5CEOA

Dlk in complex with inhibitor 2-((6-(3,3-difluoropyrrolidin-1-yl)-4-(1-(oxetan-3-yl)piperidin-4-yl)pyridin-2-yl)amino)isonicotinonitrile
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
269
Chain Sequence
LWEVPFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 12
publication title Scaffold-Hopping and Structure-Based Discovery of Potent, Selective, And Brain Penetrant N-(1H-Pyrazol-3-yl)pyridin-2-amine Inhibitors of Dual Leucine Zipper Kinase (DLK, MAP3K12).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ceoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ceoA01
3VRYA 2VX1A 4OGRA 2JKKA 3QQUA 5HVJA 2XBJA 4X2GA 3VS4A 3U54A 3MFRA 2YIWA 4EOOA 2QONA 2W05A 3TTJA 3K54A 3PTGA 4YJVA 1REJA 3PWDA 4R7HA 4Y72A 3FEGA 3E8CA 2VO3A 4QMXA 2XK7A 2XNBA 3NUSA 2DS1A 2QO9A 3DJ5A 3OT8A 1P4OA 1U5QA 4KS7A 4CXAA 4F1OA 2YM7A 4JLCA 2W1DA 3FMHA 5LWNA 5A46A 3LMHA 1KE8A 3OW3A 5HCYA 4F7NA 4H1MA 1U54A 5EW3A 4WBOA 5IH6A 3TNWA 3ZLWA 3UIUA 4GG5A 2IZTA 2Z7QA 4FKSA 4XG3A 1YW2A 2WTVA 1IASA 4ORKA 4U6RA 5AP3A 3LE6A 3RM7A 5FDXA 3ZRMA 4C35A 1OIYA 3EL7A 3RPSA 4FV1A 4RX8A 5HHWA 3A61A 3O2MA 2OICA 5JN2A 3TZ7A 1E1XA 4KSPA 2Y8OA 4D1XA 2J50A 4S32A 4KKEA 2OBJA 1M2QA 3PZHA 2CGVA 2QOKA 3B2TA 5DYJA 3VBWA 4Y83A 2V0DA 3IW5A 4I94A 2NO3A 4JVGA 2X9EA 3ZSGA 4BF2A 3BLRA 3UP2A 5AA9A 5M51A 3IW8A 2BROA 3AC4A 3IOPA 4JDHA 5TO8A 3TACA 5KMIA 5IG1A 4YZNA 3V5JA 4FZ7A 4I22A 4LV8A 1OKVA 2EVAA 2VTNA 5C1QB 2XK9A 4FGBA 3UOKA 2Z60A 4R77A 3M1SA 3DOGA 5IUGA 2XRUA 3V04A 4LRMA 3EFLA 3F2RA 4BZOA 4FICA 4I5HA 2GDOA 2WXVA 4A9YA 4EK6A 3HGKA 4C4IA 3MB6A 3TZMA 1B6CB 1DI8A 3HUBA 2G2IA 1H26A 4FTOA 3LIJA 4YJQA 3U9NA 2PL0A 4FNYA 5J79A 3ULZA 2J5EA 4UMPA 3R1YA 4I5MA 5K3YA 3FY2A 4GK3A 4IB0A 1KV1A 5K5XA 4ZTQA 4M67A 5AM6A 3QD2B 4E20A 4NIFB 4FV3A 4RJ8A 1PYEA 4AT5A 4U43A 4P7EA 3NUYA 4FTQA 5M44A 4DH8A 3AC2A 3ZTXA 4CCUA 4X6RA 3KGAA 1FGKA 2W99B 3EZRA 5ITAA 4TY1A 1QCFA 5IKWA 1YWRA 4CZYB 4EH3A 1OIRA 2CCHA 3RWPA 1PXNA 2GCDA 3L9LA 2OO8X 3HRFA 4CFMA 3DGKA 3WIKA 4G3CA 4DGMA 5DG5A 1XR1A 3U9CA 4IWOA 5DLSA 2CSNA 4II5A 2XIXA 2QLQA 3LW0A 5JFVA 2GPHA 4J71A 2CGWA 4BCHA 5E8XA 4C4HA 1URCA 3BYVA 3R02A 1G8SA 3AG9A 5FXRA 4ZSLA 4YR8A 2ITTA 5HORA 4Z7GA 4A4LA 1WVXA 3JVRA 2UW0A 4YJSA 4EWHA 4UWCA 5EQYA 2HENA 3ORXA 2IN6A 3T8OA 4N4SA 3PA5A 5EH0A 5GJFA 3BU6A 4WG5A 3RHXA 3JPVA 3IGOA 1DI9A 3R30A 2WMVA 5EDRA 5LOHA 3CKWA 4RIYA 3GGFA 2IZSA 4GRBA 4NM5A 4MKCA 4QO9A 4QP9A 3BBTB 5DBXA 2VZ6A 5DR9A 4L43A 3MBLA 2XBAA 3QRUA 3MVLA 3F3VA 5J95A 4CTCA 2BUJA 3KXXA 4H58A 4M68A 4G9RA 2NPQA 2G2FA 4UYNA 3MTLA 2B9IA 2YCQA 4FTMA 4MD9E 5CASA 3CS9A 3EYGA 1ZYSA 5AUWA 3OBGA 2WELA 3LZBA 2PZ5A 3KMUA 3ZYAA 2WHBA 5IH4A 3NUAA 2Y7JA 1BX6A 3DFAA 3OBJA 4RIXA 2BAQA 3R9OA 3RZFA 4R7BA 5LMKA 3SLSA 3TNQB 3O0GA 2R3MA 3PG1A 1OL5A 3KVWA 4AA0A 3MW1A 3FYJX 3VS3A 1B38A 4L6QA 5JQ5A 4QMZA 5EI8A 3GBZA 4O22A 3WZKA 4O7ZA 4QQTA 4O7VA 2PZPA 4PNIA 4Q2AA 1OBGA 5EYKA 4EK8A 2PYWA 2WKMA 2VWXA 4X3FA 2Z2WA 4AZVA 4EOJA 4EKLA 2C69A 4FI1A 3DU8A 3QZIA 4RIOA 3P7BA 4FV5A 1YI6A 3GQLA 2YM5A 4CZTA 1YDTE 4DGGA 3OC1A 5CAOA 3KK8A 4L67A 3KU2A 2R3JA 3UZTA 3I7CA 3ZRLA 3BGPA 2WIPA 3O96A 3R9DA 3TKUA 4FNZA 3UQGA 4FV2A 4GFOA 1PKDA 4CQEA 1PF8A 2YN8A 1GIIA 3COKA 3NNWA 4F9BA 3BV2A 1ZMUA 4GYIA 3D14A 4EH6A 1G3NA 3BBWA 3FBVA 3RHKA 1M2PA 2CKOA 2HW6A 4X0MA 5JQ8A 4GCJA 5JKGA 4ASEA 4OTDA 2SRCA 4J52A 4MBJA 4TYHB 5L2QA 4QMSA 3V8WA 2E9NA 3LVPA 3MSSA 3BWJA 3ZXZA 4EUTA 2IW8A 3D83A 5HU3A 2ITXA 2VWYA 2OZAB 3WE4A 2PVYA 1S9JA 3OMVA 3KCKA 3OTVA 4IH8A 5M53A 3L8XA 4RIWB 4TWPA 3TUCA 5LCKA 4M13A 2X1NA 3SRVB 4L53A 3ZMMA 3DKOA 4BDJA 5CAUA 3LXNA 4XP3A 3P23A 1ND4A 4UV0A 4V05A 1LPUA 1WBTA 3CQWA 5H8GA 3GVUA 2W1FA 3BEGA 4WRGA 4CCBA 4CZUA 4ZY5A 1NT2A 3HMNA 2WZJA 2IPXA 4RBLA 3Q6UA 3V51A 5L2WA 1ZARA 4U79A 4GKHA 4QMOA 2XMYA 3LLTA 3R21A 3NUXA 3DKGA 2C30A 5AV0A 2WMWA 3AD4A 3DKFA 3KRLA 4CMUA 4TNDA 4V04A 3UQFA 3ENHA 4GFMA 4AZSA 5FTQA 2GHMA 3P86A 1KE5A 2GS7A 2QNJA 4NM0A 4A9TA 3W2SA 1J7UA 5GIPE 2JEDA 4BY9E 2EB3A 4YTHA 4NUSA 4DH3A 2XF0A 4FG9A 2A27A 2OXXA 4ZP5A 4OTGA 3ZUVA 1G8AA 2QOBA 3ORTA 4ZSGA 2JDVA 3UDBA 3D15A 3GC9A 3DY7A 2XUUA 2VU3A 3FMMA 3PP1A 4NW6A 5FDPA 4EH4A 5E4HA 4FVPA 4XG8A 3VS0A 4QMQA 3CD8A 2X7FA 2B53A 3GU8A 3CJGA 2REIA 2WQMA 4O7RA 4PQNA 5JZJA 4I20A 1PY5A 5CXZA 5EQEA 4IX6A 4I4FA 5TF9A 4MYGA 2GQSA 4TKSA 3FZRA 4U8ZA 3R73A 3GCPA 3OG7A 2BTRA 3ET7A 4FGRA 4L44A 2VD5A 1J91A 2PMLX 1PMEA 2ZDTA 2G01A 3A7JA 4G3FA 2EWAA 2PZRA 3HECA 1ERKA 4KA3A 5FTOA 3UYTA 3FPMA 3F3UA 3F66A 4DBNA 2C6LA 3IW7A 4FEWA 4CT1A 2RKUA 4PX6A 5HTCA 2BAKA 3W55A 2P2IA 4WKQA 3QCYA 4NZWB 2X2MA 4DYMA 5C27A 5GZ8A 4K1BA 4CFFA 5AIKA 3QYWA 5EDQA 2B54A 2E9PA 3F2NA 3FYKX 5K5NA 5LXMA 3RK7A 2QO7A 3BHTA 2OLCA 2Q0NA 1Z5MA 4D55A 2C6TA 4UWYA 4E3CA 3ZDIA 2HZIA 4MH7A 2GMXA 1HCLA 1E1VA 4CFWA 4CKIA 3HMMA 1Q61A 5IMXA 3G2FA 3E7VA 3Q5ZA 3UIXA 3KF4A 5D12A 4YPDA 4NU1A 3TEIA 4AGUA 4M15A 4S2ZA 5ANOA 3SOCA 3OF0A 5CSHA 2UW6A 1H8FA 2OJIA 3KFAA 3QHWA 4L42A 4S34A 4U41A 3UC3A 3VQUA 5HO7A 5I9WA 3Q2MA 4CG8A 3TT0A 5EM8A 4BI1A 1XO2B 4EQCA 1I44A 3MVMA 5E8VA 4JRNA 5AP0A 5B2KA 5AA8A 5A6NA 2C3KA 2UZUE 2JDOA 5BYYA 3ZLXA 