5CEOA

Dlk in complex with inhibitor 2-((6-(3,3-difluoropyrrolidin-1-yl)-4-(1-(oxetan-3-yl)piperidin-4-yl)pyridin-2-yl)amino)isonicotinonitrile
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
269
Chain Sequence
b'LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 12
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ceoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ceoA01
4KKHA 1OITA 3AT4A 3R7YA 3FHIA 2BDFA 3T9IA 4EZ3A 4K1BA 4KB8A 5L2TA 5JFXA 5HGIA 4RIWB 3FBVA 2BPMA 3NVKI 4DFXE 1XO2B 5D7AA 4JQ7A 4TW9A 1BX6A 2Z02A 3VS0A 2BAJA 1PXLA 2XIKA 4KRDA 4ZTSA 3R9OA 3F5UA 3PY3A 4N6ZA 5H8EA 4RIWA 1REKA 4IE9A 4C61A 5CI6A 4D58A 4LV5A 4DFBA 2R3LA 3R1QA 3MPTA 4O7NA 3EQCA 3PPKA 5FM2A 5F1ZA 4CD0A 3FQEA 5AR3A 4LOQA 4EKKA 3GXLA 4ONAA 1YI4A 3DBEA 3W55A 5JEBA 2VD5A 5CF5A 1J7UA 3M2WA 3IGGA 3ORNA 5BVFA 3QQKA 3HAMA 1H0VA 3PIZA 4EH4A 3L9LA 2XNBA 4R7IA 2P2IA 3FXZA 3TNHA 5AV1A 5J1WA 5FQDC 4YC6A 5KMJA 3FXXA 3OW3A 4EH3A 4FV8A 2BROA 1W98A 4XV2A 5HBJA 2XB7A 4IM0A 3S4QA 1JQHA 4TYHA 3EHAA 3AC1A 5TO8A 4ZZMA 3BEGA 3ZONA 4I5CA 3CTJA 2JKKA 4J95A 2XBJA 4KA3A 3ANRA 4D9TA 3C5IA 2PMNX 1YHSA 5IA3A 3DB6A 3LFCA 2ZV8A 4AP7A 4F7NA 5B7VA 4FF8A 3MIAA 4LOOA 5CI7A 3NAYA 2O2UA 3ORTA 4RX7A 2WMSA 4RPVA 4FKOA 4UYNA 4RWLA 3HYHA 4RVKA 5A6OA 3ODZX 4CYIA 4H3BA 3BGPA 4IXPA 3ULZA 3O50A 1CMKE 4WBBB 5HU3A 1W82A 4FTJA 4C33A 4NFMA 3T8OA 3NIEA 4J52A 3EQFA 2FVDA 2J2IB 4A9SA 2UV2A 3TUCA 3HL7A 3I81A 4BKZA 3FL5A 5A6NA 3I5ZA 3FZ1A 2NO3A 5E8ZA 1Q97A 3E3BX 3FLSA 4TWNA 2RGPA 3DBQA 1SVHA 5JKGA 3AC8A 5H9BA 3PIYA 4D0XA 5M56A 2C4GA 3MH3A 4KD1A 2PWLA 4BGQA 1REJA 2IJMA 1IR3A 4IX3A 3DJ5A 3BU3A 5E9EA 3E8EA 4G17A 4RWJA 2C68A 3KCFA 5AR2A 2OKRA 3G9NA 4LRJA 4UBAA 2W1DA 4I22A 2JFMA 4IM3A 3ZU7A 3N4TA 4IAKA 5HCXA 2OWBA 3OT8A 4FNXA 4JBOA 4ZK5A 2QOQA 4I3ZA 3Q3BA 4UWBA 3SG8A 4CXAA 3VW8A 3QRIA 4U79A 4UWYA 2Z7QA 2Z7LA 4PDSA 4O22A 4EH7A 4EH5A 3F3ZA 2WXVA 4XG3A 2QHNA 3D94A 5ANOA 3EN5A 3A7IA 2ETMA 3IW4A 3SW7A 2A4LA 4BI0A 5IUGA 1YHWA 2AYPA 2I0VA 3L8VA 3U6HA 1UV5A 2Y4IC 3NYVA 4QYGA 3ORXA 5KCVA 2VTLA 3RHXA 2W4JA 2BKKA 4V05A 5JGDA 4EUUA 2QONA 5CT0A 4CV9A 4PPAA 3LXPA 2YDIA 2A2AA 4WG5A 2W5HA 2GS7A 2CKQA 3TACA 2ZDUA 3BE9A 3QD2B 4RJ5A 1F0QA 3HDNA 2HOGA 3C0IA 5A46A 4IDVA 4WSYA 1W83A 3BWFA 3ORLA 5J5TA 3FV8A 3R9NA 4QMNA 3FJQE 2JDSA 3LCTA 5LWNA 4LRMA 2R2PA 3DCVA 3RAIA 4NW5A 2BZIB 4AT5A 5KE0A 3OTVA 5JK3A 1KUTA 1OL5A 4ACGA 1SNUA 3QUEA 1CKJA 1JKLA 1MUOA 4NTTA 2ITYA 3BI6A 3R7EA 3R8MA 4D1ZA 1Q41A 4U7ZA 4U6RA 2FA2A 3R2BA 5JQ8A 3FMHA 3UIUA 2YCRA 5K5XA 1B6CB 2C6LA 3HGKA 3EQIA 3QAME 5CXHA 5HOAA 1BMKA 3ZH8A 3ZC6A 4PNIA 3PJ8A 4X3JA 3JUHA 4M68A 5G1XA 4FSUA 3FMNA 3C4EA 1OGUA 3W1FA 2UW9A 4PTGA 4JX7A 5H2UA 1QCFA 3DXNA 2R7IA 4X2NA 4C62A 3PWDA 5AMNA 1YDRE 4IAFA 1H01A 5DVRA 5I3RA 5IZFA 3AC3A 4PP9A 4RFZA 4RJ7A 3U9CA 2IPXA 3VC4A 4F9BA 2ESMA 3O2MA 3TZ8A 4DG0E 2ZDTA 3R00A 4X0MA 4YJNA 2PMIA 3HP2A 4GFMA 4U97A 3NUSA 4J8NA 4FGBA 3A7FA 3V5JA 2EB3A 4BDAA 3GEQA 1STCE 5HIDA 5EDQA 1RJBA 3F66A 3WARA 4XYFA 4O96A 4HOKA 2ITVA 2QLUA 1OVEA 2PK9A 5EH0A 4FEQA 3GU4A 2YM5A 3CQUA 4QMVA 4IX4A 5DYJA 4E93A 4QP7A 4MF1A 3NYOA 2B9HA 4ZTNA 5ICPA 4DGMA 4JR7A 4CMTA 4FZFB 4RX8A 4GT4A 4W8DA 5KMIA 3Q9WA 5AEPA 3G2FA 1SVGA 4O0XA 4FODA 2P3GX 2YITA 4V01A 3WBLA 4GT5A 4H05A 4FIFA 5F95A 3AG9A 3PDTA 3Q04A 5L2IA 3KXNA 1T45A 1XR1A 3D2KA 3UG1A 4ZTRA 4MD8E 3UNJA 4AFEA 4ALWA 2XNMA 2YERA 3ALNA 4F0GA 3DAJA 4YTCA 2IVSA 3LJ1A 5D11A 4JIKA 1WBPA 3KL8A 3MB6A 1GNGA 4RIXB 3VW6A 4BVUA 3BHYA 1WVYA 2WTIA 4FVPA 3ZEWA 4AQCA 3CC6A 4UV0A 4K33A 4UXQA 3R7IA 2PZRA 5CVHA 2F4JA 3HNGA 4UMTA 4XUFA 3LMGA 3WF7A 3ZFXA 5KMNA 4RIXA 3FPMA 4RIYB 4Y46A 2EU9A 3BGQA 3KMWA 2AUHA 3QA8A 4RGJA 5D10A 3WF5A 2PVHA 4MXYA 5HD4A 3ZZEA 2NPQA 3DTCA 1PRYA 4RIYA 1L3RE 2R3GA 2WMRA 4MWIA 3S3IA 4LI5A 4ZOGA 2CDZA 2VAGA 3GVUA 5CSHA 1APME 1XKKA 3IW6A 4FOCA 4NTSA 4RX9A 4PWNA 5KX8A 5EYCA 4CRSA 2W4KA 1OUYA 5L6PA 3FZOA 4O7TA 1PJKA 2YIWA 2WD1A 4CFWA 4FVRA 3IDCA 2BKZA 4FV2A 5EI2A 2G2IA 2O3PA 3QZGA 4TYEA 3R1SA 4DEBA 2NRYA 5ACKA 3UZRA 3L8SA 5C1QB 2YJRA 4FSZA 3GNIB 5CVFA 2R3PA 4D2WA 2Z7SA 4G3EA 5BX0A 4JI9A 5IDPA 4FZAB 5M4IA 2R3IA 1TQPA 3VRYA 4O0VA 5HTIA 4OTRA 3KRWA 3VS5A 3EL7A 4JBVA 5EKOA 1SVEA 4IBMA 3LQ5A 2OXDA 5HE3A 3QF9A 2BHEA 3I7BA 2Y0AA 4PPCA 2RFSA 4D28A 4RA4A 5CANA 5FXRA 4FYOA 3NDMA 3SGCA 3I6UA 4U41A 1Y8YA 2VRXA 1SYKA 3R83A 1L8TA 4ITJA 2UZBA 4CFUA 1KV1A 4FIGA 3ZZWA 1PMVA 5CEOA 2XNPA 3EFWA 4MNFA 5KMLA 2C3IB 3C4FA 5AP4A 5HG5A 4P90A 4Q2AA 4U80A 3Q5ZA 4L43A 5A54A 4GFOA 2PMLX 4D4VA 3LMIA 3WZDA 1YI3A 3TDWA 3OS3A 3LIJA 4BBFA 3TNQB 4QMXA 2UW0A 4FKRA 3PXFA 4I94A 3ZO3A 1BL6A 2ETKA 3UIMA 5L2QA 4YC3A 2CCHA 4UN0C 3M1SA 4NIFB 5HG8A 3KXXA 4IEBA 4M7IA 1XWSA 2V0DA 2VWUA 5L8JA 5ACBC 3WILA 5C4LA 4L3PA 5L8LA 2CGUA 2CPKE 2UZEA 4IWQA 5HVKA 3ROCA 1K2PA 4U43A 3W2QA 2EXEA 3K5UA 3CXWA 3NUNA 1Z5MA 2JFLA 5C27A 5IQEA 2B0QA 4NIFA 5B0XA 4CVAA 2X4FA 5E4HA 2VWBA 5EQPA 4O21A 5I9UA 3FLWA 4U3ZA 4IC8A 3SRVA 2QOOA 1XH4A 3LW0A 4EBWA 2QKWB 3QC4A 1YDTE 4ZSLA 1PHKA 1DAYA 2YM8A 3GB2A 5DR2A 3ZLXA 2GQGA 2OIQA 3PP1A 5HHWA 3UG2A 4GU6A 4FIEA 3CY2A 1BL7A 4OAUC 4MEDA 