4GSBA

Monoclinic crystal form of the apo-erk2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
343
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGMVCSAYDNLNKVRVAIKKISPFEHQTYQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monoclinic crystal form of the apo-ERK2
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 111
structure length 343
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gsbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gsbA01
5CALA 3L9NA 2O2UA 3QA8A 4NSTA 2PULA 4W4YA 4I94A 3QQHA 4AQCA 4YZDA 4D9TA 2B1PA 2W96B 4HZRA 2ZV2A 4P5QA 3MPAA 1ZYLA 3Q96A 5HE2A 4YGAA 3VBWA 3SXSA 4RIXA 3QU0A 4RIXB 5HVYA 4RIWB 5CEIA 4AW2A 1S9JA 4YC8A 3RKBA 5FUTA 1BI7A 2VWVA 3PYYA 3CC6A 3LM0A 4JI9A 1WBSA 3P0MA 5AR2A 1TQPA 3HEGA 5FRIA 1FPUA 5HBHA 3FC2A 4GIIA 3RPVA 2I0HA 2IW6A 3FLWA 3PY3A 4AZVA 4R78A 2B9HA 1PXPA 4FV9A 4QMYA 3BU6A 1Z57A 4KIPA 3H9OA 1XR1A 1PYEA 1OPKA 2AUHA 4O0VA 5DIAA 3ORIA 3GENA 3N4UA 3GXLA 3BX5A 3I60A 3VHEA 1YOJA 2YISA 3AC2A 4NH1A 1YWRA 3B2TA 1PMUA 1ZXEA 5IQIA 2X8IA 4ITHA 4BB4A 3AT4A 2R0IA 3PXKA 1UVRA 4N6YA 5EW8A 2PYWA 4AOJA 5IQFA 3DB8A 5DN3A 5GINE 3UNZA 3JXWA 1JKTA 2OH0E 2XKFA 5HTCA 5I9YA 3KK8A 4LOQA 4F9YA 1UU7A 2CKPA 1W98A 2QR8A 3DAJA 3RZFA 5M53A 1PMEA 5DRDA 2OZOA 3AG9A 4FSMA 3MY1A 4J97A 3I0OA 5B0XA 4L44A 3LHJA 3QYWA 1BUHA 4YJOA 1VYZA 1OM1A 1S9IA 4XJ0A 5IQBA 4MAOA 4TYEA 3GOPA 4HPUE 3OEFX 2BHHA 4MQ1A 4MNEB 3WIGA 3MVLA 2W0JA 3R7YA 4EK4A 4FZFB 3QWKA 4RC4A 1NA7A 1JKKA 3F7WA 3PWYA 4JDIA 3EFJA 3H30A 3ORNA 4K11A 5DRBA 4ALUA 3NVMB 1I44A 4GT4A 3RBWA 4F6UA 2AYPA 2R64A 2P3GX 4RIYB 4FV5A 1XH9A 3QFVA 3P86A 3A8XA 2UZBA 2G15A 3P4KA 2ZVAA 3C4CA 2UV2A 3D5XA 4ACCA 5GJFA 3ATSA 4KB8A 1CMKE 5FEEA 3R21A 5BVKA 4CZYB 5AUUA 3OCBA 5I3RA 5IA1A 2B9JA 3CLYA 3I6WA 1Q99A 4WG4A 3DGKA 4FNYA 3S2PA 3S0OA 2CNQA 4FSZA 3E8CA 1RDQE 2WGJA 3RVGA 1O6LA 5GZ8A 4O0YA 1PJKA 4HYHA 2GNHA 4UWYA 4YZBA 3UOHA 1QPJA 4W8DA 3KEXA 3O96A 3BKBA 1YW2A 3R28A 2OK1A 4WO5A 1XBBA 3OT3A 5FM2A 3HZTA 3OTVA 4DTBA 3GFWA 4FOCA 2OICA 3DOGA 4JBOA 4M0ZA 2QOBA 4MD9E 3MJ2A 2YABA 2HENA 2RFEA 5JRQA 3NIEA 3SRVB 3P79A 1UU3A 3D5WA 4RZVA 3R9NA 5LWMA 5DEYA 3R9RA 5IQCA 4AACA 3D94A 4XEYA 4YBKA 4XP0A 3FMMA 4IANA 2R2PA 3A2CA 3KN6A 4O0TA 2W9FB 5DMZA 4B9DA 4FKTA 3F66A 3N51A 4F6WA 2IW8A 4QTBA 3GT8A 5IA2A 1KE8A 3GC7A 2PVHA 2F2UA 3HRBA 4BDFA 4C4IA 4DEEA 1QPCA 2VWUA 3DBCA 3GC0A 3LJ1A 4KABA 4WRSA 1YOMA 1TVOA 3SXFA 3HV3A 2QG5A 4D1SA 4FEXA 5LMKC 1NXKA 1JPAA 4FG9A 1V0OA 5HO6A 3HP5A 5BMSA 2X39A 2VUWA 3FI2A 2J90A 4GFOA 4C58A 5CZIA 4BWPA 4KBCA 2ZAZA 4QTAA 2YM8A 4DFLA 1V0PA 2ZV8A 5IH4A 3ORLA 4YLJA 4AE9A 3U4WA 1NVSA 5AR4A 1TQIA 4EOJA 2VTSA 3AT3A 4PNKA 1ZOHA 2I1MA 4MTAA 4JJRA 5HEZA 3R7EA 3PPZA 3KF7A 2YLFA 4HVIA 5AUZA 3W16A 4EH3A 3FL5A 5DLSA 5ANOA 3AC1A 5CASA 3V01A 1Q4LA 3U9CA 3HA8A 2WXVA 2G2IA 5ACKA 2ZV9A 2C3LA 3EN9A 5AUWA 3ZMMA 4D4VA 4LL5A 4DGMA 5K4JA 5EW9A 4BVUA 2OJIA 3E63A 5DT0A 4EUTA 1AGWA 1Y57A 4CQEA 4F0GA 4DGLC 3QGWA 3UODA 3EIDA 4HNFA 4QMTA 2XEZA 3OVVA 3UYSA 5HD7A 2VO6A 5CEQA 2EWAA 2WQBA 2Z2WA 3F3WA 4KIKB 3VS3A 4YJPA 3LXKA 1Y6BA 2PUIA 2CLQA 4ID7A 4FKQA 4FIHA 3MSSA 1IA9A 4NYEA 4M69B 3SC1A 1OKWA 3EQCA 3K2LA 1RW8A 4GVJA 5D7VA 5GIPE 1ZMVA 4ZK5A 3MPMA 3C4EA 4UB7A 2YM3A 2GHLA 2ZYBA 1VR2A 1B39A 3AMYA 1ND4A 2HY0A 3IGOA 1JBPE 4JX7A 4MD7E 4CCUA 2WQNA 5HKMA 2F9GA 2VWIA 4PL4A 1UU8A 4DGGA 4F7NA 1Q8WA 1OBGA 4Q9SA 4RQKA 5EQPA 3TG1A 3COMA 2VTMA 3OXTA 5DVRA 5A4QA 5CT7A 2RG6A 2I0EA 1ATPE 4RA4A 4P5ZA 2O65A 2PSQA 3EOCA 4FF8A 4O27B 4EH5A 4G5PA 1OIYA 4G9CA 1UWHA 3W8QA 4L3PA 5JQ5A 2JITA 5KMIA 3MFRA 2R7IA 2P4IA 4KKHA 1JKLA 1XBAA 4OTGA 4BGQA 2W99B 4JOAA 5HCYA 2VU3A 1Q8ZA 1Y8YA 3QQGA 3DFCB 4J98A 2EB2A 2WHBA 3KULA 2Z7LA 3D9VA 3LFEA 4JBVA 4X2GA 2HWOA 4FNZA 4RG0A 4JDKA 4FI1A 2VGOA 1ZLTA 5FDXA 3W55A 4LGHA 2UZNA 4M8TA 2BZJA 2QG7A 4FT7A 3FMKA 4L68A 4F9WA 2J7TA 3DTWA 3EQGA 4LQMA 3R63A 4FOBA 4HGEA 4WG3A 5KMKA 3AD4A 3EWHA 1HCKA 4FT0A 2IVSA 2EVAA 2QU6A 2WEIA 3P23A 3PZEA 4FYNA 2DUVA 4NIFB 5DR2A 5L2QA 5KMMA 2G01A 4TW9A 4IH8A 3RAKA 4CMOA 5IA3A 5LVNA 3TJDA 2X9FA 3BYSA 4QP8A 3O7LD 4I6HA 2BKKA 1Z9XA 4IM0A 4NKAA 1OKZA 4R7BA 3I81A 3QKMA 3R30A 3FMNA 4D9UA 3MWUA 4YTCA 5IQGA 3FMHA 2BIYA 3NAYA 4NCTA 4U9AA 3ZONA 4XV3A 4TYGA 5J7HA 3R7UA 4XOZA 3BBWA 4EZ7A 2NNWB 3U8WA 5L6PA 1WVYA 4RQVA 4GMYA 5AUYA 3L8XA 3TCPA 1Q3DA 3OW3A 4NU1A 2R4BA 3TV6A 3P7CA 4PMMA 2R3MA 3EFKA 3DLZA 4YSMA 4EQUA 2VTIA 3V5JA 5M57A 2JDSA 5KE0A 2WMAA 5E8XA 3QQLA 3VBYA 4O22A 4DHFA 3KULB 5CQUA 3TWJA 4G31A 4BDIA 3KRRA 5CY3A 2C69A 1A9UA 2IZTA 3QX2A 3TL8A 2WEVA 2QVSE 3EN4A 3MVMA 4HPTE 5DWRA 3VC4A 3RAIA 4BCGA 4CTCA 4FTIA 2C68A 2XIRA 2Z7RA 2BKZA 2X8DA 3JVSA 3DKCA 3L1SA 1M14A 1SM2A 2C6KA 4IX6A 3Q32A 3VIDA 4AXAA 1H1QA 5J9ZA 3Q4UA 4F1OA 2IZRA 2OF4A 4FZ6A 2XEYA 3HMNA 3NYOA 4OR5A 1YWVA 2QLQA 3DU8A 4UX9A 5AR7A 2VNWA 5HBEA 3GC8A 1REJA 5CEMA 5JK3A 4L8MA 3FMJA 2UW6A 2IG7A 2C5NA 4JNWA 3ACKA 2X9EA 2I0VA 2ITXA 2VWBA 3HRCA 4UXQA 3VBVA 5L2TA 5M4IA 3BV3A 4RLKA 2CMWA 4XV2A 3WOWA 2J9MA 2OFUA 2VTJA 4EBWA 5M4FA 5K0XA 2GTNA 2J0JA 3NLBA 4M84A 4MNFA 3SXRA 3TNPC 3M42A 3Q5ZA 2V22A 4P2KA 4V05A 4DN5A 1A48A 