4AUAA 4PV0A 3PRIA 4P5QA 5CEMA 3C5UA 3IS5A 3DAEA 3NUNA 3MH0A 2WFYA 2YZLA 3NGAA 3PJCA 5DT4A 3UP7A 1AQ1A 2UZTA 3OWKA 3H0YA 1J3HA 1ZXEA 2FUMA 5HG8A 2IVVA 4AWIA 3CLYA 3SXFA 4XX9A 5GHVA 5EM7A 4GMYA 1OIQA 4F64A 2YJSA 3BV3A 1RW8A 4HCTA 1JQHA 4IVCA 4WD5A 4O0RA 3NAXA 4PPBA 2X7GA 4R6VA 4JIKA 4GS6A 4PWNA 3FZPA 4GIIA 4YHJA 3O71A 1FOTA 4ZTSA 4WA9A 4HYIA 5BYLA 1XJDA 4NFNA 4ZTMA 2JFMA 1YI4A 3Q6WA 4BC6A 5HIEA 2EB2A 3F3TA 3FI8A 4A7CA 1Z9XA 2VN9A 2Z8CA 4KRCA 1OL6A 3R8PA 2UVZA 3EN9A 4M8TA 4GIHA 1I09A 5BYZA 2BTSA 3A4PA 4U0IA 1KOBA 1OUYA 2XZSA 5AJQA 2BZKB 3BU5A 4JG7A 2GFCA 5HKMA 4QQCA 3UIBA 1XH8A 2RFEA 4RVLA 1YXVA 4BIEA 3UBDA 2A4LA 3PIYA 4TYIA 5DEYA 3OT3A 5I9YA 3TV7A 4G9CA 4UWBA 3A7FA 4RWLA 2C6EA 2OK1A 3O7LD 2W9ZB 2XK6A 1O6LA 3ZBXA 4U80A 4KKGA 4L68A 4UMUA 3N4UA 4N0SA 3E8EA 4EKKA 4J99A 1DAYA 3RBWA 5J1VA 3OWLA 3TL8A 4BDAA 5KMJA 1U59A 3KXNA 3BKBA 4XS2A 1Q8WA 4MHAA 3RI1A 5M4IA 2PE2A 3W2OA 3ZSHA 1CMKE 4RIWA 3N4TA 3MI9A 4D28A 2VNWA 1XHAA 3QQKA 4I0SA 4JS8A 4OTQA 1OUKA 3D5VA 4PTEA 5L6WL 4IW0A 3EHAA 5JGDA 1KUTA 3UIMA 1M2RA 2J0JA 3PA4A 2HOGA 3UOHA 1V0OA 4H1JA 4ANSA 4DEBA 4FKLA 3VULA 1M7NA 3GCUA 1VYWA 3IQ7A 5GINE 4L7FA 4QMPA 3UPZA 4XV2A 5AUXA 3ZO4A 1IR3A 3DJ6A 2GS2A 3S95A 2Y4IC 4IZ5A 3TJDA 2PUPA 3IDBA 4PMMA 3Q9ZA 1ZOHA 3U87A 4LFIA 5AV2A 4IACA 4DGLC 2BZJA 3K3JA 5EYDA 1Y6AA 3W33A 3TN8A 3G51A 3MVHA 2WTCA 2O2UA 1K2PA 1RQQA 3LQ3A 1A9UA 1IAJA 5HNIX 5E7RA 2I40A 4P5ZA 4WUAA 4WT6A 4ZS0A 3BI6A 2H6DA 2HXQA 3PYYA 3MYGA 5ANDA 3SOAA 3W32A 4YNEA 4FTRA 2O5KA 2OI4X 3E63A 2BZIB 3EZVA 3MPMA 3OFMA 4IWQA 4M0YA 4MNEA 4QP3A 3SDJA 4ZJVA 5IISA 1Y6BA 4Y5HA 3KREA 5ANEA 2FO0A 2X81A 2XJ1A 5AWMA 4H3BA 5AP5A 3VUMA 4BI2A 3LAUA 1Q62A 4DTAA 1E9HA 4RC4A 3D7TB 4TWOA 3AGLA 3NW7A 5CYIA 1UU9A 3DT1A 4KABA 4HCVA 4BFMA 5CWZA 5I3RA 3KRXA 4I6FA 2BDJA 2C4GA 3CY2A 4EL9A 1MRVA 4YTIA 2B9FA 4XUFA 4BHZA 5M09A 1YVJA 4J96A 5D1JA 4J97A 2ONLA 3R00A 2ITQA 3EQCA 5HBHA 3UNZA 3ZM9A 3KRJA 3HMIA 4DFXE 2R3LA 4G3DA 2QLUA 5EYCA 4BWXA 1OL1A 4CLJA 4DFNA 5JEBA 3W2PA 4E73A 4O0UA 2VTMA 2XIRA 4NCTC 1YWVA 5DGZA 2R0UA 3GFWA 3AMYA 5AMNA 2OF4A 3ORPA 4O84A 2CGUA 5CNNA 3P0MA 4Y8DA 5ETCA 4RG0A 3PG3A 3WBLA 4GYGA 2HY0A 4JR7A 5H8BA 2YZAA 4FV7A 4J7BA 1YXXA 2VO0A 3NW6A 3PY3A 2G1TA 3QWJA 4BZDA 4KNBA 4KS8A 2VTSA 4DCEA 4ERKA 3QTQA 4KINA 4QMMA 3F82A 4U81A 3R83A 3F9NA 4X2KA 2GNHA 4UEUA 3F5PA 2QURA 5DOSA 2RL5A 1UKIA 5FQDC 4O0VA 3WF6A 4O7LA 1R3CA 3GCQA 4O86A 1GZ8A 2I0HA 5E8UA 4L3JA 4C61A 2R3GA 4O1PA 4E5WA 2ITOA 5JH6A 4I23A 2C5VA 5CT0A 2J7TA 3QUEA 3DB8A 3TUDA 2OFVA 3DA6A 5B2MA 5DFPA 2CDZA 2JKOA 5L6OA 4XG2A 2XJ2A 4F9YA 2VTHA 4A9SA 3LXPA 2QKWB 4XLIA 5CF8A 4JBQA 2OFUA 2YCSA 4BCNA 3MH2A 2R2PA 2YCFA 4AZEA 4TRLA 1OB3A 3EQPA 3A8WA 3Q32A 2QU6A 3Q60A 3R7GA 5KZIA 2KULA 4V0GB 4O6EA 3VNTA 1YOJA 2JIUA 1SVEA 2HCKA 4JBPA 3DK7A 3GOKA 3BYOA 3FLSA 5BQ0A 3FI4A 1Q3DA 4EH8A 4ZJJA 1BI7A 4D9TA 3TWJA 5CQWA 1RJBA 4KBAA 4CGAA 4GVAA 4IADA 4PP9A 4MEDA 3MN3A 1BL6A 3W2CA 3PXYA 5HGIA 4JQ7A 3QD0A 3ZCLA 4DGOA 3SC1A 4F4PA 2HY81 4RX7A 3V8SA 2V7AA 4GV1A 4YSJA 4ZTRA 2GTNA 5M56A 4TT7A 4PMTA 4FUXA 1H0WA 1Q97A 1R78A 5L8KA 3HAVA 3IONA 4UYAA 2JKMA 3MFTA 3OCTA 5B0XA 5HBEA 2R9SA 4EQUA 3U4UA 5I9ZA 1H07A 3ZRKA 4NW5A 2J0MB 4XEYA 1JKLA 3CEKA 4NSTA 4QPSA 4M69A 4S30A 3LM0A 4DH5A 2VRXA 4MWIA 4UMTA 3D5XA 4U44A 1JNKA 3EN5A 4BWKA 3F6XA 3BE9A 3KXMA 3SG8A 2NRYA 3H0ZA 2AUHA 3VO3A 2W1CA 4YBJA 1YWNA 4D2VA 3TDWA 3QCXA 1KE7A 1Y8YA 4ALVA 2RG5A 5TE0A 2O3PA 5AUUA 3ODZX 3WE8A 5CZHA 3K2LA 4IB1A 2WMQA 4LYNA 1YXUA 3KQ7A 5BVEA 4F9WA 2UVXA 4YP8A 5HVYA 4Z3VA 2GQRA 3MIYA 3O7LB 5EM5A 1UKHA 4AA4A 4ENYA 4GJ2A 2VWBA 4YNOA 5HESA 4C7TA 3H9RA 3Q53A 3ACKA 3AC1A 4YPSA 3VW8A 3LOKA 1T45A 3OWJA 4C2VA 2YJRA 5D11A 2JDTA 4DEHA 1LUFA 3QKMA 4D58A 2VUWA 2O8YA 3CR0A 5AUYA 4TPTA 2FB8A 2V5QA 4OR5A 5CF6A 3EQBA 3AT4A 2OH0E 5HOAA 3R8LA 4XG9A 3H4JA 3VUTA 3RAWA 2YWPA 4JT3A 4JBOA 4D2SA 3QQJA 2GNFA 5IZFA 2R3PA 5IA5A 1OPLA 2VWIA 4XV3A 4O6LA 4E4XA 4F6SA 3DXQA 3ODYX 4FT3A 3QCQA 4F65A 4ZTLA 1SZMA 1MQ4A 3F88A 4QYHA 1OIUA 2WPAA 3FJQE 2R3NA 4PDSA 3Q3BA 5BVWA 2YAAA 5M08A 3ANRA 3KULA 1G5SA 3ZSIA 2G15A 4ZLYA 3L9NA 4UMQA 1U5RA 4YHFA 1PMUA 4MCVA 4NJDA 3FLNC 2Y4IB 3V5LA 3TXOA 3NYXA 1XH7A 4PTCA 5C4LA 4KIPA 1Q3WA 3ZLYA 3GCSA 1ZZLA 4RC3A 5FRIA 4QYEA 4JJRA 3CSVA 3HV3A 3DXPA 2WMRA 1F5QA 3QQLA 4JG6A 4FYNA 1PHKA 3BHVA 4FT0A 4YZCA 2WMTA 4XP0A 4IAAA 5T6KA 5C26A 3DZQA 3IDCA 3CIKA 2PULA 4ZK5A 4ITHA 5CU3A 5A4LA 3EQRA 3M42A 5AEPA 4DT8A 1SM2A 3JVSA 3UVRA 5AP6A 1H1RA 3A62A 2BDFA 3T3VA 2GTMA 4F1TA 3QFVA 3VBXA 3QD4A 3ZUUA 4YJTA 2XM9A 4BTJA 4O0TA 4O96A 4XYFA 3QALE 2IO6A 3DTCA 3DFCB 3L8SA 3QA0A 2VV9A 4OTHA 4AAAA 4DN5A 5HCZA 5HX6A 1VEBA 4IHPA 3FL4A 2YITA 3HDNA 1QPDA 4FIJA 4OT5A 4QYGA 2ZMCA 3O50A 4WSYA 3LPBA 4I93A 4XNEA 2QG5A 4YJPA 3ZOSA 4MQ1A 3EMGA 3NDMA 4DINA 5JMSA 5M07A 4FEVA 3GT8A 4AACA 3LMGA 5BMMA 2XNMA 4RMZA 5EM6A 3CD3A 4EYJA 2CGXA 3I6WA 4NM7A 3G0EA 3DNDA 4LL5A 3QYZA 4EQMA 4R78A 3GUBA 4W8DA 5CEIA 4GKIA 4M97A 3S1HA 1Y57A 2F57A 4QP7A 2CHLA 3R8VA 2B7AA 5EOBA 3VS1A 4AZTA 4EZ7A 4F0IA 3DQXA 3P7CA 4KIKA 2IWIA 4RQKA 2X6DA 2AC3A 2V62A 4IM2A 5KMOA 3IW6A 3KL8A 4I6BA 1SMHA 5HE0A 2W5HA 2C3JA 