4GSBA

Monoclinic crystal form of the apo-erk2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
343
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGMVCSAYDNLNKVRVAIKKISPFEHQTYQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Monoclinic crystal form of the apo-ERK2
rcsb
source organism Rattus norvegicus
total genus 111
structure length 343
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gsbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gsbA01
4QMNA 3BBTB 4FE2A 3TNHA 4ZSAA 2X39A 4O38A 5EDRA 4F64A 5FD2A 1OVEA 4HVSA 2O63A 5DT0A 3CIKA 4USFA 4YLJA 2HOGA 4WRSA 4HYIA 4FK3A 2J0IA 2GSFA 5HCZA 4P4CA 3COMA 2WZJA 3Q2JA 5HEZA 3O7LB 1RE8A 4JQ7A 4RC3A 4F6WA 1M14A 2HXLA 2B9JA 4H58A 3AC8A 4QOXA 4HYHA 3LFQA 3CJFA 2XZSA 1J7IA 3I0OA 2XK8A 3NAXA 2YCQA 2FSTX 2YJRA 4JL9A 4YZ9A 2VX0A 3AGLA 2WQEA 3FZRA 4PDPA 5BMSA 3NZ0A 2KULA 4GMYA 1MRVA 2QU5A 4FV9A 3QQLA 3P1AA 2GNFA 5IH5A 5K0XA 4RJ5A 3F3ZA 3OT3A 4QP1A 5HD7A 1OL1A 4PTGA 2G01A 2YN8A 3EQCA 4O0XA 2QOBA 4EBVA 2F2UA 4GSBA 5KE0A 3BE2A 4ZSLA 5KUPA 2Z7SA 3K54A 5AJQA 1H27A 1MP8A 3EOCA 5CTPA 5DFPA 5IQFA 4YJRA 4CZYB 1GIIA 5EKOA 4S33A 2PVFA 5A9UA 1YXTA 4CFMA 2PZYA 5JFVA 5K4JA 3I7CA 4ERWA 3ORNA 3KULB 4GFMA 3K5VA 4J52A 3FMJA 5C01A 2X8EA 4UX9A 2VO6A 2BAKA 3TZ8A 2PZIA 4KIPA 4NKAA 3GVUA 5DA3A 3VF9A 3WZKA 3JUHA 1Y6BA 4KKGA 4Z16A 1SYKA 3VS5A 3QRUA 2OKRA 5AP7A 4C4HA 3O8PA 4TT7A 3VS6A 4L67A 5A4EA 1QCFA 4UY9A 4QQTA 5KX8A 5AR8A 2I0YA 1XWSA 4RMZA 3VIDA 2EUFB 2VAGA 3Q2MA 5IMEA 3UIBA 2C3LA 1XJDA 4FVPA 2R3GA 2CJMA 3KRWA 5HHWA 3HMOA 2IZTA 3PE1A 4AWIA 4IAAA 5AR7A 5BUEA 3I5ZA 2J90A 4KBAA 4BICA 1E1VA 4OTIA 2QOHA 3S4QA 4D55A 2JKOA 3FE3A 5GNKA 3UIUA 4EOOA 4CG8A 3HA6A 3MWUA 5TE0A 3TNPC 4E8AA 5L2WA 3RINA 3AC5A 3KC3A 3FUPA 5LQFA 5CAPA 2XCHA 5EI2A 1ATPE 3RCDA 1BI8A 3GCSA 3ZDIA 1OIRA 2O64A 3EFLA 2F4JA 4R6VA 3ODZX 4TTHB 4NWMA 2C47A 2BRBA 4KKHA 3VNTA 5EOBA 4WUNA 4O6EA 4IX4A 2OJ9A 5EQEA 2YABA 3WBLA 3EKNA 3EB0A 3ZLXA 3ATTA 4O83A 3OXIA 4MX9A 4MQ1A 5CF5A 3H10A 3TCPA 2XB7A 3TWJA 4M97A 1FPUA 4DFBA 3C4XA 4JT3A 2QOCA 2WTDA 4AS0A 4DFNA 3GP0A 4OW8A 4XMOA 4BDGA 4JAIA 1YXVA 4HJOA 4DEIA 4BCHA 4CMTA 3V8TA 2ETKA 2PZ5A 4FNXA 3SXSA 4O6LA 2QOOA 3RI1A 3EQDA 3FI2A 4J1RA 2XK9A 3KXGA 3VBYA 1MQBA 3OEFX 3RPSA 4FEUA 2YZLA 4RX7A 2GFSA 3ZRMA 5IG1A 3DDPA 5JMSA 3KRLA 4IBMA 4ZXTA 2HWPA 5HE0A 3QHRA 3VQHA 4BIBA 3B2TA 3EYGA 4NCTA 5J79A 5M07A 3FV8A 1UU8A 4DH3A 2YERA 4I5PA 4IACA 4NW5A 2E9PA 5IU2A 4O7RA 3PVGA 3JS2A 3K2LA 2R7IA 1U54B 2VTQA 4U9AA 3RAIA 4NH1A 3OBJA 4FV7A 1ZYDA 3OF0A 1XHAA 3Q6WA 4IC7A 3TT0A 3BEAA 4Y72A 5HVYA 4I4FA 2ETRA 2ITNA 3CD8A 4X6RA 2GTMA 2XJ0A 5FXSA 2J0KA 2PL0A 3A7FA 2BAQA 4G3EA 4ZJVA 3QZGA 4U3YA 2R3FA 4JBOA 2VU3A 