2GQRA 2FO0A 3DV3A 4I20A 4KA3A 4J8MA 2R5TA 1YHWA 4FT3A 1UNHA 4Z3VA 2B55A 3I6UA 5A4CA 2GNLA 2JLDA 4JVGA 4EK5A 3V5TA 5HX8A 3P78A 1OL1A 2Y6OA 5IH5A 5C4KA 5GIOE 2HK5A 1PKDA 5FBOA 3UP2A 2DYLA 4AOIA 4S31A 3QRKA 3MB7A 3M11A 2ITWA 2QNJA 2YM5A 2C3JA 4IHPA 4GG7A 4IB1A 3AD6A 4M7IA 4X2KA 1H24A 3KXMA 4RVLA 1JSTA 4D1ZA 5JQ8A 4DFXE 4KS7A 5FP6A 3IW4A 2JBPA 4MWHA 5EOLA 4RGJA 1A06A 3Q04A 4LRJA 4DH5A 3ZZWA 3OZ6A 2EXEA 2F7EE 4WUNA 5EHYA 5ANGA 4WRGA 4BRXA 4EQCA 4DFUA 1R0PA 3ZM9A 4HGSA 3DT1A 3UNJA 2BZIB 2C1BA 3H3CA 5BX0A 3PP0A 2C6LA 4XG3A 3ZUUA 2WTWA 3LZBA 2F7XE 4LRKA 3UVQA 2WKMA 3KRWA 4KAOA 3WI6A 4TT7A 4DH1A 3NPCA 1GZOA 3DLSA 5HE3A 4FEVA 4F4PA 2FGIA 4R7HA 3SW7A 4KKEA 1JNKA 3PY1A 4J99A 4EBVA 2Q83A 2BRHA 2P0CA 3POOA 4BDKA 2GSFA 2WMSA 1SVGA 4M97A 2B9FA 3EQDA 3KU2A 3TKIA 2FYSA 3NWWA 3HGKA 4E8AA 3NGAA 4XCUA 5A9UA 5JKGA 3Q5IA 4DFZE 1KUTA 1ZARA 4L3LA 3QCXA 4BC6A 3ZZEA 4ZIMA 3NAXA 3NYVA 3E87A 4FV6A 2B7AA 2WTIA 3OC1A 4PP9A 4R5SA 3C50A 4IQ6A 1PYXA 2IWIA 4CFMA 4IX3A 4K8AA 3QCYA 2XK7A 2AC5A 2CSNA 3BQRA 3LM5A 3Q3BA 4PPCA 4FKSA 4TPTA 3H0ZA 4AW5A 4D4SA 4USEA 2Y8OA 3VAPA 4JBQA 2VO3A 3OBJA 3GU4A 3MVJA 3HECA 3BYUA 4QMZA 5DEWA 2OF2A 2XCHA 1H1SA 4DCEA 3QXPA 5JFWA 5I3OA 1GY3A 2OGVA 3TIYA 1WMKA 4ALWA 5KMLA 4ZLOA 3HMIA 4DYMA 1WBNA 4QO9A 4IZAA 4YLKA 3VBTA 1IAJA 1BKXA 1OUKA 4UEUA 5IUGA 3RK5A 3SA0A 1F5QA 5HLNA 4HNIA 3TZ8A 4C02A 3EQFA 1ZY4A 4GU9A 2OXDA 3R1SA 3QKLA 2GFSA 5IKWA 3DNEA 4YU2A 4S30A 3UP7A 2DQ7X 5HTBA 3VVHA 3OOGA 5B2KA 4EH4A 2Y4PA 4FTLA 2VTQA 4U43A 4I5HA 2CCIA 4OTIA 2IN6A 4MXZA 4JRVA 3QD3A 1XJDA 2J2IB 4H39A 3KY2A 3ET7A 3UG2A 3NCZA 4NTTA 5KUPA 3FQSA 2CHLA 3E7OA 3R8ZA 4YJTA 2QO7A 3EZVA 4N57A 5TE0A 2YITA 4JBPA 5CSVA 4FTUA 3F5GA 4GU6A 4C4HA 3MFUA 4AA5A 2UW5A 3FLZA 4RT7A 4ZTRA 5AP4A 4ZJIA 4GS6A 3LKMA 2JD5A 5IQAA 3A7FA 2GFCA 2OJJA 3BLRA 3COHA 5CVHA 5LMKA 4OTQA 3NYNA 4RIOA 2J6MA 4GIHA 4UZHA 5DHJA 2CKOA 3LQ3A 4TKSA 1WFCA 2PUNA 2X2MA 5FBNC 5M56A 5CYIA 3DAKA 4EHEA 4DT8A 3F82A 3GEQA 3TACA 2X1NA 2OJFE 4MEDA 4YJQA 5DGZA 5LMAA 2LGCA 2VX0A 4J52A 4UWCA 4V0GB 2VD5A 2WMRA 3F61A 5C01A 1V1KA 5B7VA 1NY3A 2UZVA 4PDOA 3UO6A 1W84A 3NNXA 4H3QA 3ATTA 5JGBA 5K9IA 4XX9A 1IR3A 1QPDA 3CQWA 4IVDA 3O0GA 3QXOA 4RX9A 5FXQA 4ZTLA 5CX9A 3IDPA 4ACMA 4ZY4A 4KD1A 4O96A 5LVMA 5CXZA 5HNBA 3R22A 4I21A 4QMLA 2JIUA 4NJDA 5FD2A 2WB8A 4CKJA 2C30A 2YCSA 3DTCA 4YJRA 4C3RA 2XH5A 3QZGA 2I6LA 3R01A 2F49A 4O84A 3F69A 2QOLA 3F3VA 4TWNA 2JGZA 4BCOA 4M68A 2CPKE 2ITYA 2UW8A 3LMHA 2PMLX 2IO6A 3FV8A 4CT1A 3LCOA 5DT3A 2GS7A 1H0VA 3ZHPC 4D55A 3AT2A 2QHNA 3HKOA 3EB0A 5BNJA 1SVHA 3UC4A 2P2IA 2YM7A 4EOPA 5TF9A 5FDPA 1URWA 5I9VA 2X8EA 3MV5A 1E9HA 1KE6A 3JPVA 4DG2E 4RC2A 1JKSA 2H8HA 5DG5A 3DNDA 4E6DA 3CBLA 4QTEA 4MHAA 5E7RA 4PTEA 3MESA 5HCZA 2PZYA 2SRCA 4TXCA 2W4JA 3R1YA 4X6RA 5CU3A 5K0KA 3QKKA 2WTCA 3KRJA 4RVMA 4U42A 4E4MA 2YN8A 1MQBA 1ZAOA 4O86A 2B54A 4J95A 4LGGA 3TEIA 4FIIA 4BKYA 4JR7A 4FKOA 3GP0A 5HX6A 4FV2A 3A7JA 4U97A 4PTCA 4M0YA 5AV4A 4MD8E 4ZMFA 5BVFA 3FSKA 4QP6A 3QALE 4D0WA 4NTSA 3KMMA 4PMPA 4MF0A 2G9XA 3TZMA 2UUEA 3ZXZA 4PL3A 3VS2A 3LPBA 5DOSA 3AGMA 4BTFA 2Y7JA 4TWPA 4C61A 4GYGA 5FP5A 5L8LA 4HGTA 4JAIA 4MQ2A 5AIKA 4Y46A 5EHLA 5HHWA 1DM2A 3ANQA 3VNTA 2XK9A 5J5TA 1H28A 1YI4A 3IW6A 3MTFA 4KSQA 5L2WA 1HOWA 4HVHA 4PQNA 1K3AA 2GNJA 2HZ0A 5JRSA 2HWPA 1VJYA 5KKRB 2B53A 2Y4IB 2BZKB 2WTJA 1FGIA 2X0GA 1HCLA 2VO0A 1ZOGA 3PUPA 3IONA 3CJFA 3CR0A 3RNYA 3ULZA 2X6DA 2KTYA 2XB7A 4BDBA 4QNAA 4BDJA 5A54A 1IRKA 3E5AA 3OOMA 3W1FA 4D5KA 3CJGA 3JS2A 4X2NA 1MQ4A 4EH9A 4A9TA 4D2TA 2ITZA 5AP5A 3MH3A 2XNNA 3ZBXA 4HCVA 4DG3E 1U54B 3UDBA 4F7JA 5HTIA 4C35A 4QP7A 3R7OA 4FL1A 2BTRA 4UMTA 2R3GA 4IACA 1Q8YA 5TT7A 1XBCA 2Z8CA 1XH7A 3NEWA 3W18A 4NM7A 4DTKA 1H1RA 2F4JA 4FIEA 4C33A 5A6NA 3OCSA 5AMNA 5LVOA 4IIRA 5JN2A 2W1GA 3T3VA 5EM8A 3TKUA 4YJNA 3QGYA 5KMOA 4UWBA 1NVRA 4ANSA 3GUBA 5CLPA 4EI4A 2XNGA 4GK4A 3HA6A 4GVAA 3CE3A 3DZOA 4NWMA 4F99A 4UMRA 3FI3A 4X3FC 3WZUA 3RAHA 5HG7A 1URCA 4B6LA 4PY1A 4EC8A 3GGFA 3RPSA 4CMUA 4UALA 3O51A 2XK6A 3VO3A 3FXZA 2FSLX 4YZ9A 1XWSA 3RK9A 1FMOE 4M15A 4AGDA 4E5BA 2C3IB 5KHXA 3UQCA 2VTRA 4KRDA 4DE4A 4EOKA 1OL7A 4J8NA 5IEYA 3NVKI 1W0XC 4O21A 3ORKA 4Y83A 4EYMA 5M51A 2HOGA 2F7ZE 2ITOA 3T8OA 4FODA 4Y85A 4F6SA 5BUEA 1J1CA 4FC0A 3GQLA 3EL7A 3JYAA 3U6JA 4RWLA 4AU8A 4AZEA 2IJMA 2PY3A 4OLIA 3REPA 3S1HA 1Y91A 1M2RA 4I0TA 1Z5MA 3R8MA 4EZ5A 4Z55A 1OL2A 3EHAA 4GJ3A 4I0SA 5IF1A 5H8BA 4FTQA 2YZLA 3S4QA 4MWIA 4QMMA 3NNUA 2ZV7A 1U46A 3C4FA 4WNPA 4ZSAA 2GPHA 3GI3A 4QD6A 3OWKA 4IAIA 2CJMA 2UW9A 4HVGA 2YACA 1R3CA 5HO7A 3PA5A 4UN0C 3CSVA 4PPAA 4AAAA 4TYIA 2W1ZA 3DXNA 2JAVA 2VZ6A 4PDPA 2I7QA 3PA3A 3C0GA 3SD0A 3TTJA 3D5VA 3HYHA 2XNBA 3LVPA 3D7ZA 1BI8A 2JKQA 3GOKA 4DH3A 2XKEA 3PJ8A 2PPQA 5CF8A 3C0IA 2ZOQA 3R8LA 4E93A 3QLFA 3HV7A 4YC3A 4JG7A 4XRJA 3SW4A 3TZ9A 3LJ0A 2QONA 3E8EA 2EXCX 4S33A 5L3AA 3ZLYA 4S2ZA 2H9VA 3ZO4A 4D2RA 3PPKA 4AZTA 3QYZA 4TNDA 2XUUA 1PXOA 4GYIA 5HCXA 4APCA 4BBEA 3E3BX 3Q2JA 5ICPA 4BTJA 4QQTA 4IM2A 4D0XA 2YIQA 3E8NA 3WF5A 1REKA 4HCUA 5DR6A 2HXLA 2RGPA 4I4FA 5JEBA 2QU5A 5IISA 3UOKA 4FV8A 1DAWA 3NNVA 4BKZA 4F64A 5EM7A 3ACJA 