1WBWA

Identification of novel p38 alpha map kinase inhibitors using fragment-based lead generation.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Identification of Novel P38Alpha Map Kinase Inhibitors Using Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1wbwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1wbwA01
2WZJA 3UPZA 4UXQA 4CZUA 5BUEA 4C4EA 4Y85A 3Q9WA 3MJ2A 3V5LA 3ZSIA 5M56A 3MGYA 4QYGA 4ANNA 3LOKA 5TT7A 4FSRA 2C3IB 4RVLA 2V5QA 3FLSA 3OWPA 5HD7A 2PY3A 3PXQA 4BHNA 2HZIA 4D1XA 2BAKA 3W2SA 4ZJVA 1J7LA 3PVWA 4RIWA 4D2TA 4ZJIA 4FG7A 2VV9A 3AGLA 1CKPA 3HDNA 5ETFA 2VTJA 3QD3A 4DBXA 2XP2A 1XH4A 2WKMA 5GIOE 5CU3A 1DS5A 4X2GA 3QQGA 4UY9A 3FLZA 2RSVA 3O17A 3OBJA 3PJ3A 1EH4A 3NNUA 4GMYA 1DAWA 3V5WA 3UVQA 5HBJA 4K2RA 1Q3WA 2BUJA 4YPSA 3OCGA 3UNZA 4C37A 2OIDA 3ZBXA 2G15A 4L01A 1VZOA 4GEOA 3H0YA 3WZEA 4FEWA 4RX5A 4YSMA 2W7XA 3V51A 4II5A 2XNMA 4AGDA 3F3VA 5EQPA 3GB2A 4CXAA 3VS1A 3PE1A 1L3RE 2WO6A 1DI8A 4PDSA 4EK3A 4EQUA 5J79A 5M53A 1UNGA 2GS6A 2PMOX 3C1XA 3CTQA 3FYJX 4EOSA 1NY3A 4TRLA 4F99A 2JDRA 3BWJA 3DBCA 3V3VA 4O91A 4ALUA 4NUSA 4AG8A 2XH5A 2VTAA 3QU0A 3GC8A 2OIQA 3UOJA 3OT8A 4LFIA 3WYXA 4BZOA 4AGCA 4BWPA 4ASEA 4BCOA 4NYEA 1KE7A 4FTUA 3GVUA 1GIHA 4K9YA 5AP6A 5IMEA 4DFNA 3VW8A 5AUXA 2CNQA 3DZOA 4JG6A 4D4YA 1H8FA 2WMTA 4I5HA 1CTPE 5A4CA 1H24A 3IW8A 4G6OA 2HELA 2XIZA 4UB7A 4X0MA 2VTNA 3MY0A 3BV2A 4ZEGA 4BKJA 5IISA 4RQKA 4AOTA 3VBXA 4C61A 3JS2A 2C6OA 2ONLC 4UWBA 1VYWA 3ULZA 4D58A 4YJOA 2R3JA 4IFGA 3NCZA 3FEGA 2ETMA 4Z7HA 3T9IA 3LMGA 2O63A 3PXFA 5LCKA 4A4LA 4CRLA 4CSVA 3MI9A 4V01A 5HCXA 4FKPA 4AU8A 4IAZA 4DFXE 4IM3A 1YOMA 4TPTA 2QO7A 4ZSEA 4CZYB 4C7TA 2ITPA 4O86A 4D4VA 3DT1A 3BZ3A 3F88A 5AX9A 4XCUA 3VC4A 3FI4A 4AN2A 2VGOA 2G2HA 4TYHB 3R8MA 2VNWA 3MV5A 3G90X 3OW3A 3KY2A 4FSYA 4KKEA 3VULA 4U40A 4ZTNA 1XBAA 3QCYA 2CLQA 3KKVA 3KXGA 2R3GA 5AP7A 4FKUA 3RK7A 3D7ZA 3QQJA 4MEDA 4ITJA 2Z7LA 2OZAB 2VTOA 4J53A 2A4LA 4PMTA 4IWOA 4QD6A 4RBLA 5CLPA 4BDCA 4U9AA 4FL2A 3KEXA 3QTUA 4QMVA 4HVIA 4M8TA 3KMMA 2X2KA 5IQDA 1OIRA 1PJKA 4E4NA 2IN6A 3UQCA 4QYEA 1VYZA 2UZUE 3GQIA 3IONA 3PY1A 3VHEA 3VS0A 4JI9A 1R0PA 3RNIA 2JIUA 4LOOA 5J9LA 1IAHA 3LMHA 3NUPA 4KIKB 4MQ1A 4IIRA 3KQ7A 3NSZA 2R3PA 4FTJA 4IACA 3TM0A 4FSUA 5AJQA 5JFVA 1OKYA 1ZY4A 2CN5A 1OL7A 2IVSA 3TTJA 2O2UA 4U5JA 4EBVA 4O6EA 3IDBA 1J7IA 2VTPA 3V6RA 5BVKA 1KOBA 4D5KA 5CYIA 4YJPA 3U4WA 3BLHA 4QMOA 4CG8A 4FSNA 3R8VA 2VTSA 5HX8A 1CDKA 3A4OX 3QRIA 1URWA 4MXYA 4D0XA 3LXKA 3CC6A 3FBVA 1YDSE 3PJ1A 2QOCA 3QTIA 4JDIA 4L68A 4EI4A 2JIIA 2IPXA 4BTJA 1Q3DA 5LOHA 4QOXA 4X2NA 1MQBA 4WUNA 2EB2A 4BCGA 3W8QA 4UYNA 3R7IA 5FRIA 2XIRA 3KRJA 5KHXA 2YAKA 4KS7A 2XK8A 5CU0A 4IZ5A 3ZO1A 5AIRA 4QP2A 4R7IA 5H8EA 4XV3A 3D7TB 3D15A 1JKTA 3FLQA 3OOGA 3V8TA 2IJMA 4FKQA 5CXZA 5E8XA 5LMAA 3QWKA 2OXXA 3CR0A 4AW1A 3QCQA 4DGOA 2BAQA 3JVSA 3VQHA 3QC4A 2OJIA 4XJ0A 3FC2A 4O0WA 4LG4A 2GNLA 2VUWA 4PDOA 4YLLA 4FYNA 4YHFA 3FQHA 3KULB 1B39A 3QTWA 2R3MA 2WMRA 3HV3A 5BYLA 4RIYB 3HMOA 2Q0NA 5C27A 4C3RA 4NM3A 3CXWA 3U6IA 4FKWA 1YWRA 3FXXA 1GZNA 4LMNA 4C33A 2Y0AA 3ROYA 5DN3A 1Q62A 3LAUA 4WO5A 3PFQA 1RQQA 2IW9A 4BL1A 3ZTXA 1TQMA 3Q5IA 1Q97A 1F3MC 1H1QA 3SLSA 1H25A 2QLQA 4FV2A 3CSVA 3MIYA 3WF6A 3A60A 4BWXA 3EQFA 4EWQA 3PJ2A 2X7FA 3FKLA 4L3PA 4JG8A 4ZTMA 5HIBA 2YM4A 3BEGA 4BDBA 3ATSA 4O22A 3QZIA 4IDVA 1J3HA 3L8XA 2R3IA 3P9JA 3UE4A 1J1CA 3F2NA 5FM2A 4QP1A 1LUFA 2BKZA 2WMAA 2YM7A 4O0TA 3FQEA 1A48A 3F2RA 1OKVA 3RK5A 3A7IA 3O23A 4L46A 2FUMA 4L3JA 5HG5A 3QRUA 4CYJA 3P4KA 5J9ZA 4K1BA 4IB1A 3RVGA 3O8TA 3MPMA 2PZPA 4BZDA 1R1WA 2X6DA 5IA3A 4FIFA 3FMHA 5JGBA 3DKFA 4MD8E 4RJ6A 3RALA 4PDPA 4F4PA 4ZY4A 4ID7A 5IA2A 4TY1A 4FV5A 4QMSA 4QP7A 3QALE 4M13A 4BYJA 4BF2A 2C68A 3F7ZA 3R02A 4N0SA 4QMQA 4PWNA 1MUOA 5A3XA 3V5JA 4F1OA 5FWKK 2WMVA 3FKNA 5KHWA 2QCSA 3EZRA 4ZSGA 2R3OA 3V8SA 4RSSA 1UU9A 2JDSA 4H1JA 2WB8A 5HLWA 4NEUA 4E5AX 3U6HA 4O7ZA 1DI9A 2JKKA 3A62A 4DF3A 4BCFA 4DTAA 1PYEA 3KN6A 5HO8A 4ONAA 3R7EA 2SRCA 2HYYA 3S3IA 3LJ2A 2VZ6A 4UMUA 2UVYA 4GIIA 4QQ5A 2XK4A 3TIYA 3PXZA 1U46A 2C6IA 2XNEA 2C6DA 2YHVA 5E1SA 3SXRA 4AA0A 3W10A 3TZ7A 4RWIA 2ITXA 3C0GA 2IVVA 5L6OA 4KINA 4BBFA 5J95A 2WMUA 3A2CA 4O6LA 4WT6A 2VX1A 4HCUA 4I93A 2J5FA 5H9BA 3HUBA 2NO3A 3V6SA 3V5QA 5I3OA 2DUVA 4CQEA 1WBVA 4DITA 3P5KA 4X6RA 3FL5A 3RAIA 2HCKA 4ITIA 4R7HA 3S4QA 4GW8A 4YO4A 4F7SA 2I40A 3D83A 3PLAE 4FT3A 4G6NA 5KMNA 1HCLA 5HTIA 4CGAA 3VIDA 5KBRA 2Y4IC 4YJSA 3DS6A 4EHGA 5AUUA 2R3FA 4XV2A 4YZMA 2VTTA 3KRWA 5CEQA 3IK3A 4U44A 3BE2A 3R0TA 3E8EA 3ERKA 3HMNA 3QRTA 4Q9SA 1UNHA 2ZAZA 4U3YA 4PV0A 3UP2A 3CD8A 3F69A 4G9CA 3FSFA 2YM8A 4EUUA 5JFWA 5EFQA 4FV4A 3COMA 4MNEA 3LPBA 1Z5MA 2X4ZA 5H3QA 3SRVA 4DTKA 4M66A 5GHVA 4BTMA 2XIKA 5E7RA 3NCGA 4JDKA 5L3AA 3D0EA 2W1CA 1T46A 4H05A 2Y6OA 3NEWA 4OUCA 1PXIA 5ETAA 3ULIA 3QYWA 5KBQA 3EQCA 3ZZEA 5LVMA 4IEBA 1TVOA 1BUHA 4UMRA 4FTAA 1Q61A 5EM8A 2OJFE 2ETKA 2VWWA 5C8MA 5IMXA 4QMWA 3UNKA 5CZIA 2B4SB 3OF0A 5EDQA 2ITTA 4JBQA 2OXDA 3TNIA 2CGUA 2X7GA 3F2AA 3HV5A 3D5VA 2VN9A 4I20A 2Y7JA 3FZOA 4Y73A 5DE2A 3CY3A 1PHKA 3IW7A 3KXZA 2BKKA 2ITQA 2W4KA 