4HVHA 4GIHA 4J7BA 4TWPA 3OBJA 1JPAA 2VX3A 5DNRA 5CS6A 5E1EA 1FMOE 4X6QC 4BDBA 1U5QA 3FQSA 3RVGA 5E1SA 1WBOA 4CGAA 4IWDA 1GZ8A 4UYAA 5DEYA 4FV5A 3RPYA 1UU7A 3R22A 4W9WA 2PVMA 1VYWA 3JY9A 5GINE 2UW4A 2W1CA 2X7OA 4M69A 4XBRA 3KN6A 4RFYA 5HG7A 5M09A 2PVFA 2QU6A 3HP5A 3R8UA 2VU3A 3W2RA 3LXNA 2QKRA 3E5AA 2F7ZE 2GHLA 1JOWB 4FT3A 3OCBA 3KF7A 2Y4PA 4W8EA 4CT1A 4D1SA 1NT2A 2W99B 3QTXA 4E4XA 4XX9A 2V7AA 3MWUA 4Q9ZA 3PXZA 2C6TA 1GY3A 4GG7A 4WBOA 3PG1A 4YHFA 3VBWA 2JEDA 4GK3A 1YVJA 4K0YA 4XOYA 4XRJA 2XIXA 5EYMA 3CBLA 4WNKA 3CS9A 4KAOA 4PRJA 2XF0A 2BZJA 2W1HA 3E92A 4H3PA 3TNWA 4M66A 2V62A 5E92A 3GFEA 4YJQA 5LVMA 3F3TA 5EM8A 4IC7A 5TF9A 3QRTA 5EFQA 2NP8A 3Q52A 2GCDA 3F7ZA 3VJOA 4D2TA 3NVMB 3FMJA 2GS2A 3TIYA 3EFJA 1H25A 2Q83A 2C69A 4G6LA 2HZIA 5HBEA 3O51A 4UX9A 5IA1A 4YU2A 4K18A 3D14A 5EM7A 4IQ6A 5AAEA 4BC6A 3QZIA 4DCEA 3HEGA 4P4CA 3MFUA 5CF6A 2PZYA 4EOIA 3R7VA 5KHWA 4FTUA 3RALA 4AGDA 2W06A 2JKQA 4H58A 5C26A 3GU5A 4DTBA 4FSMA 1OM1A 3NUXA 4CFNA 3RWPA 2Y8OA 5IEXA 4IH8A 4GKHA 2XKCA 1PYXA 3VO3A 4DFLA 2F2CB 3FI2A 2P2HA 2V55A 2VUWA 2WPAA 3RINA 3EMGA 3QQHA 1JWHA 4FKVA 3EB0A 2JITA 1SZMA 5KZIA 3R9DA 5CU4A 3UGCA 1P5EA 4AW0A 5IQAA 1V1KA 1MQBA 2IG7A 3MPAA 3FKNA 3D5WA 4TNDA 5IQGA 4OAVB 4O91A 2OU7A 3LXKA 2QHMA 4MF0A 3FXWA 1XJDA 5AWMA 1UKHA 4MKCA 4L01A 3W2OA 3OWKA 2QOKA 5KNJA 4XP0A 3TJCA 1ZYLA 3NLBA 4IJ9A 4QQ5A 4WO5A 1YKRA 3MYGA 2ITOA 4FVQA 3ID6C 3FLNC 4JAIA 5DR6A 4O82A 1H1SA 1ZMUA 3QTSA 1V0BA 5DIAA 4BTMA 4QMOA 4MQ2A 4CMOA 5IPJA 4EHVA 3S00A 3QTRA 3ORMA 3HV3A 1H1QA 2BRHA 1S9IA 5AP2A 4CT2A 3LMHA 2XNNA 1VJYA 4IM2A 2H96A 4RG0A 3EQBA 4WRSA 2HIWA 4LUDA 4UALA 5LMBA 4CZYB 4BDHA 3NUPA 4FV0A 4D2PA 3R7UA 1PF8A 3JR1A 4R78A 2V5QA 3EWHA 3UP7A 2YZAA 2JIUA 2OZAB 3L9PA 4KS7A 4ZJVA 4GVAA 3PSDA 2HYYA 4PP7A 4FUYA 4LRKA 2OH0E 4TL0A 3MJ1A 2OZAA 3HMMA 1GIJA 2KULA 4ZTLA 3NUYA 4Z7GA 4FTCA 2WQNA 4E4LA 1UWHA 2Z60A 3ZUUA 3FZPA 3TUBA 2H6DA 3C0GA 3MSSA 4I23A 4DGGA 1B38A 2UVZA 3R2YA 5HLWA 4GG5A 3W32A 3KC3A 2VX1A 2W1FA 4BTKA 3ZSGA 5DGZA 3PA3A 4F9YA 4YTIA 4FTIA 3CKWA 2UVXA 5E8WA 1J3HA 1JKTA 3HV4A 3L9MA 2VV9A 3FC1X 3QTZA 4OBPA 4RLLA 4BDIA 4EQCA 4EWQA 4GFGA 5J7BA 3ORPA 4B8LA 3LVPA 3ZBFA 3E62A 4F6SA 5FXSA 4WSQA 2ITPA 5AP6A 5GIOE 4WNPA 4MCVA 5LMAA 1RW8A 4TPTA 1WVXA 2QD9A 5C8MA 4O7LA 4BZDA 4F09A 3T3UA 2E9NA 2VTIA 3N51A 4RVMA 5FEDA 5K9IA 4DE4A 2XJ2A 2R3FA 2X7FA 5A9UA 3RPSA 3CJGA 3DBFA 4TZRA 2C30A 3VF9A 3F2NA 5ETIA 1PKGA 3QGWA 5FTOA 3I7CA 4FV4A 3OHTA 5CU2A 3EFLA 4GJ2A 3COKA 2GNGA 2PE2A 4BDDA 2C3LA 2W9ZB 4AUAA 4DH1A 4EK5A 4F1MA 2F2UA 1IAJA 3HMNA 4H39A 5AUWA 3U87A 1JVPP 2ITZA 3E93A 1H1RA 2XH5A 3AT3A 3QQJA 2GNHA 3AC2A 2FSLX 4TTHB 1GZNA 5DN3A 4KABA 2R3RA 3LHJA 3PE2A 4JDHA 4NUSA 3BKBA 3W8QA 1WAKA 5B2KA 1U5RA 2VTJA 5CSPA 2VO6A 4LMUA 2VTHA 3B2TA 1QL6A 4MK0A 3RK9A 5AR7A 4XG7A 3BHTA 3VBVA 4AN3A 2WAJA 2F49A 4G9CA 4FNWA 2HELA 3KB7A 4FC0A 1M17A 2XKEA 4AZSA 2O63A 2UZDA 2Z8CA 3BLRA 3CQWA 4OBOA 4YZMA 3V6SA 3UVPA 1VYZA 3R7GA 2QODA 2X6EA 3ZUVA 3RP9A 4E1ZA 5J9YA 5BNJA 2G2FA 4I4EA 1ND4A 3IECA 4GIIA 2P0CA 2BMCA 4FTKA 2XUUA 3P78A 1V0OA 3QFVA 5EI8A 5I9XA 1Q8YA 2FH9A 2GNJA 5EW8A 5FP6A 5IH4A 2GDOA 5ITAA 4UZDA 1ZOGA 2BDJA 3S95A 4IWPA 1BLXA 3CD8A 3R28A 3LCKA 4TYIA 2WMBA 1BI7A 5ANEA 3MY0A 4MD7E 4DEAA 4OUCA 4XG4A 3P7AA 2XM8A 3VUIA 4NKSA 4ID7A 3RCDA 2CNVA 1YWRA 5HNIX 4GYIA 5E8VA 2XCHA 3UPZA 3TM0A 4TT7A 4L7SA 3DT1A 3P1AA 3LXLA 3FE3A 3BLHA 3OWLA 4G3GA 4M67A 4EOSA 3V51A 4XMOA 3TIZA 4I24A 3KVXA 1GOLA 2PUUA 4L53A 5A4QA 4QMPA 3VJNA 2CNQA 4GKIA 3LJ2A 3AT2A 4G6OA 2OW3A 4NEUA 4BCQA 2ZM3A 4NCTA 2GFSA 2BRGA 2ZMCA 4C59A 2PZPA 3PA4A 2VNYA 2XCKA 3F5GA 4A4LA 1P2AA 4G2FA 3SKCA 2C1AA 2I6LA 5IQBA 2HXQA 4TRLA 3FL4A 1ZAOA 4OT5A 3TKHA 4B6LA 5HICA 4DH3A 4F9WA 1YOLA 4YZDA 3IW5A 2BHHA 2W1EA 3IQ7A 3TKIA 4JQEA 3V5LA 4XCUA 4IAZA 4AACA 4CEGA 3VF8A 2OFVA 4JDKA 4NSTA 4F08A 4H3QA 2J0IA 4BDJA 2I0EA 2JDVA 4Y5HA 5HX6A 3QKMA 4MAOA 4X3FC 3JXWA 3ZM4A 2EXMA 3F6XA 5GNKA 5HX8A 1R0EA 3LFBA 2XMYA 3GC0A 5J79A 3KRJA 2F9GA 3KXMA 3ZDIA 4IB3A 1PMEA 3TV4A 4J1RA 4DLJA 2O64A 3HDMA 4G5JA 1Q61A 3R8VA 3DXQA 4DFYA 4FKJA 3B8QA 4K6ZA 4WG4A 4BB4A 5JFVA 3DKGA 3GU6A 2YAAA 3IK3A 1WBWA 5FXQA 2OJ9A 4AW2A 1UNLA 2CKEA 3ZTXA 3R01A 2ONLA 3RK5A 4S2ZA 3ZOSA 4YSMA 4ZTQA 4V04A 4ZS4A 4UMRA 3ZLWA 3M42A 4AA0A 1Y8GA 4JT3A 5I9WA 5JRQA 3SXSA 5E8YA 4X2GA 5FDPA 4C4GA 3DQXA 4A7CA 4AX8A 3F2AA 1BUHA 1M2QA 1U59A 4IB5A 4U44A 5IH6A 5AV3A 4TYHB 3OFMA 4W4VA 3UYSA 3EQRA 2IZTA 4P2KA 2WFYA 3ZC5A 2P55A 4DC2A 3G33A 2QURA 5CNOA 4JDJA 4AZEA 1Q8TA 5BPYA 2OH4A 1QPDA 3DK6A 5BUIA 4QQCA 1Q8ZA 3P08A 3LFSA 4NM0A 1NVSA 3EJ1A 1H28A 4PUZA 3OWJA 4AW5A 2CN5A 2QNJA 3I5NA 5JFWA 4DT9A 1U4DA 1ZARA 1E9HA 3IPHA 1KOBA 3RPOA 3U9NA 5CU0A 2XRUA 3C4ZA 4NJDA 2A19B 4V0GB 2R0UA 3G9LX 4WNMA 4ASDA 1QPCA 2WELA 2XA4A 4HVSA 4BI1A 3RAHA 1MQ4A 3V8WA 3GFWA 2W17A 4YPDA 4EH8A 4V0GA 5BMMA 4UMUA 5I9ZA 2HWPA 5HG9A 3V6RA 2C5NA 3E7OA 4I6FA 4ACHA 3FI4A 3GT8A 3PFQA 3NUUA 4O86A 4ANOA 3HRBA 4A9UA 4C4JA 5JZNA 4S33A 4TYGA 4ZJJA 4ALUA 4R3RA 3Q4UA 4QP8A 5HE0A 4FTQA 5A4EA 2E9VA 3P0MA 2X7GA 4BHNA 3FAAA 4RQVA 4USDA 4KS8A 3VUMA 2DUVA 2FGIA 3PPZA 