3OF0A 3DBQA 4RZWA 4AZSA 1Q41A 2XRWA 3AC5A 4LOPA 2VWZA 4JQ8A 3BHYA 5T6KA 4AG8A 4B0GA 3ZU7A 3KQ7A 2V7OA 5CI6A 4CZTA 2DS1A 3BHTA 4JG8A 1K2PA 3G0EA 5AR5A 4U6RA 3ZRLA 4J7BA 4G5JA 4CLIA 2ZMCA 3QAME 5CTPA 5AP0A 3HUBA 2YDIA 2W17A 3QQJA 3V8SA 3V6RA 2VTNA 4NFMA 4EUUA 5KBRA 2ZB0A 3DZQA 4MVFA 3SG8A 4ZY6A 4FTKA 1J3HA 3FWQA 1IEPA 4NKSA 4AA0A 2NP8A 3K54A 4GT3A 3OCGA 2JDOA 3RJCA 1OBDA 4HGLA 4QRCA 5J9LA 2QKWB 4U3ZA 4ZMEA 2QKRA 3UVRA 1ZYCA 3KB7A 3Q6WA 2NPQA 3QZIA 5IA5A 4AGUA 4GK3A 4XV1A 4GCJA 4AOTA 3RINA 4BCHA 5EI8A 4Q9ZA 3E7VA 4EK3A 3BGPA 3FYKX 3I5NA 3FEGA 3LJ2A 3LCSA 4ASDA 2VRXA 4BWXA 2A1AB 3GCUA 5IMXA 3E8DA 3PIYA 3P7BA 4D4RA 1DI8A 3HVCA 1WBOA 1P5EA 2WZJA 3RK7A 3ZLXA 4BZOA 3IW5A 2BROA 2FVDA 4H1JA 4PRJA 4UMUA 2O5KA 3WF6A 3LMIA 3AMBA 3O50A 4I5MA 3DJ6A 3GNIB 4F65A 4IZ5A 5EYCA 1RE8A 4FTTA 4AWIA 4FL2A 4NW6A 3P08A 3PJ1A 2UW7A 3QZHA 2R3NA 2CGXA 4YTHA 5BPYA 4KNBA 2UW0A 4X3FA 3CGFA 4D1XA 3OTUA 5LCKA 2PMNX 3W10A 4F63A 3VHKA 5T3QA 2P55A 2ZDUA 1Q8UA 1IG1A 4RIWA 4WHZA 3DKGA 2PVFA 3LIJA 4N6ZA 3MA6A 5ETIA 3KC3A 3RHKA 4XH6A 4EOMA 2A19B 3VF9A 1B6CB 1YXXA 4EH6A 4C4FA 3MN3A 3V6SA 5H8EA 1JVPP 4FK6A 4AN3A 5AAFA 4OTHA 1GJOA 4I41A 3ORMA 4R6VA 3AMAA 1WZYA 5G6VA 2X4ZA 3BLHA 3BWJA 4ZJVA 2A27A 3OCTA 3N4TA 4DT9A 2BAKA 2QHMA 3D2IA 2V55A 3W2CA 4IC8A 4RWKA 3CPBA 3R71A 3E88A 4O0WA 3LCTA 2OG8A 5D7AA 5C9CA 5CQWA 1FOTA 4BDCA 3L9MA 2UZLA 5CSWA 3FKLA 5BVOA 1G8SA 1IAHA 5CF4A 3WF7A 1ZYJA 3ZEPA 2QOFA 2QI8A 3Q2MA 3KK9A 3RAWA 4DCAA 2WTKB 4HZSA 2O64A 4QQCA 4LMUA 2EB3A 4ZS4A 3QZFA 4L52A 4BN1A 1FVVA 3IQ7A 1KOAA 3MPTA 3L9LA 4UBAA 3F5PA 4IW0A 5A46A 3CPCA 5HIBA 3B8QA 5I4NA 4EZ3A 5J79A 3MBLA 1L8TA 5EDRA 4AW1A 2R3QA 4OBQA 1QMZA 4MH7A 5M4CA 4OW8A 1Y6AA 4FT9A 3LFDA 2BAJA 4FX3A 5EOBA 4S32A 2VO7A 2XK4A 3D5UA 3FBVA 2ZM3A 3GCSA 4AF3A 5CEPA 3BEGA 3NUAA 2A4LA 3IPHA 4MXYA 2CKEA 4ACHA 3KXZA 1KE9A 2IZSA 3DBDA 4O7NA 2FSTX 3DCVA 2E9VA 2HYYA 1OVEA 3LLTA 4PMTA 4IWPA 3U54A 2GU8A 4AFEA 2BALA 5DFPA 1KV2A 1FINA 2BRNA 3ZSHA 4BCNA 2H6DA 3BEAA 3CKXA 4EONA 4BHZA 2GQGA 4TWCA 3W2OA 3NYXA 4EH8A 3QRTA 4BGGA 4E3CA 2PMOX 3I0QA 4ZAUA 3D0EA 3LCKA 4QP3A 3RPOA 1U59A 4Q5HA 5AP6A 4IEBA 4ZZNA 2PU8A 2PWLA 4WSYA 1GZ8A 3HDNA 1J7IA 1RQQA 5EW3A 2PZIA 2WMUA 4O0SA 4O6EA 2Q0BA 4BI0A 2PHKA 1JQHA 3EYHA 2JDTA 4OTFA 3ZXTA 3IK3A 3QRUA 4CMTA 3P9JA 3BGQA 4BCIA 4E6AA 3OW4A 2QD9A 3UMWA 4N0SA 4NW5A 4R5YA 4MXCA 1OL5A 4F0FA 4ERKA 4WT6A 3FUPA 3ZDIA 2C5XA 4M69A 3LCDA 2XF0A 4GV1A 5AA9A 4YBJA 1H4LA 3ENMA 5M06A 4ZTMA 4QPAA 2VX3A 5CU2A 4ANNA 1GZNA 2RL5A 4IFCA 3SG9A 5HICA 4OBPA 3NNWA 1YVJA 5BUIA 3HMMA 5DYJA 3CQUA 4KUJA 4G17A 5FG8A 4CV9A 1TKIA 3A99A 3ODZX 4TN6A 3UVPA 3WZJA 4AT3A 1PY5A 1B38A 4EHVA 4O81A 2E9NA 2J5EA 4DFYA 3RPRA 2ESMA 2XM9A 3TDWA 5I9XA 5KKRC 5IPJA 2J50A 3K3IA 3KXNA 1PXMA 3UPXA 4DH7A 4II5A 3QC4A 4KIOA 3BHVA 3FQEA 3R8UA 3NX8A 4FA2A 3VUIA 4CKRA 4HW7A 3B8RA 1P2AA 4QP9A 3PPJA 5M09A 3FJQE 3QTXA 5ANEA 5BMMA 5FEQA 4O7ZA 2C0OA 1QCFA 4XHKB 4ZXTA 2R3PA 4CRSA 5IUIA 3R7GA 3II5A 4RVKA 3TNWA 1G5SA 2OFVA 2X7FA 4XMOA 2PUPA 2Z02A 3CXWA 4EYJA 3QUEA 3VN9A 5AR8A 5L2IA 4PTGA 5IUHA 4LRMA 4MK0A 2GHGA 2YEXA 4GUEA 4Z7HA 4M66A 5E8WA 3VS4A 2GHMA 4FV0A 4G3EA 3RMFA 3VS6A 5AM6A 3EQRA 2VWYA 3ZFXA 5B2MA 2BFYA 1VYWA 2HELA 2WMVA 3HNGA 3IKAA 3V5PA 1U4DA 4YTFA 5CZHA 5BVNA 5F94A 5M08A 3L8PA 2W05A 4CLJA 4HYUA 4CYIA 3DBFA 4CYJA 5HU9A 2QQ7A 4LI5A 4V01A 5M44A 4V04A 3UBDA 4IAAA 2YDJA 5HOAA 1WVWA 3ZS5A 3CS9A 3EN7A 5CANA 4E4LA 3UC3A 4FSYA 4KKGA 4G3CA 1YXTA 2JFMA 3KCKA 4K33A 3WF9A 4CFWA 4YP8A 5IA4A 3QRIA 2OU7A 4F1MA 3FPMA 4P90A 3E64A 3UO5A 2WMXA 3KA0A 5F4NA 2ZM4A 3EMGA 3W2PA 5CS6A 2BVAA 3PP1A 1PKGA 4O7WA 4YJSA 3EN5A 4BZNA 2CKQA 1AD5A 3DBEA 4YR8A 2X6EA 2F57A 4CT2A 5LOHA 1H1WA 3A4PA 1OIQA 3VS0A 4OUCA 3QC9A 5E1EA 4DTAA 1MUOA 5AP3A 4C7TA 2XYNA 3WYXA 4PP7A 5F1ZA 4O38A 5DR9A 4EC9A 2QO2A 2OSCA 4Y5QA 5FWKK 3LW0A 3KMUA 3O23A 2W1EA 4O0XA 2BR1A 2Z7SA 3DJ7A 3SX9A 4DG0E 3VRZA 4BR3A 3FLSA 4ZSLA 3W8LA 3W33A 3DJ5A 3GU7A 2REIA 4CFFA 1BL6A 4EWQA 3NW5A 3KMWA 3ZC6A 3TTIA 4BGHA 3IDBA 1OMWA 4BY9E 1YWNA 3Q52A 5AX9A 3TZ7A 2C6MA 2YCQA 4JAJA 4QMWA 1YXUA 5HQ0A 2J0IA 4O7TA 4A4OA 4NK9A 4RX8A 4FTOA 4QMSA 3R1QA 3VRYA 2CNUA 2QODA 4MXOA 2XCKA 1OKYA 2YDKA 2UW4A 2Z60A 3LMGA 5EKOA 5EK7A 5FM3A 3UZTA 4XNEA 4ANOA 4JS8A 4Z7GA 3I7BA 4C62A 4ASEA 5LVPA 2VWXA 2PZRA 4G6NA 5CAVA 3TUBA 4OTPA 2WTKC 3AXWA 4QPSA 3KXHA 1FBNA 1DS5A 3PDTA 5KZIA 1YRPA 4F09A 3TNHA 3H9RA 1OUYA 3DXQA 1NW1A 4DBXA 4EKLA 2C6EA 4JRNA 4O91A 4UY9A 4LOOA 4OT6A 4PV0A 1H25A 1LEZA 5IEXA 2BRGA 4FGBA 1X8BA 3A7HA 4EWHA 4GK2A 2PUUA 3VS1A 1Q24A 3WF8A 2WOUA 3BE9A 5AV3A 4Y8DA 3V5WA 4BCFA 4C0TA 2JKOA 3H4JA 3DDQA 2WQOA 3PXFA 3D2KA 1H07A 2GMXA 4U3YA 4H1MA 3MY5A 4DH8A 3KVXA 3PSDA 4H3BA 4AGCA 2WPAA 2XMYA 4NM3A 5HGIA 4HYSA 4NCTC 4ANMA 1PXLA 2GNGA 4CSVA 1OKVA 2VTTA 3UYTA 2PVNA 4QQJA 4XLIA 4FUYA 5D1JA 4FTJA 1LUFA 1MRUA 3FZPA 4W9XA 4F9AA 5IQEA 3H9FA 3FLYA 1TQMA 2GTMA 4O1OA 4B8MA 4L42A 3TNIA 3U9NA 4PNIA 1M7NA 4FEWA 3Q6UA 3Q9ZA 5I5ZA 1P4OA 4I93A 4RLLA 1WAKA 2XIYA 2X2LA 4BI1A 1M2PA 1R78A 3TKHA 2R7BA 4L43A 2H96A 2WMBA 3VS7A 4F70A 2YERA 4IVCA 4RC3A 3BWFA 1QPEA 2PMIA 4HOKA 4AZFA 2BMCA 