4GEOA 5AIRA 4ANNA 5DWRA 4EOQA 3SKCA 1R0PA 2NRUA 2R3HA 3UZPA 4ZLOA 2UUEA 3FMDA 3I60A 5FEDA 3QHRA 2R7IA 3NUPA 4O7TA 4X3JA 5CQUA 3G9LX 2IVSA 2ITPA 4CRSA 2JD5A 3GU4A 1SVHA 3R63A 2P3GX 4CKJA 4ANLA 3TCPA 4O7NA 3R9RA 4CFUA 3HV4A 2CMWA 2ITNA 2I0EA 2RFDA 4JAIA 3EN4A 1H25A 3KK9A 3OEZA 4Y95A 4C36A 4IQ6A 4ARKA 3NVKI 4FTIA 3R2YA 2CKQA 2ZOQA 4U42A 1OL2A 2XP2A 3LQ5A 4MQ2A 4IJ9A 1WCCA 4W9XA 4DAWA 3CC6A 4BKYA 3I79A 2OW3A 4EC9A 4C38A 5H8EA 3ZS5A 2X39A 3ZHPC 3DCVA 4AX8A 3DDQA 2HK5A 3LCSA 4RJ5A 4JOAA 4B7TA 4RLLA 3IK3A 1TQPA 1FINA 3ITZA 4U5JA 2QQ7A 5J7BA 4IXPA 3QTXA 2XNPA 4FIFA 3BE2A 5DHJA 2XIKA 3NMUF 3WF8A 4AN2A 1ZY5A 4QMYA 5HTIA 2ERZE 4MX9A 4EK3A 2W4KA 4IAZA 1CTPE 3CQUA 5CLPA 3TI1A 3E7OA 5F9EA 5IQGA 5IUIA 5EDPA 3MB7A 4WHZA 3VVHA 1NXKA 2R7BA 5ANIA 3MTFA 1JKTA 1CDKA 2XKDA 2XB7A 3FMNA 3U6JA 3IPHA 3BU3A 2BKZA 1APME 2CJMA 3VC4A 5G6VA 1VYZA 2F7XE 4YGAA 3EKKA 3RNIA 4WNOA 5KNJA 1MUOA 5HO8A 1UU8A 3VS5A 4L3PA 1ZRZA 4IM0A 4N70A 3BHYA 4JG8A 3VUIA 5DVRA 1QPEA 5CU2A 3FHRA 4EBWA 3RPYA 3R7OA 4QTAA 2J2IB 4BDCA 5CEOA 5AAGA 4EJ7A 3THBA 1ZZ2A 3PXKA 4E6DA 4MD8E 2HELA 2Q83A 3BLHA 4CTBA 4PY1A 4CSVA 5CU0A 5KMNA 3OD6X 4I6QA 5BUJA 4A07A 4APCA 3S0OA 5D7AA 4Z7HA 1H0VA 3QRJA 5IA2A 4QQJA 2QR8A 3G6GA 1OI9A 5AP7A 2C5YA 3FC2A 3C50A 3PY0A 2W1IA 3CP9A 3R9HA 4BCMA 4FKGA 3FKOA 3PSDA 2GS6A 4QPMA 4EC8A 5CF4A 2OIQA 3LHJA 4LV5A 4BCGA 5IH5A 4JNWA 5AV1A 1ZMVA 5GJGA 5CEKA 5HNBA 2FSMX 3QX2A 1H00A 1PXPA 2ZV9A 2BHHA 1JSVA 3RP9A 4BKJA 4QMTA 2GFSA 4OBPA 2UZVA 2XM8A 3EQHA 3G0FA 3FAAA 3P79A 4RA4A 4F9CA 3RAHA 3EN7A 4LOQA 1PKGA 4FZDB 4JX7A 3V5QA 4JX3A 4W4WA 2X9FA 5HE1A 2C6DA 2Q0BA 1XKKA 4ZZOA 1YQJA 1WZYA 4XBUA 1DS5A 4QPAA 4I21A 4NTSA 4U3ZA 4FSMA 4YJRA 3MA3A 2X8IA 4O1OA 1Y91A 4D2PA 4O7WA 3ALOA 4D2WA 5L4QA 2PVRA 3MS9A 4IB5A 1W84A 3EIDA 4FYOA 3FY0A 5CTPA 3OCSA 3WZDA 3BQRA 3NR9A 4HVGA 4D1ZA 1GZKA 4E8AA 4L9IA 4MXXA 4O0WA 3GP0A 5A4TA 4OAUC 1OBDA 4DH1A 1PMNA 3HYHA 1O6KA 3JY0A 3QA8A 4AGCA 2CCIA 2OWBA 3C0GA 4BYJA 5TKDA 3Q4ZA 3EQDA 4MK0A 5HIBA 5JFSA 4HOKA 4M14A 5AR2A 3FPQA 2YFXA 4BDKA 3S3IA 4FIGA 2R64A 2XEZA 5CVFA 1ZMWA 2VWUA 4G5JA 4H05A 3SG9A 2AYPA 5KMLA 3VQHA 3PJ3A 5CI7A 1FVVA 2UZLA 3RGFA 4EI4A 4R5YA 5FTGA 2JDSA 4AGWA 4XRJA 3CGOA 3C4XA 3R6XA 4IZYA 5ACKA 4NCTA 4ASDA 2UW3A 3I5ZA 3P1AA 5TT7A 3HV6A 5H2UA 4NIFA 2YM3A 4CV9A 5EOLA 2YIYA 2OH4A 3QZHA 3E62A 4RGJA 1BMKA 5HLNA 2BDWA 3ZO2A 3PIXA 2XKCA 5CEQA 3W2RA 1R1WA 3PY1A 4G6LA 4A9RA 4CNHA 3KEXA 4ZIMA 3O8PA 2YEXA 5CZIA 3HUCA 4HGTA 1JSTA 2AC5A 3FWQA 2J0KA 4IIRA 5FLFA 5CALA 5KBRA 4RWIA 2GHLA 4EZ5A 3PVUA 5LVNA 4QMNA 2XYUA 2X6EA 2CLXA 4IC7A 4WSQA 2C68A 5GZAA 5J9ZA 2F9GA 3UVPA 3TM0A 2HZNA 4G34A 4PRJA 4LMUA 1NVSA 5L3AA 3WYYA 4GL9A 5CT7A 4ERWA 2FSOX 4OAVB 5HG9A 2ETRA 3CY3A 2JBPA 1P5EA 2V7OA 3D7ZA 3OEFX 3QF9A 3QLFA 4BCJA 4EYMA 1PXMA 2WTWA 1Y8GA 5CSVA 3KMWA 4D5HA 1ZLTA 1LP4A 3VHKA 3E3BX 3QGYA 3QTUA 3Q2JA 3KXHA 3Q5IA 4XMOA 4PDOA 4DFBA 3QGWA 5E91A 1PYXA 3WI6A 2W5BA 3WYXA 5H3QA 4JRVA 3HVCA 4PUZA 4F0GA 1MQBA 4FV0A 2EUFB 2YISA 3BHHA 5EG3A 4OUCA 5HE2A 4JBVA 2XNOA 3HRCA 4HGSA 1IA8A 3KRRA 5CX9A 3U8WA 4RJ3A 4J8MA 1L8TA 2BR1A 3DK3A 2PVKA 5KKRC 5A14A 3D5WA 4YTFA 3QXPA 2PWLA 3ORMA 2R0IA 2OKRA 1OKZA 3SQQA 4NFMA 1OPJA 3C13A 3LFFA 1HCKA 2O0UA 2VTTA 2X4FA 3I7BA 4IFCA 3E64A 4P2KA 4IMYA 4C2WA 4BTKA 3QXOA 4IANA 2ZV7A 2NP8A 3K5UA 1YOLA 5IDNA 2BKKA 2CLQA 2QOCA 2E9OA 3R04A 4JQEA 1H01A 4QTCA 4BCQA 4XLVA 3EJ1A 5CAQA 1ZOGA 3UG2A 3LKMA 5F94A 4YURA 4HJOA 5KE0A 2X8EA 3C51A 2IW6A 4CLIA 2UW9A 3CQEA 4U9AA 4KB8A 4PL5A 2PHKA 3LCOA 3NW5A 1NW1A 2QODA 3C4ZA 3ELJA 3RZBA 3R71A 4LRKA 3MDYA 3A2CA 4GT4A 1T46A 1KV2A 4RVMA 1KE9A 4IX5A 3RAIA 3DTWA 4RWKA 4E93A 3D9VA 3ROCA 1J1CA 4QOXA 4WG3A 3GB2A 3OXTA 3FZOA 4G1WA 3T3UA 2UZNA 1XBAA 2ITYA 4FTCA 2WGJA 4CG9A 3VN9A 3IKAA 4JXFA 2XKFA 4TNBA 2VTRA 4ALUA 3MY1A 4FVQA 3OOMA 4FVRA 4X6QC 3RVGA 2PVMA 4TYHA 4G3EA 2BILB 5KO1A 5AUTA 5HZNA 2Y0AA 1BKXA 4RT7A 4DC2A 3RJCA 5GNKA 2OZAA 3ZM4A 1OGUA 2BIKB 3NYNA 4K33A 4MF1A 2CKEA 4D9UA 5IEXA 4IAIA 2QD9A 1W83A 4FG8A 4EH5A 1KOAA 4Q9SA 5ETAA 3SRVA 5M4UA 2UV2A 2WTKC 5BPYA 2JKQA 3NZ0A 5BMSA 2C3LA 2VAGA 3KC3A 4M7IA 4YUQA 5LMKC 2YM8A 4XG4A 1H4LA 4FSQA 4BGHA 2QO2A 4QMVA 3JUHA 3O23A 4R3CA 4FZ6A 3RM6A 5E8YA 4ZSAA 3C4CA 2C6OA 5JK3A 2ITZA 3GQIA 3EN6A 4RX5A 5K4IA 2QU5A 4EORA 4EHZA 2CKPA 3PLAE 3UMXA 5F20A 4USFA 5HQ0A 3PJ2A 5AFVA 3DQWA 2VTJA 1WFCA 2A19B 2X7OA 4RRVA 3ZBFA 3EQIA 3CE3A 4JI9A 1Q5KA 3FKLA 3TV6A 3ZH8A 3VF8A 4EOPA 3UOJA 5ANKA 1IRKA 3ZO1A 2ZB1A 4TWNA 3HP5A 3COHA 4BGQA 4FKUA 4F1MA 4R3RA 4BCOA 5A4CA 3FI2A 5EK7A 2XYNA 5IA4A 1REKA 3ORKA 3QLGA 5ETIA 5AR7A 3CPCA 5HG7A 1H1WA 4XOZA 4JDIA 2RGPA 4FEUA 3OXIA 3AMAA 2X2LA 3ORZA 4ANMA 3GU6A 3KVXA 3PLSA 1OL7A 3LCKA 2YCRA 3D2IA 2R3KA 2XIZA 4RFZA 4F09A 4NYEA 2HIWA 4J98A 4KIOA 4FT9A 1MP8A 1WBWA 3CTQA 3PXFA 4GVJA 2JC6A 3BEAA 5CVHA 5K0KA 3VBTA 3VW6A 5IEVA 4FX3A 2X0GA 3LQ8A 3NCGA 4PP7A 4D4YA 5E9EA 3G6HA 2XA4A 2ZDUA 3FUPA 4FEQA 3UC4A 3CKXA 4BBMA 5H9BA 4L7SA 3PA3A 4E4MA 3NIZA 2QHNA 1DM2A 2JDRA 1YDRE 3BYMA 4FF8A 3TZ9A 2YIRA 3HA8A 3NEWA 4FTUA 3WZEA 3A4OX 5DH3A 5F95A 4FIEA 1UU7A 3FMEA 1QPCA 3UNJA 3HP2A 4KSQA 4NT4A 5FD2A 4DFZE 