2YJSA 2R3QA 2B4SB 1PXOA 4Q9ZA 3BHYA 2O8YA 4O0SA 4BIEA 3PPZA 4ACDA 4FUXA 5EYKA 2YHVA 4ZZOA 2CMWA 3G5DA 2JKKA 4AZWA 2WELA 4WSYA 3LFAA 1T45A 3EFKA 3UO4A 4BDFA 4IIRA 2CKQA 2GMXA 2ZMCA 4BZOA 1FMOE 4RWLA 3DU8A 3FL4A 3LCSA 4AN9A 1YHVA 4BWPA 2VTOA 2Y4IC 5FM2A 2QI8A 2ZYBA 4GT3A 5J87A 1OI9A 1NY3A 3SHEA 3PXQA 4BZDA 3OTVA 3L8XA 5I3OA 2FSLX 2UZVA 3NLBA 3CTJA 3PSCA 5AV1A 4KIKA 4NKSA 3EFJA 3T3UA 3E3PA 2BHHA 2JBOA 3OROA 4IAYA 5D7AA 3AG9A 3WARA 5EI6A 1SM2A 1ZMWA 4PMMA 2JDOA 2PWLA 1BX6A 5AMNA 2PZRA 2W05A 4DEDA 1SMHA 1BMKA 5KCVA 4UWCA 4DGMA 3EFWA 5CT0A 5LMAA 2JEDA 1NVSA 2QOFA 4GRBA 3V5LA 3MFUA 3PYYA 1P14A 2PE0A 3C50A 3LFCA 3HNGA 5FTQA 4OTHA 4AW5A 2YISA 4U45A 2WHBA 3CCNA 3V6SA 2UZLA 3EQBA 2RF9A 2X6EA 3RZFA 2WTVA 1ZARA 2H96A 2JIVA 2ZVAA 4K9YA 3FLNC 3IOKA 3BZ3A 3HP2A 3WZUA 1GNGA 3ORIA 4L00A 2CDZA 4MXYA 4DTBA 5GZ8A 4ITHA 2AC3A 3I6UA 2YDKA 5FGKA 4S32A 2Z02A 2FO0A 2XK3A 3ZHPC 4A06A 1YOLA 3NR9A 4JBVA 5HBEA 5EOLA 4BDDA 2OF4A 3ZZWA 3RM6A 3VHKA 3QYZA 5CSVA 4D2WA 1PMEA 4ACHA 2I7QA 4F7JA 3OCBA 5LVNA 4WT6A 4ANMA 3R00A 1GZ8A 5I0BA 4AGWA 2VWBA 4BDAA 3O17A 4F1MA 4AE9A 4EKKA 2PMLX 4BDBA 5FBOA 4HNFA 1ZZLA 4ZOGA 4BYJA 2R5TA 4EH3A 4OAUC 4N6YA 3GUBA 4GT4A 4GH2A 5FM3A 4XP0A 4YO6A 1JOWB 5DE2A 3GCQA 2X7FA 4IX3A 4LMUA 4I22A 1SVEA 4I1ZA 4MNFA 3PPKA 4NM3A 3MFTA 3QALE 4BDHA 2BVAA 4NCTC 5KMJA 1KOAA 4QTCA 1UA2A 4B99A 3SV0A 1A48A 3PLSA 4FNWA 5DVRA 5EG3A 3OG7A 2J0MB 4FOCA 4GYGA 4XP2A 4ACMA 3ZSGA 5IPJA 5H8EA 5CYIA 2YM8A 2CGXA 2OZAB 4V0GA 3PZEA 4YZMA 3BYUA 5A14A 3RHXA 2WTIA 1OL2A 3QCSA 4DCEA 2OIDA 4QYFA 4BHNA 1H24A 4KRCA 4E6DA 3ZO4A 4DFLA 2WD1A 3KK9A 1YHSA 3SDJA 3FYJX 4BTJA 5CU3A 2ITXA 3RHKA 4BFMA 4E93A 1LPUA 3QC4A 1W83A 3ZC6A 4AW2A 3ORLA 5LJJA 2OH4A 4X2NA 4DG3E 4PL5A 1XH7A 2YWPA 3PRIA 3QU0A 4KAOA 4FV5A 5AAEA 4C62A 5M4IA 5A4TA 4BDEA 4LI5A 3UDBA 4F9AA 5I9UA 4RA4A 2RSVA 3CTQA 4FKLA 1H4LA 5HIBA 4YTFA 5L4QA 2YCFA 3SG9A 3FWQA 5I5ZA 3UO5A 4BGGA 4RA5A 5JRQA 3VS1A 3DZQA 3ZO3A 4F09A 2OLCA 4RT7A 2OF2A 4AGCA 4ZK5A 1UWHA 3DBCA 3CJGA 2BDWA 3FXWA 4FKQA 3ZLYA 4AACA 5TT7A 3IDBA 4CT2A 4U5JA 5EDQA 4H3QA 4C38A 2VZ6A 4XRLA 3BELA 1BYGA 5IUHA 3LFNA 4WOVA 5FEQA 3U51A 4TL0A 2B53A 4TY1A 4MWHA 3PG3A 5E8UA 3T3VA 3ENHA 3PTGA 4QPAA 2FB8A 2E9NA 4LL5A 4N0SA 3ZEPA 2O2UA 1GZNA 2J0LA 2UZBA 4Z9LA 1O9UA 3QTZA 5ANDA 3TV4A 3DBQA 3I4BA 3LIJA 1PYEA 2W7XA 4I5CA 4CFXA 4IQ6A 3OY3A 3KF7A 3RWPA 4AG8A 3NSZA 3BLRA 2BALA 3QTWA 2C3KA 4IZAA 3VBXA 3C5IA 1JLUE 3NEWA 4CKJA 5BVNA 3LCTA 3DZOA 4WBOA 5IEYA 2BDJA 3O7LD 3UZPA 4F6SA 1U5QA 1FMKA 3HLLA 1H25A 4LGDA 4ZSEA 4MNEB 2XH5A 4HVIA 2G2FA 3FMNA 3U9NA 4XG9A 4AXAA 4CTBA 1J7LA 4CYJA 1J1BA 4L9IA 3GCUA 4QMXA 4ALUA 2ITOA 2J50A 4K6ZA 4OGRA 4EWQA 2HK5A 4EC9A 2Y7JA 3HV6A 3VBTA 