3QRKA 1OL2A 3PZHA 3R63A 2B9IA 4MXZA 4QP2A 5CY3A 3VQUA 2PUNA 2BRBA 3LZBA 4N0SA 4AOJA 1JSTA 4FK6A 2C6DA 2C47A 5M55A 5FWKK 4DA5A 1KV2A 3OUKA 3R02A 5HO6A 4RJ8A 4ANNA 4II5A 5EM6A 2YAKA 3QWJA 4I4FA 3PVGA 5IQCA 3FI3A 5AM6A 2W05A 2QI8A 3QXPA 1MRVA 2ITXA 4HYUA 4QYHA 3UMXA 4DTKA 4YSJA 5BMSA 2CKPA 2R3NA 4X7QA 2GTMA 4UXLA 2FUMA 2VO3A 3AMBA 3WIKA 4JLCA 1FOTA 3DKFA 5CAQA 5F9EA 3W2SA 4OW8A 2HY81 3NYXA 3RK7A 4N70A 3R6XA 4G16A 2HW6A 3KRRA 2OK1A 4AZVA 3MGYA 4EI4A 2X2MA 3GQLA 2WMWA 3R8ZA 5DT4A 4QQTA 3POZA 4J8MA 4C7TA 4YHTA 2X9FA 3JVRA 3VS1A 3I79A 4HCVA 2XBAA 4EOKA 4DTAA 4F70A 2RIOA 4ITIA 4TXCA 4BFMA 4D4SA 4USEA 5HIEA 2PVNA 5AV4A 2V7OA 3OY1A 2WGJA 4FTLA 4G1WA 4MX9A 3UPXA 3V5QA 4WUNA 4AA5A 2XEZA 1UNGA 2VZ6A 1OL6A 2P4IA 3O7LB 1FQ1B 5D1JA 5AUTA 3QGYA 3AGMA 3L9NA 4FT7A 1WFCA 1WCCA 2OGVA 3UJGA 4AE6A 4F9AA 4QPSA 1IAHA 4CFFA 1J91A 3WZUA 1SM2A 2OFUA 3BYMA 1H8FA 5D7VA 4R77A 2RG5A 5T68A 2QOCA 4RQKA 3NW5A 4JOAA 3UO4A 4ZSGA 3UVQA 2VGOA 2OICA 2XZSA 1DS5A 3EOCA 4ITHA 3RMFA 2OJIA 3FUPA 3LOKA 2ITTA 4M97A 3H4JA 3UE4A 2AC3A 4IMYA 3WYYA 1OL1A 3QALE 3VRZA 4MD9E 1JKSA 3MFRA 2C6MA 3ZO1A 3KVWA 5JH6A 2RFDA 3BCEA 2E9PA 5DHJA 2YCQA 3OC1A 3QYWA 4DEIA 3GCSA 2VTNA 4F7JA 4QYEA 1Q8UA 4FNZA 4ALVA 3Q2MA 4EOQA 2PVJA 3D4QA 3NCZA 5BVDA 3VHKA 3AQVA 3CTQA 3DZOA 4QMUA 5KO1A 1KWPA 3SDJA 4FX3A 5LVLA 4JNWA 2VNWA 3U4UA 2WTWA 3N4VA 3E8CA 3MI9A 4XEYA 2QC6A 3VUDA 3Q2JA 3P5KA 4WUAA 3OXTA 4EEVA 2IN6A 4H36A 4I5HA 3C13A 3R71A 3B8RA 5CAVA 3LCOA 4M14A 4NL0A 2IVTA 4NKAA 4XLIA 4KBAA 1IA9A 2WTCA 3QRJA 4CTCA 3T3VA 4RRVA 3PJ1A 3ZBXA 2HY0A 4CG9A 2VWZA 1M52A 1UNHA 2Y6MA 4JAJA 2QVSE 1NW1A 5GZAA 3WF8A 5I0BA 5KKRC 4BDCA 4QNAA 3THBA 4O38A 4FGRA 4YTHA 4XRLA 4BBMA 3Q4CA 1URWA 3DB8A 3BX5A 3LLAA 3NAXA 4YR8A 4ASXA 2ETRA 4L3LA 4KIKB 5LXMA 2VTQA 2BAKA 4M15A 4F7LA 3D9VA 4PX6A 4LV8A 1AQ1A 4C3PA 4DITA 5GZ9A 4JG7A 3A4PA 3QX2A 4GEOA 4IAYA 3ZLYA 3QTIA 4KIPA 4FV9A 4KNBA 3EL8A 1OIYA 4KIKA 1M7QA 4I21A 5J1VA 4CYJA 3Q9ZA 3BHVA 4N4SA 4C0TA 4LGDA 4EORA 3GCQA 4O1OA 4C37A 5EKNA 2PMOX 3FKOA 3MY5A 4KSPA 3PRFA 3A7HA 4U3YA 3VS3A 4BCNA 4QP3A 3MVJA 4EL9A 3HX4A 4RJ4A 1WBSA 2W5BA 3RI1A 5FRIA 1YW2A 2IZSA 4UZHA 5DEWA 3CSVA 3QKLA 1ZMVA 5DI1A 2J7TA 4ACCA 3U6IA 2PUPA 3OP5A 5EHLA 4G5PA 4JRNA 2WMVA 3QLGA 4YMJA 2PE1A 4JX3A 5EG3A 4CLJA 4E7WA 1J1CA 4BTFA 2WMTA 4YPSA 3V5TA 1LEWA 5HO7A 1WBNA 4F4PA 5IF1A 1VR2A 3TN8A 4C2VA 2PUIA 3S2PA 4Z3VA 4HGLA 4JS8A 1ZXEA 2C5VA 1WBTA 4FI1A 4O0TA 5HORA 3GU7A 3A62A 1Q24A 4H1JA 4LGHA 1PXOA 5EHYA 1J1BA 4A4OA 4BYIA 5E8XA 3CPCA 4BCMA 3GC8A 4QMZA 4PNKA 3DKOA 4QQJA 5EYKA 3SAYA 5CALA 3KK8A 2QO7A 4R5SA 1RQQA 2VO0A 4AZTA 4DGOA 2WIHA 3FSKA 4FIIA 2O65A 4DYMA 4DGLC 2AC5A 2PVYA 5CEQA 2XNEA 2PE0A 2Y9QA 4K77A 1UU9A 4ASEA 3C1XA 4KBKA 2BTRA 3UIXA 2UW6A 2G1TA 5DR9A 3NGAA 4I0RA 2ZVAA 4PTCA 3LFEA 4UB7A 5GJDA 3HUCA 4Q5HA 2JBOA 4C4FA 1IEPA 3IOPA 5E90A 4E73A 5CSWA 5EDRA 5AP0A 2XK7A 2BFXA 5J9LA 3QZFA 4YJUA 2J90A 5FDXA 2GPHA 1NY3A 5FG8A 5J7HA 4FEVA 4B0GA 3TTIA 3R0TA 3OVVA 2C6KA 4IFCA 2OXXA 4BCHA 4NT4A 1M14A 2OJGA 4LFIA 5B2MA 3VS4A 2YM4A 4C38A 1YXTA 2QOIA 3V5PA 3BIZA 4RJ3A 4QMTA 1W84A 3TEIA 1ZWSA 1P4OA 5IUHA 5T3QA 3PPJA 4EH9A 5FTGA 5IDNA 4FL1A 4RBLA 2W7XA 2C3KA 5CEMA 2XP2A 2QLQA 2BFYA 1KOAA 1CTPE 2X8DA 3F3WA 4GCJA 4DGNA 5F4NA 1JKKA 3CE3A 3I60A 2XIZA 3KF4A 5M44A 5HE1A 4GSBA 4CQGA 2H8HA 4RSSA 1OIUA 1NVQA 1IA8A 4U42A 5CYIA 3VBTA 3C0HA 4GK4A 4BCOA 4YJOA 2WMAA 1G8SA 1Q99A 1BKXA 3MBLA 3PVBA 4JIAA 3BZ3A 3FMDA 1OIRA 3KMMA 3FLZA 4AOIA 4U9AA 5LWMA 2HENA 3ZXTA 5E8TA 3SRVB 5HLPA 2J0KA 4NK9A 3UC3A 4F0IA 3NRMA 4IAAA 5L4QA 2GHGA 1J7LA 5EYDA 4E6DA 4FOBA 5DOSA 4HW7A 5BYYA 4F65A 1XBBA 3MH0A 5CENA 1SMHA 4ZMEA 2ITQA 3VNTA 3VUHA 5LOHA 3IOKA 3BYUA 2C6IA 3MH1A 2YIRA 3G15A 4PL3A 1DI9A 5A3XA 3BV3A 3KK9A 3HLLA 3KEXA 1ZY5A 3COIA 3OMVA 4GW8A 3CIKA 3D7TB 3Q5IA 2R0IA 1OMWA 3D0EA 1Q3DA 3Q6WA 2C6OA 1W0XC 3EKKA 4M69B 3FY0A 4FICA 5BYZA 3UODA 4A06A 3UOJA 2JC6A 3QQFA 4B9DA 3NR9A 4IZ7A 3FLYA 5CT7A 4QMSA 5CEPA 4DCAA 1VEBA 5DT0A 4FKGA 4C58A 3D7TA 3TNPC 4CNHA 4IW0A 4YBJA 3G90X 2WQEA 5FBNC 5L2SA 3DS6A 4FKIA 4FKLA 3OBGA 2EVAA 5AX3A 3B2WA 4QTCA 1OKVA 3ZFYA 4L45A 5HTBA 4EKLA 2XK4A 3SC1A 1HOWA 2OF2A 4I6HA 4QT1A 4O7VA 4A9RA 3SW4A 3O71A 3MPMA 1K9AA 2WQBA 3R30A 3QD3A 2BVAA 3JVSA 3QKKA 2OXYA 2DQ7X 3DNEA 5L6OA 5CU3A 2QOLA 3KULB 3QZHA 4GUEA 4AGCA 2I7QA 3QD0A 3TCPA 3O8UA 4RMZA 5K0XA 5E91A 4YBKA 5CU6A 4NYEA 5IMEA 5DE2A 5F20A 1GIHA 3V8SA 3KULA 2CLQA 2IW6A 3K3JA 2B4SB 1RE8A 4C57A 5I3OA 3NX8A 3NWWA 4YJVA 4APCA 4D2SA 2GQSA 1Q3WA 4AG8A 2FB8A 2X0GA 2E9OA 3JY0A 4U5JA 2JKMA 1PXPA 4DFZE 2JDOA 2YEXA 4I92A 3ZLSA 3U54A 2XK3A 2ZM1A 3ETAA 3W8LA 4EOOA 1KE6A 3KY2A 4JBPA 5FD2A 3WIGA 3VS7A 4ANBA 4E4MA 4D5KA 2OLCA 4AU8A 3RAWA 5JT2A 2YWPA 2JKOA 2WEIA 4WT6A 5HZNA 1UVRA 2PTKA 4XG6A 4D55A 2B7AA 4FKTA 3O8PA 1DM2A 1PXKA 3CGOA 4EK4A 2EB2A 1YRPA 3D5XA 3UO6A 3E88A 1W8CA 4YJPA 4ERKA 2FO0A 4QD6A 4NH1A 4F64A 2B53A 2C0TA 2I40A 5IA0A 5CASA 3LPBA 4JBQA 1HCLA 4N57A 4TYJA 2JDTA 1ZZ2A 2J0MB 4YLKA 4R6VA 3V8TA 4KKGA 1ZRZA 3O0GA 1R3CA 2VGPA 4LYNA 1TQMA 3BU5A 4FZDB 4BCGA 3ATSA 4FSTA 4AS0A 4HNIA 3P86A 4RZVA 2OI4X 