3EN6A 4MX9A 1VZOA 1JSUA 2E2BA 3HUCA 4FG8A 3V3VA 5L2SA 2VV9A 3PFQA 5DNRA 3R9DA 2ZMDA 4JX3A 3L8SA 4CD0A 1WVXA 2Z7QA 5IU2A 3DB6A 2YWPA 3VW6A 4EOLA 4KIKA 5J8IA 4O7YA 3IDCA 1YXVA 5DT4A 2A2AA 2UZOA 4F1TA 4DEBA 3ORXA 3FHRA 3SVVA 2JDVA 5HU3A 1W8CA 3T9IA 3C4ZA 4XOYA 2AC3A 4A9YA 2C0IA 2BILB 4RJ8A 3KFAA 3BPRA 3LFBA 3FMLA 1LEWA 4BHNA 3FAAA 5A14A 1OGUA 2YZAA 2HCKA 2HY81 2NRYA 3QWJA 3FLNC 5A4TA 4I1ZA 3ETAA 3TV4A 3NW7A 3VJNA 3FI8A 3OBGA 2HZ4A 3MH1A 4XS2A 5B2LA 5EQEA 4XV9A 3DK6A 4FSTA 3IO7A 3C7QA 3DXPA 4DGOA 1V0BA 4BYJA 2HIWA 3FC1X 3PXZA 3AQVA 4CV8A 5LXMA 3VQHA 5KNJA 3TUDA 3DKOA 4BYIA 3DDPA 3TUCA 5CT0A 3U87A 5JFVA 2XK3A 2BRMA 3DQXA 3WE8A 3ODYX 1MRYA 2OIDA 4MXAA 1JOWB 3DAEA 3EL8A 3MI9A 3OD6X 1PHKA 2WQEA 4TYHB 3WARA 3UE4A 4R3RA 5FXSA 3RHXA 2BDJA 3AC3A 1F0QA 3PRIA 4DFNA 4WG5A 3QQKA 4IB3A 2PE1A 4F7SA 2VNYA 3CTJA 4QOXA 5D41A 4G3DA 5AM7A 3P5KA 4IJ9A 4JIAA 1E1XA 3DKFA 3PLAE 2H34A 3RNIA 5KBQA 4I5PA 4RMZA 4CKIA 4PL5A 4L3JA 3D7TA 4BDAA 1ZZ2A 4LL0A 2R3KA 2Y0AA 2YIXA 3RWPA 3OWPA 4U80A 3G6HA 2PL0A 2PVRA 4IAFA 3SDJA 4GJ2A 4DINA 2VGPA 2JAMA 4JIKA 4LGDA 4YMJA 2VAGA 1PMVA 1UWJA 1QL6A 4R1YA 4HCTA 4EOIA 1EH4A 4IADA 4Q5EA 4R8QA 3R9OA 4CFVA 4EKKA 3F3ZA 3LE6A 5CF6A 5HNGA 1CDKA 4D58A 3EQHA 5J87A 5CAQA 3S00A 4GW8A 3DA6A 4CQGA 3CTHA 2CN5A 4RRVA 4WUAA 2Y9QA 1GIHA 3UZRA 2BCJA 4UYAA 1YQJA 3RPYA 3LFNA 5JZJA 1LPUA 3UOLA 4FSRA 3Q4TA 2R3RA 4I5CA 4WSQA 5KCVA 3VW8A 5I0BA 1UKIA 3ID6C 4FV7A 3EQBA 4LUDA 4ACDA 4ZLYA 5J7BA 3O17A 3TDVA 1ZOEA 4JT3A 3PJ2A 4P4CA 2UZDA 5CNOA 3ZSIA 2R9SA 3R1NA 4QYEA 5HORA 2XJ1A 4LYNA 3QTRA 3CCNA 1Q8TA 4DBNA 1YI6A 3OT8A 4GL9A 2CGUA 1L3RE 5CVFA 5DBXA 4M67A 4W9WA 2GQSA 4PMSA 4XG8A 4G9RA 5HE1A 3NDMA 1BMKA 4FKLA 3OWLA 4IB0A 5DA3A 3SV0A 4EOQA 3QX4A 5HBJA 2W5AA 2V5QA 1E1VA 4QT1A 3VUTA 3R2BA 5EYMA 4PF4A 1FGKA 2GNFA 3TI1A 3C13A 5AP2A 4RJ3A 2IZUA 3KCFA 3N4VA 2XJ2A 2YAKA 1WBTA 4K77A 4LMNA 4U40A 4FKWA 4FVRA 4JDJA 3E3PA 5E8UA 5F20A 3U51A 3MS9A 2OWBA 3EFLA 5M4UA 4N4SA 1PXJA 4O1PA 2OJ9A 5J1VA 2YJSA 3KL8A 4RX5A 3GFEA 1YHVA 3KGAA 3MGYA 4FKUA 4HYIA 4IM3A 3KF4A 3ERKA 4RIYA 1YHSA 4ENYA 4FV4A 1AQ1A 2R3HA 4QTDA 3MB6A 4GH2A 4G6LA 3FMDA 2UVXA 1YXSA 2J0LA 5CVGA 3MW1A 3IG7A 4CEGA 4USFA 1J7UA 1G8AA 4BCKA 4I24A 4KRCA 5LCJA 5HIDA 5GJGA 4F0IA 4GG5A 3VBXA 4B99A 5A4LA 4PDYA 2C5OA 2VX1A 3PXYA 2EUFB 5E1SA 3UOJA 3LQ5A 1WBVA 4NM0A 3E62A 4L00A 4AN9A 2PVJA 5DE2A 4DEHA 2O0UA 2UZEA 3R02A 4RJ6A 5EH0A 5IDNA 4LFIA 2WOTA 3BIZA 4YZMA 2B9IA 2EXMA 3RP9A 2B52A 4GSBA 4EH7A 4FEUA 4D5HA 2ZDTA 4NZWB 2RKUA 4CVAA 4FZ7A 2VTLA 4DGNA 5A6OA 3ZOSA 5AUVA 2PVMA 3V5QA 2YFXA 3UG1A 1FVRA 2RG5A 5DPVA 3IOKA 1KE7A 3CKWA 4C38A 5BYZA 1R0EA 2QOKA 3KXXA 4JLCA 4XUFA 4RA5A 5BVWA 3QL8A 4YJVA 3LXNA 3ZLSA 4TL0A 3ZCLA 4U45A 3RTPA 5AADA 4GFMA 2ZM1A 2O8YA 4R1VA 2W4OA 2UZUE 3RM6A 3A8WA 4A9SA 2BPMA 4W4XA 2G2HA 5IMEA 4WNMA 5ANJA 3UMXA 5KHWA 1H08A 5E9EA 4U81A 4QPMA 2OXYA 2YHVA 4FK3A 4ITJA 2FUMA 4RWIA 5M07A 4JL9A 2OXXA 4D2VA 4F08A 4BDDA 3BYMA 4ZLZA 2OW3A 2FH9A 3OUKA 2JC6A 1T46A 5AP7A 4B4LA 4BTKA 5C8KA 4USDA 3ALNA 4FIGA 2W1CA 2WELA 2ONLA 3NUYA 5LVLA 3TT0A 3OP5A 4UMQA 2C3KA 4I6QA 3A61A 4MF1A 3TN8A 4FVQA 4RVTA 3R8VA 4ZY5A 4FICA 4FG7A 3DK7A 5IA0A 3BRBA 1SNXA 1BYGA 3V5LA 3Q4ZA 2OZAB 4ITIA 4CXAA 3CD8A 3SLSA 3CP9A 3F88A 4QMNA 3QD4A 3UTOA 3DS6A 4ANLA 2OLCA 4E20A 4IWDA 2E9UA 4AP7A 2YIWA 3L9PA 3NUPA 2ETRA 3VWAA 4EOSA 3U6IA 5J1WA 4XBUA 4L6QA 5M55A 4BIEA 5KMJA 2WQMA 4ZZOA 4O7RA 1M7QA 2FB8A 3NUXA 2PVYA 4OGRA 3A7GA 3PG1A 4I6FA 3FY2A 3W2SA 4C4JA 3FYJX 2WMQA 4RPVA 2BAQA 3PRFA 3RWQA 5C8MA 2C6DA 3A62A 2EU9A 1CKIA 3MYGA 1G3NA 3PG3A 4BBMA 4EK6A 3LFFA 1SZMA 2XNOA 4HVDA 3BBTB 5G1XA 3WZKA 3VS5A 5EDPA 4J1RA 5BVEA 4KWPA 1NT2A 2PTKA 1BLXA 1DAYA 2BHEA 2HW7A 2XYUA 1YOLA 4ANQA 4L9IA 4X2JA 2C6IA 3VUGA 4A7CA 4CTBA 5ANKA 2XBJA 1SYKA 3G6GA 2XVDA 1UV5A 4JQEA 5EM6A 5AWMA 4ALVA 5ANDA 1SVEA 3UGCA 2J5FA 2ITVA 4F9CA 5J9YA 3OHTA 4JQ7A 4FMQA 3Q53A 2JKMA 3M2WA 1NVQA 4O0RA 3EFWA 2WU7A 4OT5A 5ANIA 4IFGA 5AV1A 1XHAA 4QMVA 3HV6A 3NUSA 4MCVA 3O71A 3FZTA 3OUNB 3RI1A 3I1AA 3NS9A 4D2SA 5AEPA 3ZDUA 1BX6A 4EQMA 4IBMA 4IAYA 4MKCA 3LOKA 3ROYA 4ZTNA 2XM8A 4C4GA 2IVTA 4U5JA 2XA4A 4ENXA 4XG2A 5H3QA 2WMWA 3ORTA 1OL6A 5L6WL 1I09A 4FGRA 4O7LA 3MIYA 4X7QA 4YSJA 1U5QA 4YHJA 5CU0A 2QLUA 2JBOA 2WIHA 4E7WA 3MDYA 4NUSA 5TO8A 3MY0A 4BZDA 5I9ZA 4C3FA 2WU6A 3MFTA 5F95A 2R3IA 2FSOX 3HLLA 4J53A 5JMSA 3ZRKA 2C4GA 4E5AX 1BL7A 1JLUE 4PWNA 5AAEA 5CEKA 2ETKA 3A60A 3F9NA 5IH6A 3G15A 3O8PA 4QQ5A 3V51A 3SOAA 2CGVA 4YZNA 3QBNA 4IVBA 3E92A 5ETFA 4KS8A 4HVSA 2VN9A 2E9PA 3U6HA 2W4KA 3VF8A 3JY9A 4I0RA 3TV7A 3PLSA 3R00A 5CAOA 4FTNA 3G90X 4RFYA 4C3PA 4OTRA 5EQYA 5DI1A 1FQ1B 4FZAB 5H2UA 3QCSA 4BIDA 1SMHA 4U44A 3WE4A 4UYNA 2J51A 4WKQA 4V0GA 5J5SA 4MYGA 3FZSA 4GKIA 2B4SB 2PVLA 1ERKA 3SAYA 3RM7A 3EJ1A 2RIOA 2R0UA 2ITQA 4H05A 4IC7A 3AD5A 4DLIA 4DF3A 3BQCA 1KV1A 2YJRA 3WILA 4YO4A 4E4NA 4W4WA 5AV2A 3FQHA 3I4BA 3JY0A 4G1WA 1UA2A 4IJPA 5CU4A 3NR9A 3D4QA 3R2YA 3W32A 4ZTSA 4DITA 3ORZA 4IWQA 3OFMA 5T68A 2X4FA 3FPQA 4M12A 4ASZA 1P14A 2W7XA 2YIYA 5E8YA 3R6XA 3DK3A 1CM8A 1MRVA 3IW8A 4FSUA 3PVGA 1FVTA 4RFZA 4BWKA 2VTPA 1GAGA 