1BL6A 3HZTA 2VGPA 4O27B 4C58A 2Q0BA 2OI4X 3POOA 3W18A 4KSPA 1URCA 1L3RE 1OUKA 2G15A 4YJTA 3M1SA 3DOGA 3MFRA 1PYXA 2XIYA 3GOKA 4KBCA 3VBVA 4DG0E 3PJ8A 2Z7LA 3VUHA 4FTTA 3LHJA 3BKBA 1SNUA 3A99A 4L7FA 4PF4A 4I41A 4RZWA 2Y4PA 4FIGA 4LL0A 2PVLA 3UNZA 4HCVA 3UYTA 4JIAA 2R3OA 4IVBA 3PSDA 4M12A 3QYWA 1ZOHA 4QMYA 3FKOA 5ACKA 3V5TA 4ACGA 5C4KA 3AQVA 5IQHA 2I1MA 3UNJA 2QD9A 3QL8A 1DI8A 5B2KA 4ANNA 2C6IA 2IN6A 4KABA 2I0VA 5M4UA 1NW1A 4ZMEA 2X4ZA 4XX9A 4G6NA 4I24A 5IMXA 2O65A 3C5UA 4X0MA 3ITZA 3DGKA 4UMTA 4LMNA 4WA9A 3OTUA 3BYSA 3TZ7A 1JAMA 2ZAZA 4I6HA 5AUZA 5HGIA 4PRJA 4FSZA 4E26A 4AZVA 4FX3A 5AP0A 4W4YA 1YDTE 2B7AA 4QP2A 5K3YA 2H6DA 2C6OA 1KE9A 5HVKA 4Y85A 5HORA 4O7ZA 4F63A 4MKCA 2XRWA 4DEGA 5HBHA 3CPCA 3DS6A 4D0XA 2GPHA 4DCAA 5CEQA 4QMVA 5EQPA 5CVGA 4KNBA 4CRLA 4OAVB 5IQGA 3W33A 2PUUA 3Q32A 4CRSA 4A9TA 4M0YA 4ZZNA 5H8BA 4EOKA 3AD6A 3LKMA 3TZMA 2UZUE 3VHEA 2PVNA 3QFVA 1P4OA 1H01A 1YVJA 4JG6A 4EK8A 4WNKA 3EQHA 3OOMA 3GC0A 5FRIA 1CM8A 1R78A 5EW8A 5HTIA 4LQMA 2Y4IB 5A54A 3KREA 5KMNA 2CNUA 1JSUA 3ACKA 3MTLA 5JQ8A 4EQMA 2C6LA 4OTDA 2QO7A 4TWOA 3QX2A 3MDYA 4F70A 2RFDA 5AIRA 4Y95A 2E9OA 5E1SA 4BCMA 2JD5A 4L7SA 4F99A 5J1WA 3PXYA 2JIUA 4FODA 2VO3A 3UIXA 4K8AA 2R0UA 4E6CA 5B2LA 4AQCA 3TTIA 3LCOA 4QQ5A 2W0JA 3UC4A 3C0HA 3KXHA 4JG7A 5CI6A 1G5SA 1PY5A 3EL7A 4ZY6A 3VWAA 4X3JA 3VW6A 3SG8A 3ORXA 4C4FA 5LMBA 3MN3A 3O51A 4F1OA 2QQ7A 2X2MA 3C7QA 4CVAA 3IONA 4BGHA 1JKLA 3AMAA 4JNWA 3QGYA 4ZEGA 3AT4A 4BVUA 4HGTA 5EI8A 4EK3A 2X9FA 4F4PA 1M17A 3LW0A 5FDXA 2R3NA 3F6XA 3DK3A 5CU6A 1UNLA 5I9WA 2Z7RA 5JGDA 1XH9A 2R7BA 4BCOA 4L01A 2XS0A 3H9FA 3MY1A 5FTOA 5IQBA 5DOSA 5C4LA 4QMSA 1ZYSA 4J8NA 2X2LA 3WOWA 3Q60A 4L3LA 4BRXA 4RJ3A 4FZDB 4FKTA 5L8LA 4FIIA 4QQCA 3W8LA 4WNOA 2GNHA 3UOKA 5ANGA 2YCSA 5DWRA 4BL1A 3S1HA 3B2WA 4D2SA 3CQWA 5AA9A 2JKMA 1Z5MA 2P2IA 2V55A 2OICA 2WTKB 4W4XA 4NM7A 3PVBA 3A60A 4OBPA 2WEVA 5CSHA 3QQHA 3GU8A 1G3NA 2XNOA 4I23A 4L42A 3BV3A 3EQFA 3HUBA 3Q4TA 3V01A 4D0WA 4YZDA 4ZTMA 3ZSIA 4IX5A 4MTAA 5FDPA 3FMEA 1H08A 4IFCA 2GNIA 3MFSA 5BPYA 2VUWA 3GT8A 4PP9A 4QPSA 4G2FA 2YM6A 4AOJA 2C6DA 4FIHA 4J95A 4M7IA 4NUSA 1GJOA 4ZP5A 2XM9A 3EZRA 4FKGA 2VTHA 3O50A 5EM5A 3UVQA 2GTNA 3N4TA 1ZWSA 3F7ZA 4GUBA 5BUIA 4FKJA 3AGMA 3GC7A 4R7BA 4YJUA 4YZBA 1XO2B 2GNLA 5M57A 2CKEA 2X6DA 4X3FA 2XBJA 3EYHA 4IWQA 4BTFA 2ZM4A 4USEA 2XKFA 3D7TA 1O6KA 3PP1A 1H28A 4IB3A 4D2TA 4EHGA 3FEGA 1OL6A 3ZO2A 3QHWA 3HDMA 4FTRA 4FKRA 3ZRKA 2Z60A 5CZIA 2J4ZA 4WNMA 5CU4A 3BGQA 4O7TA 2QO9A 3WZJA 4ZZMA 4U6RA 5EW9A 3E63A 3ROCA 5JH6A 4DT9A 3ZS5A 4O7SA 4J53A 3CGFA 5BNJA 5M55A 4WG5A 4H1MA 4QO9A 5D9HA 2AYPA 4HPTE 2C3JA 2BTRA 4HCTA 4FKVA 3EWHA 4N70A 4O86A 4X2GA 4NK9A 4RJ4A 4E3CA 3ZOSA 3DFAA 