1OZ1A 4XV9A 3GQIA 3CCNA 2WMUA 4S31A 4OR5A 4X6RA 3LCDA 4L42A 4BCJA 3K54A 3Q4ZA 4WG3A 5LCJA 2VX0A 3A8WA 5BQ0A 4EC9A 4X2KA 4Y72A 1ZYCA 1WVWA 4S30A 1M2RA 2XKDA 3GP0A 3UNKA 3LJ0A 2F7XE 4G3FA 2ZV2A 5ANDA 3MIYA 5EDPA 4ZJIA 3UOHA 4FKPA 2DS1A 5TE0A 4KRCA 3GUBA 4C34A 2XK9A 4LMNA 3RWQA 4L8MA 1UA2A 2GTNA 2JLDA 4BZNA 4HZSA 2RL5A 5JSMA 3KKVA 3AGLA 4ZEGA 5K4IA 1MP8A 3IDPA 3UMWA 3OD6X 4QTEA 1F5QA 3TDVA 2RSVA 3FC2A 3K3IA 3PJCA 5C4KA 3DDPA 3Q32A 3NPCA 4OGRA 4P5QA 2H34A 3G0EA 2BRMA 3KRXA 4KUJA 2ZAZA 3L8PA 3HECA 4R8QA 3AD6A 4CZUA 4EZ7A 4IZ5A 2HCKA 3ZRLA 3OOMA 4QMMA 1O6LA 3DAEA 4QP6A 4QRCA 5DRDA 2UZUE 4EYJA 3C5UA 5CZHA 5CEKA 1CM8A 3ET7A 2CGXA 2HWOA 1FVTA 3T9TA 3UZPA 4MBLA 3VUTA 1ZMWA 2R3JA 3TZ9A 4AT3A 4HJOA 4EHZA 1YWVA 4FA2A 4ORKA 5LVNA 2ITNA 3I4BA 5CZIA 3DK7A 1ZYJA 2BZHB 2VTMA 4IVCA 5B2LA 4L7FA 3RHKA 3TUDA 4CCBA 4U8ZA 1FGIA 4J98A 2QOBA 1YHVA 4DINA 4ZXTA 2XM9A 5EI6A 3U4WA 1CKIA 2GNFA 4UMQA 4AW1A 2F7EE 2VO7A 4DG3E 4PDOA 1PY5A 4YUQA 3O8TA 2E2BA 2W4OA 2VWXA 3ACKA 4ZSAA 4BL1A 3TZMA 4D1XA 4F99A 4JDIA 1RDQE 2C3JA 3HV7A 4RA5A 4ACMA 3RM7A 2ZV7A 2YACA 2JAMA 3EZRA 3GENA 5HCYA 1DAWA 5GZ8A 4BCFA 5LMKC 5J5SA 2HZ4A 3UNZA 4F6UA 2I1MA 3BU6A 4GH2A 2W5AA 4KIQA 5KMOA 3OEFX 2HZNA 4BCIA 4DT8A 1LP4A 2WQMA 4GJ3A 4P5ZA 1Y91A 4BKJA 3NS9A 4M12A 3PWYA 3U8WA 2WTKC 3A60A 3OWPA 1GZOA 4I0TA 5JGBA 4XV3A 3U55A 4H1MA 1OECA 3VBXA 3VUGA 2R3KA 3CGFA 4O6LA 4TN6A 3ZXZA 5LVPA 2A1AB 3BWJA 4FR4A 4I0SA 4ZSEA 3U51A 3UTOA 2X81A 4F6WA 5IU2A 3AOXA 3SA0A 4LQMA 3R21A 2BIKB 5M4CA 4JG8A 3MTFA 2GFCA 4M8TA 2I0HA 3HMIA 3MVMA 4E26A 3BYOA 2EWAA 3HMPA 3GBZA 4E3CA 3NCGA 3MV5A 1WZYA 2XJ0A 4O83A 4PDYA 3RZFA 4BY9E 2IZUA 4QYFA 3ULIA 4ZSJA 2WQOA 3KN5A 2J6MA 3FZRA 3QCQA 4NU1A 4YLLA 4C3RA 4DH7A 4G3DA 4C36A 5BVNA 4MWHA 3F7WA 4E8AA 2QR8A 2WTJA 2XIRA 4FV1A 2UZNA 2Q0BA 5C8NA 5IEVA 3ZMMA 1ZOEA 1FBNA 1H4LA 5C03A 4CTBA 4DBXA 5AUZA 4L00A 2B55A 3ZFMA 5M53A 4CG8A 4KIOA 4LL5A 2LGCA 4PL5A 5KBRA 3PUPA 4ZZNA 4BR3A 4FV6A 5M07A 3DGKA 3WE4A 2VN9A 2C1BA 4PMTA 1P4FA 1I44A 3AD5A 1PMNA 1ATPE 5ETCA 1Q62A 2VTRA 4EBVA 4R5YA 3C9WA 4L46A 3REPA 1BI8A 4WRGA 4FTAA 3KU2A 3OZ6A 3KXZA 4BF2A 3DFAA 4BIEA 3F69A 3KA0A 4K2RA 5IUIA 4F63A 4OTIA 5M08A 5EM5A 4XLVA 3PJ3A 3A4OX 1TKIA 3C51A 3R04A 1IASA 1GIIA 2YM3A 3C50A 4U40A 5M06A 4PTEA 4APPA 4BDFA 4WIHA 1BYGA 4DHFA 4FV3A 3DOGA 3BLQA 4TWOA 4Z9LA 4CLIA 3EQDA 3PYYA 4K9YA 4YJTA 2XIYA 2ZB1A 3IDBA 4CFXA 4W9XA 3QC9A 1G8AA 3GOKA 3EN6A 4FTNA 3TV7A 4PMMA 3CY3A 1ERKA 2PVRA 1YOJA 3HUBA 3LM5A 3P7CA 4YO4A 3OEZA 5CAPA 3R1YA 4FSWA 2X9EA 4WOVA 5DBXA 4JR3A 1OPLA 3ZRKA 4D2VA 2YN8A 4E6CA 2B52A 3HAVA 4HYHA 4X2JA 1LPUA 3ZO4A 2HW7A 4J96A 3PY0A 2G01A 2VTOA 2YABA 3F3UA 1YXSA 3F88A 3PY1A 1F3MC 3W16A 3PLAE 2WOTA 4X21A 4OTQA 3D5UA 4ANMA 2A27A 2J50A 2HK5A 2XK8A 3HVCA 3ATTA 4X2FA 2ONLC 3ALOA 4K11A 3SXFA 2YFXA 1LR4A 3CTHA 5AR4A 5AV2A 2R5TA 4IVAA 5I9VA 2C0IA 3P4KA 3O7LD 3R9HA 5KZ0A 2UZWE 4ANSA 3TTJA 3EH9A 1DI8A 2ZOQA 4X3FB 4BIBA 5LVOA 1WMKA 4XJ0A 4L52A 5HBHA 4RVLA 5AUVA 2Y6OA 4ZLZA 3F5XA 5FLFA 5C01A 3MA3A 4XNEA 3QBNA 3OCSA 3E87A 3VULA 3PVWA 5A14A 4X3FA 4UY9A 4QNYA 5H3QA 3R73A 4A07A 3COHA 2PY3A 3QHWA 2YISA 3CEKA 1OBDA 3EZVA 3FPQA 4FZ7A 5DPVA 3BEAA 2ZJWA 3EQGA 4HGTA 4JJRA 2JGZA 1LEZA 2ZMDA 5FGKA 2BUJA 3Q9XA 2XKFA 3EKNA 4E6AA 1FVVA 4J99A 5J87A 3A7JA 4BYJA 1J7IA 2X2LA 4CKJA 3COMA 3G0FA 3DAKA 1IG1A 4PPBA 3RNYA 1R1WA 3C4CA 3QD4A 4O7RA 2CSNA 3LFQA 1Q4LA 4GT3A 5DRBA 5DLSA 3HRFA 4BCKA 4C3FA 5AA9A 3OW4A 2VWVA 3W2CA 3L8XA 4I1ZA 5EW3A 5C9CA 1Z57A 3NZ0A 3SXRA 4J53A 4CKRA 3ACJA 5ANIA 1TQIA 5KMKA 3LAUA 4PY1A 5JMSA 3F82A 3FLQA 4EOPA 1EH4A 4FTRA 2XRWA 4OTFA 3QQGA 4ANLA 3PIXA 2ITUA 3D15A 2X39A 4RIOA 2R7BA 3QCXA 4LGGA 4YJSA 2H9VA 3HZTA 4Y5QA 2XYUA 2CCIA 3F2RA 3SQQA 1GZKA 1QMZA 3IS5A 1MRUA 2Y7JA 3LM0A 5LQFA 5M51A 4JG6A 5IA5A 1YXXA 3HV6A 4BHZA 1P14A 3I0QA 4R3PA 4BZOA 5HIBA 2C5XA 2WB8A 5T6KA 3G51A 4YURA 4B7TA 3BYSA 1PXNA 3QQLA 3QWKA 5CWZA 3TV6A 5K3YA 5D41A 1CSNA 1OB3A 4Y95A 5BUJA 4IIRA 2OG8A 3F9NA 1YOMA 2WEVA 5HVYA 4IZYA 4E6QA 3A99A 4YLJA 4E5AX 4A4XA 4G34A 4Z55A 1Y6AA 4BN1A 4F1OA 2X8EA 3N4UA 2OBJA 2CMWA 3RGFA 4TNBA 2QR7A 1PMUA 3IGOA 2RFEA 4KINA 2HZ0A 2UW7A 2W0JA 3UOKA 4A9TA 4FZ6A 4EHEA 4KSQA 4D2RA 4RJ6A 4B99A 2VTPA 4AE9A 4NM5A 3FYKX 5BYLA 3EYHA 2IO6A 3UQFA 3LCSA 1JBPE 4IDTA 4KKEA 4DFNA 3DXPA 3ERKA 4EYMA 3QX4A 4LOPA 1W7HA 1E1VA 2GU8A 3IG7A 4EHGA 4IACA 4XP3A 3I6WA 5DT3A 3FMEA 4D4RA 3UZTA 2ERZE 4P7EA 2FSOX 4M13A 1OKWA 2YCSA 3BQCA 3BRBA 4QMQA 5I9YA 2P33A 2YHVA 1B39A 1JLUE 3V04A 3NUAA 4EK6A 2B54A 4BDGA 4RFMA 1V0PA 4F0FA 5A4TA 4I5PA 2OJJA 5EK7A 2Y4IB 5AUYA 5HLNA 2XJ1A 1PKDA 3QRUA 1CKPA 3OCTA 3NSZA 5FEEA 2G2HA 5AIKA 1XHAA 4I6QA 4DH8A 3E3PA 3GI3A 3U6JA 4OTHA 3VAPA 4Y83A 2QG7A 5CSVA 2C0OA 1YI6A 3OXZA 2UUEA 4YC8A 4Z16A 5K4JA 5K5NA 4RVTA 2W1GA 2IW8A 5K0KA 3WF6A 3E8DA 4EC8A 5EQYA 2ACXA 4MQ1A 4BDEA 2JIIA 3BELA 2R3OA 3DPKA 3FWQA 5D9HA 4M84A 2UZTA 4XHKB 5CXZA 1XBCA 1YDSE 5HVJA 4CMUA 5CF8A 4YZBA 4R7BA 3SOCA 4USFA 3ORZA 5FTQA 4NM7A 1XQZA 3PLSA 3DJ7A 3AXWA 5HNGA 3W2PA 4GV1A 3IO7A 3FQHA 4HVDA 4BTJA 5IMXA 4ZIMA 3WOWA 2JDRA 1O6KA 5ETAA 2WO6A 3MS9A 4IB0A 