3FXWA 2XK4A 1Q8ZA 1AGWA 4UALA 1UVRA 4YJNA 2WMBA 3COIA 3OY1A 3ETAA 4ZLZA 5FEQA 3MV5A 4HYUA 2WU6A 1STCE 2WMSA 3OUKA 4H36A 4EOSA 3TNHA 1OKWA 4PMSA 2WB8A 3BCEA 5DR2A 2XS0A 4QP2A 2R3IA 1XQZA 4AE6A 4BZNA 4D2RA 4E1ZA 2GU8A 3R0TA 2W1HA 3TDVA 2B4SB 3HMOA 3W18A 3ACJA 4L52A 1U4DA 4NJ3A 2W9FB 4YC8A 4PMPA 1IA9A 1A48A 1BL7A 1JBPE 1JKSA 2PVNA 3GU7A 5IQDA 1UNLA 3FL5A 4LMNA 3HV5A 4YZ9A 3Q9YA 1BYGA 1U54B 4YC6A 2F49A 3GXLA 2C1AA 3R22A 4TTHB 4FV8A 4C4JA 4EONA 3PJ8A 3E5AA 1ZYDA 4C58A 3EFKA 3E88A 5E8ZA 3TJCA 3NS9A 1DAWA 1SNUA 5ETFA 4A4XA 3GC8A 2IVUA 4AXAA 4B99A 2J0IA 2W7XA 4FTAA 3RINA 4LI5A 3CGFA 4G16A 3PFQA 2JIIA 3O17A 2YM6A 4HPUE 5J9LA 3P08A 4AGDA 3MJ1A 4YBKA 3W8LA 2QCSA 4J1RA 2YLFA 2R3FA 1OVEA 5LVOA 4EOLA 2WU7A 3JY9A 4F08A 5IQIA 2Z02A 2XCKA 1CM8A 3I6UA 4C4EA 3ZXTA 2I7QA 5BUIA 3PXZA 4QP6A 4ZSEA 2VTAA 2WOTA 3HL7A 3QL8A 4D4RA 4FUYA 4R1YA 4NL0A 3OCGA 1OKYA 3L9PA 4GSBA 4BIDA 2R3QA 4WNMA 3OP5A 4XG7A 4FL3A 1UNHA 3JYAA 3M2WA 4UZHA 3GFEA 5A54A 2DWBA 2EXCX 3B8RA 4KUJA 4IX4A 4Q9ZA 1CSNA 3CTJA 2XVDA 3R7UA 4UY9A 5EW8A 2B52A 4OTWA 2VWVA 3QZGA 4JDJA 1YHWA 2ZM1A 2YM4A 2PVHA 1K9AA 4XJ0A 5AR3A 4DFYA 2X4ZA 3CPBA 2C5NA 3FZ1A 2ETKA 5JGAA 2IG7A 2VTPA 4AT3A 5HTBA 3F2AA 2WTJA 2Y6MA 2YACA 2C6IA 4AFJA 5C8KA 4E4NA 2VTLA 1GNGA 5KKRB 4DT9A 5L2SA 1FMKA 4BCKA 5LWMA 3GEQA 4FKOA 3ZEPA 2W0JA 4EOKA 2VO6A 5BVNA 2GNGA 4LOPA 1XH4A 4MTAA 4BBEA 5LMBA 5IA3A 2PVLA 3PJ1A 4RC2A 2JAVA 4IC8A 4AOIA 3Q4UA 4UN0C 2JITA 4FOBA 4WOVA 2BALA 4G6OA 3FDNA 4FV9A 2PMNX 5I5ZA 2XK8A 4FE2A 1M7QA 3LM5A 3P5KA 3VBQA 4C34A 2W5AA 2IZRA 3DKCA 5FM2A 5HI2A 4HGEA 2IW9A 3NVMB 2YLEA 4HNIA 1O6YA 2XKEA 3AMBA 4DH7A 3DZOA 4G17A 2JBOA 4DE4A 4USEA 2XNGA 2JIVA 4BKZA 5B2LA 2ZJWA 3S4QA 1TKIA 3OS3A 4FV4A 4E6AA 4NTTA 4EHGA 1WBPA 4DFLA 3C9WA 4C57A 5I4NA 3QBNA 5AR5A 4BDEA 1JSUA 4X2NA 4CQGA 3WIGA 5DN3A 4ANBA 3PDTA 3R8ZA 4BYIA 5CI6A 4KBKA 5DMZA 4UB7A 1IEPA 2VTIA 4L3LA 5FGKA 4K6ZA 4BRXA 5FUTA 1LEZA 2PMIA 4C4FA 4EUUA 3NRMA 5IU2A 2EXEA 4Z9LA 1H08A 4O0SA 4RIYB 3E87A 3GC0A 3R8UA 5AR8A 1QL6A 5FP6A 5KUPA 3FLQA 2I0VA 5AUVA 2QKRA 3MH3A 5EHOA 5BUEA 2W4JA 5EI6A 4E26A 4OBQA 4XH6A 4BBFA 1FQ1B 1VJYA 5E8SA 1GZNA 1Q99A 3D7TA 3BPRA 2B9JA 4IVBA 3BELA 4LG4A 2BIYA 3ZLSA 3ERKA 3D94A 1GIHA 4H39A 3Q96A 3LCTA 4RA5A 3RTPA 2XCHA 5A4QA 1JKKA 3EQGA 4TZRA 2WD1A 5GZ9A 4HZSA 2F2CB 3BRBA 3QTSA 4QD6A 5IQHA 4YTCA 1YXSA 4GFGA 2WTKB 2FA2A 2BRNA 4AT4A 3V6RA 3ID6C 4RIXB 2OIDA 4RFMA 4YLKA 4GU6A 4HCUA 2E9UA 5BX0A 4DG0E 3C4WA 3ANQA 4QNYA 3KRWA 5E1EA 2ZMDA 2R4BA 3K5VA 3LJ0A 4FTKA 4V01A 3GI3A 4BCIA 4X3FB 4K8AA 1JOWB 4N6YA 5E1SA 5DNRA 2R3RA 4APPA 3PIZA 3SHEA 1OITA 4WUNA 4MXAA 3GNIB 1V0PA 2UZEA 4GW8A 4PDYA 2YDKA 4OTPA 3UJGA 4GU9A 5CNOA 2PUUA 4AW1A 4WRSA 3IW4A 3RWQA 4ZXTA 4E5AX 1W0XC 4LM5A 2WMXA 4EH7A 5IF1A 3PE1A 2LAVA 5DRBA 1YXTA 2YIXA 4IAFA 5HO6A 3NNUA 4ID7A 4JDKA 4WBBB 3TTIA 1OECA 1ZOEA 3DLSA 4S33A 4U45A 3FI3A 3BX5A 2UW8A 4ACGA 4BB4A 1FBNA 1XH5A 2QG7A 1HOWA 1KE6A 2FVDA 2UW5A 3P4KA 4N6ZA 4BWPA 2V22A 3V8TA 5A9UA 3P78A 4HPTE 4XV1A 3TNIA 1CKPA 3W8QA 1WMKA 4OW8A 4AN9A 3MY0A 3EFWA 4FKQA 3KB7A 4Y46A 2X2KA 1KWPA 3PVWA 1PXIA 2YERA 4EH9A 3BYSA 3QRIA 5HIDA 5LVLA 2OXYA 2J6MA 2PE0A 3OVVA 3VWAA 2PVFA 2W06A 5C8NA 4ZSJA 2CN8A 2C6MA 3AD6A 3GOPA 3UOLA 4XOYA 3DXNA 2A2AA 3AGMA 4FZAB 5JZNA 1R0EA 4QTEA 1OPKA 5TR6A 5HBJA 4K11A 4GH2A 1KSWA 1QPJA 4FV6A 3S2PA 3KN5A 2WQOA 2ONLC 3CJFA 4W4YA 5DA3A 3PVBA 4FZFB 3B8QA 4V0GA 5CENA 2C5OA 2PE1A 5EKNA 4NH1A 3C4FA 4FG7A 3W1FA 2C0IA 2JGZA 4D4VA 3S00A 1GIJA 2WTDA 3GC7A 2W1EA 2ZV8A 2A1AB 3DB6A 3PSBA 3W10A 3HZTA 2F7ZE 3OROA 3R7YA 4IB3A 4ZTHA 4O38A 5KMKA 4RQVA 2E9VA 3P9JA 3W2QA 2P33A 3NYVA 1IG1A 2FYSA 5L8LA 2BRBA 3MFUA 4BICA 4C3PA 3C0HA 4C33A 4FMQA 3O8TA 4HGLA 3RK5A 5KMMA 3H9FA 3HMPA 3Q4CA 3WARA 4G2FA 2BFXA 4TXCA 4QNAA 3T9TA 4AS0A 3FZTA 3R1NA 4JIAA 3OY3A 4AW0A 4Q5EA 3VHEA 3WOWA 4FR4A 4DLIA 2RFSA 5EQPA 1A06A 3FXXA 4GJ3A 4L01A 2P4IA 3HLLA 3LCDA 1UWHA 4IFGA 1UU3A 3FC1X 4AU8A 4MBIA 4YO6A 3RPOA 2BPMA 3FLZA 3DBDA 3II5A 2C5XA 4G6NA 5HG5A 3ZONA 3SD0A 3ZC6A 4EJNA 4R5SA 4CVAA 5HCXA 2P0CA 4BCPA 3VS7A 3DBQA 2PPQA 1LR4A 3ROYA 1K3AA 4YZMA 3UO5A 1QMZA 4MXZA 3TNPC 1H28A 3RKBA 4I1ZA 5L6PA 2CNVA 4D5KA 4X7QA 4FIHA 1M14A 3SAYA 3KXZA 2DUVA 5AV3A 4C62A 3EB0A 4DBXA 3R1QA 2FH9A 4O7SA 2EU9A 4IX3A 2WOUA 3MWUA 3OZ6A 3R2BA 3U51A 3ZFYA 1ZY4A 2PUIA 3TG1A 3F3WA 2ZB0A 3OOGA 3L1SA 1S9IA 1OZ1A 2RF9A 4GK4A 3N9XA 4D0XA 4FC0A 3AOXA 2GNLA 4ZTNA 5DIAA 3FV8A 3KY2A 4FOCA 3ZZWA 3FXZA 3ORNA 3OHTA 5CY3A 5ANGA 5HD4A 4C3FA 2VNYA 4OBOA 4RJ6A 3DS6A 2O65A 3E3PA 3LJ2A 3PUPA 3PZEA 3QTWA 4I3ZA 4FK6A 5JFXA 1FVTA 2ACXA 1XWSA 1Z57A 5CXHA 5T68A 3UO6A 4MD7E 1PW2A 4DTBA 5AP2A 2NNWB 2Z7SA 1URWA 4X2JA 3VUGA 2FSLX 4N57A 3DV3A 2OZOA 4DEDA 1GY3A 2X8DA 3N51A 4IAYA 3FHIA 3W16A 4IEBA 4ZS4A 3I0QA 5CF5A 2YAKA 4F7SA 1AD5A 5KZ0A 4BDFA 3U6IA 5HD7A 2VGPA 4W4XA 2RIOA 3KMMA 3V5TA 4EH2A 2YDJA 5FBNC 3KXGA 3ENMA 3HV7A 2YWVA 3V5PA 1NVRA 2VWWA 2YABA 3BLQA 3G90X 2OSCA 4R1VA 4U3YA 4YSMA 4D0WA 4FNWA 1BUHA 3KA0A 5IQBA 4RZWA 3MH1A 2RFNA 1OMWA 3NIEA 3U4WA 1SVGA 3Q9WA 5FXQA 3UNKA 1NVQA 2C3IB 3VUDA 1MRUA 2WMAA 1OM1A 1W82A 5AM7A 3N4VA 2VTQA 3F7ZA 1BLXA 2I0YA 