4UEUA 3DAEA 1MP8A 2UZWE 1FPUA 3NAXA 4MXAA 2C5YA 4GT4A 2F49A 4RA4A 4UMTA 3FLYA 2RFSA 1JVPP 4AQCA 3CLYA 1Q8UA 4FEVA 3BEAA 2XK7A 3H9OA 1H1RA 2GHLA 2DYLA 4ZTHA 3PWDA 3G15A 3OWLA 3VF9A 3CQWA 5EQEA 5HO7A 1NA7A 4FEXA 4MVFA 5JFSA 4C4FA 3RCDA 3NW7A 5JT2A 5BYZA 1LEWA 5BVNA 2BZHB 3UBDA 3LCTA 5G1XA 3EQBA 3F61A 3NIEA 4S33A 3UOHA 4DEDA 2OZOA 3PZHA 4Z55A 2P33A 2NPQA 4NIFA 2EUFB 1A06A 3O51A 1WBTA 2VTLA 3WF9A 5D11A 2QC6A 5ACKA 4BC6A 3I7CA 4EC8A 4F09A 2R3HA 2Z7SA 3LCKA 4YURA 5IQHA 1PMNA 5BVDA 4RLKA 5HE2A 3CIKA 4FKOA 4CT2A 4M68A 4OBQA 4CT1A 4F7NA 2XK6A 5M07A 3KFAA 3S0OA 4IVAA 5D9HA 5AAGA 5FD2A 3NYVA 2QQ7A 3R9OA 4N57A 1BI8A 4UALA 4KIPA 4QP3A 2X8EA 4BTFA 3WBLA 4Z7GA 3C0HA 3C4CA 2CN8A 2OG8A 3VQUA 4X2JA 4AP7A 1ZMUA 4I23A 3GCUA 4LV8A 2F2UA 2GS2A 1PXPA 3FC1X 3DFAA 1U5RA 5B2LA 4PRJA 4YGAA 2CKEA 4ZSLA 3Q9YA 3PPKA 4CYIA 2OICA 4W8DA 2W96B 4GT3A 4TL0A 4S30A 4JG7A 3FZPA 3VS2A 3R83A 2OJ9A 1WZYA 4WBOA 4RRVA 2XRUA 2QO2A 5C1QB 2WTCA 3NMUF 4ALVA 4QMYA 5LWMA 2F2CB 1UU7A 4EZ5A 5L6WL 1QPJA 2ITNA 1UKIA 4TN6A 3VBYA 4LI5A 5AR4A 3GC7A 3QLGA 5FDXA 3OY1A 4R5SA 2WQBA 3QC9A 5HESA 3SQQA 2UVXA 5AUYA 5IQBA 2Z2WA 3E8NA 1O9UA 4OGRA 4R6VA 2XYUA 4YPDA 4USEA 4KUJA 1FINA 1REKA 3TG1A 5CQWA 4DH8A 3QCXA 3U51A 3FZ1A 5TE0A 4F9BA 4FIHA 4QTDA 4DH3A 3DA6A 2PL0A 2VX0A 2X9FA 3A7HA 1O6KA 3EQGA 4J98A 4X6QC 4ANSA 3SW7A 4NJ3A 2JDTA 4O96A 5CSXA 4CV8A 3D5XA 2OI4X 4FZDB 5FEDA 4YP8A 3OC1A 4AXAA 2WD1A 4XS2A 4NKSA 1RW8A 5E8YA 1WVYA 5AX3A 4NFMA 4CLJA 3DQXA 2KULA 4U0IA 4WNKA 3AOXA 4BIEA 1PXKA 4BN1A 5IA4A 2BFXA 2KTYA 4FV1A 4AT3A 3AC2A 5EDRA 2JDOA 5AP4A 3TI1A 3GGFA 5M06A 1XWSA 4YTCA 2C1BA 3P7AA 2J0KA 3NW6A 3UQGA 5M44A 1R0EA 3EQRA 2VWUA 3IGGA 5L8JA 3R9RA 1JSVA 1XH8A 3IKAA 4J96A 2W9FB 5M4FA 2OF2A 3PSCA 3F5GA 4FK3A 4AE9A 4K8AA 2GPHA 3RCJA 3DBDA 5IA0A 3HRFA 2XBAA 1ZOEA 3H4JA 4FTNA 4G3CA 3PIXA 5AR5A 3WZJA 4FODA 4CCBA 4HNIA 3PPZA 1QPDA 2BZKB 3GFWA 4F9CA 4FSMA 4O38A 1WVXA 3F5UA 1PXLA 3BYUA 2WOUA 2H6DA 3DPKA 3GC9A 3HKOA 4FT9A 3RAHA 3R9DA 4AGUA 3OHTA 4L00A 3HUCA 5ANGA 3OW4A 3VUKA 2QOOA 4JNWA 3SHEA 4D9TA 4OBPA 2JKMA 4IDTA 2CPKE 5TOZA 1YXTA 3UO5A 2WTJA 3MH0A 5EYMA 4W4WA 4AACA 1XR1A 3HMPA 5CALA 1WBOA 4AF3A 2BZIB 4YJQA 2AC3A 4AZTA 3OFMA 1J7UA 2X1NA 4RFMA 5KZ0A 3PPJA 4C3PA 5IA1A 4FTMA 4AX8A 4QNAA 4EH7A 4DT9A 4WIHA 5E8SA 4FKIA 5EW9A 5AAEA 1ZLTA 3ZYAA 5IPJA 4D0WA 5CU6A 3KB7A 5EYCA 4HVGA 3CQEA 4C4GA 2EVAA 4KAOA 2HZNA 3DAJA 3I5ZA 4Y72A 4FTQA 2GTNA 4AZFA 4F70A 4KD1A 3CEKA 3ZRLA 1WCCA 1IEPA 4GIHA 3QTSA 1H4LA 3TKHA 5L6PA 1U54A 2UW3A 4YLKA 3D4QA 3A7GA 4RX9A 3KREA 5JN2A 4RIOA 3HEGA 5FTQA 3ODYX 4FOCA 2RFEA 2XEZA 3QRKA 3VS5A 4BDAA 3BBTB 4JX7A 1Q4LA 1TQIA 4AT4A 2Y4IB 1WMKA 5EKNA 4I5PA 4G1WA 4ZXTA 4X3FA 2J90A 2CKPA 1FMKA 5A46A 4GK2A 2XKCA 4O83A 2HW7A 1XH7A 2B1PA 4GJ2A 5AR7A 3TACA 1KE6A 5F9EA 4EH6A 3DKGA 3HYHA 2QLUA 4CCUA 3QGWA 3ORIA 3ZSHA 4CKIA 3C50A 3L8SA 4PX6A 2BHHA 2RFDA 4CFUA 4QNYA 4YBKA 4DT8A 2UW0A 2R7BA 2C3LA 2YWPA 4Z9LA 3GCQA 5HLPA 4JBVA 3DXNA 3VUHA 4I0SA 4D55A 4BDJA 3KK9A 4GJ3A 4RJ4A 4DFBA 3H10A 1R39A 2P0CA 4B6LA 5DR9A 4E4MA 3KN5A 2PVJA 4C57A 3HRCA 4O27B 1VJYA 5DA3A 3UIXA 4OTQA 2V7AA 3S2PA 3D5UA 3BI6A 3OOMA 2PZYA 3BU6A 2F7EE 4W9WA 4IB0A 1OIQA 4OAVB 4XX9A 5CWZA 3FI8A 3OBGA 4ZOGA 5FTOA 4XG8A 3BLRA 3LXPA 2PUPA 1Y6BA 3R73A 3ZC6A 5AV1A 1WVWA 2AUHA 3QHWA 3TKIA 2E9UA 1SZMA 3AC4A 3QX2A 5JEBA 4L43A 2V22A 4EQCA 3IOPA 2CGWA 3F3TA 4OTFA 4ANOA 4NZWB 3P79A 4U42A 4O0YA 3CPBA 5LMKC 4AE6A 3NVKI 3FI2A 3HV4A 1APME 4F9YA 4Z16A 3DFCB 3FY2A 3M11A 4ANBA 4E5BA 5I9VA 4EHEA 1YWVA 1QMZA 3FLNC 3O8UA 2IVTA 4AZVA 5EW3A 2R3KA 1YQJA 2PZ5A 2ZV9A 5ANIA 1Y8GA 3TDWA 1YOLA 5IDPA 3R71A 2W4OA 5FEQA 4YTIA 2YACA 2YWVA 3DXQA 2JKOA 3JPVA 4C38A 4ASZA 4KBKA 1FMOE 4FIGA 4ERWA 4FNYA 4ERKA 3SGCA 3SG8A 5DR6A 5TF9A 4KABA 2YDJA 3UZTA 1BI7A 5DMZA 3DB8A 3P78A 4FV6A 4D1ZA 4ORKA 4GVJA 5A6NA 4FGRA 2YCSA 4YTHA 3OMVA 2QR7A 5DRBA 2C0OA 3C4WA 2VTIA 4TXCA 3ORXA 1OZ1A 2JEDA 3UO4A 5LMKA 4FTRA 1TQPA 3EB0A 5HCZA 5T68A 5DG5A 3EFLA 4HNFA 4EOIA 4OBOA 4KIQA 4GKHA 5HVJA 4ZY6A 3MVJA 3QX4A 3UG2A 5CSVA 3R1YA 3ZHPC 5M4UA 5F20A 4WHZA 2PZRA 5M08A 3GU6A 4IC8A 1OMWA 4IMYA 5C9CA 4G16A 5EOLA 4E7WA 3SOCA 3UDBA 3WIKA 5K5XA 2HXLA 3O0GA 3E8CA 4EJ7A 4YO6A 4BDFA 2QU6A 3MB6A 1H01A 3L8PA 1MRVA 4X21A 3RTPA 4LUEA 2Z8CA 2BRGA 3DJ6A 3KXXA 2YCFA 3QF9A 4JT3A 2GNGA 2CJMA 4NT4A 5F95A 4CMOA 1W0XC 4J71A 2WU6A 1BX6A 3UVRA 3F3ZA 5DRDA 3UGCA 3LXNA 3ZM9A 2PE2A 5IQFA 3PTGA 3NW5A 4IAAA 3DV3A 3DXPA 1ZYJA 5C4KA 4HCVA 3EQIA 5ANJA 4IX6A 4DG2E 3CE3A 4MBJA 2YJSA 2YM5A 4E6DA 3T9TA 3ZFYA 4LMUA 4RQVA 3AC1A 4USFA 4UN0C 4M3QA 2QU5A 4QMLA 2YAAA 4EC9A 4NU1A 4WG3A 2C5OA 3TNPC 2I0EA 3R2YA 3BYVA 2PUNA 2X8IA 4AN3A 5BVWA 2IWIA 3ANRA 4Y5HA 3CJGA 3TNHA 5GJDA 5LCJA 4FKTA 3FMEA 4S2ZA 2WELA 3QQFA 4RZVA 4F9AA 4AFEA 4YZNA 4NH1A 3GBZA 5ANOA 1M7QA 5JH6A 3NLBA 2B54A 3QD2B 4H39A 1VR2A 5AFVA 4PY1A 1WAKA 4AWIA 4QPMA 5AWMA 2P2HA 4G5PA 4PF4A 3QWJA 3AQVA 3OUNB 4ZLZA 3L1SA 1ZOHA 2E9VA 4YJTA 4TWOA 4C4HA 3SD0A 5A4QA 3Q4ZA 5HU3A 3ZBFA 3LCSA 2ZB0A 4EBWA 2JC6A 1Q8ZA 2WXVA 4XG7A 5CEKA 3EJ1A 4I6FA 3TUCA 4RLLA 3MDYA 2XCHA 2QOLA 2V7OA 5GJGA 