2ZB1A 3NIZA 4MBJA 4QYYA 1K9AA 2QCSA 4B7TA 5GZAA 3HV4A 5IQHA 2GS6A 5L8JA 3ZLWA 5CSPA 1Q5KA 3EH9A 1W83A 3CQEA 3V8TA 3GBZA 2WAJA 4G6OA 2W1HA 2I0YA 5JGDA 4KBKA 4APPA 4QMUA 3QQUA 3WIKA 1OI9A 4OAVB 3CY2A 1CKJA 4NFNA 5GZ9A 5FXRA 3D83A 3PSCA 3S3IA 3PZHA 1LR4A 4YPDA 4C8BA 2R3OA 4TYHA 4MNEA 1IA8A 4PDSA 4WA9A 3GU6A 4N70A 4E73A 5AUXA 4L45A 4AA4A 5JT2A 4BBFA 1PW2A 3JVRA 3R83A 1O6KA 4BIBA 5IZFA 3VUKA 2JEDA 5CNNA 2PZ5A 5KZ0A 3C0HA 4DA5A 3BV2A 4EHGA 1O6YA 4BCPA 1M2QA 3MTLA 3MH0A 4RJ7A 2QC6A 1PXNA 4FTRA 4GRBA 4BL1A 2WTVA 2X81A 3GU8A 2J4ZA 4G2FA 5HG8A 3THBA 4AE6A 5CEOA 5E92A 5LQFA 3L8VA 2PE0A 3PA4A 5C26A 2Q0NA 2IVUA 2YA9A 4WIHA 2QOIA 3HL7A 3SHEA 3AOXA 1Q97A 1GIJA 2R3JA 2UW3A 2UVYA 3FZOA 3ZFMA 2DWBA 3QD2B 3LAUA 4XG9A 4LG4A 4DEDA 5IG1A 2WFYA 4DFBA 4FKPA 1KSWA 4IE9A 2WIPA 4AUAA 4R3CA 3PVUA 5JZNA 3AC4A 4FTCA 4K0YA 3R7VA 3NW6A 1APME 4IDVA 2PE2A 3LFSA 4AZWA 4D2PA 4I22A 5E8SA 5LWNA 3G51A 4IX4A 4FT5A 4CG9A 2OZAA 3F2AA 3FHIA 3QA0A 5ACBC 3OS3A 3HV5A 3W2QA 4ZSGA 4BDEA 4ZJJA 2QO9A 3FDNA 4JR3A 4A07A 5HE0A 3KKVA 5CSHA 3ALOA 3SKCA 2GCDA 3M1SA 1F3MC 3UZPA 3QTZA 4K6ZA 2O3PA 3FKOA 3OXZA 1OITA 3K5VA 3EQIA 2R3LA 5HD4A 3FXWA 2ZJWA 3O2MA 4YO6A 2XIXA 5GHVA 4BCQA 4YUQA 2YLEA 4QTCA 5AA8A 2RFSA 4H58A 1H00A 5J95A 5KMNA 4XP2A 3KVWA 4RSSA 1PMNA 3ZO3A 3TM0A 4FNWA 3UQGA 3OY3A 1STCE 5HVJA 3ZH8A 2XNMA 2YAAA 2I40A 1T45A 4U79A 4Y73A 3G0FA 2QOHA 5BYLA 2Y6MA 1YDSE 4K1BA 4PPBA 1XO2B 1CSNA 4U7ZA 5C03A 2WTDA 3WZDA 4BI2A 3R04A 2VWWA 3BHHA 4JXFA 4PX6A 1M52A 2VTOA 3E93A 3FL4A 3KXGA 4I4EA 4YZCA 5AP1A 2WO6A 4AT5A 2B0QA 2OO8X 3MVHA 2X7GA 5TR6A 2OIBA 5KX8A 3OXIA 5HZNA 2J0MB 4XBRA 1J1BA 1YI3A 3I7CA 3K3JA 3C1XA 1ZRZA 1U5RA 4ZSEA 5K5XA 5L4QA 2X7OA 4Z16A 4L7FA 2NO3A 4ZTQA 3PVWA 2ITTA 3PJCA 2XKDA 3QD0A 4FKVA 4XP3A 3QHRA 3BLQA 1OECA 4U41A 4BCMA 4GKHA 3UO4A 4CRLA 2CNVA 4KINA 4P7EA 3HP2A 4R7IA 5D12A 2OH4A 4IDTA 5EI6A 3UIMA 2BZHB 5GJDA 4DEIA 5AFVA 4ONAA 4BKJA 4IXPA 4CFXA 3NCGA 4RWJA 3QLGA 4G16A 2FSMX 4Y5HA 2CGWA 4GEOA 2YCRA 5GNKA 2IW9A 4WBOA 3I5ZA 4EK8A 3F5XA 2BFXA 3OROA 3UIUA 4F7LA 1WBPA 2W5BA 3IS5A 4CCBA 3C51A 3KRXA 4I23A 3ANRA 3A7IA 2OBJA 3GCVA 3GVUA 2HW6A 5FEDA 5A3XA 4WNOA 5EI2A 4M3QA 3MJ1A 5KO1A 3HRFA 4X21A 3CGOA 3ROCA 4TWOA 5D11A 2RSVA 4K18A 4IVAA 3ULIA 3LQ8A 4O2ZA 3TXOA 4LM5A 3IOPA 2OJGA 4AN2A 3VBQA 3NRMA 4KSPA 3R0TA 1CTPE 1R39A 5TKDA 3HDMA 2IVVA 2WMTA 5CAUA 3AGLA 3F2RA 2W5HA 3PIZA 4FBXA 4QYHA 4XG7A 3VUMA 1Y8GA 3ZFYA 1XKKA 1UKHA 2YM6A 2VTHA 2ITUA 3BGZA 3FY0A 4IAZA 4UXLA 4YNEA 4J71A 4LV8A 3FI4A 5E8VA 4YNOA 3ZRMA 3SQQA 2IPXA 3QTWA 4BTMA 2R3FA 3KREA 3G2FA 3ZO2A 4FYOA 1DI9A 3OEZA 4DC2A 4C2WA 2QURA 1FMKA 4E5WA 3UNKA 1ZMWA 3GU5A 3QRJA 4ASXA 1YDTE 3ITZA 4Y95A 4BDHA 3P1AA 1SNUA 3DQWA 4FSQA 4EHZA 5EHOA 5EM5A 1PXKA 4FVPA 3COKA 5LARA 4A9UA 4CFUA 5C1QB 2YCFA 1XH6A 3QF9A 4K2RA 3C4WA 3GQIA 3UIBA 5JFXA 4CNHA 4AGWA 4AW0A 4ORKA 4M14A 3VULA 3EQPA 2JIVA 1GOLA 3Q9YA 3FZRA 1UU9A 3KN5A 2JKKA 2Y4IC 4IAKA 1XH4A 5ETCA 5TOZA 5CAPA 3Q9WA 3BELA 3FZ1A 3WYYA 5HIEA 2ITPA 5AX3A 2UVZA 3QHWA 4EJ7A 4NM5A 5E8TA 1YKRA 4OBOA 4W4VA 3I79A 4JG6A 2QOOA 5AJQA 1JWHA 4B8LA 3BE2A 2C5YA 3O7LB 3DY7A 5EG3A 3RCDA 4E6CA 4J96A 4G34A 4YTIA 3MFSA 4IZ7A 3SOCA 4O7VA 3WZEA 3HAMA 5I9UA 3F2NA 4GFGA 4AFJA 3RZBA 4D2WA 3POZA 3BZ3A 4M13A 4C36A 4IWOA 2BRBA 3S95A 5A4EA 3FMEA 3PTGA 4RFMA 5BYYA 5HNIX 4XG4A 3C5IA 1OB3A 5HLWA 5AAGA 2XKCA 3EKKA 4FIFA 5F9EA 2G2FA 4FKJA 5K3YA 5CU6A 4AT4A 3F3TA 4QP2A 4EL9A 3OMVA 5IEVA 1W7HA 4W8EA 4ZTHA 5FQDC 3GC9A 3TJCA 2W1DA 3FLQA 3BU5A 3O8UA 4TNBA 4H36A 5AR3A 2PZPA 2E9OA 3U4UA 3ZUVA 2QOQA 3CTQA 4L67A 5BQ0A 1Q62A 3R9HA 3ZM4A 2OIQA 1GNGA 3G33A 2XK8A 5CI7A 4A4LA 4WBBB 4GUBA 2BDWA 1OZ1A 3F6XA 3VQUA 3EZRA 4IX5A 3BYOA 5AUTA 3G5DA 3H0YA 4U8ZA 4I3ZA 5HG5A 2HXQA 2RFNA 5D9HA 5HG9A 2LAVA 3OG7A 4WD5A 4FTMA 2NRUA 4O0UA 4E4XA 3PXQA 4K9YA 5AIRA 3PSBA 4I92A 1OIRA 2C0TA 4NJ3A 4L46A 4EH2A 3PXRA 4F9BA 3Q60A 3R8PA 3UJGA 1ZZLA 4FR4A 2OKRA 2ERKA 4G3GA 3O8TA 1OPLA 3F5UA 3QCQA 4FUXA 3F7ZA 3JR1A 5BVDA 1MP8A 1H1PA 2JIIA 4CGAA 4C34A 1GZKA 3ELJA 3G9NA 3QQFA 2XS0A 1UNLA 5HLPA 4ZP5A 2XP2A 5FGKA 2JFLA 3PWDA 3ZEWA 4FIJA 4EORA 5EKNA 3VJOA 4Y72A 4QNYA 2PVKA 4ZSJA 2XJ0A 4NIFA 3IW7A 4AX8A 3ZO1A 3NSZA 1YDRE 3K5UA 4UZDA 4XG6A 2F2CB 4FKGA 4X2FA 2W06A 2HAKA 3UIXA 4MBLA 3FKNA 4OTWA 4MBIA 2CCHA 5C8NA 4X3FB 5FTQA 2BUJA 4E26A 1PRYA 4NL0A 2PK9A 5CENA 5D10A 2KULA 2C6OA 4QMQA 4NEUA 2CN8A 4OTDA 4FV1A 2GDOA 4DAWA 2BIKB 2HZNA 4FEQA 2ONLC 3GCQA 3PE1A 4YPSA 2C47A 4TRLA 4C59A 3Q9XA 4QP4A 4O7SA 4QP1A 4NT4A 3FXXA 2ITNA 3LFQA 4MXXA 3GCPA 3HMPA 4IZYA 3P7AA 2XIZA 1ZYSA 2XZSA 4G3FA 3NZ0A 4DEGA 3QTSA 5JGAA 3D14A 1WBWA 3NUNA 4YLLA 2QR7A 3HAVA 4YHFA 3T9TA 3ZYAA 3BI6A 2HZIA 3BCEA 1H0WA 1LP4A 3LFAA 2YIRA 3MA3A 1JAMA 1XH8A 2V7AA 4UV0A 4TY1A 4TZRA 4X0MA 3EYGA 4XLVA 4ANBA 2ACXA 1U54A 5CSXA 5EYDA 4ARKA 2V62A 5FTOA 2FA2A 2C1AA 3FE3A 5L8KA 5ITAA 3PY0A 4IB5A 4ZS0A 3PVBA 4HJOA 4DLJA 3UPZA 4QYGA 4RBLA 2A0CX 3IECA 3MH2A 4L7SA 4C57A 3D7TB 4YURA 1Q3WA 4QMOA 2J0KA 4C4EA 3SRVA 3IGGA 3C5UA 4O83A 4TYJA 3CY3A 3DPKA 4A9RA 2GNIA 2W9ZB 4FKRA 4RJ4A 1KE5A 4GT5A 3TIZA 3NMUF 5CWZA 4BDGA 1H01A 4RX7A 3CIKA 3U55A 