1FINA 4QOXA 2QU5A 4ZY5A 1QPEA 2PZIA 3D2IA 1UKIA 3BQRA 1FGKA 2YDKA 1AGWA 4NFNA 4ARKA 4GRBA 4NW6A 4FTTA 4XOZA 3VQHA 3FZSA 4GU9A 5DG5A 3LQ3A 2PZ5A 1XH8A 4FSYA 4HPTE 4YNEA 5JZJA 4GMYA 2YM6A 3MA6A 3PJ2A 5DFPA 4I5MA 3JS2A 1XH7A 4IANA 4O0RA 4DEGA 5M57A 3PTGA 3O96A 3WZEA 2QO9A 5HESA 3CR0A 1HCKA 4OTDA 4HCUA 3SHEA 5IEYA 5DH3A 2QOHA 3DLSA 2ZB0A 4AGWA 2J5FA 4RT7A 3ZCLA 5DWRA 2O0UA 5A4CA 5KKRB 2B9JA 5BVOA 5H8BA 4AFJA 1URCA 2Z2WA 4G31A 3JPVA 4RZWA 4FEWA 2DYLA 2V22A 4C35A 5CNNA 1R39A 5EOBA 2IWIA 4ENYA 3H9OA 2WNTA 2J9MA 4FKQA 3LFDA 2REIA 4UEUA 5FP5A 1PW2A 2GNIA 4AN2A 3WI6A 2CGWA 4YZ9A 3TXOA 4JQ8A 4D9UA 3A61A 3EIDA 3ORKA 5TKDA 2WU6A 2EUFB 3WZKA 3Q53A 3NW7A 4EOMA 2W1ZA 1H1PA 1LUFA 2LAVA 4NM3A 5AAFA 4M0YA 4AOTA 3KREA 3DNDA 4BI2A 1OI9A 5TR6A 1I09A 2YLEA 3LFAA 1YQJA 3E63A 4OTGA 4FL3A 1R0PA 5CEIA 3P79A 2F57A 3SD0A 4ENXA 2OF4A 5BUEA 3FKLA 1A06A 5HU9A 3LLTA 4FEXA 1Q5KA 3QCSA 4TY1A 1R78A 3TI1A 3TT0A 1A48A 1KSWA 1MRYA 3A2CA 3I1AA 2PSQA 4BDKA 4FTMA 4IVBA 4KWPA 5BVWA 4I20A 5G6VA 4WHZA 2W9FB 5AP1A 4L3JA 4C4IA 5AX9A 3GGFA 3UO5A 5AA8A 4F1TA 3BE2A 3OTUA 5KUPA 1XH5A 3MVHA 5IKWA 4PQNA 4YGAA 5L8KA 4EONA 2NRUA 1U46A 4DEDA 1UWJA 3BV2A 4QP9A 4O7SA 3BYVA 3DA6A 1KE8A 3OUNB 2I0YA 2C6EA 3ORIA 3OT3A 5EHOA 3TJDA 1FPUA 4PDPA 3Q96A 4F9CA 2GMXA 4IX6A 3ENMA 3V5WA 3G6GA 4O1PA 4K8AA 4ZS0A 3LFNA 3GOPA 3H30A 4M3QA 4MBIA 4CFMA 2WKMA 4CZTA 4EOJA 4YZCA 2Q0NA 3AMYA 4LM5A 5J8IA 4PMSA 2OZOA 5AFVA 3OF0A 4RLKA 4DLIA 1XH9A 5AM7A 4QMWA 4EJNA 2XYNA 3FYJX 4XG8A 4R1VA 3E8NA 4FMQA 2SRCA 3DV3A 3H9RA 4O7ZA 4RC2A 3ZM9A 4D4YA 2CJMA 2E9UA 3WZJA 3QTWA 4BWKA 5ANKA 4HVIA 4C4HA 5AADA 3PZEA 4IX5A 4DAWA 4RC4A 5CX9A 4YP8A 5KBQA 4JRVA 3NEWA 3FHRA 3BGZA 3QUDA 4FKSA 1NA7A 1XBAA 3A8XA 4OLIA 5E8SA 3UP2A 2GSFA 4EZ5A 4HVGA 4HYSA 5IQIA 4ZMFA 4XH6A 3F5PA 4MVFA 2ERKA 3C4XA 3OXIA 2XNOA 3DTWA 4U45A 1H0WA 5FM3A 3GCPA 4PF4A 4EUTA 4XG9A 3MVLA 3PSCA 3ZDUA 3Q60A 2OIBA 3CKXA 3GCUA 5HCZA 4E4NA 5E8UA 3SV0A 4AF3A 2PULA 2FYSA 5IA2A 2BIYA 4QMYA 4L9IA 3CD3A 3QTUA 4EQUA 3PA5A 4JXFA 4U81A 3MB7A 4EK8A 4XS2A 4JVGA 2W96B 3O23A 1Y6BA 3V01A 3LQ8A 4WKQA 3KXHA 4LUEA 3ZHPC 4DEHA 5IISA 3ROYA 2G9XA 3HKOA 4FE2A 1PXMA 3DJ6A 2PPQA 4QP1A 4FIJA 3UBDA 3RPVA 4ANQA 4AWIA 1KE7A 3VN9A 1CDKA 2UZVA 3H0ZA 1PXJA 2R3QA 4NWMA 2XS0A 3CLYA 3FDNA 4Y73A 5BVEA 4PMPA 3R9RA 4EK3A 4QYYA 4FKWA 4HYIA 5AP5A 1KE5A 4O0WA 5IG1A 2QQ7A 5AJQA 3GC9A 4R3CA 5HNBA 4J71A 3ZSHA 4EH6A 4NJ3A 1YWNA 3MH2A 4MNEB 3EQPA 5LARA 4IAIA 2O5KA 3D5VA 3CP9A 3GCVA 3II5A 3KMUA 5J9ZA 1ZLTA 4KBCA 2BILB 1NXKA 4ZY6A 5DA3A 4MNEA 5D12A 1PXIA 2YDJA 4DH5A 4ZZOA 3ENHA 2W1IA 4OBQA 4FIHA 1O6YA 1UU8A 5JRSA 4CV8A 5HTCA 4TWCA 2R4BA 3Q9YA 3BBWA 3QU0A 2UW5A 1GAGA 1A9UA 3PXQA 5GJGA 1FMKA 4A9YA 2JAVA 4IVDA 5AR5A 5AV0A 5CAUA 3AD4A 4QPAA 3DKCA 1U54B 3UC4A 4E5WA 3D7ZA 3WE8A 1G5SA 2GHMA 2CNUA 4BIDA 2CN8A 3R8LA 3EN4A 4M0ZA 2UZOA 3NIZA 3ZUTA 5IA4A 5EQEA 2JD5A 4ZP5A 1U54A 3PXYA 3RPRA 4QTDA 4O0SA 1QPJA 2PVLA 4BICA 3GC7A 2YIXA 3BBTB 1H08A 1ZZLA 2XK6A 4XBUA 4TKSA 4MYGA 2OJFE 4HGSA 2HAKA 2UVYA 4AA4A 5I4NA 3DQWA 3ELJA 4Q5EA 2PVKA 2YA9A 4DEEA 3MTLA 2YCFA 4EJ7A 2BZKB 3KFAA 2CLXA 4L6QA 4MBJA 4ZLOA 3UQCA 2R3MA 3HRCA 3S1HA 4FEUA 3AMAA 3EYGA 3QL8A 1H07A 4E5BA 4D0WA 1OPJA 2ITWA 3W10A 2BDWA 3BPRA 4DFUA 3PE1A 3EN9A 2R64A 3VBYA 2VWYA 4RC3A 4W4XA 3CPBA 3VS2A 2KTYA 3W18A 3V3VA 2G15A 2YIQA 4RWIA 4D5HA 5AAGA 3EQHA 4ASZA 4MTAA 1OBGA 3OG7A 2X8IA 5M4UA 2XEYA 5GHVA 4CRLA 5IQHA 2QO2A 2BALA 4IB1A 4IWOA 5AR8A 3OCGA 4J97A 3W33A 3DY7A 3H10A 3FEGA 4L67A 4QMLA 4GK2A 4FT9A 5L2WA 3K2LA 3FI8A 1H24A 2VTTA 4QPMA 2WIPA 2ZM4A 1JAMA 4IZAA 3RNIA 5BVKA 4U0IA 2BAQA 4S34A 5HKMA 2X6DA 4WNOA 1TVOA 4O84A 1JNKA 4GVJA 2PL0A 4MXCA 2PYWA 2VTSA 1OUKA 3ITZA 3NNVA 3QQUA 4WA9A 4WD5A 1KE9A 3UIBA 2YZLA 4O7WA 3RM6A 4DF3A 4AZWA 3CQEA 2XNGA 2J51A 3BHHA 3EN7A 4GUBA 4UWCA 1H1WA 1O9UA 5AUXA 2BTSA 5CTPA 2HXLA 1OL7A 2GNLA 4BWXA 3UYTA 4BGHA 2B9FA 5CLPA 3R1NA 4L44A 3LKMA 3MESA 4GS6A 1ZYDA 3HV5A 2GQRA 1YXUA 2DWBA 3DFCB 4CCUA 2PU8A 2C5OA 3PP0A 1AD5A 3IONA 4FSQA 4MHAA 2WMQA 5M4FA 3QXOA 2VWIA 4AXAA 3PRIA 5J95A 4R1YA 3NNUA 4YNOA 2NNWB 4O6EA 3QHRA 2WTVA 4ZY4A 5ETFA 3FMKA 5TT7A 5LJJA 2WOUA 4YO6A 1OPKA 3MFSA 5CVGA 3UQGA 2CHLA 5JN2A 2RKUA 5AP3A 4XG2A 3PVUA 4EQMA 3FMMA 2IVVA 4O2ZA 4FNYA 1S9JA 4O0YA 5TOZA 4RX5A 5HO8A 5AUUA 5KHXA 4FG7A 4OT6A 5C8KA 4DBNA 5CQUA 3AC5A 5IH5A 3MFTA 4LL0A 2X4ZA 4BRXA 4O0UA 3LFFA 4R7HA 3QUPA 5I5ZA 4Z7HA 1JSVA 4HZRA 1Z9XA 3K5VA 5CQWA 3TZ7A 2RFNA 4C2WA 4I41A 4CKIA 5CAOA 5DMZA 4OTPA 4MXXA 5JQ5A 4EOLA 2YM7A 5L6WL 3RBWA 2YJSA 3PXRA 4FTOA 3R8PA 3VVHA 4EH2A 1UU3A 2YWVA 2ZV9A 2RF9A 3O17A 4W4WA 4QP4A 1Q8WA 1XH6A 3IKAA 3RTPA 3HMOA 2FSMX 1ZY4A 3VHEA 4L68A 4YZNA 3L1SA 3UDBA 5A4LA 4EWHA 3RJCA 4YTFA 4IHPA 4G9RA 1H26A 4AN9A 4O27B 4Y8DA 3VWAA 2WZJA 2BRNA 5HQ0A 4QO9A 4ZAUA 3QLFA 3QTQA 5HD7A 4BGGA 3ZYAA 3JYAA 2ZYBA 1FVRA 4YJRA 3DBCA 4GL9A 4DN5A 4C8BA 3AC4A 4HNFA 2VWWA 3BHUA 2IZRA 4MXAA 1NVRA 1H00A 2IW9A 3MW1A 5E7RA 4CSVA 4ZTHA 2VTAA 2WMXA 1ZYSA 2Z7RA 5F94A 4O7YA 4W4YA 5HE2A 5IQFA 3CJFA 2GS6A 2J4ZA 1X8BA 3FMLA 4FKUA 1VZOA 4RWKA 5FEQA 3NNXA 2QG5A 5ANJA 4FG9A 3UOLA 5IQDA 