2HAKA 1M2PA 2FSLX 5HU9A 4ZY5A 4CFWA 3KXHA 3LIJA 4FNZA 4MTAA 5B2KA 3E88A 2QO9A 5CENA 3FL4A 4YMJA 2JFLA 1T45A 3LQ5A 4L45A 5HKMA 3RM6A 3HVCA 2VTRA 3BYOA 3DCVA 1YDRE 3KVXA 4JQ8A 4R1VA 5CU2A 3RI1A 3V01A 2WTIA 2J9MA 3NVMB 4APPA 3GCPA 4FNXA 5IKWA 4WBBB 4UMPA 3CBLA 3UOLA 5I9ZA 2EXEA 4KBAA 3LFSA 4DN5A 2C6KA 5LARA 3ZFMA 4P5QA 3SA0A 5K0KA 4FTLA 3SOAA 2IZUA 3QGYA 4N70A 3CKWA 4MCVA 3NZ0A 4S32A 4L42A 5E92A 2BILB 4TT7A 4ZZMA 1H08A 3H30A 2ZDUA 5D10A 3RAWA 1QPEA 4OLIA 3RPOA 5KE0A 1ZXEA 4MBLA 1Y57A 2QOQA 2VO0A 1GY3A 3AXWA 3DB6A 1JKSA 1JSUA 3QKKA 3WF5A 3BYSA 4WRGA 2OIBA 2R3NA 3VS6A 3E7OA 3PWYA 4M7IA 4R3RA 4RGJA 2OKRA 3PP0A 4FZAB 4I4FA 5CT0A 2PE1A 3I5NA 2XA4A 4ZTQA 3R30A 4U41A 4DEBA 3NUAA 1A9UA 4XRLA 4BB4A 3ZH8A 2NNWB 1BMKA 3S95A 5C4LA 5E9EA 5AA9A 5DHJA 2ITZA 1ZAOA 3FMMA 4YJNA 2YN8A 4HGLA 5EYKA 3HNGA 4IE9A 4LOPA 5FG8A 4UZDA 2VO3A 5DIAA 5HQ0A 4EHVA 4FEQA 1KUTA 3MSSA 3ETAA 4OTIA 1J1BA 4HYIA 5K0XA 5EHYA 4J8NA 4CTCA 5AP0A 2BVAA 1IAJA 2CCIA 1PMEA 4XH6A 4C58A 2QOHA 2PVLA 4CMTA 4HZSA 4EH5A 1WBNA 3C13A 3ZRKA 2WNTA 5FP5A 1ATPE 1SM2A 4ZZOA 5CANA 2QG7A 1FVTA 2REIA 4FTIA 3ZXTA 4AZSA 5J5TA 4EK8A 3R1NA 3C51A 4D2RA 4RZWA 4DGLC 4H3PA 3QD0A 3Q4CA 5BMSA 2A1AB 4MXCA 4FV8A 5LWNA 2IG7A 1ERKA 1JKLA 5E91A 3AT2A 1H07A 1UVRA 3A7JA 4MXZA 4NTSA 5L8KA 2CSNA 3NYOA 1PXNA 2YERA 3ZC5A 2UW5A 4JQEA 4QYYA 5HG7A 3WZKA 4O2ZA 3LCDA 1OUKA 1UWHA 3EOCA 3HV7A 4MF1A 3EHAA 2XNBA 4FA2A 1SVEA 4DEGA 3MFRA 2GQGA 4O2PA 1Q8TA 3M2WA 4BYIA 4JVGA 3A8XA 4X2FA 5CEPA 4NM5A 5FBOA 4IC7A 2WEIA 4F63A 5K5NA 5L4QA 2ITVA 4J95A 2JD5A 4FMQA 2O5KA 3P08A 3V04A 4G2FA 3KL8A 3R9NA 3ITZA 5IH5A 3VJNA 3KGAA 3W2RA 5KCVA 1RE8A 4AS0A 5CF5A 4CQGA 2OSCA 2ZV8A 3MVMA 4JLCA 4CZTA 4HYHA 3LJ1A 2BZJA 4E8AA 1LEZA 4WSYA 4ZSAA 1XHAA 4IW0A 4ACCA 2NP8A 3EQHA 4I3ZA 4GT5A 4ARKA 4XUFA 2W9ZB 4I4EA 3GU4A 2C3JA 3QRJA 4TWPA 4NL0A 1Q41A 4I0TA 4FE2A 3RJCA 4FKJA 3ZLSA 3LKMA 4O0XA 4QTCA 4U97A 3GENA 2VWYA 1LPUA 4O7LA 3HP5A 2R4BA 3NNWA 4I6QA 3LFEA 5IUGA 3W18A 3BBWA 1KV1A 4ZTSA 4S31A 3D5WA 2VWIA 4GCJA 3RZBA 1HCKA 4G34A 4G31A 2OH4A 2OO8X 4O81A 2W4JA 3LFFA 2J2IB 4P5ZA 2UUEA 1GIJA 5D12A 4AAAA 4EZ3A 4JDHA 5CZHA 3VWAA 5J1VA 4FZ6A 3R8UA 5JQ5A 3PG1A 3NGAA 3HA8A 4D4RA 3VF8A 4BWKA 5DOSA 4YJVA 3Q2MA 5A4EA 3ANQA 3UMXA 4RIWB 4HVHA 3PA3A 4IAIA 2LGCA 3UIMA 2ZVAA 2BRBA 1MRUA 1BKXA 1FGIA 4XHKB 3UOKA 3HLLA 1M2RA 5DLSA 4ZK5A 4XLVA 4BTKA 3MB7A 3NX8A 2YLEA 5EHLA 3Q96A 2V55A 4B9DA 3UYTA 5IQCA 5M09A 4EOPA 2A0CX 5CNOA 2BRHA 3DLZA 2OFVA 2QR8A 3BYMA 4JJRA 4IZAA 4E6QA 5BVOA 5LXMA 3LFQA 2HZ4A 4RX8A 4C4IA 4QMTA 3BHVA 3SX9A 3GXLA 5FUTA 1ZY5A 3NUYA 4EZ7A 2QOIA 3TEIA 3ZEPA 1KE9A 2O3PA 4M69A 5HNIX 5CF8A 5EOBA 4A4XA 5DT4A 1P5EA 3MW1A 4JX3A 4C4JA 5KX8A 2GDOA 2OXYA 4N4SA 5JFXA 2CKOA 3BGZA 5G6VA 3HDMA 4DHFA 4I6BA 2PSQA 2VAGA 5ANEA 3ZLWA 4DEIA 4C2WA 2CHLA 2WMWA 5KMJA 4EOOA 3WYYA 2C6LA 2UW7A 2VTMA 4FX3A 4K33A 4MWHA 2IO6A 2JKQA 3KF7A 4AFJA 4E4LA 4L8MA 2XF0A 1OPLA 4TYJA 1H0WA 2JAMA 4RFZA 3A99A 3AMAA 2JIVA 4IWDA 4JIAA 3TZMA 2PVNA 4RIXA 4Q9ZA 4R77A 2PZIA 3QZHA 3G6GA 2B9JA 5KMKA 4CTBA 4IH8A 1Q8WA 3FJQE 4QMNA 2WQNA 3IDCA 3A4PA 2J50A 4GVAA 3NRMA 4QTAA 1ZMVA 1OKZA 2WIHA 2EU9A 5IQIA 2W1FA 3OCSA 2GTMA 3M1SA 3HX4A 2QHMA 5CSWA 4A06A 5C8NA 2W1GA 3IGOA 4GG5A 3Q4TA 4E6CA 4FSTA 1GZ8A 2BDWA 2EXCX 4JBOA 2EWAA 2FGIA 1YXVA 3PIZA 3IS5A 4FOBA 3RPSA 1XBCA 1JNKA 2G01A 4L3LA 4FV3A 1L8TA 4KKGA 4ZSJA 5IF1A 1IA9A 3DK6A 4FIJA 4EJNA 3QL8A 1G8SA 4X3JA 4HGSA 1XQZA 4NWMA 4R3PA 4DBNA 4L52A 4M97A 3BKBA 3BU3A 1E9HA 2XRWA 2GFCA 4YNEA 4XP0A 5AIKA 3SW4A 4EK5A 1SYKA 2OFUA 2Q0BA 4FL3A 2IZTA 1Q99A 1YXXA 3BRBA 3EH9A 4K6ZA 3BE9A 3IW4A 4GYGA 3GFEA 3C9WA 2R3LA 4E73A 3I0QA 5HI2A 4EYMA 1CKJA 4RVMA 3F5XA 4B0GA 2JFMA 2XNNA 1JWHA 4QMUA 3IG7A 2X4FA 4RC3A 3ORMA 2WQMA 4DEAA 5KMOA 3Q32A 1Y8YA 3EWHA 1H27A 3LFDA 4O21A 4RT7A 3EKNA 4E4XA 2C3KA 5M4CA 4F6UA 5CI6A 2R3RA 4IB5A 4IJ9A 5CX9A 3DOGA 2C4GA 4J7BA 4N6YA 2P55A 2BTSA 5FM3A 4YC8A 1YHWA 4B4LA 2F9GA 3AMBA 3FYKX 3LJ0A 3N51A 4L44A 3ROCA 4C36A 4CKRA 3P7BA 3TJDA 4YHJA 2IW6A 2VWZA 1H1WA 4O0SA 3NWWA 3OUKA 1ZRZA 3SC1A 4A9TA 5M55A 2RKUA 3OP5A 4MF0A 2Z7QA 4A07A 5FDPA 3EL8A 5BMMA 3FMNA 4BIDA 2FH9A 3VHKA 3ORNA 3BU5A 3QZGA 4TNBA 5CS6A 3DAKA 3P23A 4QYFA 5GINE 3UIUA 3D14A 4RJ8A 2Y4PA 2H96A 4NW5A 4FG8A 2C5XA 2WMSA 3IOKA 4YZDA 4YZBA 3WOWA 1W83A 2FSOX 4FIIA 2QD9A 4FVPA 5ACBC 3RMFA 3W16A 4C62A 3VUIA 2IVUA 1XH6A 4G3EA 3VJOA 4NM0A 4FKGA 2G2FA 3V5PA 2R0IA 4LOQA 4ZAUA 2ZJWA 3IW6A 2P4IA 3I60A 4CKJA 3F6XA 4IX5A 2AC5A 3TJCA 5GZ8A 3T3VA 3RPRA 5FQDC 1STCE 5C03A 4DG3E 4AGWA 4F7JA 5T6KA 3VNTA 2YZAA 4DGNA 4HYUA 2WTKC 3U87A 2XM8A 2JDVA 1H28A 3NNXA 1R3CA 5EI6A 4EOMA 5A6OA 5DT0A 4BIBA 4GFOA 4FVRA 4PL5A 3AD4A 4I92A 4UYAA 3Q04A 4WG4A 3PLSA 4WNPA 4A7CA 4YR8A 5JKGA 3FAAA 2CLXA 3GU8A 3QYZA 3EKKA 3HRBA 4UXLA 4BCMA 1PXJA 2C0IA 2BROA 5L2IA 1OITA 3I81A 1YWNA 5BPYA 2YABA 3RK9A 2VO7A 2ERKA 3BQCA 3KCFA 4V0GA 3RWPA 3NUNA 3GU7A 3GUBA 4ITHA 4BFMA 1JSTA 4KNBA 3RINA 4RVTA 3WZUA 2I0VA 2RGPA 2YCQA 4F08A 2PE0A 2J51A 1OM1A 3UZPA 2F7XE 3OROA 3AD5A 2BMCA 3VS3A 2HENA 4EOJA 5IEXA 3P7CA 4G3GA 5AR3A 4BZNA 4L9IA 3TUDA 3KRLA 