2JFLA 3TXOA 3W1FA 3UNKA 3PJCA 3R01A 4MBJA 3V6RA 3EQIA 3KVXA 4DEAA 5AUTA 1Q24A 4TKSA 4WSQA 3M11A 2YM5A 3VAPA 5IDNA 4H3BA 4PNKA 4DFXE 2UZDA 4MXAA 2O3PA 1Q8ZA 1V0PA 4S30A 3DKFA 1LR4A 4O2ZA 4MXOA 3ZRLA 4AZSA 3TDVA 4FTKA 3OMVA 4KIKB 2PVJA 3Q4UA 2XUUA 3AXWA 2BCJA 4M15A 4RIWA 1XBBA 2GU8A 1ZOGA 4EQUA 4RJ7A 4O2PA 3DKGA 4TWNA 3ZONA 5LWNA 5IEXA 3MB6A 5HO7A 4FSMA 3UOJA 1FGKA 3ET7A 3IDCA 1OZ1A 4DG2E 3MVLA 1FVTA 5LWMA 4M69A 2PK9A 4UBAA 4DLJA 4ASZA 4GL9A 4U42A 5J1VA 4AT3A 3PUPA 3QKMA 4EBWA 3JPVA 4P2KA 2UW6A 4B8MA 4F0IA 2UW5A 4YP8A 4IAFA 2BZJA 2XKEA 4II5A 4FG7A 5DRDA 4CFVA 3RCJA 4BR3A 4FOBA 3JVRA 4GU6A 5A46A 2PYWA 1Y8GA 4R7IA 4HYSA 3SC1A 4O22A 3A62A 2QC6A 2WQNA 3NWWA 4GU9A 4XBUA 4XS2A 4DLIA 3NIEA 4C3RA 3G9LX 5FQDC 5ANKA 3KCKA 5EM6A 4TW9A 3WILA 1M7QA 4AT5A 1R0EA 3L9PA 3QD0A 4J8MA 4NYEA 2ITYA 4Y83A 2WMSA 4LG4A 4OBOA 1L8TA 4Y46A 4F1TA 4BDCA 4EL9A 1H1QA 1H07A 5KO1A 3ID6C 5JFSA 3RPYA 4QNAA 3R7GA 3RNYA 4EUTA 2BMCA 3RNIA 2HW7A 4RQVA 4G3GA 3Q9ZA 4XV1A 4YJSA 4F9BA 4L45A 4FEVA 4BCJA 2VWIA 2XKDA 3MA3A 1YKRA 4ID7A 1OKWA 4RSSA 5F9EA 4JR7A 1OGUA 2J0JA 3IGOA 4QMPA 3FAAA 2B55A 3C1XA 2W1FA 4RBLA 4BBFA 4BI1A 5CEMA 3DXPA 4FZ7A 4RVKA 4DA5A 4AAAA 3LFEA 1K3AA 3PP0A 1YWVA 1YOMA 3H9OA 2UW4A 2OXDA 4EJNA 1NT2A 4EORA 3ETAA 3MH2A 3HP5A 4PWNA 5CQWA 3S95A 3IW6A 4WBBB 2E9VA 4XH6A 3ATSA 3ZM9A 5KHWA 4EHVA 3GI3A 5DHJA 4E5AX 1F5QA 2QHNA 4YURA 2SRCA 1WVXA 3MIYA 4GKIA 5A4CA 4X3FC 2X81A 3SD0A 2RFSA 3L9MA 5KMLA 4UZDA 4GFOA 1WBWA 5CEOA 3VJOA 3UC3A 2ZM1A 3PG1A 4V0GB 2QOIA 2BROA 5FEEA 3COHA 2WEIA 2R4BA 3FZPA 5E92A 2UZOA 3SOAA 3UVRA 1ZAOA 3ZBFA 3HGKA 4QPMA 3VUKA 3H0YA 3R7YA 5E91A 4JRVA 4EH2A 3RBWA 3TG1A 3PWYA 2GFCA 3FMHA 2XEYA 3KRXA 3QTXA 3P08A 4FSWA 3LXLA 4PV0A 4XJ0A 2VO0A 3D0EA 5AIKA 3W2RA 1YI4A 5HICA 2ZJWA 1ND4A 5EW3A 4C61A 3VBQA 2I6LA 3PXKA 3O23A 4X21A 1BL7A 3G6HA 4APPA 2VTLA 3FZOA 3MBLA 3R1NA 5IH6A 3NNVA 4Q2AA 3I5NA 3THBA 2G2IA 2QONA 3C4ZA 5IA3A 2VTPA 2WMRA 4XOYA 4APCA 4CMOA 4GJ3A 4TXCA 3E8CA 3D15A 3W2QA 2B0QA 4AP7A 4D2PA 4DAWA 4AFJA 3Q53A 2C1BA 4ASDA 3LXKA 3QAME 4G9CA 3LJ1A 2BRMA 3MVJA 4AA0A 1PXIA 4EQCA 5A4QA 4EC8A 3K3IA 3MJ1A 3U4UA 2I0EA 2H34A 3Q9YA 3R8MA 3HL7A 4M84A 4FTIA 4E6QA 3QUEA 3SXRA 3TN8A 3QTQA 2YAKA 4M8TA 2QU6A 3LOKA 1RDQE 1RQQA 1XH6A 2C4GA 2WFYA 2C5OA 2VRXA 3H30A 4IX6A 3AMYA 4QYYA 4RIXA 2FA2A 5CAQA 5LOHA 2OXXA 4F6UA 3VRZA 2PUPA 3FL5A 5AP5A 3DK6A 3TZ9A 1H26A 3G6GA 4AW1A 3QQJA 1TQPA 2J5EA 3RZBA 4BCKA 2BILB 2GHMA 4BN1A 3U6IA 4CYIA 4ZS4A 1GIJA 1WBTA 3DBFA 1OIYA 3QTUA 4V01A 4AW0A 3G90X 2CNVA 3BYMA 3CQUA 3RKBA 3EH9A 3UIMA 1O6YA 4FMQA 4RC2A 4IWDA 1TQMA 5CASA 3HRFA 5L2QA 1JKKA 4O0WA 4BZNA 2GQSA 1OMWA 4J99A 2XKCA 1H0WA 3VS3A 2WMAA 4J97A 1LEWA 1R39A 5HZNA 2OSCA 