4HYSA 4AZFA 4EHEA 5IDPA 5LVMA 3QKKA 3G5DA 4U97A 2ETMA 4ITIA 4W4VA 3UYSA 4H3QA 3V3VA 2GSFA 3OTUA 4C59A 2ITWA 5CVGA 4ENXA 3FKNA 5C8MA 4D2TA 4DG3E 2XEYA 4UXLA 3OW4A 4FKVA 2VX0A 2WEIA 5TOZA 4BDHA 3DBFA 4KWPA 2JFLA 4C4GA 4DGNA 4YLJA 5CANA 5CSXA 4JL9A 2WTIA 3QUDA 2YIQA 2EXMA 3VBYA 2KTYA 4UXQA 3TIZA 4FKIA 1WBSA 3ULIA 4DHFA 4J53A 4XP2A 4IDTA 5AP4A 3RPRA 1TQMA 2XK3A 5J7HA 3ORLA 3MPTA 2PZYA 5FXSA 4IWDA 5EHLA 3D4QA 3FQHA 5FEEA 4B4LA 4CEGA 4E5BA 5I9XA 4DCAA 3QC4A 4MAOA 2CN5A 3R28A 3OCBA 4QRCA 4O27B 2ZAZA 2ITVA 5E90A 5HNGA 2XRWA 3BYUA 4FKJA 4QP8A 5I3OA 4BDDA 3M11A 2QOLA 4O0YA 5LVPA 4OLIA 1PXLA 3IO7A 3ZZEA 5EYMA 2FSTX 2IZUA 3SW4A 2PMOX 3Q04A 4BIBA 5IA1A 3ZU7A 2PK9A 4Q5HA 2WMUA 4O21A 2V55A 3DBCA 3EOCA 4QYFA 4GT5A 5AX9A 4F99A 3COMA 3OUNB 4IJPA 4O2PA 2W96B 4B8MA 4C8BA 4KRDA 5I9VA 3Q9XA 4F7LA 3A7GA 5IEYA 3TZ8A 2F4JA 5J9YA 3LFEA 4I5PA 3HDMA 2LGCA 4DITA 5K0XA 3BIZA 5ICPA 3TV4A 5HE3A 3JS2A 4K2RA 3LXKA 5LQFA 2OJJA 2WIHA 3QC9A 3QZFA 4LGDA 3SXRA 5CAVA 3TUBA 5BVKA 2BAJA 1MRYA 4NM3A 2ZM3A 2ITUA 4MBLA 2HZ4A 3TKHA 4MVFA 1PXJA 5D10A 2IJMA 4ZY6A 3TKIA 4KIQA 3QRTA 2A0CX 5EKOA 2GQGA 4RLKA 2QOFA 4CV8A 3PPKA 4LGGA 3UG1A 1P2AA 2WO6A 1NY3A 3KKVA 3FLWA 4FKTA 2OJGA 3UO4A 4EK5A 3DBEA 2JAMA 5IMEA 3LFCA 3PPJA 5C01A 2J0LA 1SNXA 3V01A 3DPKA 1FMOE 3DAKA 4RWJA 2R5TA 2ZYBA 3H3CA 4GT3A 5AX3A 4NWMA 1ZAOA 3B2WA 4MNEB 4BHNA 3QU0A 3SW7A 4PL3A 3LMIA 1YRPA 1Q41A 2QC6A 1ZYJA 5IQCA 5M57A 4WNKA 3QD3A 2RSVA 3I1AA 3QX4A 4XBRA 4E6CA 3DLZA 2G9XA 4LUEA 4W8EA 3JXWA 3P7AA 4GUEA 4AW2A 4LUDA 5C4KA 4JAJA 4DTKA 3SVVA 4NEUA 3RALA 4HW7A 1PXKA 4ZAUA 4Y73A 2WQBA 1F0QA 1GZOA 5K9IA 3QQHA 3G15A 2UZWE 4TYJA 4ACMA 3MFSA 2VX3A 1M52A 3CXWA 4G5PA 3LFSA 4A4OA 5KCVA 3RK9A 4FEXA 3LXLA 3AT3A 1J7LA 4TWCA 3AT2A 4QMUA 1YI3A 5DRDA 4AQCA 4MWHA 3MGYA 5L2TA 4OTFA 5FM3A 3HX4A 4NKAA 1TVOA 4LGHA 4AOTA 3T9IA 4EEVA 1J1BA 4FSZA 4ZZMA 3VJOA 5GIOE 2J51A 4O82A 4L46A 4GK2A 4F63A 4BDGA 4F6WA 5IQEA 5JRSA 3C0IA 2BVAA 3VAPA 4E7WA 3A60A 5J5TA 3VS6A 1JWHA 3R7EA 4FSTA 2PY3A 1ZYLA 2J9MA 2Y6OA 2IVTA 3EWHA 3Q4TA 4FTLA 1PXOA 2Z7LA 3I4BA 3G33A 4CFNA 5CEPA 3AQVA 2QOHA 3WF5A 4YU2A 4BI0A 3O51A 5KBQA 2VWZA 4LL0A 4C3RA 4PDPA 3QQFA 2B9HA 4ZMEA 4R8QA 3U6HA 2BFYA 1YDSE 3NWWA 2ZV2A 4I4EA 2QOIA 4ACHA 3FLYA 4K9YA 4QMLA 2HXLA 4FKWA 4XV9A 2J90A 3F3ZA 4B0GA 3EH9A 3H10A 4G31A 4QMWA 4ZJIA 2C0TA 3PPZA 1Q8UA 5EI2A 2HZ0A 4AP7A 2OXDA 4OT6A 4XG6A 2C0OA 1XBBA 2QOOA 1PJKA 3CCNA 3A8XA 3R01A 3L9MA 4LOOA 2QHMA 3O8UA 3QTRA 2WQEA 5IUHA 3D0EA 5M06A 3HNGA 5C9CA 4FSRA 1SYKA 2OIBA 1WBNA 2OJFE 1JLUE 2I6LA 2UW7A 4QYYA 5BVDA 5HVKA 4HYHA 4AF3A 1WVWA 3RAKA 4M0ZA 4D1SA 4L00A 3NSZA 5HLPA 4FSWA 3ATSA 4F6UA 3JR1A 3U55A 3MPAA 4D4SA 2VO7A 4RJ7A 4ZY4A 4ZMFA 4TYEA 2W17A 3BHUA 4I24A 3E8DA 3PXRA 3RCJA 4AA5A 5HEZA 3UVQA 4BTFA 4I0RA 4UMRA 3AC5A 1JVPP 2WQNA 1NA7A 3C5IA 1YKRA 5ANJA 4FKRA 3C7QA 4JR3A 5F1ZA 3HEGA 2Z7RA 4FNXA 3L8PA 3MJ2A 5DPVA 4IZ7A 4FL1A 2PVJA 1YHVA 3FE3A 3ZUTA 2J4ZA 4HVDA 4ZZNA 5LARA 2ERKA 5JT2A 4O0XA 1XBCA 2UZOA 4UBAA 4MXOA 1W8CA 3MY5A 3KF7A 4FSYA 3BQCA 5FP5A 4CMOA 4FSUA 4QP4A 3HA6A 5E8TA 5LJJA 1ATPE 5D41A 5J8IA 4PF4A 4YZBA 2QOQA 5B7VA 3LJ1A 3NNVA 4C37A 4X3FC 3VS2A 4RPVA 4H3PA 5D7VA 4DEAA 4XHKB 2QVSE 3LFAA 3L8VA 2C47A 4P90A 5DEWA 4C0TA 4UX9A 4GUBA 5D9HA 3PWYA 4M69B 2CNUA 5CU6A 3NPCA 5F4NA 4BVUA 4W9WA 2BRGA 1BI8A 4HZRA 2QR7A 4QQ5A 4XCUA 4QT1A 3IOKA 1GJOA 2HAKA 4E4LA 4WO5A 5KHWA 5AUZA 1GOLA 4KAOA 5KX8A 5JSMA 5A3XA 4O2ZA 5G1XA 5EHYA 3A7HA 4I5CA 3BGQA 5CS6A 3DJ7A 3F5UA 5DT3A 2YDIA 3WZJA 4BL1A 4CFVA 4AE9A 2B55A 3F7WA 2H96A 3I0OA 4MNFA 4NKSA 5HX8A 4P4CA 4I0TA 4USDA 4ZOGA 3VF9A 2BZHB 4FTNA 5AAFA 1Q8YA 4CT2A 3FSFA 4ANOA 2VGOA 3FSKA 3E92A 4AG8A 5T3QA 3QTZA 2BHEA 5ACBC 1H24A 1LEWA 2W1GA 2HWPA 3UODA 5KHXA 2Y9QA 3C4EA 1W7HA 4B9DA 2B0QA 5IQFA 3WILA 1ZWSA 4CMTA 1UWJA 5CAPA 2G2HA 2QI8A 4F70A 3RMFA 3IG7A 4FODA 4QTBA 3ZFXA 2XH5A 3AXWA 3H9OA 3PRFA 4PL4A 2XJ0A 1VR2A 3ZC5A 5DE2A 4CFXA 1XH6A 3F69A 4EWQA 5M4CA 2W4OA 4FT5A 4RX9A 4IM3A 2RG6A 3RPVA 4RVKA 3UZRA 4EOIA 1O9UA 1R39A 4RJ4A 3PP0A 3MVJA 3ZO3A 1W98A 2H8HA 3E8NA 1P4FA 2W1ZA 4FT7A 5J87A 3WZUA 4M3QA 5A4EA 4LQMA 3BZ3A 4IVAA 2H9VA 3NLBA 4YLLA 3UPXA 5JFWA 3PXQA 3NCZA 5FBOA 1TQIA 1RDQE 3LFQA 5E8WA 3OXZA 5AP1A 4ALWA 2H34A 4DEEA 5BVFA 5LCJA 3DNEA 4AOJA 1CKIA 3Q52A 5CSWA 3D5UA 4ONAA 3LFNA 5JGBA 1Q4LA 2UZBA 4FTTA 4PTGA 4EOMA 4FA2A 3KULB 3FZSA 2ZM4A 3FMLA 4L45A 5HICA 3VRZA 1RE8A 5AADA 2GHGA 4R3PA 4J8NA 3R7IA 3REPA 3ORIA 4DLJA 4K77A 4YMJA 3D2KA 4I6HA 4RFYA 4A06A 4ACDA 5BVOA 4O83A 4BDIA 4IVDA 4YJOA 3FQSA 3NAYA 5FG8A 2WNTA 3V6SA 2FGIA 4X2FA 5DR6A 1V1KA 4QTDA 2P2HA 4I41A 2JLDA 4HVSA 5EW9A 5AV4A 3MESA 3E93A 4WNPA 3SX9A 2O64A 4F0FA 3G9NA 5M55A 1EH4A 2PTKA 3KN6A 4Y5QA 4BCFA 2B1PA 4IBMA 4M84A 4NK9A 2OF2A 4E6QA 1IAHA 5FWKK 4B6LA 1VZOA 5IQAA 4XRLA 3IGGA 3HAMA 3UMWA 2O63A 4CKRA 2HWOA 4AN3A 4ACCA 4C02A 1UNGA 4TL0A 3SV0A 4BN1A 3WF9A 2XNNA 4YZDA 4MXCA 3EYHA 4KD1A 4ASXA 3F61A 1H1QA 3HKOA 4GG7A 4UZDA 3QCSA 4LRJA 3DDPA 3GCVA 2BRMA 1H1PA 2P55A 2XIYA 5A6OA 4L8MA 5I0BA 1GAGA 3FQEA 4FIIA 4IZAA 4KBCA 3NNXA 5J1WA 2PZIA 3R1SA 3OWPA 4DFUA 1UV5A 3QWKA 4CYJA 2C6KA 4CYIA 1JAMA 