3Q9XA 4IVCA 3FXZA 5LVLA 5JSMA 3F3WA 4FKVA 4XEYA 4EOLA 3I7BA 3ZRMA 1ZYCA 2W1IA 4O0UA 1UU8A 5I9WA 3AGMA 3D9VA 3UC3A 3BELA 3HV6A 4XOYA 3MFUA 4AW2A 4E5WA 4AOJA 2B53A 3NUXA 4O7VA 5M4IA 4K11A 5D1JA 5T3QA 4EH8A 1JLUE 4MWIA 3CTJA 5I9YA 2XKEA 1FOTA 3T8OA 2BAJA 3OS3A 2OH0E 5L8LA 3JYAA 4W9XA 5AUTA 3G9LX 2YIYA 5FXQA 4G17A 3Q9ZA 4WNMA 3EIDA 4R78A 2VWXA 1PXMA 4NTTA 4ZLYA 2BALA 3JY0A 5GZ9A 3SAYA 3OY3A 4QYHA 2H34A 4TTHB 5AR2A 1R78A 2W06A 5FXSA 3VBVA 3D2KA 4QPAA 4GG7A 3GNIB 3RPVA 1YXUA 3DJ5A 3B8RA 3QQKA 3AC3A 4W8EA 3KK8A 2R0UA 4FKLA 5DWRA 1PF8A 4MD7E 2WMQA 4CMUA 1PXOA 2O64A 2YIWA 1QL6A 3REPA 3DK3A 2J0JA 3IPHA 3U4UA 5HVYA 3BHTA 4FEUA 4K77A 2WOTA 3MIAA 4O7NA 2GMXA 2ZV7A 4WOVA 3WIGA 3W2CA 2F4JA 3U6JA 4CLIA 4U45A 4NSTA 1IA8A 4LRKA 3QD4A 3U9NA 4H36A 3D94A 2ZV2A 5HE0A 2RIOA 5A9UA 2YJRA 4U6RA 1AQ1A 5C8KA 4GU6A 3E3PA 5FLFA 1YHVA 4E6AA 1IASA 1UNLA 1G3NA 2CCHA 3UIBA 4BCQA 3E87A 5ETCA 2UZLA 2E2BA 4N6ZA 3MH2A 3PXYA 5HG8A 3HAMA 4KS8A 4PP7A 4XG3A 5DBXA 2QURA 3LMIA 3BCEA 3MWUA 4F65A 5A54A 3ZUVA 1S9JA 4WG5A 2Z02A 2C0TA 3ZU7A 5BUIA 4LRJA 4MYGA 3FPQA 2JAVA 2YDIA 3JVRA 3OWKA 4IZYA 5DVRA 4X3FC 3OXIA 2UZOA 4DGMA 3R1QA 2JITA 3K5UA 4JR7A 4JBPA 1DM2A 1FQ1B 2C69A 4BHZA 1V0BA 4KB8A 3PY3A 3R22A 1F0QA 5IUHA 2BRMA 4OAUC 2OJJA 4BDDA 1Y91A 2YISA 3TV6A 4F1TA 1V0PA 3C4XA 1NVQA 2B9HA 3OXTA 4MNEB 5LMBA 3BHUA 3I4BA 3MFTA 4AW5A 3SRVB 3RAKA 2IW8A 2PVKA 4DAWA 2ZM1A 3ORPA 3FZSA 4RA5A 3TIZA 5BX0A 4BDIA 1ZYDA 4FVQA 1ZARA 5L2QA 1H1PA 5CXHA 3W33A 4HVSA 4EONA 4BCHA 4HCTA 1XJDA 2B9IA 3C4EA 2VD5A 3FMLA 3NIZA 5ANDA 3SG9A 2XS0A 1MRYA 3PY0A 4TYHA 4DE4A 4HPUE 4ZZNA 1PKGA 2GNJA 3W55A 2BIYA 3NAYA 4KIOA 3WF8A 4ANLA 3E3BX 2G2IA 3LFNA 5CF4A 2F7ZE 3FLWA 4S34A 3ZZWA 5EHOA 2B9FA 2A2AA 4DFLA 5CEOA 4O82A 1OI9A 3IO7A 3TZ9A 4DH1A 3IECA 5L2TA 2HY81 3SV0A 1ZYSA 3OWJA 4G3FA 2OZAA 3MJ1A 3COIA 3IQ7A 5F1ZA 4IXPA 2PMIA 3TDVA 3VUDA 4F1MA 1ND4A 4KSQA 3DKCA 4R3CA 3TCPA 5KUPA 2O65A 1I44A 3LLTA 4RJ5A 4UV0A 2XZSA 3G51A 4FBXA 4TNDA 3R2BA 3DK7A 4HZRA 5H8GA 2XNGA 1BYGA 2W0JA 5A4TA 3LXLA 5HBEA 2E9PA 1P4FA 3NYNA 3PA4A 5D7VA 1G5SA 4FSQA 4GS6A 2I0HA 4IWQA 4NIFB 3OEFX 2C30A 3FHRA 5D7AA 5HD4A 2PUIA 3DTCA 1H00A 4I6HA 4EEVA 3AC5A 1WBSA 4AA4A 1OB3A 4UBAA 5AR8A 2W5HA 3QQUA 4IX3A 4RWKA 2OWBA 2FVDA 4CG9A 5JGDA 1E1XA 4Q2AA 4ZS0A 4OTHA 2UW9A 4GU9A 2UV2A 5IDNA 3RPYA 5CAVA 4ZTLA 4O7SA 5HVKA 4GRBA 5IG1A 4BBEA 4YTFA 3DNDA 4I1ZA 2ZB1A 3ZS5A 4TKSA 4YSJA 2WHBA 4IANA 3QBNA 2XYNA 5CAUA 2RG5A 3FWQA 3RHKA 4Q5HA 4FICA 2EB3A 4BCPA 3DTWA 4FTOA 4LM5A 4PNKA 5EM6A 3D7TA 5CVHA 4OT5A 1PKDA 3TV4A 2F57A 2HZ0A 1U59A 3I79A 4EK6A 5HNBA 2GNIA 3E7VA 4YU2A 5HE3A 4GUEA 1XH5A 2HW6A 4KWPA 5FGKA 2V0DA 4OT6A 3KU2A 3UC4A 3ZO3A 2WTKB 4F0FA 4KA3A 4XBUA 4JRNA 3OXZA 4IADA 4UZHA 5BVEA 3CGFA 1W8CA 2JBPA 5LVNA 2BR1A 4DC2A 1OPKA 5HGIA 1BL6A 3RM7A 2J6MA 3E62A 3MY1A 3FI3A 3KA0A 4FK6A 2JGZA 2ZOQA 3Q6WA 3R1SA 4XOZA 3ZDIA 4E20A 4PDYA 3AD6A 4OR5A 5DFPA 4D2VA 4NW6A 2VWBA 4LQMA 3K2LA 4RIYA 5HNGA 1O6LA 2I1MA 1U4DA 3R04A 4OTPA 5EDPA 3KMUA 5EYDA 2X2MA 4JRVA 4ACHA 4AUAA 4XP3A 3OCBA 4IM2A 4HW7A 4IVDA 4PNIA 3PSDA 3HMIA 4FYOA 5J5SA 5E8VA 3K3IA 2C6EA 3II5A 3QZFA 4MNFA 4MX9A 4RVKA 2Z60A 4DCEA 3PJ8A 4BDHA 2OGVA 5EK7A 4XP2A 4QTEA 3GEQA 5AUVA 2R7IA 3L9MA 1OKWA 1V1KA 3F66A 4Y95A 5I3RA 2CGVA 4M84A 3FZTA 5CI7A 3R7VA 3C5UA 3UG1A 4PTCA 1YHSA 3TNWA 4XRJA 4YUQA 4GH2A 5HZNA 4O7WA 1P2AA 4G6LA 1M14A 3H0ZA 4W4XA 4LGGA 3TTIA 3UP7A 3UTOA 3GP0A 4UX9A 2YFXA 1TKIA 2VRXA 2XJ2A 3O7LB 3WE8A 4J52A 4EYJA 5M51A 4AOIA 4EH4A 5EW8A 3U55A 4I94A 4WA9A 5HTCA 2R5TA 3OVVA 4ANQA 4JXFA 5HIEA 4KRDA 3ZLXA 1CMKE 3FPMA 2YA9A 2QNJA 4LYNA 1OBGA 4J8MA 4BI0A 4GFGA 4APCA 4DEEA 2R3QA 4CRSA 3LM5A 4RC2A 3O8PA 3RHXA 3CD3A 3AMYA 3W8LA 4YC6A 3UVPA 1YXSA 4HGEA 3LVPA 2PTKA 3FE3A 3Q60A 4NM7A 4O0VA 4O1PA 3CJFA 3UQFA 2BFYA 5E1EA 3LFBA 4L6QA 3FXWA 4XV1A 4CFXA 5HEZA 3EL7A 4FF8A 4PL4A 4ACMA 4HJOA 2H9VA 4LV5A 1GOLA 5C01A 5EQYA 2W1HA 3K54A 3E63A 3QXPA 3WARA 3ZCLA 2QVSE 4FL1A 4BR3A 5F94A 5HG9A 3ALOA 4BGQA 5L2WA 2WGJA 4PMPA 1GIIA 3PXKA 3UPXA 2C5VA 3DNEA 4XBRA 2QONA 2XEYA 5HX6A 3DKOA 3BHHA 3MH3A 1OBDA 4I41A 3BLQA 2XJ1A 1YVJA 2QOBA 3WE4A 3D2IA 1UU3A 5M57A 3COHA 2XJ0A 4X2KA 3BPRA 2VNYA 3FQSA 3UODA 3H9FA 4E93A 4FKSA 4JS8A 5DEWA 3FKOA 2WMXA 1JOWB 1U54B 2RF9A 3R63A 2BHEA 1Z9XA 3PA5A 3PIYA 1ZWSA 2Y8OA 3OG7A 3EZVA 1PMVA 5E8ZA 4JIKA 5CEIA 4C35A 1LR4A 4W4YA 5E8WA 2WTDA 1BLXA 2NRYA 3ORZA 3DBQA 1YI6A 4R8QA 4XG9A 3QTXA 4HVDA 2WQEA 2XM9A 2WPAA 4X3FB 1REJA 4CFVA 3DU8A 2QOFA 3FY0A 3JY9A 4H3QA 4CEGA 5A14A 1W7HA 4AT5A 2CKQA 3K3JA 3FDNA 2ERZE 3LFAA 4QP4A 4C0TA 5HTBA 5IH4A 2UZVA 5JK3A 3CTHA 5CY3A 4RPVA 5E4HA 3TWJA 1WBWA 3KXMA 4F6SA 2ONLA 4EUTA 3RKBA 1J91A 4IBMA 3R00A 4ENYA 2YIXA 3SDJA 3CGOA 5HLNA 4K18A 1ZZ2A 4EH9A 2R64A 4YC3A 3P86A 2I7QA 4U81A 3ENMA 5DNRA 4CD0A 1YKRA 4OTGA 5CVGA 1Q8YA 3ACJA 2UW8A 3MH1A 4I24A 3PDTA 3ZFXA 5CSPA 1OIYA 4XMOA 3EYGA 4MBIA 3TXOA 1W84A 4W4VA 5AM6A 5IQAA 3ZUTA 3DDQA 3R01A 4X7QA 3C5IA 5I0BA 3FV8A 5IQEA 5HCYA 3VBQA 3W2PA 3PZEA 4B8MA 4DFZE 4JOAA 4PPAA 5JQ8A 2ITYA 5E90A 5J7BA 4M0ZA 3ORLA 5AV0A 4C8BA 3VS7A 2X2LA 2JBOA 4U79A 