3UO5A 1YXSA 4CSVA 1KE6A 3MH1A 3QC9A 4YC6A 4UMPA 2LGCA 4GRBA 4UWYA 3SDJA 3V01A 4R1YA 2I0YA 2WU7A 4U40A 4ZMEA 2W1HA 3OOGA 4FMQA 1OMWA 4AP7A 4DTKA 4DFXE 4QOXA 2W1CA 3T3UA 4CD0A 4ORKA 5CEKA 5D7AA 2WXVA 3UQFA 5L6PA 3QRUA 3Q60A 3MY1A 3W2SA 5IEVA 5CZIA 3A7IA 3TMOA 3R22A 2IEWA 4L44A 4PL4A 3MY0A 4FTRA 3WF5A 4CMUA 4FR4A 2JIVA 3MVLA 2OF4A 3C4CA 2GPHA 4ITJA 4FIFA 3ZU7A 2JIIA 4G3GA 3RWPA 4O0WA 4TL0A 2PUIA 4UN0C 3Q2MA 4YC8A 4BTKA 3EQPA 2VUWA 3HP2A 5BX0A 5E8XA 5AP2A 4IAIA 4FKIA 4DHZA 5JZNA 2GS7A 1W2DA 2OGVA 3DU8A 4K1BA 3W33A 1OVEA 4BCIA 2WQEA 4PX6A 4WKQA 2X81A 2FSOX 3OT8A 2R3NA 2YM4A 3QD4A 1IRKA 4KKHA 4NM7A 4IM3A 4PMSA 5J7HA 4JRVA 4G2FA 3R8ZA 4FVRA 2F9GA 4IX5A 3E7VA 3CQUA 5CS6A 4IB0A 4XJ0A 4Q5EA 3GFWA 5LXMA 3TDWA 2IZSA 2OIQA 3DGKA 4WRSA 5K0XA 5CSXA 3W0NA 2CGXA 4L67A 3G0EA 2PE1A 3FMLA 4RMZA 2JC6A 3MESA 1XR1A 4YJVA 1UU7A 4BCHA 4OGRA 2IVTA 4PMMA 1DAWA 4FT3A 4O86A 2QODA 5IZFA 3FXZA 4QDVA 3TTIA 4EJNA 3FXWA 3W0QA 3F5UA 4QMZA 1FINA 1M52A 3RPSA 3C51A 3AC1A 3Q04A 5TF9A 3COKA 2OWBA 3VW6A 2AC5A 2YLEA 2PYWA 4MWHA 3QTZA 5DR6A 4NZWB 3ZSIA 4HJOA 4EOSA 4EHVA 4EK6A 5AJQA 4FV1A 5ANIA 3PIXA 4RPVA 4KABA 1H26A 5IMEA 2VTPA 3ENHA 2EU9A 3NAXA 5BMMA 4BL1A 1UWHA 1JKTA 3EQGA 5CU6A 4L3JA 5HTCA 2R9SA 5AWMA 4ZLYA 1GY3A 3SGCA 3FZPA 3MJ2A 4EOPA