4PL4A 3SVVA 3ZRMA 4AAAA 4B8MA 2C5YA 3DDQA 1IRKA 4IJPA 3FY2A 4FBXA 3ZSIA 4UMPA 5LMKA 2CGVA 2QOFA 3QCYA 4HPUE 2WTKB 3RAKA 1Y57A 2BCJA 2X2KA 3HA8A 2UW3A 1OIQA 3DU8A 5JGAA 3NNWA 3LE6A 2IVUA 2J0JA 1GJOA 3QA0A 4FL2A 3TL8A 4BBEA 4QTBA 4E20A 4G6NA 4ERWA 5CF4A 5AP7A 1ZOHA 2UW8A 4Y85A 3S0OA 2OSCA 3PSBA 3R7OA 3OROA 1YXVA 4C02A 3P7BA 5FUTA 4CQEA 2A0CX 1M2PA 3N9XA 2YIYA 2YLFA 5KMMA 3RCJA 4IFGA 3E7VA 4O2PA 2CKOA 4FG8A 4CFVA 3FSFA 3UVRA 4HCTA 4JL9A 3DZQA 3POOA 3ZEPA 3ANQA 4DG2E 2OO8X 4IADA 3TWJA 5HI2A 5EOLA 2X1NA 3MN3A 1WBVA 3G6HA 3PXKA 4FSRA 5EW9A 5LCKA 3SG9A 3NMUF 4HGEA 3TKUA 3IW7A 3NYNA 3OOGA 3H0YA 4ZLYA 4AT4A 2WHBA 3MY1A 3QYZA 2BR1A 2UZLA 4FV7A 4C4EA 2WU7A 4YHJA 3HA6A 3FZTA 1K3AA 3SLSA 4NCTC 2JBPA 1JSUA 5GJFA 3SOAA 2R3HA 3D83A 4LG4A 1PYEA 4G3CA 5AIRA 3VBQA 4BWPA 2OIDA 3F3VA 3MJ2A 3IW8A 3SX9A 3VS6A 4ACDA 3A7GA 1M7NA 3NW6A 2XVDA 2EXCX 3G5DA 4XP2A 3KXGA 3RZBA 3H9FA 2J0LA 1H27A 4S32A 2QCSA 5JFSA 3GU8A 2B1PA 3ODYX 4MXOA 3Q4TA 2O8YA 4GYGA 3C7QA 3P9JA 3PG3A 4OTWA 5FBOA 4O81A 3DBDA 3DLZA 3KCKA 3OY3A 3MDYA 4FYNA 2FSTX 2WTDA 2J5EA 4FT5A 4QTAA 3I0OA 1G3NA 3TNIA 3ZS5A 3KQ7A 4PV0A 1SNXA 4ZTMA 4BKYA 4FSNA 3ZO2A 4Q9SA 4FT0A 2RG6A 2PHKA 3M11A 4N6YA 4XV1A 3WF9A 2JIVA 4NZWB 3VIDA 5GIPE 5HEZA 3VUKA 3WYXA 4F7SA 1OKZA 3TG1A 5L3AA 5H8GA 3KRLA 4AGUA 5CSXA 3EFKA 3E64A 3KGAA 3P23A 4FUXA 4I6BA 3Q6UA 3RKBA 4AZFA 4BCPA 4MH7A 2R9SA 4FK3A 1T46A 5ANGA 4B4LA 3H3CA 3F61A 1OKYA 3DK3A 4I93A 1E1XA 3C4WA
chains in the Genus database with same CATH superfamily
4KKHA 1OITA 3AT4A 3R7YA 3FHIA 2BDFA 3T9IA 4EZ3A 4K1BA 4KB8A 5L2TA 5JFXA 5HGIA 4RIWB 3FBVA 5BV3A 2BPMA 3NVKI 4DFXE 1XO2B 5D7AA 4JQ7A 4TW9A 1BX6A 2Z02A 3VS0A 2BAJA 1PXLA 2XIKA 1W2DA 4KRDA 4ZTSA 3R9OA 3F5UA 3PY3A 4N6ZA 5H8EA 4RIWA 1REKA 4IE9A 4C61A 5CI6A 4D58A 4LV5A 4DFBA 2R3LA 3R1QA 3MPTA 4O7NA 3EQCA 3PPKA 5FM2A 5F1ZA 4CD0A 3FQEA 5AR3A 4LOQA 4EKKA 3GXLA 4ONAA 1YI4A 3DBEA 3W55A 5JEBA 2VD5A 5CF5A 1J7UA 3M2WA 3IGGA 3ORNA 5BVFA 3QQKA 3HAMA 1H0VA 3PIZA 4EH4A 3L9LA 2XNBA 4R7IA 2P2IA 3FXZA 3TNHA 5AV1A 5J1WA 5FQDC 4YC6A 5KMJA 3FXXA 3OW3A 4EH3A 4FV8A 2BROA 1W98A 4XV2A 5HBJA 2XB7A 4IM0A 3S4QA 1JQHA 4TYHA 3EHAA 3AC1A 5TO8A 4ZZMA 3BEGA 3ZONA 4I5CA 3CTJA 2JKKA 4J95A 2XBJA 4KA3A 3ANRA 4D9TA 3C5IA 2PMNX 1YHSA 5IA3A 3DB6A 3LFCA 2ZV8A 4AP7A 4F7NA 5B7VA 4FF8A 3MIAA 2XALA 4LOOA 5CI7A 3NAYA 2O2UA 3ORTA 4RX7A 2WMSA 4RPVA 4FKOA 4UYNA 4RWLA 3HYHA 4RVKA 5A6OA 3ODZX 4CYIA 4H3BA 3BGPA 4IXPA 3ULZA 3O50A 1CMKE 4WBBB 5HU3A 1W82A 4FTJA 4C33A 4DDGA 4NFMA 3T8OA 3NIEA 4J52A 3EQFA 2FVDA 2J2IB 4A9SA 2UV2A 3TUCA 3HL7A 3I81A 4BKZA 3FL5A 5A6NA 3I5ZA 3FZ1A 2NO3A 5E8ZA 1Q97A 3E3BX 3FLSA 4TWNA 2RGPA 3DBQA 1SVHA 5JKGA 3AC8A 5H9BA 3PIYA 4D0XA 5M56A 2C4GA 3MH3A 4KD1A 2PWLA 4BGQA 2AEGA 1REJA 2IJMA 1IR3A 4IX3A 3DJ5A 3BU3A 5E9EA 3E8EA 4G17A 4RWJA 2C68A 3KCFA 5AR2A 2OKRA 3G9NA 4LRJA 4UBAA 2W1DA 4I22A 2JFMA 4IM3A 3ZU7A 3N4TA 4IAKA 5HCXA 2OWBA 3OT8A 4FNXA 4JBOA 4ZK5A 2QOQA 4I3ZA 3Q3BA 4UWBA 3SG8A 4CXAA 3VW8A 3QRIA 4U79A 4UWYA 2Z7QA 2Z7LA 4PDSA 4O22A 4EH7A 4EH5A 3F3ZA 2WXVA 4XG3A 2QHNA 3D94A 5ANOA 3EN5A 3A7IA 2ETMA 3IW4A 3SW7A 2A4LA 4BI0A 5IUGA 1YHWA 2AYPA 2I0VA 3L8VA 3U6HA 1UV5A 2Y4IC 3NYVA 4QYGA 3ORXA 5KCVA 2VTLA 3RHXA 2W4JA 2BKKA 4V05A 5JGDA 4EUUA 2QONA 5CT0A 4CV9A 4PPAA 3LXPA 2YDIA 2A2AA 4WG5A 2W5HA 2GS7A 2CKQA 3TACA 2ZDUA 3BE9A 3QD2B 4RJ5A 1F0QA 3HDNA 2HOGA 3C0IA 5A46A 4IDVA 4WSYA 1W83A 3BWFA 3ORLA 1G8KA 5J5TA 3FV8A 3R9NA 4QMNA 3FJQE 2JDSA 3LCTA 5LWNA 4LRMA 2R2PA 3DCVA 3RAIA 4NW5A 2BZIB 4AT5A 5KE0A 1TZDA 3OTVA 5JK3A 1OL5A 1KUTA 4ACGA 1SNUA 3QUEA 1CKJA 1JKLA 1MUOA 4NTTA 2ITYA 3BI6A 3R7EA 3R8MA 4D1ZA 1Q41A 4U7ZA 4U6RA 2FA2A 3R2BA 5JQ8A 3FMHA 3UIUA 2YCRA 5K5XA 1B6CB 2C6LA 3HGKA 3EQIA 3QAME 5CXHA 5HOAA 1BMKA 3KIOC 3ZH8A 3ZC6A 4PNIA 3PJ8A 4X3JA 3JUHA 4M68A 5G1XA 4FSUA 3FMNA 3C4EA 1OGUA 3W1FA 2UW9A 4PTGA 4JX7A 5H2UA 1QCFA 3DXNA 2R7IA 4X2NA 4C62A 3PWDA 5AMNA 1YDRE 4IAFA 1H01A 5DVRA 5I3RA 5IZFA 3AC3A 4PP9A 4RFZA 4RJ7A 3U9CA 2IPXA 3VC4A 4F9BA 2ESMA 3O2MA 3TZ8A 4DG0E 2ZDTA 3R00A 4X0MA 4YJNA 2PMIA 3HP2A 4GFMA 4U97A 3NUSA 4J8NA 4FGBA 3A7FA 3V5JA 2EB3A 4BDAA 3GEQA 1STCE 5HIDA 5EDQA 1RJBA 3F66A 3WARA 4XYFA 4O96A 4HOKA 2ITVA 2QLUA 1OVEA 2PK9A 5EH0A 4FEQA 3GU4A 2YM5A 3CQUA 4QMVA 4IX4A 5DYJA 4E93A 4QP7A 4MF1A 3NYOA 2B9HA 4ZTNA 5ICPA 4DGMA 4JR7A 4CMTA 4FZFB 4RX8A 4GT4A 4W8DA 5KMIA 3Q9WA 5AEPA 3G2FA 1SVGA 4O0XA 4FODA 2P3GX 2YITA 4V01A 3WBLA 4GT5A 4H05A 4FIFA 5F95A 3AG9A 3PDTA 3Q04A 5L2IA 3KXNA 1T45A 1XR1A 3D2KA 3UG1A 4ZTRA 4MD8E 3UNJA 4AFEA 4ALWA 2XNMA 2YERA 3ALNA 4F0GA 3DAJA 4YTCA 2IVSA 3LJ1A 5D11A 4JIKA 1WBPA 3KL8A 3MB6A 1GNGA 4RIXB 3VW6A 4BVUA 3BHYA 1WVYA 2WTIA 4FVPA 3ZEWA 4AQCA 3CC6A 4UV0A 4K33A 4UXQA 3R7IA 2PZRA 5CVHA 2F4JA 3HNGA 4UMTA 4XUFA 3LMGA 3WF7A 3ZFXA 5KMNA 4RIXA 3FPMA 4RIYB 4Y46A 2EU9A 3BGQA 4AXFA 3KMWA 2AUHA 3QA8A 4RGJA 5D10A 3WF5A 2PVHA 4MXYA 5HD4A 3ZZEA 2NPQA 3DTCA 1PRYA 4RIYA 1L3RE 2R3GA 2WMRA 4MWIA 3S3IA 4LI5A 4ZOGA 2CDZA 2VAGA 3GVUA 5CSHA 1APME 1XKKA 3IW6A 4FOCA 4NTSA 4RX9A 4PWNA 5KX8A 5EYCA 4CRSA 2W4KA 1OUYA 5L6PA 3FZOA 4O7TA 1PJKA 2YIWA 