4DYMA 2WTVA 3PG3A 4P2KA 3NNVA 4JAJA 3M42A 4YZ9A 1WFCA 3QUPA 2GSFA 1M17A 4FUXA 2PK9A 5GZAA 3AT3A 3HP2A 4M12A 2B55A 3T3UA 1PYXA 3L8VA 4GK3A 4WD5A 4ASXA 2PVRA 1KOAA 4Y8DA 5AADA 3POOA 2WU7A 3A61A 3G0EA 3DY7A 2VTQA 4G3DA 4O7YA 1H26A 4UWCA 5KZIA 5LJJA 4FV9A 5K3YA 1X8BA 2FB8A 2NRUA 4EHZA 2ZMDA 4ZTRA 3DJ7A 4BGHA 4RWLA 3R9HA 3E92A 3WILA 5AV4A 5KMMA 3SKCA 4C34A 4IM0A 3ZMMA 1YW2A 5KMIA 3QAME 1OUYA 5B7VA 2O0UA 3Q4UA 4H3BA 2YLFA 1AD5A 4WUAA 4C02A 4DGGA 3F5PA 5AM7A 3KMWA 5EM7A 2YITA 4XG4A 3DQWA 5AP3A 5FEEA 3G5DA 3MFSA 3BWFA 3GCVA 4NK9A 1FBNA 5ITAA 4P4CA 4YHTA 2RG6A 5IU2A 3OCTA 1V0OA 5J7HA 3KCKA 4I22A 2YEXA 4L7FA 3W32A 1ZYLA 2WEVA 3VRZA 3JR1A 3EMGA 4M67A 4U7ZA 1NW1A 4LL5A 3S00A 2BRNA 2BTRA 3FMDA 3ZO4A 5GJFA 4BY9E 3BQRA 3MN3A 4Z3VA 5JZNA 4GYIA 3O2MA 4XG6A 2YCRA 2J0MB 3LE6A 3R8LA 3VRYA 3EFJA 3MTLA 4ALWA 3R7YA 3WF7A 5JZJA 1XO2B 3PJCA 4IJPA 2JLDA 4KRCA 1KE8A 1MQ4A 4DH5A 2XBJA 2UZEA 4BCKA 4HPTE 3PP1A 2GU8A 2PVHA 3Q5ZA 2HWOA 3QUDA 2O8YA 3ZONA 2QKWB 1UV5A 4FR4A 3W2OA 2IZSA 4ASDA 5LVOA 3BGQA 5I9UA 2XKDA 1F5QA 3G2FA 1OPJA 4E26A 4B99A 4C3FA 4FTCA 3NUSA 4G5JA 3JXWA 3K5VA 4QMMA 5B0XA 5JMSA 1OVEA 3GQLA 2ZMCA 1SNXA 3GOKA 4DFYA 4LUDA 4EQMA 2GNFA 4O0RA 4UWYA 3N4VA 5HE1A 4RG0A 3TT0A 3TUBA 5IA5A 4FGBA 3RNYA 4CNHA 4FV0A 4PP9A 5I9XA 5IZFA 2PVMA 3ZSGA 4PUZA 1GZKA 4IQ6A 4L67A 1CSNA 2PU8A 1Z57A 5CAOA 5L2SA 2HIWA 4J97A 4G9RA 3ODZX 1SNUA 3PVUA 4IB3A 5AAFA 4IVBA 3S1HA 4GUBA 2YIRA 4AZEA 4F7LA 2GHGA 4XLIA 1FGKA 5AP2A 2X9EA 3KF4A 3KXNA 3ZO2A 2ZYBA 4QMXA 5CTPA 3VN9A 5AA8A 3PSBA 3F7WA 2CNVA 1K3AA 2FYSA 1GJOA 4KSPA 5FP6A 4FKRA 3PVBA 3R7OA 3LHJA 5TO8A 4TYGA 2XK9A 4HYSA 2C6MA 3A8WA 4M14A 2RFNA 3QQHA 1PW2A 2HK5A 4ENXA 3U8WA 4MK0A 4BDGA 5AUWA 2BIKB 2YM3A 2PULA 3O50A 4V05A 4GFMA 3AG9A 3LQ8A 1PMUA 5E8UA 3UMWA 2W1EA 4RX7A 1UWJA 2OU7A 3I0OA 2VO6A 2J7TA 3O7LD 5K4JA 4F6WA 3MA3A 1GNGA 3I6UA 3E93A 4IWPA 4J99A 4IFCA 4NKAA 3ELJA 3B2TA 3FMJA 3OTUA 3LW0A 4DLJA 1SMHA 3ORTA 3Q52A 5B2MA 2ITOA 3MBLA 2ITUA 4PL3A 5EI2A 4GL9A 3AT4A 1O6YA 5J87A 4MHAA 5I5ZA 2WTWA 3FUPA 2C47A 4U80A 3ET7A 4E1ZA 3PRIA 4MXXA 3DLSA 2DQ7X 2ZDTA 4IHPA 1LP4A 2W5BA 3E8DA 2PWLA 3KC3A 3Q3BA 4FC0A 2Y9QA 4DFUA 1KV2A 3MA6A 3GOPA 3SVVA 5J1WA 2Q83A 3H9RA 1S9IA 2WIPA 5CVFA 3HZTA 3Q6UA 2UZTA 2XKFA 2XUUA 4M0YA 2OF4A 4XV9A 5KO1A 4QP9A 3B2WA 4J1RA 2BPMA 3VAPA 5EM5A 2GQRA 4E3CA 3C7QA 3ZEWA 3CS9A 3LQ3A 1W82A 3TZ8A 2HOGA 4QP6A 5KKRC 4A9SA 5IEVA 2HY0A 3R8PA 4TYIA 3BGPA 3OT3A 4UMQA 5A4LA 3GCSA 3MS9A 3R28A 1E1VA 1GZOA 3R7GA 5JRSA 3MTFA 4P90A 4BVUA 5AEPA 4IAYA 5K9IA 2J5EA 3LCOA 4BICA 2WMBA 3NYXA 3QXOA 4Y46A 4K0YA 4Q5EA 2E9NA 3RBWA 5CF6A 4O7RA 2Y6MA 2I6LA 3IDPA 2E9OA 2V62A 4IZ7A 3THBA 4KBCA 4R5YA 4BI2A 3CPCA 4KKHA 5DH3A 3RZFA 1DAYA 5EKOA 3UJGA 4FTTA 4BI1A 1G8AA 5ETIA 4RWJA 4ZMFA 3LFCA 4WKQA 1BL7A 2GQSA 4D5HA 3E5AA 2PHKA 4FT0A 3JUHA 2WQOA 3CY2A 2FSMX 4HOKA 2RL5A 2PVYA 4H58A 3FSKA 3HA6A 3NS9A 3TN8A 2ESMA 3F82A 3ZM4A 1NT2A 2C5NA 5J8IA 4QP8A 5I4NA 3EQPA 5IEYA 3ATTA 3FZRA 5KMLA 3QFVA 3UYSA 4QQTA 4FNWA 4FSZA 4O1OA 4ANMA 3ZUUA 3E64A 3LLAA 4ZIMA 2QODA 4FTKA 4H1MA 4PPCA 3SXSA 2XNOA 2C1AA 4QMZA 5EI8A 3VUGA 2XVDA 3F3UA 1B6CB 2C6TA 5H2UA 3UZRA 4BRXA 3COKA 3PE2A 4I0RA 4MD9E 4PPBA 4JQ7A 3DZQA 5LVPA 2Z7RA 3QHRA 1KE5A 4FIEA 1U5QA 2X7OA 5DGZA 2OW3A 2W1ZA 1M52A 5DEYA 4EK4A 4ZLOA 3QLFA 2QKRA 4U8ZA 3GU5A 3LM0A 2G9XA 5DI1A 3R8ZA 3UNJA 3QTRA 3G6HA 4IX4A 4BCNA 3MVHA 3NPCA 4GKIA 2YZLA 3U54A 1WBPA 1OECA 1GAGA 3O71A 4I21A 3MYGA 1XBBA 2P3GX 5BYYA 1K2PA 4RFYA 3MVLA 4DLIA 4BDKA 5CEMA 1UKHA 3L9PA 5AP1A 2ETRA 1OL2A 4BKZA 3I6WA 4EWHA 2J0LA 4BCJA 2B7AA 3P1AA 3PUPA 2CGXA 1NXKA 3GT8A 4MH7A 3OTVA 4O7TA 2UZBA 4DH7A 4EKLA 2R9SA 2UW6A 2X39A 4AA5A 4EKKA 1RJBA 2GCDA 2A19B 4M69B 3EYHA 4L7SA 3ORKA 3ZOSA 4PQNA 4BGGA 1H0VA 4USDA 4NCTC 3CCNA 1URCA 3EFKA 3VS4A 3N4TA 2YDKA 2XK3A 3OZ6A 4JR3A 3WI6A 4FG9A 3B8QA 2R2PA 2QI8A 2WAJA 1JAMA 2OBJA 4YZCA 5TKDA 2AYPA 4D2PA 4D9UA 4CVAA 1PRYA 5IQGA 4LL0A 3G0FA 4GK4A 4OTDA 1H1SA 2DS1A 2VTHA 4YJUA 3V8WA 1Q24A 4AW0A 4D2SA 1YRPA 3QTZA 4U3ZA 3UO6A 4RIXB 2YM6A 4L53A 4BBMA 4D2WA 1NVSA 1VEBA 2W5AA 4MQ2A 5CU4A 4YNOA 3TL8A 1YI4A 3IW5A 1RDQE 3L9NA 4QQJA 4LGHA 5KNJA 1CKIA 1SVHA 4ACDA 4CFMA 4NJDA 3POZA 3L9LA 2OLCA 5AP5A 3HECA 5ANKA 1ZOGA 3ZLYA 4EOKA 2X6EA 3NR9A 3KRRA 3QKLA 5F4NA 2UZDA 1JBPE 3GI3A 2GHMA 3TNQB 2A27A 5AMNA 5HBHA 3C0IA 2CDZA 2W1DA 5DYJA 3QA8A 1IG1A 4NCTA 4OW8A 1PY5A 5AV3A 3WZDA 3QUEA 3EFWA 3QQLA 4IAFA 2UW4A 4F0IA 3VO3A 3KVWA 2GNHA 5CAQA 3ALNA 1P14A 5HOAA 5BQ0A 3SXFA 2XCKA 2W05A 5BVFA 2CMWA 2IZRA 4TZRA 1JKKA 2LAVA 3PYYA 4QO9A 2EXMA 4D4SA 3BIZA 1OL6A 4I5MA 5EG3A 4D28A 4RC4A 5CT7A 4OTWA 5C26A 1XH9A 3HL7A 3PRFA 3R6XA 1UA2A 1ZZLA 3C4FA 2GFSA 4BCIA 3MPAA 4LRMA 4GSBA 4TWNA 4WRSA 2X0GA 1OL5A 5E8TA 4XYFA 3FHIA 3ZDUA 3AC8A 2PMNX 4F9WA 2XIXA 1IRKA 1FVVA 3GC0A 4F64A 1B38A 2CNUA 4RJ3A 4B8LA 1XKKA 4MKCA 3R21A 3DGKA 4FI1A 3VBWA 3CKXA 3ZXZA 3FMKA 3ID6C 5HICA 4EORA 3I1AA 2QG5A 5J9YA 4U43A 2OJGA 2PPQA 3QA0A 5FXRA 2BDJA 4ACGA 3N9XA 3MY5A 3H3CA 4Y5QA 5CQUA 3BHYA 4TWCA 3PVGA 4O84A 3TKUA 4YBJA 3QTQA 1OGUA 2W99B 5CSHA 5JGAA 4CFNA 3EN9A 3HMMA 4EL9A 