3ZEWA 4K0YA 4F9AA 2WEVA 5BNJA 4RVTA 3I5NA 3WF7A 3A99A 3VIDA 3QTIA 2F7EE 3POOA 4U40A 2OU7A 3PSCA 3F5XA 1FGIA 1M17A 4BTMA 3PE2A 3R8MA 1F3MC 3AC3A 4BDBA 5AR4A 4IWPA 4PNKA 4DG2E 1JPAA 3SXSA 3C1XA 2YA9A 4TN6A 2ESMA 4EHVA 4EZ3A 4DA5A 4S31A 4FKPA 4KIKB 2HYYA 3R7VA 4O81A 4K18A 4FK3A 2GNJA 2UVYA 4FL2A 2CPKE 4OTRA 3ZDUA 2PU8A 1X8BA 3K3IA 2YHVA 4RSSA 2UZDA 5LMAA 2GNIA 5M4FA 3NX8A 3IDPA 4YC3A 2OG8A 3MIAA 4ITJA 4MF0A 1WAKA 4YHTA 5EFQA 5K4JA 3SGCA 4B8LA 2WAJA 3GU5A 1P14A 2CNQA 3QRKA 2BMCA 5C03A 1UA2A 3VBVA 4YO4A 4BR3A 2E2BA 4X21A 3QQGA 2PSQA 4FTJA 1U46A 4IDVA 2HW7A 4WIHA 5IA0A 4RZVA 3AD5A 4A9UA 4CD0A 5L2IA 3F5GA 4IAKA 3BGZA 3DK6A 1FPUA 2I1MA 4JQ8A 3SA0A 3VUKA 2OJ9A 1Q24A 3IECA 3V5WA 2J5FA 3NYOA 1FVRA 4CRLA 2VTOA 4R7IA 1H27A 3RNYA 4DEIA 3UE4A 4DF3A 1V0BA 3DAJA 4TYGA 3VJNA 3ZFMA 1CKJA 4AW5A 1WBOA 4MXYA 4YJUA 4J95A 4M66A 4ASZA 5I9UA 2PUNA 3CBLA 4Y85A 3LFDA 4ANQA 4FBXA 3BWFA 3QUPA 1ZYCA 4AFEA 2BCJA 3PVGA 3R9NA 3UGCA 2Y4PA 3GENA 4TW9A 2BRHA 3EQFA 3UQCA 1WVYA 4M12A 1B39A 3FMJA 2R3OA 4AZWA 5DT0A 3H30A 3KCFA 4WG4A 2DYLA 3I81A 5JRQA 1XH9A 2OGVA 4QP1A 2UW4A 4G3GA 3UTOA 4HVHA 3LFBA 3EKNA 3POZA 4F7JA 3AC8A 4PPCA 1J7IA 2XNEA 4HVIA 3LLAA 3CTHA 1YHSA 1PMVA 3HRBA 3QKLA 5AAEA 3EFJA 4KKHA 4OTIA 5HLWA 3A7IA 1H1SA 4ZEGA 4I92A 2ZVAA 3EL8A 4HNFA 1L3RE 3MA6A 4BGGA 4U7ZA 2DQ7X 1PRYA 3QAME 1Q8TA 5GJDA 2F2UA 3RCDA 3FMKA 5IPJA 4EBVA 4PPAA 5L8JA 1YOMA 5J5SA 5E92A 4O91A 3TIYA 3VUHA 3NUUA 5DI1A 5CSPA 3ATTA 4O7YA 2C1BA 4DEGA 4EK4A 4Z16A 4IE9A 1WBVA 3ALNA 5CU4A 4FSNA 4Z55A 5HU9A
chains in the Genus database with same CATH superfamily
3VRYA 2VX1A 4OGRA 2JKKA 3QQUA 5HVJA 2XBJA 4X2GA 3VS4A 3U54A 3MFRA 2YIWA 4EOOA 2QONA 2W05A 3TTJA 3K54A 3PTGA 4YJVA 1REJA 3PWDA 4R7HA 4Y72A 3FEGA 3E8CA 2VO3A 4QMXA 2XK7A 2XNBA 3NUSA 2DS1A 2QO9A 3DJ5A 3OT8A 1P4OA 1U5QA 4KS7A 4CXAA 4F1OA 2YM7A 4JLCA 2W1DA 3FMHA 5LWNA 5A46A 3LMHA 1KE8A 3OW3A 5HCYA 4F7NA 4H1MA 1U54A 5EW3A 4WBOA 5IH6A 3TNWA 3ZLWA 3UIUA 4GG5A 2IZTA 2Z7QA 4FKSA 4XG3A 1YW2A 2WTVA 1IASA 4ORKA 4U6RA 5AP3A 3LE6A 3RM7A 5FDXA 3ZRMA 4C35A 1OIYA 3EL7A 3RPSA 4FV1A 4RX8A 5HHWA 1XMLA 3A61A 3O2MA 2OICA 5JN2A 3TZ7A 1E1XA 4KSPA 2Y8OA 4D1XA 2J50A 4S32A 4KKEA 2OBJA 1M2QA 3PZHA 2CGVA 2QOKA 3B2TA 5DYJA 3VBWA 4Y83A 2V0DA 3IW5A 4I94A 2NO3A 4JVGA 2X9EA 3ZSGA 4BF2A 3BLRA 3UP2A 5AA9A 5M51A 3IW8A 2BROA 3AC4A 3IOPA 4JDHA 5TO8A 3TACA 5KMIA 5IG1A 4YZNA 3V5JA 4FZ7A 4I22A 4LV8A 1OKVA 2EVAA 2VTNA 5C1QB 2XK9A 4FGBA 3UOKA 2Z60A 4R77A 3M1SA 3DOGA 5IUGA 2XRUA 3V04A 4LRMA 3EFLA 3F2RA 4BZOA 4FICA 4I5HA 2GDOA 2WXVA 4A9YA 4EK6A 3HGKA 4C4IA 3MB6A 3TZMA 1B6CB 1DI8A 3HUBA 2G2IA 3TMOA 1H26A 4FTOA 3LIJA 4YJQA 3U9NA 2PL0A 4FNYA 5J79A 3ULZA 2J5EA 4UMPA 3R1YA 4I5MA 5K3YA 3FY2A 4GK3A 4IB0A 1KV1A 5K5XA 4ZTQA 4M67A 5AM6A 3UDTA 3QD2B 4BJJB 4E20A 4NIFB 4FV3A 4RJ8A 1PYEA 4AT5A 4U43A 4P7EA 3NUYA 4FTQA 5M44A 4DH8A 3AC2A 3ZTXA 4CCUA 4X6RA 3KGAA 1FGKA 2W99B 3EZRA 5ITAA 3TYKA 4TY1A 1QCFA 5IKWA 1YWRA 4CZYB 4EH3A 1OIRA 2CCHA 3RWPA 1PXNA 2GCDA 3L9LA 2OO8X 3HRFA 4CFMA 3DGKA 3WIKA 4G3CA 4DGMA 5DG5A 1XR1A 3U9CA 4IWOA 5DLSA 2CSNA 4II5A 2XIXA 2QLQA 3LW0A 5JFVA 2GPHA 4J71A 2CGWA 4BCHA 5E8XA 4C4HA 1URCA 3BYVA 3R02A 1G8SA 3AG9A 5FXRA 4ZSLA 4YR8A 2ITTA 5HORA 4Z7GA 4A4LA 1WVXA 3JVRA 2UW0A 4YJSA 4EWHA 4UWCA 5EQYA 2HENA 3ORXA 2IN6A 3T8OA 4N4SA 3PA5A 5EH0A 5GJFA 3BU6A 4WG5A 3RHXA 3JPVA 3IGOA 1DI9A 3R30A 2WMVA 5EDRA 5LOHA 3CKWA 4RIYA 3GGFA 2IZSA 4GRBA 4NM5A 4MKCA 4QO9A 4QP9A 3BBTB 5DBXA 2VZ6A 5DR9A 4L43A 3MBLA 2XBAA 3QRUA 3MVLA 3F3VA 2XANA 5J95A 4CTCA 2BUJA 3KXXA 4H58A 4M68A 4G9RA 2NPQA 2G2FA 4UYNA 3MTLA 2B9IA 4QDEA 2YCQA 4FTMA 4MD9E 5CASA 3CS9A 3EYGA 1ZYSA 5AUWA 3OBGA 5GIPE 2WELA 3LZBA 2PZ5A 3KMUA 3ZYAA 2WHBA 5IH4A 3NUAA 2Y7JA 1BX6A 3DFAA 3OBJA 4RIXA 2BAQA 3R9OA 3RZFA 4R7BA 5LMKA 3SLSA 3TNQB 3O0GA 2R3MA 3PG1A 1OL5A 3KVWA 4AA0A 3MW1A 3FYJX 3VS3A 3ML1A 1B38A 4L6QA 5JQ5A 4QMZA 5EI8A 3GBZA 4O22A 3WZKA 4O7ZA 4QQTA 4O7VA 2PZPA 4PNIA 4Q2AA 1OBGA 3W0OA 5EYKA 4EK8A 2PYWA 2WKMA 2VWXA 4X3FA 2Z2WA 4AZVA 4EOJA 4EKLA 2C69A 4FI1A 3DU8A 3QZIA 4RIOA 3P7BA 4FV5A 1YI6A 3GQLA 2YM5A 4CZTA 1YDTE 4DGGA 3OC1A 5CAOA 3KK8A 4L67A 3KU2A 2R3JA 3UZTA 3I7CA 3ZRLA 3BGPA 2WIPA 3O96A 3R9DA 3TKUA 4FNZA 3UQGA 4FV2A 4GFOA 1PKDA 4CQEA 1PF8A 2YN8A 1GIIA 3COKA 3NNWA 4F9BA 3BV2A 1ZMUA 4GYIA 3D14A 4EH6A 1G3NA 3BBWA 3FBVA 3RHKA 1M2PA 2CKOA 2HW6A 4X0MA 5JQ8A 4GCJA 5JKGA 4ASEA 4OTDA 2SRCA 4J52A 4MBJA 4TYHB 5L2QA 4QMSA 3V8WA 2E9NA 3LVPA 3MSSA 3BWJA 3ZXZA 4EUTA 2IW8A 3D83A 5HU3A 2ITXA 2VWYA 2OZAB 3WE4A 2PVYA 1S9JA 3OMVA 3KCKA 3OTVA 4IH8A 5M53A 3KIOC 3L8XA 4RIWB 4TWPA 3TUCA 5LCKA 4M13A 2X1NA 3SRVB 4L53A 3ZMMA 3DKOA 4BDJA 5CAUA 3LXNA 4XP3A 3P23A 1ND4A 4UV0A 4V05A 1LPUA 1WBTA 3CQWA 5H8GA 3GVUA 2W1FA 3BEGA 4WRGA 4CCBA 4CZUA 4ZY5A 1NT2A 3HMNA 2WZJA 2IPXA 4RBLA 3Q6UA 3V51A 5L2WA 1ZARA 4U79A 4GKHA 4QMOA 2XMYA 3LLTA 3R21A 3NUXA 3DKGA 2C30A 5AV0A 2WMWA 3AD4A 3DKFA 3KRLA 4CMUA 4TNDA 4V04A 3UQFA 3ENHA 1VLRA 4GFMA 4AZSA 5FTQA 2GHMA 3P86A 1KE5A 2GS7A 2QNJA 4NM0A 4A9TA 3W2SA 1J7UA 3W0SA 2JEDA 4BY9E 2EB3A 4YTHA 4NUSA 4DH3A 2XF0A 4FG9A 2A27A 2OXXA 4ZP5A 4OTGA 3ZUVA 1G8AA 