2WD1A 4CFWA 4FVRA 3IDCA 2BKZA 4FV2A 5EI2A 2G2IA 2O3PA 3QZGA 4TYEA 3R1SA 4DEBA 2NRYA 5ACKA 3UZRA 3L8SA 5C1QB 2YJRA 4FSZA 3GNIB 5CVFA 2R3PA 4D2WA 2Z7SA 4G3EA 5BX0A 4JI9A 5IDPA 4FZAB 5M4IA 2R3IA 1TQPA 3VRYA 4O0VA 5HTIA 4OTRA 3KRWA 3VS5A 3EL7A 4JBVA 5EKOA 1SVEA 4IBMA 3LQ5A 2OXDA 5HE3A 3QF9A 2BHEA 3I7BA 2Y0AA 4QEBA 4PPCA 2RFSA 4D28A 4RA4A 5CANA 5FXRA 4FYOA 3NDMA 3SGCA 3I6UA 4U41A 1Y8YA 2VRXA 1SYKA 3R83A 1L8TA 4ITJA 2UZBA 4CFUA 1KV1A 4FIGA 3ZZWA 1PMVA 5CEOA 2XNPA 3EFWA 4MNFA 5KMLA 2C3IB 3C4FA 5AP4A 5HG5A 4P90A 4Q2AA 4U80A 3Q5ZA 4L43A 5A54A 4GFOA 2PMLX 4D4VA 3LMIA 3WZDA 3BLAA 1YI3A 3TDWA 3OS3A 3LIJA 4BBFA 3TNQB 4QMXA 2UW0A 4FKRA 3PXFA 4I94A 3ZO3A 1BL6A 2ETKA 3UIMA 5L2QA 4YC3A 2CCHA 4UN0C 3M1SA 4NIFB 5HG8A 3KXXA 4IEBA 4M7IA 1XWSA 2V0DA 2VWUA 5L8JA 5ACBC 3WILA 5C4LA 4L3PA 5L8LA 2CGUA 2CPKE 2UZEA 4IWQA 5HVKA 3ROCA 1K2PA 4U43A 3W2QA 2EXEA 3K5UA 3CXWA 3NUNA 1Z5MA 2JFLA 5C27A 5IQEA 2B0QA 4NIFA 5B0XA 4CVAA 2X4FA 5E4HA 2VWBA 5EQPA 4O21A 5I9UA 3FLWA 4U3ZA 4IC8A 3SRVA 2QOOA 1XH4A 3LW0A 4EBWA 2QKWB 3QC4A 1YDTE 4ZSLA 1PHKA 1DAYA 2YM8A 3GB2A 5DR2A 3ZLXA 2GQGA 2OIQA 3PP1A 5HHWA 3UG2A 4GU6A 4FIEA 3CY2A 1BL7A 4OAUC 4MEDA 4HVHA 4GIHA 4J7BA 4TWPA 3OBJA 1JPAA 2VX3A 5DNRA 5CS6A 5E1EA 4LDTA 1FMOE 4X6QC 4BDBA 1U5QA 3FQSA 3RVGA 5E1SA 1WBOA 4CGAA 4IWDA 1GZ8A 4UYAA 5DEYA 4FV5A 3RPYA 1UU7A 3R22A 4W9WA 2PVMA 1VYWA 3JY9A 5GINE 2UW4A 2W1CA 2X7OA 4M69A 4XBRA 3PFYA 3KN6A 4RFYA 5HG7A 5M09A 2PVFA 2QU6A 3HP5A 3R8UA 2VU3A 3W2RA 3LXNA 2QKRA 3E5AA 2F7ZE 2GHLA 1JOWB 4FT3A 3OCBA 3KF7A 2Y4PA 4W8EA 4CT1A 4D1SA 1NT2A 2W99B 3QTXA 4E4XA 4XX9A 2V7AA 3MWUA 4Q9ZA 3PXZA 2C6TA 1GY3A 4GG7A 4WBOA 3PG1A 4YHFA 3VBWA 2JEDA 4GK3A 1YVJA 4K0YA 4XOYA 4XRJA 2XIXA 5EYMA 3CBLA 4WNKA 3CS9A 4KAOA 4PRJA 2XF0A 2BZJA 2W1HA 3E92A 4H3PA 3TNWA 4M66A 2V62A 5E92A 3GFEA 4YJQA 5LVMA 3F3TA 5EM8A 4IC7A 5TF9A 3QRTA 5EFQA 2NP8A 3Q52A 2GCDA 3F7ZA 3VJOA 4D2TA 3NVMB 3FMJA 2GS2A 3TIYA 3EFJA 1H25A 2Q83A 2C69A 4G6LA 2HZIA 5HBEA 3O51A 4UX9A 5IA1A 3NFFB 4YU2A 4K18A 3D14A 5EM7A 4IQ6A 5AAEA 4BC6A 3QZIA 4DCEA 3HEGA 4P4CA 3MFUA 5CF6A 2PZYA 4EOIA 3R7VA 5KHWA 4FTUA 3RALA 4AGDA 2W06A 1VLRA 2JKQA 4H58A 5C26A 3GU5A 4DTBA 4FSMA 1OM1A 3NUXA 4CFNA 3RWPA 2Y8OA 5IEXA 4IH8A 4GKHA 2XKCA 1PYXA 3VO3A 4DFLA 2F2CB 3FI2A 2P2HA 2V55A 2VUWA 2WPAA 3RINA 3EMGA 3QQHA 1JWHA 4FKVA 3EB0A 2JITA 1SZMA 5KZIA 3R9DA 5CU4A 3UGCA 1P5EA 4AW0A 5IQAA 1V1KA 1MQBA 2IG7A 3MPAA 3FKNA 3D5WA 4TNDA 5IQGA 4OAVB 4O91A 2OU7A 3LXKA 2QHMA 4MF0A 3FXWA 1XJDA 5AWMA 1UKHA 3O5AA 4MKCA 4L01A 3W2OA 3OWKA 2QOKA 5KNJA 4XP0A 3TJCA 1ZYLA 4O4DA 3NLBA 4IJ9A 4QQ5A 4WO5A 1YKRA 3MYGA 2ITOA 4FVQA 3ID6C 3FLNC 4JAIA 5DR6A 4O82A 1H1SA 1ZMUA 3QTSA 1V0BA 5DIAA 4BTMA 4QMOA 4MQ2A 4CMOA 5IPJA 4EHVA 3S00A 3QTRA 3ORMA 3HV3A 1H1QA 2BRHA 1S9IA 5AP2A 4CT2A 3LMHA 2XNNA 1VJYA 4IM2A 2H96A 4RG0A 3EQBA 4WRSA 2HIWA 4LUDA 4UALA 5LMBA 4CZYB 4BDHA 3NUPA 4FV0A 4D2PA 3R7UA 1PF8A 3JR1A 4R78A 2V5QA 3EWHA 3UP7A 2YZAA 3W0NA 2JIUA 2OZAB 3L9PA 4KS7A 4ZJVA 4GVAA 3PSDA 2HYYA 4PP7A 4FUYA 4LRKA 2OH0E 4TL0A 3MJ1A 2OZAA 3HMMA 1GIJA 2KULA 4ZTLA 3NUYA 4Z7GA 4FTCA 2WQNA 4E4LA 1UWHA 2Z60A 3ZUUA 3FZPA 3TUBA 2H6DA 3C0GA 3MSSA 4I23A 4DGGA 1B38A 2UVZA 3R2YA 5HLWA 4GG5A 3W32A 3KC3A 2VX1A 2W1FA 4BTKA 3ZSGA 5DGZA 3PA3A 4F9YA 4YTIA 4FTIA 3CKWA 2UVXA 5E8WA 1J3HA 1JKTA 3HV4A 3L9MA 2VV9A 3FC1X 3QTZA 4OBPA 4RLLA 4BDIA 4EQCA 4EWQA 4GFGA 5J7BA 3ORPA 4B8LA 3LVPA 3ZBFA 3E62A 4F6SA 5FXSA 4WSQA 2ITPA 5AP6A 5GIOE 4WNPA 4MCVA 5LMAA 1RW8A 4TPTA 1WVXA 2QD9A 5C8MA 4O7LA 4BZDA 4F09A 3T3UA 2E9NA 2VTIA 3N51A 4RVMA 5FEDA 5K9IA 3W0QA 2XJ2A 4DE4A 2R3FA 2X7FA 5A9UA 3RPSA 3CJGA 3DBFA 4TZRA 2C30A 3VF9A 3F2NA 5ETIA 1PKGA 3QGWA 5FTOA 3I7CA 4FV4A 3OHTA 5CU2A 3EFLA 4GJ2A 3COKA 2GNGA 2PE2A 4BDDA 2C3LA 2W9ZB 4AUAA 4DH1A 4EK5A 4F1MA 2F2UA 1IAJA 3HMNA 4H39A 5AUWA 3U87A 1JVPP 2ITZA 3E93A 1H1RA 2XH5A 3AT3A 3QQJA 2GNHA 3AC2A 2FSLX 4TTHB 1GZNA 5DN3A 4KABA 2R3RA 3LHJA 3PE2A 4JDHA 4NUSA 3BKBA 3W8QA 1WAKA 5B2KA 1U5RA 2VTJA 3ML1A 5CSPA 2VO6A 4LMUA 2VTHA 3B2TA 1QL6A 4MK0A 3RK9A 5AR7A 4XG7A 3BHTA 3VBVA 4AN3A 2WAJA 2F49A 4G9CA 4FNWA 2HELA 3KB7A 4FC0A 1M17A 2XKEA 4AZSA 2O63A 2UZDA 2Z8CA 3BLRA 3CQWA 4OBOA 4YZMA 3V6SA 3UVPA 1VYZA 3R7GA 2QODA 2X6EA 3ZUVA 3RP9A 4E1ZA 5J9YA 5BNJA 2G2FA 4I4EA 1ND4A 3IECA 4GIIA 2P0CA 2BMCA 4FTKA 2XUUA 3P78A 1V0OA 3QFVA 5EI8A 5I9XA 1Q8YA 2FH9A 2GNJA 5EW8A 5FP6A 5IH4A 2GDOA 5ITAA 4UZDA 1ZOGA 2BDJA 3S95A 4IWPA 1BLXA 3CD8A 3R28A 3LCKA 4TYIA 2WMBA 1BI7A 5ANEA 3MY0A 4MD7E 4DEAA 4OUCA 4XG4A 3P7AA 2XM8A 3VUIA 4NKSA 4ID7A 3RCDA 2CNVA 1YWRA 5HNIX 4GYIA 5E8VA 2XCHA 3UPZA 3TM0A 4TT7A 4L7SA 3DT1A 3P1AA 3LXLA 3FE3A 3BLHA 3OWLA 4G3GA 4M67A 4EOSA 3V51A 4XMOA 3TIZA 4I24A 3KVXA 1GOLA 2PUUA 4L53A 5A4QA 4QMPA 3VJNA 2CNQA 4GKIA 3LJ2A 3AT2A 4G6OA 2OW3A 4NEUA 4BCQA 2ZM3A 4NCTA 2GFSA 2BRGA 2ZMCA 4C59A 2PZPA 3PA4A 2VNYA 2XCKA 3F5GA 4A4LA 1P2AA 4G2FA 3SKCA 2C1AA 2I6LA 5IQBA 2HXQA 4TRLA 3FL4A 1ZAOA 4OT5A 1W2CA 3TKHA 5HICA 4B6LA 4DH3A 4F9WA 1YOLA 4YZDA 3IW5A 2BHHA 2W1EA 3IQ7A 3TKIA 4JQEA 3V5LA 4XCUA 4IAZA 4AACA 4CEGA 3VF8A 2OFVA 4JDKA 4NSTA 4F08A 4H3QA 2J0IA 