2QOKA 3NUUA 4P7EA 5AUZA 2XMYA 2X81A 2FSTX 2PYWA 2FA2A 2PVFA 4I5CA 1M7NA 1IR3A 2XB7A 4B7TA 5DPVA 2YIQA 4DEHA 4WSQA 4EOQA 5IH6A 1K9AA 4LGDA 3RGFA 4TYEA 4C59A 2VU3A 4DA5A 2VX3A 4CFFA 1Y6AA 1YDTE 1ZMWA 2DWBA 1P4OA 2G1TA 4FT7A 4GV1A 4KIKA 5CNNA 3TV7A 3VUMA 4M15A 3EN7A 4YLJA 4D1SA 1NVRA 1CM8A 5JRQA 1OIUA 3Q2JA 2VGPA 3LZBA 2GS7A 3P0MA 4PTGA 1YOJA 3CP9A 4EH2A 2ZM4A 4DTBA 3OEZA 2ITWA 4YJRA 3DBEA 3G33A 2FO0A 4MXOA 3QKMA 4CV9A 4TW9A 3W1FA 2W17A 5EH0A 3VUTA 4DCAA 4ZS4A 3NDMA 4FV7A 2OK1A 2VWVA 4NFNA 3W2QA 2UVZA 3C4ZA 5TR6A 1SVGA 2UZNA 2BCJA 1HOWA 4ZMEA 3DDPA 3KRXA 4WNOA 4A4OA 5GIPE 3PXRA 5BNJA 1QCFA 4RJ7A 3BV3A 3HAVA 4PMSA 3DBFA 4XNEA 4A9RA 4ZJJA 5KKRB 2P2IA 3EN5A 4FT5A 5AV2A 4EH3A 3VW6A 3RWQA 4BDEA 4MAOA 4V0GB 5ICPA 2J4ZA 1W98A 4FSWA 4PTEA 4V04A 3EN6A 4A9YA 2XIYA 3EQDA 4XG2A 5HORA 1KWPA 2QHNA 3RP9A 1I09A 3QCSA 4IAKA 3U9CA 4R1YA 3MPTA 4QQCA 4ZP5A 3F9NA 1M2QA 2J0IA 3OD6X 1QPCA 4OTRA 3V5TA 3ENHA 4FUYA 5DR2A 1Q5KA 4A9UA 5CAPA 2ZM3A 5DT3A 3VBTA 2HXQA 4JL9A 4AZWA 2BDFA 5CASA 3KULA 1YI3A 2WFYA 3Q53A 3ACKA 4BKYA 2PUUA 5LQFA 3HGKA 2PMLX 3A7FA 5D41A 5HO6A 3EN4A 4JDJA 5HHWA 3VVHA 5BUJA 5FTGA 4C2VA 4F0GA 4RMZA 4QPSA 1FVRA 4QTBA 4QT1A 2ACXA 5FBNC 4JAIA 4HGTA 4FZFB 4R7BA 3R7UA 2I0YA 2B52A 4Y83A 3G9NA 4FZ7A 1JPAA 2H8HA 5H8BA 4PMMA 3MESA 3O96A 2B0QA 4DG0E 1JQHA 5IUIA 4QRCA 4QMPA 3BX5A 2HWPA 4AN9A 4DINA 3N4UA 1KSWA 1AGWA 2X8DA 1OL1A 5K4IA 5HIDA 3CQUA 5GNKA 2XNPA
chains in the Genus database with same CATH superfamily
2WZJA 3UPZA 4UXQA 4CZUA 5BUEA 4C4EA 4Y85A 3Q9WA 3MJ2A 3V5LA 3ZSIA 5M56A 3MGYA 4QYGA 4ANNA 3LOKA 5TT7A 4FSRA 2C3IB 4RVLA 2V5QA 3FLSA 3OWPA 5HD7A 2PY3A 3PXQA 4BHNA 2HZIA 4D1XA 2BAKA 3W2SA 4ZJVA 1J7LA 3PVWA 1TFFA 4RIWA 4D2TA 4ZJIA 4FG7A 2VV9A 3AGLA 1CKPA 3HDNA 5ETFA 2VTJA 3QD3A 4DBXA 2XP2A 1XH4A 2WKMA 5GIOE 5CU3A 1DS5A 4X2GA 3QQGA 4UY9A 3FLZA 2RSVA 3O17A 3OBJA 3PJ3A 1EH4A 3NNUA 4GMYA 1DAWA 3V5WA 3UVQA 5HBJA 4K2RA 1Q3WA 2BUJA 4YPSA 3OCGA 3UNZA 4C37A 2OIDA 3ZBXA 2G15A 4L01A 1VZOA 4GEOA 3H0YA 3WZEA 4FEWA 4RX5A 4YSMA 2W7XA 3V51A 4II5A 2XNMA 4AGDA 3F3VA 3BL7A 5EQPA 3GB2A 4CXAA 3VS1A 3PE1A 1L3RE 2WO6A 1DI8A 4PDSA 4EK3A 4EQUA 5J79A 5M53A 1UNGA 2GS6A 2PMOX 3C1XA 3CTQA 3FYJX 4EOSA 1NY3A 4TRLA 4F99A 2JDRA 3BWJA 3DBCA 3V3VA 4O91A 4ALUA 4NUSA 4AG8A 2XH5A 2VTAA 3QU0A 3GC8A 2OIQA 3UOJA 3OT8A 4LFIA 3WYXA 4BZOA 4AGCA 4BWPA 4ASEA 4BCOA 4NYEA 1KE7A 4FTUA 3GVUA 1GIHA 4K9YA 5AP6A 5IMEA 4DFNA 3VW8A 5AUXA 2CNQA 3DZOA 4JG6A 4D4YA 1H8FA 2WMTA 4I5HA 1CTPE 5A4CA 1H24A 3IW8A 4G6OA 2HELA 2XIZA 4UB7A 4X0MA 2VTNA 3MY0A 3BV2A 4ZEGA 4BKJA 5IISA 4RQKA 4AOTA 3VBXA 4C61A 3JS2A 2C6OA 2ONLC 4UWBA 1VYWA 3ULZA 4D58A 4YJOA 2R3JA 4IFGA 3NCZA 3FEGA 2ETMA 4Z7HA 3T9IA 3LMGA 2O63A 3PXFA 5LCKA 4A4LA 4CRLA 4CSVA 3MI9A 4V01A 5HCXA 4FKPA 4AU8A 4IAZA 4DFXE 4IM3A 1YOMA 4TPTA 2QO7A 4ZSEA 4CZYB 4C7TA 2ITPA 4O86A 4D4VA 3DT1A 3BZ3A 3F88A 5AX9A 4XCUA 3VC4A 3FI4A 1TZDA 2VGOA 4AN2A 2G2HA 4TYHB 3R8MA 2VNWA 3MV5A 3G90X 3OW3A 3KY2A 4FSYA 4KKEA 3VULA 4U40A 4ZTNA 4AQKA 1XBAA 3QCYA 2CLQA 3KKVA 3KXGA 2R3GA 5AP7A 4FKUA 4QDEA 3RK7A 3D7ZA 3QQJA 4MEDA 4ITJA 2Z7LA 2OZAB 2VTOA 4J53A 2A4LA 4PMTA 4IWOA 4QD6A 4RBLA 5CLPA 4BDCA 4U9AA 4FL2A 3KEXA 3QTUA 4QMVA 4HVIA 4M8TA 3KMMA 2X2KA 5IQDA 1OIRA 1PJKA 4E4NA 2IN6A 3UQCA 4QYEA 1VYZA 2UZUE 3GQIA 3IONA 3PY1A 3VHEA 3VS0A 4JI9A 1R0PA 3RNIA 2JIUA 4LOOA 5J9LA 1IAHA 3LMHA 3NUPA 4KIKB 4MQ1A 4IIRA 3KQ7A 3NSZA 2R3PA 4FTJA 4IACA 3TM0A 4FSUA 5AJQA 5JFVA 1OKYA 1ZY4A 2CN5A 1OL7A 2IVSA 3TTJA 2O2UA 4U5JA 4EBVA 4O6EA 3IDBA 1J7IA 2VTPA 3V6RA 5BVKA 1KOBA 2NYAA 4D5KA 5CYIA 4YJPA 3U4WA 3BLHA 4QMOA 4CG8A 4FSNA 3R8VA 2VTSA 5HX8A 1W2FA 1CDKA 3A4OX 3QRIA 1URWA 4MXYA 4D0XA 3LXKA 3CC6A 3FBVA 1YDSE 3PJ1A 2QOCA 3QTIA 4JDIA 4L68A 4EI4A 2JIIA 2IPXA 4BTJA 1Q3DA 5LOHA 4QOXA 4X2NA 1MQBA 4WUNA 2EB2A 4BCGA 3W8QA 4UYNA 3R7IA 5FRIA 2XIRA 3KRJA 5KHXA 2YAKA 4KS7A 2XK8A 5CU0A 4IZ5A 3ZO1A 5AIRA 4QP2A 4R7IA 5H8EA 4XV3A 3D7TB 4FJVA 3D15A 1JKTA 3FLQA 3OOGA 3V8TA 2IJMA 4FKQA 5CXZA 5E8XA 5LMAA 3QWKA 2OXXA 3CR0A 4AW1A 3QCQA 4DGOA 2BAQA 3JVSA 3VQHA 3QC4A 2OJIA 4XJ0A 3FC2A 4O0WA 4JMQA 4LG4A 2GNLA 2VUWA 4PDOA 4YLLA 4FYNA 4YHFA 3FQHA 3KULB 1B39A 3QTWA 2R3MA 2WMRA 3HV3A 5BYLA 4RIYB 3HMOA 2Q0NA 5C27A 4C3RA 4NM3A 3CXWA 3U6IA 4FKWA 1YWRA 3FXXA 1GZNA 4LMNA 4C33A 2Y0AA 3ROYA 5DN3A 1Q62A 3LAUA 4WO5A 2ZFYA 3PFQA 1RQQA 2IW9A 4BL1A 3ZTXA 1TQMA 3Q5IA 1Q97A 1F3MC 1H1QA 3SLSA 1H25A 2QLQA 4FV2A 3CSVA 3MIYA 3WF6A 3A60A 4BWXA 3EQFA 4EWQA 4F78A 3PJ2A 3BLAA 2X7FA 3FKLA 4L3PA 4JG8A 4ZTMA 3P5JC 5HIBA 2YM4A 3BEGA 4BDBA 3ATSA 4O22A 3QZIA 4IDVA 1J3HA 3L8XA 2R3IA 3P9JA 3UE4A 1J1CA 3F2NA 5FM2A 4QP1A 1LUFA 2BKZA 2WMAA 2YM7A 4O0TA 3FQEA 1A48A 3F2RA 1OKVA 3RK5A 3A7IA 3O23A 4L46A 2FUMA 4L3JA 5HG5A 3QRUA 4CYJA 3P4KA 5J9ZA 4K1BA 4IB1A 3VONA 3RVGA 3O8TA 3MPMA 2PZPA 4BZDA 1R1WA 2X6DA 5IA3A 4FIFA 3FMHA 5JGBA 3DKFA 4MD8E 4RJ6A 3RALA 4PDPA 4F4PA 4ZY4A 4ID7A 5IA2A 4TY1A 4FV5A 4QMSA 4QP7A 3QALE 4M13A 4BYJA 4BF2A 2C68A 3F7ZA 3R02A 4N0SA 4QMQA 4PWNA 1MUOA 2AQXA 5A3XA 3V5JA 4F1OA 5FWKK 2WMVA 3FKNA 5KHWA 2QCSA 3EZRA 4ZSGA 2R3OA 3V8SA 4RSSA 