2QOBA 3ORTA 4ZSGA 2JDVA 3UDBA 3D15A 3GC9A 3DY7A 2XUUA 2VU3A 3FMMA 3PP1A 4NW6A 5FDPA 4EH4A 5E4HA 4FVPA 4XG8A 3VS0A 4QMQA 3CD8A 2X7FA 2B53A 3GU8A 3CJGA 2REIA 2WQMA 4O7RA 4PQNA 5JZJA 4I20A 1PY5A 5CXZA 5EQEA 4IX6A 4I4FA 5TF9A 4MYGA 2GQSA 4TKSA 3FZRA 4U8ZA 3R73A 3GCPA 3OG7A 2BTRA 3ET7A 4FGRA 4L44A 2VD5A 1J91A 2PMLX 1PMEA 2ZDTA 3AKLA 3P5JC 2G01A 3A7JA 4G3FA 2EWAA 2PZRA 3HECA 1ERKA 4KA3A 5FTOA 3UYTA 3FPMA 3F3UA 3F66A 4DBNA 2C6LA 3IW7A 4FEWA 4CT1A 2RKUA 4PX6A 5HTCA 2BAKA 3W55A 2P2IA 4WKQA 3QCYA 4NZWB 2X2MA 4DYMA 5C27A 5GZ8A 4K1BA 4CFFA 5AIKA 3QYWA 5EDQA 2B54A 2E9PA 3F2NA 3FYKX 5K5NA 5LXMA 3RK7A 2QO7A 3BHTA 2OLCA 2Q0NA 1Z5MA 4D55A 2C6TA 4AXEA 4UWYA 4E3CA 3ZDIA 2HZIA 4MH7A 2GMXA 1HCLA 1E1VA 4CFWA 4CKIA 3HMMA 1Q61A 5IMXA 3G2FA 3E7VA 3Q5ZA 3UIXA 3KF4A 5D12A 4YPDA 4NU1A 3TEIA 4AGUA 4M15A 4S2ZA 5ANOA 3SOCA 3OF0A 5CSHA 2UW6A 1H8FA 2OJIA 3KFAA 3QHWA 4L42A 4S34A 4U41A 3UC3A 3VQUA 5HO7A 5I9WA 3Q2MA 4CG8A 3TT0A 5EM8A 4BI1A 1XO2B 4EQCA 1I44A 3MVMA 5E8VA 4JRNA 5AP0A 5B2KA 5AA8A 5A6NA 2C3KA 2UZUE 2JDOA 5BYYA 3ZLXA 4AUAA 4PV0A 3PRIA 4P5QA 5CEMA 3C5UA 3IS5A 3DAEA 3NUNA 3MH0A 2WFYA 2YZLA 3NGAA 3PJCA 5DT4A 3UP7A 1AQ1A 2UZTA 3OWKA 3H0YA 1J3HA 1ZXEA 2FUMA 5HG8A 2IVVA 4AWIA 3CLYA 3SXFA 4XX9A 5GHVA 5EM7A 4GMYA 1OIQA 4F64A 2YJSA 3BV3A 1RW8A 4HCTA 1JQHA 4IVCA 4WD5A 4O0RA 3NAXA 4PPBA 2X7GA 4R6VA 4JIKA 4GS6A 4PWNA 3FZPA 4GIIA 4YHJA 3O71A 1FOTA 4ZTSA 4WA9A 4HYIA 5BYLA 1XJDA 4NFNA 4ZTMA 2JFMA 1YI4A 3Q6WA 4BC6A 5HIEA 2EB2A 3F3TA 3FI8A 4A7CA 1Z9XA 2VN9A 2Z8CA 4KRCA 1OL6A 3R8PA 2UVZA 3EN9A 4M8TA 4GIHA 1I09A 5BYZA 2BTSA 3A4PA 4U0IA 1KOBA 1OUYA 2XZSA 2NYAA 5AJQA 2BZKB 3BU5A 4JG7A 2GFCA 5HKMA 4QQCA 3UIBA 1XH8A 2RFEA 4RVLA 1YXVA 4BIEA 3UBDA 2A4LA 3PIYA 4TYIA 5DEYA 3OT3A 5I9YA 3TV7A 4G9CA 4UWBA 3A7FA 4RWLA 2C6EA 2OK1A 3O7LD 4AAYA 2W9ZB 2XK6A 1O6LA 3ZBXA 4U80A 4KKGA 4L68A 4UMUA 3N4UA 4N0SA 3E8EA 4EKKA 4J99A 1DAYA 3RBWA 5J1VA 3OWLA 3TL8A 4BDAA 5KMJA 1U59A 3KXNA 3BKBA 4XS2A 1Q8WA 4MHAA 3RI1A 5M4IA 2PE2A 3W2OA 3ZSHA 1CMKE 4RIWA 3N4TA 3MI9A 4D28A 2VNWA 1XHAA 3QQKA 4I0SA 4JS8A 4OTQA 1OUKA 3D5VA 4PTEA 5L6WL 4IW0A 3EHAA 5JGDA 1KUTA 3UIMA 1M2RA 2J0JA 3PA4A 2HOGA 3UOHA 1V0OA 4H1JA 4ANSA 4DEBA 4FKLA 3VULA 1M7NA 3GCUA 1VYWA 3IQ7A 5GINE 4L7FA 4QMPA 3UPZA 4XV2A 5AUXA 3ZO4A 2XALA 1IR3A 3DJ6A 2GS2A 3S95A 2Y4IC 4IZ5A 3TJDA 2PUPA 3IDBA 4PMMA 3Q9ZA 1OGYA 1ZOHA 3U87A 4LFIA 5AV2A 4IACA 4DGLC 2BZJA 3K3JA 5EYDA 1Y6AA 3W33A 3W0QA 3TN8A 3G51A 3MVHA 2WTCA 2O2UA 1K2PA 1RQQA 2IEWA 3LQ3A 1A9UA 1IAJA 5HNIX 5E7RA 4DDGA 2I40A 4P5ZA 4WUAA 4WT6A 4ZS0A 3BI6A 2H6DA 2HXQA 3PYYA 3MYGA 5ANDA 3SOAA 3W32A 4YNEA 4FTRA 2O5KA 2OI4X 3E63A 2BZIB 3EZVA 3MPMA 3OFMA 4IWQA 4M0YA 4MNEA 4QP3A 3SDJA 4ZJVA 5IISA 1Y6BA 4Y5HA 3KREA 5ANEA 2FO0A 2X81A 2XJ1A 5AWMA 4H3BA 5AP5A 3VUMA 4BI2A 3LAUA 1Q62A 4DTAA 1E9HA 4RC4A 3D7TB 4TWOA 3AGLA 3NW7A 5CYIA 1UU9A 3DT1A 4KABA 4HCVA 4BFMA 5CWZA 5I3RA 3KRXA 4I6FA 2BDJA 2C4GA 3CY2A 4EL9A 1MRVA 4YTIA 2B9FA 4XUFA 4BHZA 5M09A 1YVJA 4J96A 5D1JA 4J97A 2ONLA 3R00A 2ITQA 3EQCA 5HBHA 3UNZA 3ZM9A 3KRJA 3HMIA 4DFXE 2R3LA 4G3DA 2QLUA 5EYCA 4BWXA 1OL1A 4CLJA 4DFNA 5JEBA 3W2PA 4AXFA 4E73A 4O0UA 4QEBA 2VTMA 2XIRA 4NCTC 1YWVA 5DGZA 2R0UA 3GFWA 3AMYA 5AMNA 2OF4A 3ORPA 4O84A 2CGUA 5CNNA 3P0MA 4Y8DA 5ETCA 4RG0A 3PG3A 3WBLA 4GYGA 2HY0A 4JR7A 5H8BA 2YZAA 4FV7A 4J7BA 1YXXA 2VO0A 3NW6A 3PY3A 2G1TA 3QWJA 4BZDA 4KNBA 4KS8A 2VTSA 4DCEA 4ERKA 3QTQA 4KINA 4QMMA 3F82A 4U81A 3R83A 3F9NA 4X2KA 2GNHA 4UEUA 3F5PA 2QURA 5DOSA 2RL5A 1UKIA 5FQDC 4O0VA 3WF6A 4O7LA 1R3CA 3GCQA 4O86A 1GZ8A 2I0HA 5E8UA 4L3JA 4C61A 2R3GA 4O1PA 4E5WA 2ITOA 5JH6A 4I23A 2C5VA 5CT0A 2J7TA 3QUEA 3DB8A 3TUDA 2OFVA 3DA6A 5B2MA 5DFPA 2CDZA 2JKOA 5L6OA 4XG2A 2XJ2A 4F9YA 2VTHA 3AKKA 4A9SA 3LXPA 2QKWB 4XLIA 5CF8A 4JBQA 2OFUA 2YCSA 4BCNA 3MH2A 2R2PA 2YCFA 4AZEA 4TRLA 1OB3A 3EQPA 3A8WA 3Q32A 2QU6A 3Q60A 3R7GA 5KZIA 2KULA 4V0GB 4O6EA 3VNTA 1YOJA 2JIUA 1SVEA 2HCKA 4JBPA 3DK7A 3GOKA 3BYOA 3FLSA 5BQ0A 3FI4A 1Q3DA 4EH8A 4ZJJA 1BI7A 4D9TA 3TWJA 5CQWA 1RJBA 4KBAA 4CGAA 4GVAA 2X0OA 4IADA 4PP9A 4MEDA 3MN3A 1BL6A 3W2CA 3PXYA 5HGIA 4JQ7A 3QD0A 3ZCLA 4DGOA 3SC1A 4F4PA 2HY81 4RX7A 3V8SA 2V7AA 4GV1A 4YSJA 4ZTRA 2GTNA 5M56A 4TT7A 4PMTA 4FUXA 1H0WA 1Q97A 1R78A 5L8KA 3HAVA 3IONA 4UYAA 2JKMA 3MFTA 3OCTA 5B0XA 5HBEA 2R9SA 4EQUA 3U4UA 5I9ZA 1H07A 3ZRKA 4NW5A 2J0MB 4XEYA 1JKLA 3CEKA 4NSTA 4QPSA 4M69A 4S30A 3LM0A 4DH5A 2VRXA 4MWIA 4UMTA 3D5XA 4U44A 1JNKA 3EN5A 4BWKA 3F6XA 3BE9A 3KXMA 3SG8A 2A98A 2NRYA 3H0ZA 2AUHA 3VO3A 2W1CA 4YBJA 1YWNA 4D2VA 3TDWA 3QCXA 1KE7A 1Y8YA 4ALVA 2RG5A 5TE0A 2O3PA 5AUUA 3ODZX 3WE8A 5CZHA 3K2LA 4IB1A 2WMQA 4LYNA 1YXUA 3KQ7A 5BVEA 4F9WA 2UVXA 4YP8A 5HVYA 4Z3VA 2GQRA 3MIYA 3O7LB 5EM5A 1UKHA 4AA4A 4ENYA 4GJ2A 2VWBA 4YNOA 5HESA 4C7TA 3H9RA 3Q53A 3ACKA 3AC1A 4YPSA 3VW8A 3LOKA 1T45A 3OWJA 4C2VA 2YJRA 5D11A 2JDTA 4DEHA 1LUFA 3QKMA 4D58A 2VUWA 2O8YA 3CR0A 5AUYA 4TPTA 2FB8A 2V5QA 4OR5A 5CF6A 3EQBA 3AT4A 2OH0E 5HOAA 3R8LA 4XG9A 3H4JA 3VUTA 3RAWA 2YWPA 4JT3A 4JBOA 4D2SA 3QQJA 2GNFA 5IZFA 2R3PA 5IA5A 1OPLA 2VWIA 4XV3A 4O6LA 4E4XA 4F6SA 3DXQA 3ODYX 4FT3A 3QCQA 4AXDA 4F65A 