4BDJA 2I0EA 2JDVA 4Y5HA 5HX6A 3QKMA 4MAOA 4X3FC 3JXWA 3ZM4A 2EXMA 3F6XA 5GNKA 5HX8A 1R0EA 3LFBA 2XMYA 3GC0A 5J79A 3KRJA 2F9GA 3W0OA 3KXMA 3ZDIA 4IB3A 1PMEA 3TV4A 1G8JA 4J1RA 4DLJA 2O64A 3HDMA 4G5JA 1Q61A 3R8VA 3DXQA 4DFYA 4FKJA 3B8QA 4K6ZA 4WG4A 4BB4A 5JFVA 3DKGA 3GU6A 2YAAA 3IK3A 1WBWA 5FXQA 2OJ9A 4AW2A 1UNLA 2CKEA 3ZTXA 3R01A 2ONLA 3RK5A 4S2ZA 3ZOSA 4YSMA 4ZTQA 4V04A 4ZS4A 4UMRA 3ZLWA 3M42A 4AA0A 1Y8GA 4JT3A 5I9WA 5JRQA 3SXSA 5E8YA 4X2GA 5FDPA 4C4GA 3DQXA 4A7CA 4AX8A 3F2AA 1BUHA 1M2QA 1U59A 4IB5A 4U44A 5IH6A 5AV3A 4TYHB 3OFMA 4W4VA 3UYSA 3EQRA 2IZTA 4P2KA 2WFYA 3ZC5A 2P55A 4DC2A 3G33A 2QURA 5CNOA 4JDJA 4AZEA 1Q8TA 5BPYA 2OH4A 1QPDA 3DK6A 5BUIA 4QQCA 1Q8ZA 3P08A 3LFSA 4NM0A 1NVSA 3EJ1A 1H28A 4PUZA 3OWJA 4AW5A 2CN5A 2QNJA 3I5NA 5JFWA 4DT9A 1U4DA 1ZARA 1E9HA 3IPHA 1KOBA 3RPOA 3U9NA 5CU0A 2XRUA 3C4ZA 4NJDA 2A19B 4V0GB 2R0UA 3G9LX 4WNMA 4ASDA 1QPCA 2WELA 2XA4A 4HVSA 4BI1A 3RAHA 1MQ4A 3V8WA 3GFWA 2W17A 4YPDA 4EH8A 4V0GA 5BMMA 4UMUA 5I9ZA 2HWPA 5HG9A 3V6RA 2C5NA 3E7OA 4I6FA 4ACHA 3FI4A 3GT8A 3PFQA 3NUUA 4O86A 4ANOA 3HRBA 4A9UA 4C4JA 5JZNA 4S33A 4TYGA 4ZJJA 4ALUA 4R3RA 3Q4UA 4QP8A 5HE0A 4FTQA 5A4EA 2E9VA 3P0MA 2X7GA 4BHNA 3FAAA 4RQVA 4USDA 4KS8A 3VUMA 2DUVA 2FGIA 3PPZA 3QRKA 1OL2A 3PZHA 3R63A 2B9IA 4MXZA 4QP2A 5CY3A 3VQUA 2PUNA 2BRBA 3LZBA 4N0SA 4AOJA 1JSTA 4FK6A 2C6DA 2C47A 5M55A 5FWKK 4DA5A 1KV2A 3OUKA 3R02A 5HO6A 3AKKA 4RJ8A 4ANNA 4II5A 4LV7A 5EM6A 2YAKA 3QWJA 4I4FA 3PVGA 5IQCA 3FI3A 5AM6A 2W05A 2QI8A 3QXPA 1MRVA 2ITXA 4HYUA 4QYHA 3UMXA 4DTKA 4YSJA 5BMSA 2CKPA 2R3NA 4X7QA 2GTMA 4UXLA 2FUMA 2VO3A 3AMBA 3WIKA 4JLCA 1FOTA 3DKFA 5CAQA 5F9EA 3W2SA 4OW8A 2HY81 3NYXA 3RK7A 4N70A 3R6XA 4G16A 2HW6A 3KRRA 2OK1A 4AZVA 3MGYA 4EI4A 2X2MA 3GQLA 2WMWA 3R8ZA 5DT4A 4QQTA 3POZA 4J8MA 4C7TA 4YHTA 2X9FA 3JVRA 3VS1A 3I79A 4HCVA 2XBAA 4EOKA 4DTAA 4F70A 2RIOA 4ITIA 4TXCA 4BFMA 4D4SA 4USEA 5HIEA 2PVNA 5AV4A 2V7OA 3OY1A 2WGJA 4FTLA 4G1WA 4MX9A 3UPXA 3V5QA 4WUNA 4AA5A 2XEZA 4DHIB 1UNGA 2VZ6A 1OL6A 2P4IA 3O7LB 1FQ1B 5D1JA 5AUTA 3QGYA 3AGMA 3L9NA 4FT7A 1WFCA 1WCCA 2OGVA 3UJGA 4AE6A 4F9AA 4QPSA 1IAHA 3P5JC 4CFFA 1J91A 3WZUA 1SM2A 2OFUA 3BYMA 1H8FA 5D7VA 4R77A 2RG5A 5T68A 2QOCA 4RQKA 3NW5A 4JOAA 3UO4A 4ZSGA 3UVQA 2VGOA 2OICA 2XZSA 1DS5A 3EOCA 4ITHA 3RMFA 2OJIA 3FUPA 3LOKA 2ITTA 4M97A 3H4JA 3UE4A 2AC3A 4IMYA 3WYYA 1OL1A 3QALE 3VRZA 4MD9E 1JKSA 3MFRA 2C6MA 3ZO1A 3KVWA 5JH6A 2RFDA 3BCEA 2E9PA 5DHJA 2YCQA 3OC1A 3QYWA 4DEIA 3GCSA 2VTNA 4F7JA 4QYEA 1Q8UA 4FNZA 4ALVA 3Q2MA 4EOQA 2PVJA 3D4QA 3NCZA 5BVDA 3VHKA 3AQVA 3CTQA 3DZOA 4QMUA 5KO1A 1KWPA 3SDJA 4FX3A 5LVLA 4JNWA 2VNWA 3U4UA 2WTWA 3N4VA 3E8CA 3MI9A 4XEYA 2QC6A 3VUDA 3Q2JA 3P5KA 4WUAA 3OXTA 4EEVA 2IN6A 4H36A 4I5HA 3C13A 3R71A 3NFGB 3B8RA 5CAVA 3LCOA 4M14A 4NL0A 2IVTA 4NKAA 4XLIA 4KBAA 1IA9A 2WTCA 3QRJA 4CTCA 3T3VA 4RRVA 3PJ1A 3ZBXA 2HY0A 4CG9A 2VWZA 1M52A 1UNHA 2Y6MA 4JAJA 2QVSE 1NW1A 5GZAA 3WF8A 5I0BA 5KKRC 4BDCA 4QNAA 3THBA 4O38A 4FGRA 4YTHA 4XRLA 4BBMA 3Q4CA 1URWA 3DB8A 3BX5A 3LLAA 3NAXA 4YR8A 4ASXA 2ETRA 4L3LA 4KIKB 5LXMA 2VTQA 2BAKA 4M15A 4F7LA 3D9VA 4PX6A 4LV8A 1AQ1A 4C3PA 4DITA 5GZ9A 4JG7A 3A4PA 3QX2A 4GEOA 4IAYA 3ZLYA 3QTIA 4KIPA 4FV9A 4KNBA 3EL8A 1OIYA 4KIKA 1M7QA 4I21A 5J1VA 4CYJA 3Q9ZA 3BHVA 4N4SA 4C0TA 4LGDA 4EORA 3GCQA 4O1OA 4C37A 5EKNA 2PMOX 3FKOA 3MY5A 4KSPA 4O4FA 3PRFA 3A7HA 4U3YA 3VS3A 4BCNA 4QP3A 3MVJA 4EL9A 3HX4A 4RJ4A 4I6LA 1WBSA 2W5BA 3RI1A 5FRIA 1YW2A 2IZSA 4UZHA 5DEWA 3CSVA 3QKLA 1ZMVA 5DI1A 2J7TA 4ACCA 3U6IA 2PUPA 3OP5A 5EHLA 4G5PA 4JRNA 2WMVA 3QLGA 4YMJA 2PE1A 4JX3A 5EG3A 4CLJA 4E7WA 1J1CA 4BTFA 2WMTA 4YPSA 3V5TA 1LEWA 5HO7A 1WBNA 4F4PA 5IF1A 1VR2A 3TN8A 4C2VA 2PUIA 3S2PA 4Z3VA 4HGLA 4JS8A 1ZXEA 2C5VA 1WBTA 4FI1A 4O0TA 5HORA 3GU7A 3A62A 1Q24A 4H1JA 4LGHA 1PXOA 5EHYA 1J1BA 4A4OA 4BYIA 5E8XA 3CPCA 4BCMA 3GC8A 4QMZA 4PNKA 3DKOA 4QQJA 5EYKA 3SAYA 5CALA 3KK8A 2QO7A 4AAYA 4R5SA 1RQQA 2VO0A 4AZTA 4DGOA 2WIHA 3FSKA 4FIIA 2O65A 4DYMA 4DGLC 2AC5A 2PVYA 5CEQA 2XNEA 2PE0A 2Y9QA 4K77A 1UU9A 4ASEA 3C1XA 4KBKA 2BTRA 3UIXA 2UW6A 2G1TA 5DR9A 3NGAA 4I0RA 2ZVAA 4PTCA 2X0PA 3LFEA 4UB7A 5GJDA 3HUCA 4Q5HA 2JBOA 4C4FA 1IEPA 3IOPA 5E90A 4E73A 5CSWA 5EDRA 5AP0A 2XK7A 2BFXA 5J9LA 3QZFA 4YJUA 2J90A 5FDXA 2GPHA 1NY3A 5FG8A 5J7HA 4FEVA 4B0GA 3TTIA 3R0TA 3OVVA 2C6KA 4IFCA 2OXXA 4BCHA 4NT4A 1M14A 2OJGA 4LFIA 5B2MA 3VS4A 2YM4A 4C38A 1YXTA 2QOIA 3V5PA 3BIZA 4RJ3A 4QMTA 1W84A 3TEIA 1ZWSA 1P4OA 5IUHA 5T3QA 3PPJA 4EH9A 5FTGA 5IDNA 4FL1A 4RBLA 2W7XA 2C3KA 5CEMA 2XP2A 2QLQA 2BFYA 1KOAA 1CTPE 2X8DA 3F3WA 4GCJA 4DGNA 5F4NA 1JKKA 3CE3A 3I60A 2XIZA 3KF4A 5M44A 5HE1A 4GSBA 4CQGA 2H8HA 4RSSA 1OIUA 1NVQA 1IA8A 4U42A 5CYIA 3VBTA 3C0HA 4GK4A 4BCOA 4YJOA 2WMAA 1G8SA 1Q99A 1BKXA 3MBLA 3PVBA 4JIAA 3UDTA 3BZ3A 3FMDA 4AXCA 1OIRA 3KMMA 3FLZA 4AOIA 4U9AA 5LWMA 2HENA 3ZXTA 5E8TA 3SRVB 5HLPA 3BL7A 2J0KA 4NK9A 3UC3A 4F0IA 3NRMA 4IAAA 5L4QA 2GHGA 1J7LA 5EYDA 4E6DA 4FOBA 5DOSA 4HW7A 5BYYA 4F65A 1XBBA 3MH0A 5CENA 1SMHA 4ZMEA 2ITQA 3VNTA 3VUHA 5LOHA 3IOKA 3BYUA 2C6IA 3MH1A 2YIRA 3G15A 4PL3A 1DI9A 5A3XA 3BV3A 3KK9A 3HLLA 3KEXA