4EJNA 4AS0A 3F3UA 4E1ZA 1CKPA 3COIA 3WBLA 1KOBA 5LMBA 5CF5A 5AV0A 3QTQA 5ETAA 1Q61A 5FLFA 3OY1A 3HX4A 4C37A 3LLAA 1UNGA 4CG8A 2W1FA 2XBAA 4FNXA 2P33A 3BHUA 4LV5A 4XYFA 3RALA 5IDPA 3B2WA 3LXLA 4ZOGA 3RGFA 1KWPA 3ZSGA 2O63A 5FTGA 2YM4A 2YWVA 1M17A 4KBAA 1H8FA 1XQZA 4ZZMA 4R77A 3UQFA 5K4IA 2WD1A 4TTHB 3T3UA 4O82A 4DEAA 3ENHA 3QTIA 3PE2A 4KIQA 5EYKA 3G9LX 2XRUA 4Z9LA 4XRLA 3PIXA 3QUDA 2CDZA 2C6TA 4I6BA 5L6OA 2XIKA 2CLXA 4FZDB 3QTUA 4WNKA 5HI2A 2G1TA 4RJ5A 4FSNA 3VUHA 4ZEGA 1PXIA 2XNEA 3FSFA 1H26A 2ERZE 3AC8A 5LJJA 5JFSA 2ETMA 3RCJA 3EKNA 3QUPA 2GS2A 3D15A 4FTAA 4CFNA 2P2HA 4ACGA 4H3PA 3N9XA 3ZUTA 4QMPA 1H27A 4X6QC 5EFQA 1OIUA 2OI4X 3BYVA 3JUHA 5HVKA 3CEKA 4QMXA 3HMOA 5E8ZA 3W2RA 4EOOA 3C9WA 5BUJA 5E91A 5HESA 2QOCA 2RFDA 2V0DA 4FE2A 3C4XA 3SGCA 2UZTA 3R73A 5H9BA 1P4FA 2UZWE 4A06A 3DFAA 3A4OX 2C5VA 4FSWA 3KRLA 1PF8A 3LXPA 5IQDA 4BICA 3ORPA 5HO8A 3V04A 2X2KA 3OWJA 2BTSA 2VTAA 4UMPA 4A4XA 5DH3A 1GIIA 2RF9A 5EDQA 1JSVA 5I9WA 5JSMA 1R1WA 5E4HA 5E90A 1VEBA 4YHTA 2W1IA 1J91A 5C4LA 4Q2AA 3R7IA 4ERWA 3ZTXA 2WNTA 4YC6A 4S34A 4WOVA 3LFCA 5K5NA 3CD3A 4E6QA 3VUDA 4FKIA 1ZMUA 5H8GA 2JDRA 5JH6A 1WCCA 5C27A 4EEVA 4FV3A 3Q4CA 3ZBFA 3H10A 4D28A 1RJBA 1ZYDA 4L53A 2XNPA 4X3JA 3GB2A 4JDHA 4L01A 4BCJA 1ZWSA 1O9UA 1XH5A 3BU3A 4FL3A 4D4YA 4U0IA 1W82A 4LUEA 4BFMA 3MIAA 1OPJA 3TNQB 3PJ3A 4CZUA 4O2PA 3NUUA 4OAUC 4IMYA 3V8WA 4PUZA 2BDFA 4YJUA 3ZC5A 4C2VA 1ZY5A 1J7LA 4QYFA 4BF2A 4R3PA 4O6LA 1IASA 5CXHA
chains in the Genus database with same CATH superfamily
5CALA 3L9NA 2O2UA 3QA8A 4NSTA 2PULA 4W4YA 4I94A 3QQHA 4AQCA 4YZDA 4D9TA 2B1PA 2W96B 4HZRA 2ZV2A 4P5QA 3MPAA 1ZYLA 3Q96A 5HE2A 4YGAA 3VBWA 3SXSA 4RIXA 3QU0A 4RIXB 5HVYA 4RIWB 5CEIA 4AW2A 1S9JA 4YC8A 3RKBA 5FUTA 1BI7A 2VWVA 3PYYA 3CC6A 3LM0A 4JI9A 1WBSA 3P0MA 5AR2A 1TQPA 3HEGA 5FRIA 1FPUA 5HBHA 3FC2A 4GIIA 3RPVA 2I0HA 2IW6A 3FLWA 3PY3A 4AZVA 4R78A 2B9HA 1PXPA 4FV9A 4QMYA 3BU6A 1Z57A 4KIPA 3H9OA 1XR1A 1PYEA 1OPKA 2AUHA 4O0VA 5DIAA 3ORIA 3GENA 3N4UA 3GXLA 3BX5A 3I60A 3VHEA 1YOJA 2YISA 3AC2A 4NH1A 1YWRA 3B2TA 1PMUA 1ZXEA 5IQIA 2X8IA 4ITHA 4BB4A 3AT4A 2R0IA 3PXKA 1UVRA 4FJVA 4N6YA 2XALA 5EW8A 2PYWA 4AOJA 5IQFA 3DB8A 5DN3A 5GINE 3UNZA 2AQXA 3JXWA 1JKTA 2OH0E 2XKFA 5HTCA 5I9YA 3KK8A 1G8KA 4LOQA 4F9YA 1UU7A 2CKPA 1W98A 2QR8A 3DAJA 3RZFA 5M53A 1PMEA 5DRDA 2OZOA 3AG9A 4FSMA 3MY1A 4J97A 3I0OA 5B0XA 4L44A 3LHJA 3QYWA 1BUHA 4YJOA 1VYZA 1OM1A 1S9IA 4XJ0A 4MUQA 5IQBA 4MAOA 4TYEA 3GOPA 4HPUE 3OEFX 2BHHA 4MQ1A 4MNEB 3WIGA 3MVLA 2W0JA 3R7YA 4EK4A 4FZFB 3QWKA 4RC4A 1NA7A 1JKKA 3F7WA 3PWYA 4JDIA 3EFJA 3H30A 3ORNA 4K11A 5DRBA 4ALUA 3NVMB 1I44A 4GT4A 3RBWA 4F6UA 2AYPA 2R64A 2P3GX 4RIYB 4FV5A 1XH9A 3QFVA 3P86A 3A8XA 2UZBA 2G15A 3P4KA 2ZVAA 3C4CA 2UV2A 3D5XA 4ACCA 5GJFA 3ATSA 4KB8A 1CMKE 5FEEA 3R21A 5BVKA 4CZYB 5AUUA 3OCBA 5I3RA 5IA1A 2B9JA 3CLYA 3I6WA 1Q99A 4WG4A 3DGKA 4FNYA 3S2PA 3S0OA 2CNQA 4FSZA 3E8CA 1RDQE 2WGJA 3RVGA 1O6LA 5GZ8A 4O0YA 1PJKA 4HYHA 2GNHA 4UWYA 4YZBA 3UOHA 1QPJA 4W8DA 3KEXA 3O96A 3BKBA 1YW2A 3R28A 2OK1A 4WO5A 1XBBA 3OT3A 5FM2A 1OGYA 3HZTA 3OTVA 4DTBA 3GFWA 4FOCA 2OICA 3DOGA 4JBOA 4M0ZA 2QOBA 4MD9E 3MJ2A 2YABA 2HENA 2RFEA 5JRQA 3NIEA 3SRVB 3P79A 1UU3A 3D5WA 4RZVA 3R9NA 5LWMA 5DEYA 3R9RA 5IQCA 4AACA 3D94A 4XEYA 4YBKA 4XP0A 3FMMA 4IANA 2R2PA 3A2CA 3KN6A 4O0TA 2W9FB 5DMZA 4B9DA 4FKTA 3F66A 3N51A 4F6WA 2IW8A 4QTBA 3GT8A 5IA2A 1KE8A 3GC7A 2PVHA 2F2UA 3HRBA 4BDFA 4C4IA 4DEEA 1QPCA 2VWUA 3DBCA 3GC0A 3LJ1A 4KABA 4WRSA 1YOMA 1TVOA 3SXFA 3HV3A 2QG5A 4D1SA 4FEXA 5LMKC 1NXKA 1JPAA 4FG9A 1V0OA 5HO6A 3HP5A 5BMSA 2X39A 2VUWA 3FI2A 2J90A 4GFOA 4C58A 5CZIA 4BWPA 4KBCA 2ZAZA 4QTAA 2YM8A 4DFLA 1V0PA 2ZV8A 5IH4A 3ORLA 4YLJA 4AE9A 3U4WA 1NVSA 5AR4A 1TQIA 4EOJA 1G8JA 2VTSA 3AT3A 4PNKA 1ZOHA 2I1MA 4MTAA 4JJRA 5HEZA 3R7EA 3PPZA 3KF7A 2YLFA 4HVIA 5AUZA 3W16A 4EH3A 3FL5A 5DLSA 5ANOA 3AC1A 5CASA 3V01A 1Q4LA 3U9CA 3HA8A 2WXVA 2G2IA 5ACKA 2ZV9A 2C3LA 3EN9A 5AUWA 3ZMMA 4D4VA 4LL5A 4DGMA 5K4JA 5EW9A 4BVUA 2OJIA 3E63A 5DT0A 4EUTA 1AGWA 1Y57A 4CQEA 4F0GA 4DGLC 3QGWA 3UODA 3EIDA 4HNFA 4QMTA 2XEZA 3OVVA 3UYSA 5HD7A 2VO6A 5CEQA 2EWAA 2WQBA 2Z2WA 3F3WA 4KIKB 3VS3A 4YJPA 3LXKA 1Y6BA 2PUIA 2CLQA 4ID7A 4FKQA 4FIHA 3MSSA 1IA9A 4NYEA 4M69B 3SC1A 1OKWA 3EQCA 3K2LA 1RW8A 4GVJA 5D7VA 5GIPE 1ZMVA 4ZK5A 3MPMA 3C4EA 4UB7A 2YM3A 2GHLA 2ZYBA 3O5AA 4AXFA 1VR2A 1B39A 3AMYA 1ND4A 2HY0A 3IGOA 1JBPE 4JX7A 4MD7E 4CCUA 2WQNA 5HKMA 2F9GA 2VWIA 4PL4A 1UU8A 4DGGA 4F7NA 1Q8WA 1OBGA 4Q9SA 4RQKA 5EQPA 3TG1A 3COMA 2VTMA 3OXTA 5DVRA 5A4QA 5CT7A 2RG6A 2I0EA 1ATPE 4RA4A 4P5ZA 2O65A 2PSQA 3EOCA 4FF8A 4O27B 4EH5A 4G5PA 1OIYA 4G9CA 1UWHA 3W8QA 4L3PA 5JQ5A 2JITA 5KMIA 3MFRA 2R7IA 2P4IA 4KKHA 1JKLA 1XBAA 4OTGA 4BGQA 2W99B 4JOAA 5HCYA 2VU3A 4AAYA 1Q8ZA 1Y8YA 3QQGA 3DFCB 4J98A 2EB2A 2WHBA 3KULA 2Z7LA 3D9VA 3LFEA 4JBVA 4X2GA 2HWOA 4FNZA 4RG0A 4JDKA 4FI1A 2VGOA 1ZLTA 5FDXA 3W55A 4LGHA 2UZNA 4M8TA 2BZJA 2QG7A 4FT7A 3PUFC 3FMKA 4L68A 4F9WA 2J7TA 3DTWA 3EQGA 4LQMA 3R63A 4FOBA 4HGEA 4WG3A 5KMKA 3AD4A 3EWHA 1HCKA 4FT0A 3KIOC 2IVSA 2EVAA 2QU6A 2WEIA 3P23A 3PZEA 4FYNA 2DUVA 4NIFB 5DR2A 