1UU9A 2JDSA 4H1JA 2WB8A 5HLWA 4NEUA 4E5AX 3U6HA 4O7ZA 1DI9A 2JKKA 3A62A 4DF3A 4BCFA 4DTAA 1PYEA 3KN6A 5HO8A 4ONAA 3R7EA 2SRCA 2HYYA 3S3IA 3LJ2A 2VZ6A 4UMUA 2UVYA 4GIIA 4QQ5A 2XK4A 3TIYA 3PXZA 1U46A 2C6IA 2XNEA 2C6DA 2YHVA 5E1SA 3SXRA 4AA0A 3W10A 3TZ7A 4RWIA 2ITXA 3C0GA 2IVVA 5L6OA 4KINA 4BBFA 5J95A 2WMUA 3A2CA 4O6LA 4WT6A 2VX1A 4HCUA 4I93A 2J5FA 5H9BA 3HUBA 2NO3A 3V6SA 3V5QA 5I3OA 2DUVA 4CQEA 1WBVA 4DITA 3P5KA 4X6RA 3FL5A 3RAIA 2HCKA 4ITIA 4R7HA 3S4QA 4GW8A 4YO4A 4F7SA 2I40A 3D83A 3PLAE 4FT3A 4G6NA 5KMNA 1HCLA 5HTIA 4CGAA 3VIDA 5KBRA 2Y4IC 4YJSA 3DS6A 4EHGA 5AUUA 2R3FA 4XV2A 4YZMA 2VTTA 3KRWA 5CEQA 3IK3A 4U44A 3BE2A 3R0TA 3E8EA 3ERKA 3HMNA 3QRTA 4Q9SA 1UNHA 2ZAZA 4U3YA 4PV0A 3UP2A 3CD8A 3F69A 4G9CA 3FSFA 2YM8A 4EUUA 5JFWA 5EFQA 4FV4A 3COMA 4MNEA 3LPBA 1Z5MA 2X4ZA 5H3QA 3SRVA 4DTKA 4M66A 5GHVA 4BTMA 2XIKA 5E7RA 3NCGA 4JDKA 5L3AA 3D0EA 2W1CA 1T46A 4H05A 2Y6OA 3NEWA 4OUCA 1PXIA 5ETAA 3ULIA 3QYWA 5KBQA 3EQCA 3ZZEA 5LVMA 4IEBA 1TVOA 1BUHA 4UMRA 4FTAA 1Q61A 5EM8A 2OJFE 2ETKA 3UDSA 2VWWA 5C8MA 5IMXA 4QMWA 3UNKA 5CZIA 2B4SB 3OF0A 5EDQA 2ITTA 4JBQA 2OXDA 3TNIA 2CGUA 2X7GA 3F2AA 3HV5A 3D5VA 2VN9A 4I20A 2Y7JA 3FZOA 4Y73A 5DE2A 3CY3A 1PHKA 3IW7A 3NFGB 3KXZA 2BKKA 2ITQA 2W4KA 4UEUA 4AAYA 3DAEA 1MP8A 2UZWE 1FPUA 3NAXA 4MXAA 2C5YA 4GT4A 2F49A 4RA4A 4UMTA 3FLYA 2RFSA 1JVPP 4AQCA 3CLYA 1Q8UA 4FEVA 2AEGA 3BEAA 2XK7A 3H9OA 1H1RA 2GHLA 2DYLA 4ZTHA 3PWDA 3G15A 3OWLA 3VF9A 3CQWA 5EQEA 5HO7A 1NA7A 4FEXA 4MVFA 5JFSA 4BJJA 4C4FA 3RCDA 3NW7A 2XALA 5JT2A 5BYZA 1LEWA 5BVNA 2BZHB 3UBDA 3LCTA 5G1XA 3EQBA 3F61A 3NIEA 4S33A 3UOHA 4DEDA 2OZOA 3PZHA 4Z55A 2P33A 2NPQA 4NIFA 2EUFB 1A06A 3O51A 1WBTA 2VTLA 3WF9A 5D11A 2QC6A 5ACKA 4BC6A 3I7CA 4EC8A 4F09A 2R3HA 2Z7SA 3LCKA 4YURA 5IQHA 1PMNA 5BVDA 4RLKA 5HE2A 2X0PA 3CIKA 4FKOA 4LV7A 4CT2A 4M68A 4OBQA 4CT1A 4F7NA 2XK6A 5M07A 3KFAA 3S0OA 4IVAA 5D9HA 5AAGA 5FD2A 3NYVA 2QQ7A 3R9OA 4N57A 1BI8A 4UALA 4KIPA 4QP3A 2X8EA 4BTFA 3WBLA 4Z7GA 3C0HA 3C4CA 2CN8A 2OG8A 3VQUA 4X2JA 4AP7A 1ZMUA 4I23A 3GCUA 4LV8A 2F2UA 2GS2A 1PXPA 3FC1X 3DFAA 1U5RA 5B2LA 4PRJA 4YGAA 2CKEA 4ZSLA 4QEBA 3Q9YA 3PPKA 4CYIA 2OICA 4W8DA 2W96B 4GT3A 4TL0A 4S30A 4JG7A 3FZPA 3VS2A 3R83A 2OJ9A 1WZYA 4WBOA 4RRVA 2XRUA 2QO2A 5C1QB 2WTCA 3NMUF 4ALVA 4QMYA 5LWMA 2F2CB 1UU7A 4EZ5A 5L6WL 1QPJA 2ITNA 1UKIA 4TN6A 3VBYA 3O5AA 4LI5A 5AR4A 3GC7A 3QLGA 5FDXA 3OY1A 4R5SA 2WQBA 3QC9A 5HESA 3SQQA 2UVXA 5AUYA 5IQBA 2Z2WA 3E8NA 1O9UA 4OGRA 4R6VA 2XYUA 4YPDA 4USEA 4KUJA 1FINA 1REKA 3TG1A 5CQWA 4DH8A 3QCXA 3U51A 3FZ1A 5TE0A 4F9BA 4FIHA 4QTDA 4DH3A 3DA6A 2PL0A 2VX0A 2X9FA 3A7HA 1O6KA 3EQGA 4J98A 4X6QC 4ANSA 3SW7A 4NJ3A 2JDTA 4O96A 5CSXA 4CV8A 3D5XA 2OI4X 4FZDB 5FEDA 4YP8A 3OC1A 4AXAA 2WD1A 4XS2A 4NKSA 1RW8A 5E8YA 1WVYA 5AX3A 4NFMA 4CLJA 3DQXA 2KULA 4U0IA 4WNKA 3AOXA 4BIEA 1PXKA 4BN1A 5IA4A 2BFXA 2KTYA 4FV1A 4AT3A 3AC2A 5EDRA 2JDOA 5AP4A 3TI1A 3GGFA 5M06A 1XWSA 4YTCA 2C1BA 3P7AA 2J0KA 3NW6A 3UQGA 5M44A 1R0EA 3EQRA 2VWUA 3IGGA 5L8JA 3R9RA 1JSVA 4I6LA 1XH8A 3IKAA 4J96A 2W9FB 5M4FA 2OF2A 3PSCA 3F5GA 4FK3A 4AE9A 4K8AA 2GPHA 3RCJA 3DBDA 5IA0A 3HRFA 2XBAA 1ZOEA 3H4JA 4FTNA 4G3CA 3PIXA 5AR5A 3WZJA 4FODA 4CCBA 4HNIA 3PPZA 1QPDA 2BZKB 3GFWA 4F9CA 4FSMA 4O38A 1WVXA 3F5UA 1PXLA 3BYUA 2WOUA 2H6DA 3DPKA 3GC9A 3HKOA 4FT9A 3RAHA 3R9DA 4AGUA 3OHTA 4L00A 3HUCA 5ANGA 3OW4A 3VUKA 2QOOA 4JNWA 3SHEA 4D9TA 4OBPA 2JKMA 4IDTA 2CPKE 5TOZA 1YXTA 3UO5A 2WTJA 3MH0A 5EYMA 4W4WA 4AACA 1XR1A 3HMPA 5CALA 1WBOA 4AF3A 2BZIB 4YJQA 2AC3A 4AZTA 3OFMA 1J7UA 2X1NA 4RFMA 5KZ0A 3PPJA 4C3PA 5IA1A 4FTMA 4AX8A 4QNAA 4EH7A 4DT9A 4WIHA 5E8SA 4FKIA 5EW9A 5AAEA 1ZLTA 3ZYAA 5IPJA 4D0WA 5CU6A 3KB7A 5EYCA 4HVGA 3CQEA 4C4GA 2EVAA 4KAOA 2HZNA 3DAJA 3I5ZA 4Y72A 4FTQA 2GTNA 4AZFA 4F70A 4KD1A 3CEKA 3ZRLA 1WCCA 1IEPA 4GIHA 3QTSA 1H4LA 3TKHA 5L6PA 3W0QA 1U54A 2UW3A 4YLKA 3D4QA 3A7GA 4RX9A 3KREA 5JN2A 4RIOA 3HEGA 5FTQA 1ST4A 3ODYX 4FOCA 2RFEA 2XEZA 3QRKA 3VS5A 4BDAA 3BBTB 4JX7A 1Q4LA 1TQIA 4AT4A 2Y4IB 1WMKA 5EKNA 4I5PA 4G1WA 4ZXTA 4X3FA 2J90A 2CKPA 1FMKA 5A46A 4GK2A 2XKCA 4O83A 2HW7A 1XH7A 2B1PA 4GJ2A 5AR7A 3TACA 1KE6A 5F9EA 4EH6A 3DKGA 3HYHA 2QLUA 4CCUA 3QGWA 3ORIA 3ZSHA 4CKIA 3C50A 3L8SA 4PX6A 2BHHA 2RFDA 1W2DA 4CFUA 4QNYA 4YBKA 4DT8A 2UW0A 2R7BA 2C3LA 2YWPA 4Z9LA 3GCQA 5HLPA 4JBVA 3DXNA 3VUHA 4I0SA 4D55A 4BDJA 3KK9A 4GJ3A 4RJ4A 4DFBA 3H10A 1R39A 2P0CA 4B6LA 5DR9A 4E4MA 3KN5A 2PVJA 4C57A 3HRCA 4O27B 1VJYA 5DA3A 3UIXA 4DHZA 4OTQA 2V7AA 3S2PA 3D5UA 3BI6A 3OOMA 2PZYA 3BU6A 2F7EE 4W9WA 4IB0A 1OIQA 4OAVB 4XX9A 5CWZA 3FI8A 3OBGA 4ZOGA 5FTOA 4XG8A 3BLRA 3LXPA 2PUPA 1Y6BA 3R73A 3ZC6A 5AV1A 1WVWA 2AUHA 3QHWA 3TKIA 2E9UA 1SZMA 3AC4A 3QX2A 5JEBA 4L43A 2V22A 4EQCA 3IOPA 2CGWA 3F3TA 4OTFA 4ANOA 4NZWB 3P79A 4U42A 4O0YA 3CPBA 5LMKC 4AE6A 3NVKI 3FI2A 3HV4A 1APME 4F9YA 4Z16A 3DFCB 3FY2A 3M11A 4ANBA 4E5BA 5I9VA 4EHEA 1YWVA 1QMZA 3FLNC 3O8UA 2IVTA 4AZVA 3PUFC 5EW3A 2R3KA 1YQJA 2PZ5A 2ZV9A 5ANIA 1Y8GA 3TDWA 1YOLA 5IDPA 3R71A 2W4OA 5FEQA 4YTIA 2YACA 2YWVA 3DXQA 2JKOA 3JPVA 4C38A 4ASZA 4KBKA 1FMOE 4FIGA 4ERWA 4FNYA 4ERKA 3SGCA 3SG8A 