3F5UA 5CEPA 4DEEA 2NRUA 2V7AA 3PXRA 3QX4A 1Q3WA 2HCKA 4R1VA 3V5PA 4LUDA 4EJ7A 1JSVA 2OJGA 2X7OA 5H3QA 4XYFA 3T9IA 5T68A 4DH7A 1XH8A 5J9ZA 4OTFA 3M42A 2PU8A 4FV4A 4D4YA 3ALNA 3HAMA 2O5KA 2XNBA 3DKOA 2BZHB 5HBJA 2C5VA 2HWOA 4FKIA 2PVYA 3GBZA 4JXFA 5J9YA 3E3BX 5K5XA 4ZLYA 4AF3A 1NVQA 1YRPA 1OB3A 3FJQE 4CFNA 4F9WA 3FSFA 4RFYA 5K0KA 5GJGA 5E90A 4FYOA 4ZJJA 1I09A 4FL1A 3TIZA 3T8OA 5CEIA 4K1BA 2WXVA 5HI2A 2XVDA 4AN3A 2WMUA 3CGOA 4E4NA 1S9JA 2OBJA 5GIPE 3RWQA 3MY0A 3MI9A 2YAAA 3WYYA 2Z7QA 4LRKA 2WPAA 2BZKB 4QTDA 3W55A 1W7HA 2C3IB 3CY3A 4XBRA 2OJJA 3FKLA 4U0IA 4ANBA 4F9YA 3JYAA 1VEBA 2RFEA 3U54A 3I1AA 1VZOA 2B1PA 4MD8E 3TEIA 5HG9A 1KE8A 3EQGA 5BVEA 3FBVA 4DH8A 3Q6UA 3D2IA 4R8QA 4HZSA 4NSTA 1EH4A 4RC4A 4C33A 3NVMB 4AT4A 4I21A 4C34A 1LUFA 5IF1A 3CD3A 2A19B 2JFMA 2UZEA 4JX7A 3R71A 5HG7A 4PPBA 5EM7A 1A06A 4G17A 3RMFA 3CKXA 2W4OA 2YLEA 4LV8A 5IISA 4MH7A 5AEPA 3KGAA 3NW7A 4YC8A 2J2IB 5DPVA 5F4NA 3ZMMA 5JFWA 4R78A 3M2WA 4D4RA 3QLFA 1R3CA 3AT2A 2W17A 1YQJA 4XG3A 4MYGA 4DYMA 5KNJA 1M7NA 2A27A 2P3GX 3AT3A 3GXLA 3OHTA 4CMUA 2CLXA 4QNYA 3PY1A 5E8WA 4ZSGA 4BGQA 5L3AA 5IQEA 1B38A 3QTSA 2Q0NA 2CPKE 3IDPA 3I60A 5F1ZA 4XG6A 2PHKA 2ZDUA 3G0EA 5HKMA 2GHLA 1W98A 3IGGA 5A6OA 2W9FB 1ZZ2A 4PMTA 3DB6A 3ENMA 2LAVA 5LCJA 1JQHA 4UYNA 3UG1A 4FV6A 5AM7A 5BX0A 3MS9A 4FYNA 4S31A 4FEQA 4WHZA 4TWCA 4C7TA 4KS8A 3FC2A 4MBIA 4W4WA 5KZIA 3FI8A 3QD3A 4BDKA 2ITUA 2QLUA 4FC0A 4ZAUA 5DT4A 4XHKB 3ZLSA 3DV3A 4QMLA 5L6OA 5I4NA 2IW9A 1Q97A 3C0IA 2F57A 3BI6A 2WMXA 2WU6A 3R8UA 3KF4A 3ZCLA 2WQOA 4X7QA 4HGEA 3V5QA 3BHTA 2X4FA 4I0RA 4D58A 5DT3A 5IA5A 4CV8A 5LCKA 3NUPA 3DAEA 4ZTNA 3W2CA 3R7UA 3NNUA 2A2AA 2XBAA 2YZAA 4G31A 1YDSE 3R63A 2VTNA 5T6KA 2UVZA 3RK9A 3Q96A 4RJ6A 5L2IA 4AUAA 5M56A 5DGZA 2PVRA 2EXMA 4ZSJA 3CR0A 4C0TA 1JNKA 1GZKA 2YIRA 3HMPA 4HOKA 4JJRA 5GJDA 3MPMA 3OZ6A 2EB3A 4MQ2A 4QTBA 3WF6A 5EK7A 4W8EA 1PXLA 4C57A 1V1KA 2IZSA 2VWZA 4GIHA 3MVHA 1FVRA 3C4EA 3R7OA 2XJ1A 4TPTA 3ZZEA 2Y6OA 4FVQA 3R8ZA 3QXPA 3VVHA 1TKIA 1FVVA 1U5RA 4F65A 3TDWA 1K2PA 1PKGA 3LE6A 3QQUA 3VS4A 4F9CA 3ZSHA 4HPUE 4DGOA 5KMKA 2W1ZA 1TVOA 4IM0A 5HCYA 1OBGA 4Z7GA 3DNEA 3OFMA 4YNEA 4G3CA 3ZM4A 2CN5A 3I79A 5D12A 3OVVA 2XRUA 3O96A 3F3VA 5TR6A 2OXYA 1W82A 3AC4A 1STCE 5JSMA 3VO3A 1PXKA 4NEUA 4GIIA 1U4DA 4FNYA 1DM2A 4HGLA 4P5QA 4QMMA 4YC6A 3VUIA 4CTCA 3R9RA 4IZ7A 4R77A 2XIZA 3FXXA 4C02A 2ACXA 2IVSA 4G16A 3ZUUA 4BTKA 1PHKA 4GS6A 5H2UA 2UW3A 3NW5A 4N6ZA 3UQCA 3FPMA 3C51A 3PPJA 4YSJA 4EK5A 3CXWA 2GCDA 4MEDA 2J9MA 4MD9E 4X3FB 4XLVA 4RQKA 5IUIA 4D4SA 4BY9E 2QG5A 3D7TB 3ORTA 4PPCA 3UOLA 2JDRA 2C6TA 3VQUA 2C30A 1WMKA 3P7CA 3MTFA 3QBNA 3QCYA 5HE3A 3ZUTA 5CXZA 5AFVA 4FI1A 3LM5A 5J5TA 2ONLA 3B8RA 1X8BA 5CALA 