4ZTLA 1SZMA 1MQ4A 3F88A 4QYHA 1OIUA 2WPAA 3FJQE 2R3NA 4PDSA 3Q3BA 5BVWA 3PUFC 2YAAA 5M08A 3ANRA 3KULA 1G5SA 3ZSIA 2G15A 4ZLYA 3L9NA 4UMQA 1U5RA 4YHFA 1PMUA 4MCVA 4NJDA 3FLNC 1ST0A 2Y4IB 3V5LA 3TXOA 3NYXA 1XH7A 4PTCA 5C4LA 4KIPA 1Q3WA 3ZLYA 3GCSA 1ZZLA 4RC3A 5FRIA 4QYEA 4JJRA 3CSVA 3HV3A 3DXPA 2WMRA 1F5QA 3QQLA 4JG6A 4FYNA 1PHKA 3BHVA 4FT0A 4YZCA 2WMTA 4XP0A 4IAAA 5T6KA 5C26A 3DZQA 3IDCA 3CIKA 2PULA 4ZK5A 4ITHA 5CU3A 5A4LA 3EQRA 3M42A 5AEPA 4DT8A 1SM2A 3JVSA 3UVRA 5AP6A 1H1RA 3A62A 2BDFA 3T3VA 2GTMA 4F1TA 3QFVA 3VBXA 3QD4A 3ZUUA 4YJTA 2XM9A 4BTJA 4O0TA 4O96A 4XYFA 3QALE 2IO6A 3DTCA 3DFCB 3L8SA 3QA0A 2VV9A 4OTHA 4AAAA 4DN5A 5HCZA 5HX6A 1VEBA 4IHPA 3FL4A 2YITA 3HDNA 1QPDA 4FIJA 4OT5A 4QYGA 3W0RA 2ZMCA 3O50A 4WSYA 3LPBA 4I93A 4XNEA 2QG5A 4YJPA 3ZOSA 4MQ1A 3EMGA 3NDMA 4DINA 5JMSA 5M07A 4FEVA 3GT8A 4AACA 3LMGA 5BMMA 2XNMA 4RMZA 5EM6A 3CD3A 4EYJA 2CGXA 3I6WA 4NM7A 3G0EA 3DNDA 4LL5A 3QYZA 4EQMA 4R78A 3GUBA 4W8DA 5CEIA 4GKIA 4M97A 3S1HA 1Y57A 2F57A 4QP7A 2CHLA 3R8VA 2B7AA 5EOBA 3VS1A 4AZTA 4EZ7A 4F0IA 3DQXA 3P7CA 4KIKA 2IWIA 4RQKA 2X6DA 2AC3A 2V62A 4IM2A 5KMOA 3IW6A 3KL8A 4I6BA 1SMHA 5HE0A 2W5HA 2C3JA 4GEOA 5AIRA 4ANNA 5DWRA 4EOQA 3SKCA 1R0PA 2NRUA 2R3HA 3UZPA 4ZLOA 2UUEA 3FMDA 3I60A 5FEDA 3QHRA 2R7IA 3NUPA 4O7TA 4X3JA 5CQUA 3G9LX 2IVSA 2ITPA 4CRSA 2JD5A 3GU4A 1SVHA 3R63A 2P3GX 4CKJA 4ANLA 3TCPA 4O7NA 3R9RA 4CFUA 3HV4A 2CMWA 2ITNA 2I0EA 2RFDA 4JAIA 3EN4A 1H25A 3KK9A 3OEZA 4Y95A 4C36A 4IQ6A 4ARKA 3NVKI 4FTIA 3R2YA 2CKQA 2ZOQA 4U42A 1OL2A 2XP2A 3LQ5A 4MQ2A 4IJ9A 1WCCA 4W9XA 4DAWA 3CC6A 4BKYA 3I79A 2OW3A 4EC9A 4C38A 5H8EA 3ZS5A 2X39A 3ZHPC 3DCVA 4AX8A 3DDQA 2HK5A 3LCSA 4RJ5A 4JOAA 4B7TA 4RLLA 4AXCA 3IK3A 1TQPA 4JMQA 1FINA 3ITZA 4U5JA 2QQ7A 5J7BA 4IXPA 3QTXA 2XNPA 4FIFA 3BE2A 5DHJA 2XIKA 3NMUF 3WF8A 4AN2A 1ZY5A 4QMYA 5HTIA 2ERZE 4MX9A 4EK3A 2W4KA 4IAZA 1CTPE 3CQUA 5CLPA 3TI1A 3E7OA 5F9EA 5IQGA 5IUIA 5EDPA 3MB7A 4WHZA 3VVHA 1NXKA 2R7BA 5ANIA 3MTFA 1JKTA 1CDKA 2XKDA 2XB7A 3FMNA 3U6JA 3IPHA 3BU3A 2BKZA 1APME 2CJMA 3VC4A 2XAMA 5G6VA 4AQKA 1VYZA 2F7XE 4YGAA 3EKKA 3RNIA 4WNOA 5KNJA 1MUOA 5HO8A 1UU8A 3VS5A 4L3PA 1ZRZA 4IM0A 4N70A 3BHYA 4JG8A 3VUIA 5DVRA 1QPEA 5CU2A 3FHRA 4EBWA 3RPYA 3R7OA 4QTAA 2J2IB 4BDCA 5CEOA 5AAGA 3PFYA 3THBA 4EJ7A 1ZZ2A 3PXKA 4E6DA 4MD8E 2HELA 2Q83A 3BLHA 4CTBA 4PY1A 4CSVA 5CU0A 5KMNA 3OD6X 4I6QA 5BUJA 4A07A 4APCA 3S0OA 5D7AA 4Z7HA 1H0VA 3QRJA 5IA2A 4QQJA 2QR8A 3G6GA 1OI9A 5AP7A 2C5YA 3FC2A 3C50A 3PY0A 2W1IA 3CP9A 3R9HA 4BCMA 4FKGA 3FKOA 3PSDA 2GS6A 4QPMA 4EC8A 5CF4A 2OIQA 3LHJA 4LV5A 4BCGA 5IH5A 4JNWA 5AV1A 1ZMVA 5GJGA 5CEKA 5HNBA 2FSMX 3QX2A 1H00A 1PXPA 2ZV9A 2BHHA 1JSVA 3RP9A 4BKJA 4QMTA 2GFSA 4OBPA 2UZVA 2XM8A 3EQHA 3G0FA 3FAAA 3P79A 4RA4A 4F9CA 3RAHA 3EN7A 4LOQA 1PKGA 4FZDB 4JX7A 3V5QA 4JX3A 4W4WA 2X9FA 5HE1A 2C6DA 2Q0BA 1XKKA 4ZZOA 1YQJA 1WZYA 4XBUA 1DS5A 4QPAA 4I21A 4NTSA 4U3ZA 4FSMA 4YJRA 3MA3A 2X8IA 4O1OA 1Y91A 4D2PA 4O7WA 3ALOA 4D2WA 5L4QA 2PVRA 3MS9A 4IB5A 1W84A 3EIDA 4FYOA 3FY0A 5CTPA 3OCSA 3WZDA 3BQRA 3NR9A 4HVGA 4D1ZA 1GZKA 4E8AA 4L9IA 4MXXA 4O0WA 3GP0A 5A4TA 4OAUC 1OBDA 4DH1A 1PMNA 3HYHA 1O6KA 3JY0A 3QA8A 4AGCA 2CCIA 2OWBA 3C0GA 4BYJA 5TKDA 3Q4ZA 3EQDA 4MK0A 5HIBA 5JFSA 4HOKA 2IF8A 4M14A 5AR2A 3FPQA 2YFXA 4BDKA 3S3IA 4FIGA 2R64A 2XEZA 5CVFA 1ZMWA 2VWUA 4G5JA 4H05A 3SG9A 2AYPA 5KMLA 3VQHA 3PJ3A 5CI7A 1FVVA 2UZLA 3RGFA 4EI4A 4R5YA 5FTGA 2JDSA 4AGWA 4XRJA 3CGOA 3C4XA 3R6XA 4IZYA 5ACKA 4NCTA 4ASDA 2UW3A 3I5ZA 3P1AA 5TT7A 4BJJA 3HV6A 5H2UA 4NIFA 2YM3A 4CV9A 5EOLA 2YIYA 2OH4A 3QZHA 2XAOA 3E62A 4RGJA 1BMKA 5HLNA 2BDWA 3ZO2A 3PIXA 2XKCA 5CEQA 3W2RA 1R1WA 3PY1A 4G6LA 4A9RA 4CNHA 3KEXA 4ZIMA 3O8PA 2YEXA 5CZIA 3HUCA 4HGTA 1JSTA 2AC5A 3FWQA 2J0KA 4IIRA 4O4CA 5FLFA 5CALA 5KBRA 4RWIA 2GHLA 4EZ5A 3PVUA 5LVNA 4QMNA 3W0PA 2XYUA 2X6EA 2CLXA 4IC7A 4WSQA 2C68A 5GZAA 5J9ZA 2F9GA 3UVPA 3TM0A 2HZNA 4G34A 4PRJA 4LMUA 1NVSA 5L3AA 3WYYA 4GL9A 5CT7A 4ERWA 2FSOX 4OAVB 2X0QA 5HG9A 2ETRA 3CY3A 2JBPA 1P5EA 2V7OA 3D7ZA 3OEFX 3QF9A 3QLFA 4BCJA 4EYMA 1PXMA 2WTWA 1Y8GA 5CSVA 3KMWA 4D5HA 1ZLTA 1LP4A 3VHKA 3E3BX 3QGYA 3QTUA 3Q2JA 3KXHA 3Q5IA 4XMOA 4PDOA 4DFBA 3QGWA 5E91A 1PYXA 3WI6A 2W5BA 3WYXA 5H3QA 4JRVA 3HVCA 4PUZA 4F0GA 1MQBA 4FV0A 2EUFB 2YISA 3BHHA 5EG3A 4OUCA 5HE2A 4JBVA 2XNOA 3HRCA 4HGSA 1IA8A 3KRRA 5CX9A 3U8WA 4RJ3A 4J8MA 1L8TA 2BR1A 3DK3A 2PVKA 5KKRC 5A14A 3D5WA 4YTFA 3QXPA 2PWLA 3ORMA 2R0IA 2OKRA 1OKZA 3SQQA 4NFMA 1OPJA 3C13A 3LFFA 2ZFYA 1HCKA 4F78A 2O0UA 2VTTA 2X4FA 3I7BA 4IFCA 3E64A 4P2KA 4IMYA 4C2WA 4BTKA 3QXOA 4IANA 2ZV7A 2NP8A 3K5UA 1YOLA 5IDNA 2BKKA 2CLQA 2QOCA 2E9OA 3R04A 4JQEA 1H01A 4QTCA 4BCQA 4XLVA 3EJ1A 5CAQA 1ZOGA 3UG2A 3LKMA 5F94A 4YURA 4HJOA 5KE0A 2X8EA 3C51A 2IW6A 4CLIA 2UW9A 3CQEA 4U9AA 4KB8A 4PL5A 2PHKA 3LCOA 3NW5A 1NW1A 2QODA 3C4ZA 3ELJA 3RZBA 3R71A 4LRKA 3MDYA 3A2CA 4GT4A 1T46A 1KV2A 4RVMA 1KE9A 4IX5A 3RAIA 3DTWA 4RWKA 4E93A 3D9VA 3ROCA 1J1CA 4QOXA 4WG3A 3GB2A 3OXTA 3FZOA 4G1WA 3T3UA 2UZNA 1XBAA 2ITYA 4FTCA 2WGJA 4CG9A 3VN9A 3IKAA 4JXFA 2XKFA 4TNBA 2VTRA 4ALUA 3MY1A 4FVQA 3OOMA 4FVRA 4X6QC 3RVGA 2PVMA 4TYHA 4G3EA 2BILB 5KO1A