5DR6A 5TF9A 4KABA 2YDJA 3UZTA 1BI7A 5DMZA 3DB8A 3P78A 4FV6A 4D1ZA 4ORKA 4GVJA 5A6NA 4FGRA 2YCSA 4YTHA 3OMVA 2QR7A 5DRBA 2C0OA 3C4WA 2VTIA 4TXCA 3ORXA 1OZ1A 2JEDA 3UO4A 5LMKA 4FTRA 1TQPA 3EB0A 5HCZA 5T68A 5DG5A 3EFLA 4HNFA 4EOIA 4OBOA 4KIQA 4GKHA 5HVJA 4ZY6A 3MVJA 3QX4A 3UG2A 5CSVA 3R1YA 3ZHPC 5M4UA 5F20A 4WHZA 2PZRA 5M08A 3GU6A 4IC8A 1OMWA 4IMYA 5C9CA 4G16A 5EOLA 4E7WA 3SOCA 3UDBA 3WIKA 5K5XA 2HXLA 3O0GA 3E8CA 4EJ7A 4YO6A 4DHIB 4BDFA 2QU6A 3MB6A 1H01A 3L8PA 1MRVA 4X21A 3RTPA 4LUEA 2Z8CA 2BRGA 3DJ6A 3KXXA 2YCFA 3QF9A 4JT3A 2GNGA 2CJMA 4NT4A 5F95A 4CMOA 1W0XC 4J71A 2WU6A 1BX6A 3UVRA 3F3ZA 5DRDA 3UGCA 3LXNA 3ZM9A 2PE2A 5IQFA 3PTGA 3NW5A 4IAAA 3DV3A 3DXPA 1ZYJA 5C4KA 4HCVA 3EQIA 5ANJA 4IX6A 4DG2E 3CE3A 4MBJA 2YJSA 2YM5A 4E6DA 3T9TA 3ZFYA 4LMUA 4RQVA 3AC1A 4USFA 4UN0C 4M3QA 2QU5A 4QMLA 4AXCA 2YAAA 4EC9A 4DHJA 4NU1A 4WG3A 2C5OA 4O4EA 3TNPC 2I0EA 3R2YA 3BYVA 2PUNA 2X8IA 4AN3A 5BVWA 2IWIA 3ANRA 3AKKA 4Y5HA 3CJGA 3TNHA 5GJDA 5LCJA 4FKTA 3FMEA 4S2ZA 2WELA 3QQFA 4RZVA 4F9AA 4AFEA 4YZNA 4NH1A 3GBZA 5ANOA 1M7QA 5JH6A 3NLBA 2B54A 3QD2B 4H39A 1VR2A 5AFVA 4PY1A 1WAKA 4AWIA 4QPMA 5AWMA 2P2HA 4G5PA 4PF4A 3QWJA 3AQVA 3OUNB 4ZLZA 3L1SA 1ZOHA 3TMOA 2E9VA 4YJTA 4TWOA 4C4HA 3SD0A 5A4QA 3Q4ZA 5HU3A 3ZBFA 3LCSA 2ZB0A 4EBWA 2JC6A 1Q8ZA 2WXVA 2X0OA 4XG7A 5CEKA 3EJ1A 4I6FA 3TUCA 4RLLA 3MDYA 2XCHA 2QOLA 2V7OA 5GJGA 2HAKA 1M2PA 2FSLX 5HU9A 4ZY5A 4CFWA 3KXHA 3LIJA 4FNZA 4MTAA 5B2KA 3E88A 2QO9A 5CENA 3FL4A 4YMJA 2JFLA 1T45A 3LQ5A 4L45A 5HKMA 3RM6A 3HVCA 2VTRA 3BYOA 3DCVA 1YDRE 3KVXA 4JQ8A 4R1VA 5CU2A 3RI1A 3V01A 2WTIA 2J9MA 2XAMA 4APPA 3NVMB 3GCPA 4FNXA 5IKWA 4WBBB 4UMPA 3CBLA 3UOLA 5I9ZA 2EXEA 4KBAA 3LFSA 4DN5A 2C6KA 5LARA 3ZFMA 4P5QA 3SA0A 5K0KA 4FTLA 3SOAA 2IZUA 3QGYA 4N70A 3CKWA 4MCVA 3NZ0A 4S32A 4L42A 5E92A 2BILB 4TT7A 4ZZMA 1H08A 3H30A 2ZDUA 5D10A 3RAWA 1QPEA 4OLIA 3RPOA 5KE0A 1ZXEA 4MBLA 1Y57A 2QOQA 2VO0A 1GY3A 3AXWA 3DB6A 1JKSA 1JSUA 3QKKA 3WF5A 3BYSA 4WRGA 2OIBA 2R3NA 3VS6A 3E7OA 3PWYA 4M7IA 4R3RA 4RGJA 2OKRA 3PP0A 4FZAB 4I4FA 5CT0A 2PE1A 3I5NA 4AXDA 2XA4A 4ZTQA 3R30A 4U41A 4DEBA 3NUAA 1A9UA 4XRLA 4BB4A 3ZH8A 2NNWB 1BMKA 3S95A 5C4LA 3W0SA 5E9EA 5AA9A 1XMMA 5DHJA 2ITZA 1ZAOA 3FMMA 4YJNA 3BL9A 2YN8A 4HGLA 5EYKA 3HNGA 4IE9A 4LOPA 5FG8A 4UZDA 2VO3A 5DIAA 2IEWA 5HQ0A 4EHVA 4FEQA 1KUTA 3MSSA 3ETAA 4OTIA 1J1BA 4HYIA 5K0XA 5EHYA 4J8NA 4CTCA 5AP0A 2BVAA 1IAJA 2CCIA 1PMEA 4XH6A 4C58A 2QOHA 2PVLA 4CMTA 4HZSA 4EH5A 1WBNA 3C13A 3ZRKA 2WNTA 5FP5A 1ATPE 1SM2A 4ZZOA 5CANA 2QG7A 1FVTA 2REIA 4FTIA 3ZXTA 4AZSA 5J5TA 4EK8A 3R1NA 3C51A 4D2RA 4RZWA 4DGLC 4H3PA 3QD0A 3Q4CA 5BMSA 2A1AB 4MXCA 4FV8A 4O4FA 5LWNA 2IG7A 1ERKA 1JKLA 5E91A 3AT2A 1H07A 1UVRA 3A7JA 4MXZA 4NTSA 5L8KA 2CSNA 3NYOA 1PXNA 2YERA 3ZC5A 2UW5A 4JQEA 4QYYA 5HG7A 3WZKA 4O2ZA 3LCDA 1OUKA 1UWHA 3EOCA 3HV7A 4MF1A 3EHAA 2XNBA 4FA2A 1SVEA 4DEGA 3MFRA 2GQGA 4O2PA 1Q8TA 3M2WA 4BYIA 4JVGA 3A8XA 4X2FA 4O4CA 5CEPA 4NM5A 5FBOA 4IC7A 2WEIA 4F63A 5K5NA 5L4QA 2ITVA 4J95A 2JD5A 4FMQA 2O5KA 3P08A 3V04A 4G2FA 3KL8A 3R9NA 3ITZA 5IH5A 3VJNA 3KGAA 3W2RA 5KCVA 1RE8A 4AS0A 5CF5A 4CQGA 2OSCA 2ZV8A 3MVMA 4JLCA 4CZTA 4HYHA 3LJ1A 2BZJA 4E8AA 1LEZA 4WSYA 4ZSAA 1XHAA 4IW0A 4ACCA 2NP8A 3EQHA 4I3ZA 4GT5A 4ARKA 4XUFA 2W9ZB 4I4EA 3GU4A 2C3JA 3QRJA 4TWPA 4NL0A 1Q41A 4I0TA 4FE2A 3RJCA 4FKJA 3ZLSA 3LKMA 4O0XA 4QTCA 4U97A 3GENA 2VWYA 1LPUA 4O7LA 3HP5A 2R4BA 3NNWA 4I6QA 3LFEA 5IUGA 3W18A 3BBWA 1KV1A 4ZTSA 4S31A 3D5WA 2VWIA 4GCJA 3RZBA 1HCKA 4G34A 4G31A 2OH4A 2OO8X 4O81A 2W4JA 3LFFA 2J2IB 4P5ZA 2UUEA 1GIJA 5D12A 4AAAA 4EZ3A 3AKLA 4JDHA 5CZHA 3VWAA 5J1VA 4FZ6A 3R8UA 5JQ5A 3PG1A 3NGAA 3HA8A 4D4RA 3VF8A 4BWKA 5DOSA 4YJVA 3Q2MA 5A4EA 3ANQA 3UMXA 4RIWB 4HVHA 3PA3A 4IAIA 2LGCA 3UIMA 2ZVAA 2BRBA 1MRUA 1BKXA 1FGIA 4XHKB 3UOKA 3HLLA 1M2RA 5DLSA 4ZK5A 4XLVA 4BTKA 3MB7A 3NX8A 2YLEA 5EHLA 3Q96A 2V55A 4B9DA 3UYTA 5IQCA 5M09A 4EOPA 2A0CX 5CNOA 2BRHA 3DLZA 2OFVA 2QR8A 3BYMA 4JJRA 4IZAA 4E6QA 5BVOA 5LXMA 3LFQA 2HZ4A 4RX8A 4C4IA 4QMTA 3BHVA 3SX9A 3GXLA 5FUTA 1ZY5A 3NUYA 4EZ7A 2QOIA 3TEIA 4MUQA 3ZEPA 1KE9A 2O3PA 4M69A 5HNIX 5CF8A 5EOBA 4A4XA 5DT4A 1P5EA 3MW1A 4JX3A 4C4JA 5KX8A 2GDOA 2OXYA 4N4SA 5JFXA 2CKOA 3BGZA 5G6VA 3HDMA 4DHFA 4I6BA 2PSQA 2VAGA 5ANEA 3ZLWA 4DEIA 4C2WA 2CHLA 2WMWA 5KMJA 4EOOA 3WYYA 2C6LA 2UW7A 2VTMA 4FX3A 4K33A 4MWHA 2IO6A 2JKQA 3KF7A 4AFJA 4E4LA 4L8MA 2XF0A 1OPLA 4TYJA 1H0WA 2JAMA 4RFZA 3A99A 3AMAA 2JIVA 4IWDA 4JIAA 3TZMA 2PVNA 4RIXA 4Q9ZA 4R77A 2PZIA 3QZHA 3G6GA 2B9JA 5KMKA 4CTBA 4IH8A 1Q8WA 3FJQE 4QMNA 2WQNA 3IDCA 3A4PA 2J50A 4GVAA 3NRMA 4QTAA 1ZMVA 1OKZA 2WIHA 2EU9A 5IQIA 2W1FA 3OCSA 2GTMA 3M1SA 2XARA 3HX4A 2QHMA 5CSWA 4A06A 5C8NA 2W1GA 3IGOA 4GG5A 3Q4TA 4E6CA 4FSTA 1GZ8A 2BDWA 2EXCX 4JBOA 1ST0A 2EWAA 2FGIA 1YXVA 3PIZA 3IS5A 4FOBA 3RPSA 1XBCA 1JNKA 2G01A 4L3LA 4FV3A 1L8TA 4KKGA 4ZSJA 5IF1A 1IA9A 3DK6A 4FIJA 4EJNA 3QL8A 1G8SA 4X3JA 4HGSA 1XQZA 4NWMA 4R3PA 4DBNA 4L52A 4M97A 3BKBA 3BU3A 1E9HA 2XRWA 2GFCA 4YNEA 4XP0A 5AIKA 3SW4A 4EK5A 1SYKA 2OFUA 2Q0BA 4FL3A 2IZTA 1Q99A 1YXXA 3BRBA 3EH9A 4K6ZA 3BE9A 3IW4A 4GYGA 3GFEA