2Y8OA 2YACA 2KTYA 1AGWA 4I92A 3MPTA 4IM2A 5D11A 4DTKA 2C0OA 4ZS0A 3VS7A 4HVDA 4CQGA 2CGUA 4DEBA 1FQ1B 2HZNA 4KS7A 3KVWA 4BHZA 4CFFA 5CF4A 4FGRA 1PXPA 3FHRA 3KCFA 4DINA 4M67A 5F20A 4TYEA 1KE7A 4NIFA 2XIRA 3DA6A 3KY2A 3A8WA 2YEXA 4BC6A 4AFEA 4MVFA 5TF9A 4C3FA 5BVDA 1P4FA 3EN4A 2R3JA 4FTNA 5JZNA 4E73A 4NTSA 4FTLA 3OP5A 2FUMA 3QTIA 4EONA 3OS3A 2C68A 5FXRA 4Y5HA 2WQMA 4OTPA 4C4IA 4EZ7A 5HD4A 3LQ8A 2QLQA 4IAIA 1OL7A 5A4LA 3Q4CA 2IW8A 5EHYA 2ZMDA 4O81A 5M53A 4DBXA 4MK0A 3MIAA 2WTJA 4RIWB 4BBMA 1OBDA 4USDA 4HCUA 4NJ3A 4PNIA 2IG7A 3F69A 4N4SA 4OTQA 3P5KA 4DFZE 5I9VA 3DT1A 4Z7HA 3R1QA 3QF9A 1ZYLA 5M51A 3E7OA 3HMNA 5ETFA 3UGCA 4M69B 4JG8A 5K5NA 1U46A 5AP4A 1QPEA 3GCPA 3PWDA 2Y6MA 3G51A 2OH0E 4Q9SA 4WNPA 4WRGA 1KE6A 1UWJA 4PMSA 2R3LA 4ORKA 2DYLA 5E4HA 1H1WA 4BIDA 2OIQA 1ZLTA 5CU2A 5BYZA 2NRYA 3ORZA 4QP6A 3EN6A 4KA3A 4FTUA 4QYGA 3W8QA 2UW8A 5JFXA 3F2RA 4OT6A 4RWIA 2W06A 4E4MA 3LJ2A 4FKSA 1ZY4A 3C13A 3GEQA 4QP9A 5D7VA 3GC8A 2PTKA 3HYHA 3GFEA 4LV5A 2YIYA 4CD0A 2QODA 4I5HA 5CSWA 1UV5A 4EH4A 2B9FA 3DLSA 5AA8A 1J91A 5E8YA 2XK4A 3QZHA 4A07A 2Y0AA 1UNGA 1UU3A 4NU1A 1IRKA 3FMLA 2ZV7A 3EKKA 1DAWA 4QP7A 3NYNA 3I7BA 3ACJA 3R7EA 4A9UA 5AUXA 4MHAA 4U8ZA 3COIA 5EH0A 3UE4A 4E1ZA 2WMVA 2P0CA 3EN9A 4TYHA 5M4CA 1NA7A 3PXFA 3QZFA 3AC2A 4PL3A 5AR5A 4UWBA 2YWVA 3ZYAA 1OPLA 4WG3A 4OTRA 2EB2A 1MQ4A 1Q41A 4BKJA 4N57A 4ITJA 2BDFA 2C6MA 2HZIA 1OITA 4TNDA 5LMKA 2J7TA 3FY2A 5CVFA 3A7IA 4QQJA 3D9VA 5HX6A 3SRVA 4IB1A 3DQXA 4B4LA 3BGZA 2IVTA 1XQZA 1K9AA 3WIGA 1SZMA 1DAYA 1PF8A 2HY0A 2YCRA 3DXNA 4U44A 4GT5A 5DEYA 3SXFA 2W4JA 2CLQA 4AGDA 4UEUA 1QL6A 2XYUA 4IAKA 4O0RA 3I0QA 3P4KA 2JDVA 3PIXA 4Q5EA 3GC9A 3FXZA 4XV2A 3TNIA 3U4WA 4O21A 4I94A 5HIEA 5E8TA 3VBWA 3GQIA 2EVAA 3D14A 2ESMA 5DH3A 3F3WA 3F66A 4FUYA 1H1RA 5HOAA 1PMVA 2ZV9A 3KN5A 3IKAA 3QQKA 1Z57A 4FBXA 4QP4A 2VTTA 2OZOA 4KD1A 2IZRA 2LGCA 3P78A 4G9RA 2F7ZE 5EHOA 4MXCA 4IC8A 2WGJA 5EYCA 2OG8A 4I6QA 4CCUA 2I0HA 2ONLC 3DKCA 5HO8A 5LVLA 4IEBA 1KWPA 4A9RA 1OL5A 4E4XA 4AU8A 5BYYA 3JXWA 2PUIA 4EK4A 3BLHA 3EN7A 3RP9A 2EXCX 4AN2A 4XG4A 3R9NA 4BTMA 4PDYA 4FG8A 4C35A 4R3CA 3OBGA 2UW9A 3A61A 4R7HA 2CGWA 3GU6A 4M3QA 5HNGA 4QTEA 4PY1A 3LLAA 4MD7E 4IWOA 1DI9A 2BRGA 5IUGA 5GIOE 4Q5HA 5H9BA 4F0FA 3MYGA 1OIUA 2OIBA 4IANA 4RIOA 4YNOA 3OWJA 4GVAA 4QMUA 3UP7A 3A4OX 4TYIA 3RPVA 1PMUA 5CENA 3MGYA 2HZ4A 3IW5A 1KSWA 3KFAA 4YR8A 2JGZA 3L1SA 3DDQA 4JX3A 4ANOA 2VTMA 3Q3BA 4ZTLA 5FEDA 4U43A 5B2MA 3D94A 1O6LA 5KZ0A 4I0SA 5GHVA 4GV1A 2OJFE 5ANIA 1YI3A 4BI0A 2Y9QA 2XNGA 3NUYA 2OGVA 4YHTA 5L6WL 2WMQA 3CPBA 2HW6A 2EXEA 3IW7A 5L2TA 1J7UA 2GS6A 5G1XA 2XP2A 4D5KA 3F7WA 3FQSA 5CS6A 4FSRA 5CXHA 5CNOA 4KUJA 4RIXB 3OWLA 2GQRA 2RG5A 4CCBA 