5L2QA 5KMMA 2G01A 4TW9A 4IH8A 3RAKA 4CMOA 5IA3A 5LVNA 3TJDA 2X9FA 3BYSA 4QP8A 2X0OA 3O7LD 4I6HA 2BKKA 1Z9XA 4IM0A 4NKAA 1OKZA 4R7BA 3I81A 3QKMA 3R30A 3FMNA 4D9UA 3MWUA 4YTCA 5IQGA 3FMHA 2BIYA 3NAYA 4NCTA 4U9AA 3ZONA 4XV3A 4TYGA 5J7HA 3R7UA 4XOZA 3BBWA 4EZ7A 2NNWB 3U8WA 5L6PA 1WVYA 4RQVA 4GMYA 5AUYA 3L8XA 3TCPA 1Q3DA 3OW3A 4NU1A 2R4BA 3TV6A 3P7CA 4PMMA 2R3MA 3EFKA 3DLZA 4YSMA 4EQUA 1XMLA 2VTIA 3V5JA 5M57A 2JDSA 5KE0A 2WMAA 5E8XA 3QQLA 3VBYA 4O22A 4DHFA 3KULB 5CQUA 3TWJA 4G31A 4BDIA 3KRRA 5CY3A 2C69A 1A9UA 2IZTA 3QX2A 3TL8A 2WEVA 2QVSE 3EN4A 3MVMA 4HPTE 5DWRA 3VC4A 3RAIA 4BCGA 4CTCA 4FTIA 2C68A 2XIRA 2Z7RA 3W0MA 2BKZA 2X8DA 3JVSA 3DKCA 3L1SA 1M14A 1SM2A 2C6KA 4IX6A 3Q32A 3VIDA 4AXAA 1H1QA 5J9ZA 3Q4UA 4F1OA 2IZRA 2OF4A 4FZ6A 2XEYA 3HMNA 3NYOA 4OR5A 1YWVA 2QLQA 3DU8A 4UX9A 5AR7A 2VNWA 5HBEA 3GC8A 1REJA 5CEMA 5JK3A 4L8MA 3FMJA 2UW6A 2IG7A 2C5NA 4JNWA 3ACKA 2X9EA 2I0VA 2ITXA 2VWBA 3HRCA 4UXQA 3VBVA 5L2TA 5M4IA 3BV3A 4RLKA 2CMWA 4XV2A 3WOWA 2J9MA 2OFUA 2VTJA 4EBWA 5M4FA 5K0XA 2GTNA 2J0JA 3NLBA 4M84A 4MNFA 3SXRA 3TNPC 3M42A 3Q5ZA 2V22A 4P2KA 4V05A 4DN5A 1A48A 2GQRA 2FO0A 3DV3A 4I20A 4KA3A 4J8MA 3VONA 2R5TA 1YHWA 4FT3A 1UNHA 4Z3VA 2B55A 3I6UA 5A4CA 2GNLA 2JLDA 4JVGA 4EK5A 3V5TA 5HX8A 3P78A 1OL1A 2Y6OA 5IH5A 5C4KA 5GIOE 2HK5A 1PKDA 5FBOA 3UP2A 2DYLA 4AOIA 4S31A 3QRKA 3MB7A 3M11A 2ITWA 2QNJA 2YM5A 3W0OA 2C3JA 4IHPA 4GG7A 4IB1A 3AD6A 4M7IA 4X2KA 1H24A 3KXMA 4RVLA 1JSTA 4D1ZA 5JQ8A 4DFXE 4KS7A 5FP6A 3IW4A 2JBPA 4MWHA 5EOLA 4RGJA 1A06A 3Q04A 4LRJA 4DH5A 3ZZWA 3OZ6A 2EXEA 2F7EE 4WUNA 5EHYA 5ANGA 4WRGA 4BRXA 4EQCA 4DFUA 1R0PA 3ZM9A 4HGSA 3DT1A 3UNJA 2BZIB 2C1BA 3H3CA 5BX0A 3PP0A 2C6LA 4XG3A 3ZUUA 2WTWA 3LZBA 2F7XE 4LRKA 3UVQA 2WKMA 3KRWA 4KAOA 3WI6A 4TT7A 4DH1A 4DHJA 3NPCA 1GZOA 3DLSA 5HE3A 4FEVA 4F4PA 2FGIA 4R7HA 3SW7A 4KKEA 1JNKA 3PY1A 4J99A 4EBVA 2Q83A 2BRHA 2P0CA 3POOA 4BDKA 2GSFA 2WMSA 1SVGA 4M97A 2B9FA 3EQDA 3KU2A 3TKIA 2FYSA 3NWWA 3HGKA 4E8AA 3NGAA 4XCUA 5A9UA 5JKGA 3Q5IA 4DFZE 1KUTA 1ZARA 4L3LA 3QCXA 4BC6A 3ZZEA 4ZIMA 3NAXA 3NYVA 3E87A 4FV6A 2B7AA 2X0QA 2WTIA 3OC1A 4PP9A 4R5SA 3C50A 4IQ6A 1PYXA 2IWIA 4CFMA 4IX3A 4K8AA 3QCYA 2XK7A 2AC5A 2CSNA 3BQRA 3LM5A 3Q3BA 4PPCA 4FKSA 4TPTA 3H0ZA 4AW5A 4D4SA 4USEA 2Y8OA 3VAPA 4JBQA 2VO3A 3OBJA 3GU4A 3MVJA 3HECA 3BYUA 4QMZA 5DEWA 2OF2A 2XCHA 1H1SA 4DCEA 3QXPA 5JFWA 5I3OA 1GY3A 2OGVA 3TIYA 1WMKA 4ALWA 5KMLA 4ZLOA 3HMIA 4DYMA 1WBNA 4QO9A 4IZAA 4YLKA 3VBTA 1IAJA 1BKXA 1OUKA 4UEUA 5IUGA 3RK5A 3SA0A 1F5QA 5HLNA 4HNIA 3TZ8A 4C02A 3EQFA 4AXDA 1ZY4A 4GU9A 2OXDA 3R1SA 3QKLA 2GFSA 5IKWA 3DNEA 4YU2A 4S30A 3UP7A 2DQ7X 5HTBA 3VVHA 3P5JC 3OOGA 5B2KA 4EH4A 2Y4PA 4FTLA 2VTQA 4U43A 4I5HA 2CCIA 4OTIA 2IN6A 4MXZA 4JRVA 3QD3A 1XJDA 2J2IB 4H39A 3KY2A 3ET7A 3UG2A 3NCZA 4NTTA 5KUPA 3FQSA 2CHLA 3E7OA 3R8ZA 4YJTA 2QO7A 3EZVA 4N57A 5TE0A 2YITA 4JBPA 5CSVA 4FTUA 3F5GA 4GU6A 4C4HA 3MFUA 4AA5A 2UW5A 3FLZA 4RT7A 4ZTRA 5AP4A 4ZJIA 4GS6A 3LKMA 2JD5A 5IQAA 3A7FA 2GFCA 2OJJA 3BLRA 3COHA 5CVHA 5LMKA 4OTQA 3NYNA 4RIOA 2J6MA 4GIHA 4UZHA 5DHJA 2CKOA 3LQ3A 4TKSA 1WFCA 2PUNA 2X2MA 5FBNC 5M56A 5CYIA 3DAKA 4EHEA 4DT8A 3F82A 3GEQA 3TACA 2X1NA 2OJFE 4MEDA 4YJQA 5DGZA 5LMAA 4DHZA 2LGCA 2VX0A 4J52A 4UWCA 4V0GB 2VD5A 2WMRA 3F61A 5C01A 1V1KA 5B7VA 1NY3A 2UZVA 4PDOA 3UO6A 1W84A 3NNXA 4H3QA 3ATTA 4QDVA 5JGBA 5K9IA 4XX9A 1IR3A 1QPDA 3CQWA 4IVDA 3O0GA 3QXOA 4RX9A 5FXQA 4ZTLA 5CX9A 5BV3A 3IDPA 4AQKA 4ACMA 4ZY4A 4KD1A 4O96A 5LVMA 5CXZA 5HNBA 3R22A 4I21A 4QMLA 2JIUA 4NJDA 5FD2A 2WB8A 4CKJA 2C30A 2YCSA 3DTCA 4YJRA 4C3RA 2XH5A 3QZGA 2I6LA 3R01A 2F49A 4O84A 3F69A 2QOLA 3F3VA 4TWNA 2JGZA 4BCOA 4M68A 2CPKE 2ITYA 2UW8A 3LMHA 2PMLX 2IO6A 3FV8A 4CT1A 3LCOA 5DT3A 2GS7A 1H0VA 3ZHPC 4D55A 4BJJB 3AT2A 2QHNA 3HKOA 3EB0A 5BNJA 1SVHA 3UC4A 2P2IA 2YM7A 4EOPA 5TF9A 5FDPA 1URWA 5I9VA 2X8EA 3MV5A 1E9HA 1KE6A 3JPVA 4DG2E 4RC2A 1JKSA 2H8HA 5DG5A 3DNDA 4E6DA 3CBLA 4QTEA 4MHAA 5E7RA 4PTEA 3MESA 5HCZA 2PZYA 2SRCA 4TXCA 2W4JA 3R1YA 4X6RA 5CU3A 5K0KA 3QKKA 2WTCA 3KRJA 4RVMA 4U42A 4E4MA 2YN8A 1MQBA 1ZAOA 4O86A 2B54A 4J95A 4LGGA 3TEIA 4FIIA 4BKYA 4JR7A 4FKOA 3GP0A 5HX6A 4FV2A 3A7JA 4U97A 4PTCA 4FRFA 4M0YA 5AV4A 4MD8E 4ZMFA 5BVFA 3FSKA 4QP6A 3QALE 4D0WA 4NTSA 3KMMA 4PMPA 4MF0A 2G9XA 3TZMA 2UUEA 3ZXZA 4PL3A 3VS2A 3LPBA 5DOSA 3AGMA 4BTFA 2Y7JA 4TWPA 4C61A 4GYGA 5FP5A 5L8LA 4HGTA 4JAIA 4MQ2A 5AIKA 4Y46A 5EHLA 5HHWA 1DM2A 3ANQA 3VNTA 2XK9A 5J5TA 1H28A 1YI4A 3IW6A 3MTFA 4KSQA 5L2WA 1HOWA 4HVHA 4PQNA 1K3AA 2GNJA 2HZ0A 5JRSA 2HWPA 1VJYA 5KKRB 2B53A 2Y4IB 2BZKB 2WTJA 1FGIA 2X0GA 1HCLA 2VO0A 1ZOGA 3PUPA 3IONA 3CJFA 3CR0A 3RNYA 3ULZA 2X6DA 2KTYA 2XB7A 4BDBA 4QNAA 4BDJA 5A54A 1IRKA 3E5AA 3OOMA 3W1FA 4D5KA 3CJGA 3JS2A 4X2NA 1MQ4A 4EH9A 4A9TA 4D2TA 2ITZA 5AP5A 3MH3A 2XNNA 3ZBXA 4HCVA 4DG3E 1U54B 3UDBA 4F7JA 5HTIA 4C35A 4QP7A 3R7OA 4FL1A 2BTRA 4UMTA 2R3GA 4IACA 1Q8YA 5TT7A 1XBCA 2Z8CA 1XH7A 3NEWA 3W18A 4NM7A 4DTKA 1H1RA 2F4JA 4FIEA 4AXCA 4C33A 5A6NA 3OCSA 5AMNA 5LVOA 4IIRA 5JN2A 2W1GA 3T3VA 5EM8A 3TKUA 4YJNA 3QGYA 5KMOA 4UWBA 1NVRA 4ANSA 3GUBA 5CLPA 4EI4A 2XNGA 4GK4A 3HA6A 4GVAA 3CE3A 