4D5HA 3ZXZA 3P23A 5LVPA 3KXMA 2IZUA 2P33A 4FV0A 3BGPA 3HUCA 4G5JA 3CY2A 3CSVA 5IEVA 5EYDA 4FZAB 2ZB0A 3PY0A 1VYZA 5L8JA 4B8LA 1PJKA 2OU7A 3HRCA 1UU9A 4RJ8A 3ZO1A 5JN2A 3CS9A 3KMMA 4UMRA 2C5XA 4GK4A 3KXNA 3OT8A 2JBPA 4EZ5A 5DR9A 5DG5A 4NW6A 4GKHA 4NM0A 3IO7A 3PIYA 1H00A 4WD5A 5HQ0A 4J98A 4AOTA 3GNIB 4RGJA 3ZC5A 3PE2A 2JKQA 3NCGA 3QC9A 3QUPA 3FZTA 2QCSA 4YJNA 5AR2A 5H8GA 5C8MA 5EKNA 1QMZA 4O0UA 3GU7A 2X9EA 5GINE 2A0CX 1NVRA 4AX8A 4HVHA 5AADA 3K3JA 2XK7A 3EHAA 3MH3A 4ACCA 3GQLA 1WVWA 3BRBA 4CT1A 2C1AA 3R2BA 5AM6A 5IA2A 2PMNX 4XG8A 4IVDA 3V3VA 1G8AA 2VWXA 3NCZA 3UMXA 3COKA 1CTPE 3E7VA 4O1OA 2ITVA 2FH9A 2HAKA 4KIQA 4C3PA 4L52A 4D2RA 4YTCA 3QKKA 5IQAA 5LMKC 4IJ9A 4KRDA 5GZ9A 4NFNA 4IW0A 2VV9A 3II5A 4QMQA 4RIYA 3P0MA 3FLWA 2PE1A 4XV3A 2J6MA 4ZTHA 4BCGA 4R5YA 3DJ6A 5LVOA 3L8VA 4I20A 5E7RA 3SVVA 4FKUA 5J8IA 3RALA 1OKYA 3P7BA 4GCJA 2W9ZB 3HMIA 3UJGA 1GIHA 3DBDA 5GJFA 5CEKA 2R2PA 3R21A 1MRUA 4PP7A 3FLQA 1PKDA 4F0GA 5BVKA 1Q61A 3E88A 4B7TA 4FF8A 4A9SA 4DEHA 3GCVA 3VS0A 5CAOA 4IFGA 5L8KA 4GG5A 2FSMX 1ZMVA 4YLLA 4EOPA 3LMHA 4WIHA 2B9IA 5DNRA 3N4UA 4FEXA 2UVXA 4I93A 4EWHA 2C6EA 2PE2A 1XKKA 1V0BA 4JIKA 3C9WA 3BU6A 3FDNA 2VO7A 1XBAA 4L43A 3E8DA 3F2AA 3JVSA 3Q52A 5E8SA 3D5WA 4PTCA 4ENYA 5I9YA 1A9UA 4FIFA 1R1WA 3D2KA 3D7ZA 3HRBA 3IK3A 1OKVA 3LXNA 3ULIA 4CV9A 3LVPA 4ASEA 3ORPA 5FUTA 4FICA 5EM8A 4ONAA 4HW7A 4DE4A 4I6BA 3LZBA 3VJNA 3QCQA 5LARA 2GQGA 3PA5A 4X6QC 1UU7A 4YPSA 5JKGA 3NS9A 2QO2A 3MVMA 5HESA 2UUEA 4IE9A 3W32A 2BRNA 3QRKA 1GOLA 4PPAA 2CSNA 3OCGA 4KSQA 4H1JA 5CF8A 1Q62A 4TNBA 1W0XC 3CE3A 2R64A 5DRBA 3QA0A 3R7VA 2AC5A 4Y8DA 4EH5A 2YDIA 4QD6A 1U59A 4OTGA 4ANQA 2YM3A 4JBPA 4WO5A 2P2HA 3KN6A 3L8SA 1HOWA 3R1SA 3TM0A 4RRVA 3NYXA 5CX9A 3ROYA 3L9LA 4WG4A 3G0FA 3FLSA 4YPDA 1IA8A 4RVLA 3VW8A 1AD5A 3MH1A 3F82A 4MAOA 3W2OA 4FL2A 4XV9A 3QXOA 4E4LA 3DJ7A 3R28A 1Q99A 3NPCA 4CNHA 4EOJA 2FSOX 5L6PA 2BR1A 3TI1A 4BF2A 2JAMA 4YU2A 3PDTA 4YC3A 1ERKA 3HECA 4LOPA 3R9OA 3BU5A 4CKIA 2XCKA 4J7BA 4L44A 4UMUA 2QG7A 2OK1A 3FSKA 2FVDA 3E62A 3HKOA 4L68A 4P90A 3SX9A 2HY81 3DBEA 3C4WA 2XEZA 5EYMA 4ITIA 1Q5KA 2QVSE 4DC2A 4QRCA 3QLGA 1KOBA 3GFWA 3VF8A 4K2RA 4RZVA 4B6LA 4H05A 1M52A 4I0TA 4D28A 3VS2A 3PJ1A 3QUDA 3PLAE 3S2PA 3OY1A 2FGIA 4BCIA 2PY3A 3D83A 4BDIA 5AR3A 2DUVA 4FTAA 3AD4A 2IVUA 3JY9A 2VTAA 5JEBA 2WOUA 4I4EA 3KK8A 3IECA 3UQGA 3V5JA 4BBEA 5HNBA 3E5AA 1J1CA 4KINA 5HG8A 5B7VA 5KBQA 4FTJA 4K33A 4R1YA 3FPQA 4EOMA 3O0GA 3OOGA 2XM8A 4FKPA 2BTSA 4GJ2A 4RFZA 3VUDA 4DH1A 1MRYA 2JITA 1B39A 3ZUVA 4FNZA 1YHWA 4NFMA 4EOLA 1PMNA 4D2VA 2W1GA 4HVGA 4G6LA 3TKIA 5IQIA 5ETIA 2WMBA 3TJDA 4UZHA 4GEOA 2R3HA 4FKOA 1OUYA 4D1XA 3OWKA 3WE4A 5CANA 2W4KA 3QGWA 3IS5A 4ZY5A 4KWPA 