3DZOA 4NWMA 4F99A 4UMRA 3FI3A 4X3FC 3WZUA 3RAHA 5HG7A 1URCA 4B6LA 4PY1A 4EC8A 3GGFA 3RPSA 4CMUA 4UALA 3O51A 2XK6A 3VO3A 3FXZA 2FSLX 4YZ9A 1XWSA 3RK9A 1FMOE 4M15A 4AGDA 4E5BA 2C3IB 5KHXA 3UQCA 2VTRA 4KRDA 4DE4A 4EOKA 1OL7A 4J8NA 5IEYA 3NVKI 1W0XC 4O21A 3ORKA 4Y83A 4EYMA 5M51A 2HOGA 2F7ZE 2ITOA 3T8OA 4FODA 4Y85A 4F6SA 5BUEA 1J1CA 4FC0A 3GQLA 3EL7A 3JYAA 3PFYA 3U6JA 4RWLA 4AU8A 4AZEA 2IJMA 2PY3A 4OLIA 3REPA 3S1HA 1Y91A 1M2RA 4I0TA 1Z5MA 3R8MA 4EZ5A 4Z55A 1OL2A 3EHAA 4GJ3A 4I0SA 5IF1A 5H8BA 4FTQA 2YZLA 3S4QA 4MWIA 4QMMA 3NNUA 2ZV7A 1U46A 3C4FA 4WNPA 4ZSAA 2GPHA 3GI3A 4QD6A 3OWKA 4IAIA 2CJMA 2UW9A 4HVGA 2YACA 1R3CA 5HO7A 3PA5A 4UN0C 3CSVA 2IF8A 4PPAA 4AAAA 4TYIA 2W1ZA 3DXNA 2JAVA 2VZ6A 4PDPA 2I7QA 3PA3A 3C0GA 3SD0A 3TTJA 3D5VA 3HYHA 2XNBA 3LVPA 3BLAA 3D7ZA 1BI8A 2JKQA 3GOKA 4DH3A 2XKEA 3PJ8A 2PPQA 5CF8A 3C0IA 2ZOQA 3R8LA 4E93A 3QLFA 3HV7A 4YC3A 4JG7A 4XRJA 3SW4A 3TZ9A 3LJ0A 2QONA 3E8EA 2EXCX 4S33A 5L3AA 3ZLYA 4S2ZA 2H9VA 3ZO4A 4D2RA 3PPKA 1W2FA 4AZTA 3QYZA 4TNDA 2XUUA 1PXOA 4GYIA 5HCXA 4APCA 4BBEA 3E3BX 3Q2JA 5ICPA 4BTJA 4QQTA 4IM2A 4D0XA 2YIQA 3E8NA 3WF5A 1REKA 4HCUA 5DR6A 2HXLA 2RGPA 3AKLA 4I4FA 5JEBA 2QU5A 5IISA 2ZFYA 3UOKA 4FV8A 1DAWA 3NNVA 4BKZA 4F64A 5EM7A 3ACJA 3OF0A 3DBQA 4RZWA 4AZSA 1Q41A 2XRWA 3AC5A 4LOPA 2VWZA 4JQ8A 3BHYA 5T6KA 4AG8A 4B0GA 3ZU7A 3KQ7A 2V7OA 5CI6A 4CZTA 2DS1A 3BHTA 4JG8A 1K2PA 3G0EA 5AR5A 4U6RA 3ZRLA 4J7BA 4G5JA 4CLIA 2ZMCA 3QAME 5CTPA 5AP0A 3HUBA 2YDIA 2W17A 3QQJA 3V8SA 3V6RA 2VTNA 4NFMA 4EUUA 5KBRA 2ZB0A 3DZQA 4MVFA 3SG8A 4ZY6A 4FTKA 1J3HA 3FWQA 1IEPA 4NKSA 4AA0A 2NP8A 3K54A 4GT3A 3OCGA 2JDOA 3RJCA 1OBDA 4HGLA 4QRCA 5J9LA 2QKWB 4U3ZA 4ZMEA 2QKRA 3UVRA 1ZYCA 3KB7A 3Q6WA 2NPQA 3QZIA 5IA5A 4AGUA 4GK3A 4XV1A 4GCJA 4AOTA 3RINA 4BCHA 5EI8A 4Q9ZA 3E7VA 4EK3A 3BGPA 3FYKX 3I5NA 3FEGA 3LJ2A 3LCSA 4ASDA 2VRXA 4BWXA 2A1AB 3GCUA 5IMXA 3E8DA 3PIYA 3P7BA 4D4RA 1DI8A 3HVCA 1WBOA 1P5EA 2WZJA 3RK7A 3ZLXA 4BZOA 3IW5A 2BROA 2FVDA 4H1JA 4PRJA 4UMUA 2O5KA 3WF6A 3LMIA 3AMBA 3O50A 4I5MA 3DJ6A 3GNIB 4F65A 4IZ5A 5EYCA 3NFGB 1RE8A 4FTTA 4AWIA 4FL2A 3W0PA 4NW6A 4LV7A 3P08A 3PJ1A 2UW7A 3QZHA 2R3NA 2CGXA 4YTHA 5BPYA 4KNBA 2UW0A 4X3FA 3CGFA 4D1XA 3OTUA 5LCKA 2PMNX 3W10A 4F63A 3VHKA 5T3QA 2P55A 2ZDUA 1Q8UA 1IG1A 4RIWA 4WHZA 3DKGA 2PVFA 3LIJA 4N6ZA 3MA6A 5ETIA 3KC3A 3RHKA 4XH6A 4EOMA 2A19B 3VF9A 1B6CB 1YXXA 4EH6A 4C4FA 3MN3A 3V6SA 5H8EA 1JVPP 4FK6A 4AN3A 5AAFA 4OTHA 1GJOA 4I41A 3ORMA 4R6VA 3AMAA 1WZYA 5G6VA 2X4ZA 3BLHA 3BWJA 4ZJVA 2A27A 3OCTA 3N4TA 4DT9A 2BAKA 2QHMA 3D2IA 2V55A 3W2CA 4IC8A 4RWKA 3CPBA 3R71A 3E88A 4O0WA 3LCTA 2OG8A 5D7AA 5C9CA 5CQWA 1FOTA 4BDCA 3L9MA 2UZLA 5CSWA 3FKLA 5BVOA 1G8SA 1IAHA 5CF4A 3WF7A 4JMQA 1ZYJA 3ZEPA 2QOFA 2QI8A 3Q2MA 3KK9A 3RAWA 4DCAA 2WTKB 4HZSA 2O64A 4QQCA 4LMUA 2EB3A 4ZS4A 3QZFA 4L52A 4BN1A 1FVVA 3IQ7A 1KOAA 3MPTA 3L9LA 4UBAA 3F5PA 4IW0A 5A46A 3CPCA 5HIBA 3B8QA 5I4NA 4EZ3A 5J79A 3MBLA 1L8TA 5EDRA 4AW1A 2R3QA 4OBQA 1QMZA 4MH7A 5M4CA 4OW8A 1Y6AA 4FT9A 3LFDA 2BAJA 4FX3A 5EOBA 4S32A 2VO7A 2XK4A 3D5UA 3FBVA 2ZM3A 3GCSA 4AF3A 5CEPA 3BEGA 3NUAA 2A4LA 3IPHA 4MXYA 2CKEA 4ACHA 3KXZA 1KE9A 2IZSA 3DBDA 4O7NA 2FSTX 3DCVA 2E9VA 2HYYA 1OVEA 3LLTA 4PMTA 4IWPA 3U54A 4F78A 2GU8A 4AFEA 2BALA 5DFPA 1KV2A 1FINA 2BRNA 3ZSHA 4BCNA 2NYAA 2H6DA 3BEAA 3CKXA 4EONA 4BHZA 2GQGA 4TWCA 3W2OA 3NYXA 4EH8A 3QRTA 4BGGA 4E3CA 2PMOX 3I0QA 4ZAUA 3D0EA 3LCKA 4QP3A 3RPOA 1U59A 4Q5HA 5AP6A 4IEBA 4ZZNA 2PU8A 2PWLA 4WSYA 1GZ8A 3HDNA 1J7IA 1RQQA 5EW3A 2PZIA 2WMUA 4O0SA 4O6EA 2Q0BA 4BI0A 2PHKA 1JQHA 3EYHA 2JDTA 4OTFA 3ZXTA 3IK3A 3QRUA 4CMTA 3P9JA 3BGQA 4BCIA 4E6AA 3OW4A 2QD9A 3UMWA 4N0SA 4NW5A 4R5YA 4MXCA 1OL5A 4F0FA 4ERKA 4WT6A 3FUPA 3ZDIA 2C5XA 4M69A 3LCDA 2XF0A 4GV1A 5AA9A 4YBJA 1H4LA 3ENMA 5M06A 4O4CA 4ZTMA 4QPAA 2VX3A 5CU2A 4ANNA 1GZNA 2RL5A 4IFCA 3SG9A 5HICA 4OBPA 3NNWA 1YVJA 5BUIA 3HMMA 5DYJA 3CQUA 4KUJA 4G17A 5FG8A 4CV9A 1TKIA 3A99A 3ODZX 4TN6A 3UVPA 3WZJA 4AT3A 1PY5A 1B38A 4EHVA 4O81A 2E9NA 2J5EA 4DFYA 3RPRA 2ESMA 2XM9A 3TDWA 5I9XA 5KKRC 5IPJA 2J50A 3K3IA 3KXNA 1PXMA 3UPXA 4DH7A 4II5A 3QC4A 4KIOA 3BHVA 3FQEA 3R8UA 3NX8A 4FA2A 3VUIA 4CKRA 4HW7A 3B8RA 1P2AA 4QP9A 3PPJA 5M09A 3FJQE 3QTXA 5ANEA 5BMMA 5FEQA 4O7ZA 2C0OA 1QCFA 1TFFA 4XHKB 4ZXTA 2R3PA 4CRSA 5IUIA 3R7GA 3II5A 4RVKA 3TNWA 1G5SA 2OFVA 2X7FA 4XMOA 2PUPA 2Z02A 3CXWA 4EYJA 3QUEA 3VN9A 5AR8A 5L2IA 4PTGA 5IUHA 4LRMA 4MK0A 2GHGA 2YEXA 4GUEA 4Z7HA 4M66A 5E8WA 3VS4A 2GHMA 4FV0A 4G3EA 3RMFA 3VS6A 5AM6A 3EQRA 2VWYA 3ZFXA 5B2MA 2BFYA 1VYWA 2HELA 2WMVA 3HNGA 3IKAA 3V5PA 1U4DA 4YTFA 5CZHA 5BVNA 2XANA 5F94A 5M08A 3L8PA 2W05A 4CLJA 4HYUA 4CYIA 3DBFA 4CYJA 5HU9A 2QQ7A 4LI5A 4V01A 5M44A 4V04A 3UBDA 4IAAA 4I6LA 2YDJA 5HOAA 3BL7A 1WVWA 3ZS5A 3CS9A 3EN7A 5CANA 4E4LA 3UC3A 4FSYA 4KKGA 4G3CA 1YXTA 2JFMA 3KCKA 4K33A 3WF9A 4CFWA 4YP8A 5IA4A 3QRIA 2OU7A 4F1MA 3FPMA 4P90A 3E64A 3UO5A 2WMXA 3KA0A 5F4NA 2ZM4A 3EMGA 3W2PA 5CS6A 2BVAA 3PP1A 1PKGA 4O7WA 4YJSA 3EN5A 4BZNA 2CKQA 1AD5A 3DBEA 4YR8A 2X6EA 2F57A 4CT2A 5LOHA 1H1WA 3A4PA 1OIQA 3VS0A 4OUCA 3QC9A 5E1EA 4DTAA 1MUOA 5AP3A 4C7TA 2XYNA 3WYXA 4PP7A 5F1ZA