4R5SA 3RAKA 2A1AB 3NIZA 4UXLA 2VNWA 3RM7A 4O7VA 1AQ1A 4CLIA 4IB5A 4M13A 2ITZA 4B9DA 3RPRA 2YM7A 5CF6A 1YXUA 2RFNA 3IW8A 4IXPA 4CEGA 2RIOA 3H3CA 4QYHA 3MESA 4BWKA 2XNMA 4D9UA 3JY0A 4JBQA 4X2FA 5I3RA 2W1DA 2IWIA 2R9SA 2W1EA 4ZTQA 5G6VA 3ANRA 2QKRA 5HVJA 4F7SA 5EDPA 3KQ7A 4GVJA 2X0GA 3MSSA 1Q8YA 3U87A 4UMPA 4O7LA 1FINA 4ANSA 2XJ2A 3EIDA 3OWPA 3BYVA 4FSQA 4J71A 5D1JA 1DS5A 3OW4A 4IJPA 3AC3A 3QRIA 3TACA 2WOTA 2PMOX 3EN5A 3GGFA 4B0GA 3SA0A 4P7EA 5AWMA 3R30A 4ALWA 4W9XA 4E5BA 5C03A 5M44A 4NIFB 4IM3A 3UZTA 1HCLA 4O0TA 4FEWA 4IVAA 1QPCA 2ITWA 4I5MA 1W8CA 3FHIA 1JVPP 4UWYA 3SLSA 3F5PA 3VUMA 4LFIA 4O91A 2OJIA 1B6CB 4S34A 5LVMA 2IPXA 1WVYA 4OT5A 4A7CA 2BPMA 3KMUA 4O0YA 2CN8A 3R6XA 2BRHA 4FZFB 3BV2A 3PZHA 4X2KA 4BYIA 4OTWA 3EL8A 3O2MA 4G6OA 2G9XA 4OLIA 4YHJA 1P2AA 3HEGA 4XRJA 3LJ0A 4FA2A 5FP6A 1CSNA 3BIZA 2W5BA 5DIAA 4EOSA 1IR3A 3CP9A 5CI7A 3VUGA 4FV8A 3R2YA 3DFCB 5JRSA 3E92A 3R9HA 2V0DA 3ERKA 2GDOA 2UVYA 2C69A 1YXSA 4GUEA 5D10A 5CU0A 4H39A 3Q4ZA 4RG0A 1JPAA 1PXNA 3NW6A 5TKDA 5HLWA 2CNQA 2VTRA 1ZOEA 5HTBA 1Y6AA 3A4PA 3QQFA 2CKPA 3F2NA 3LLTA 1GZOA 4MXXA 4YJPA 5C27A 2ZOQA 3PJ2A 2BIKB 1W84A 2B54A 3DQWA 3MH0A 4D1ZA 4UN0C 3WF7A 1LEZA 4UYAA 5FP5A 2NPQA 1XH4A 3WYXA 4JLCA 2YM4A 4C4JA 5HLPA 2VWUA 5JGBA 2ZV2A 3QWJA 1MUOA 1XR1A 1REKA 1ZXEA 2OO8X 2R3MA 3CC6A 4FT9A 4CFWA 2RKUA 3QTRA 5I9ZA 5F95A 2WB8A 2UZWE 4JR3A 2XMYA 4U79A 4E5WA 5C1QB 3SQQA 4K11A 3ZBXA 4D1SA 1F3MC 4K18A 2VX3A 2WTCA 2ZV8A 3KL8A 1OM1A 4CLJA 2F7EE 3FC1X 3G9NA 3VULA 2IJMA 4ZJIA 4BCNA 5HX8A 3R7IA 1IA9A 4U81A 2GNGA 4LGHA 1HCKA 1Y91A 4OR5A 3DNDA 3C4CA 3O8UA 5KKRC 1CKIA 4L53A 5DI1A 4TYHB 2PSQA 4ENXA 2VGOA 2WMWA 3DPKA 3N9XA 3ELJA 4L46A 5AR4A 4CKRA 1UNHA 2X2KA 1JKSA 1PRYA 4KIOA 4M0ZA 4LM5A 3ZEWA 2PULA 5BMMA 3H9RA 3EZVA 4DGLC 3TUBA 4XP3A 4RWKA 2F2CB 4JOAA 3OCSA 4E7WA 3FKNA 4IADA 4QTAA 2JLDA 1KV2A 3B8QA 3SRVB 4BWXA 5J5SA 5L2SA 5C8KA 2BZIB 3HDNA 4RVTA 5E8VA 5JZJA 4FIEA 1S9IA 2XK6A 5M08A 3FQHA 1VYWA 4O0VA 1Q8UA 5C26A 5GZAA 5ANOA 4IDVA 3KEXA 4IB0A 4U41A 5K4IA 2RL5A 2BIYA 2WIHA 4XCUA 3S0OA 5KBRA 4BCFA 1CKPA 3E8NA 4K0YA 5EHLA 5HU9A 1TQIA 3D5XA 2JDSA 4YJQA 5BVWA 2OWBA 4CQEA 3PA3A 3HA8A 4Z55A 4FV3A 4O7WA 4RWJA 4BKZA 3DXQA 3PRFA 5BVFA 2NP8A 2GS2A 5DYJA 1Y8YA 3BBWA 3EJ1A 3MPAA 4LRMA 4HZRA 4V05A 4XNEA 3LAUA 3KXZA 3ZTXA 4ARKA 1FBNA 1PXJA 1CKJA 2VD5A 4YZNA 4ZY4A 3VRYA 5HTCA 1I44A 1ZMUA 3LFDA 2YDJA 4JDKA 3DK7A 4G3DA 3IPHA 3ODYX 4JDIA 4ZTRA 4CXAA 2WKMA 4MWIA 4KBKA 4O7YA 1YOJA 3AMBA 3GB2A 3UVPA 4M14A 4I3ZA 2PVMA 3F61A 3BHVA 3TKHA 1E9HA 2X8IA 1JBPE 4AZEA 5CWZA 2YA9A 1Z9XA 3R8PA 3KA0A 1PW2A 2QR7A 3SOCA 4EOQA 5J7BA 2NO3A 3QRJA 1YI6A 4HGSA 3TUDA 5IDPA 3MA6A 2J5FA 3WIKA 3QCXA 1WBOA 3MW1A 2V62A 4YBKA 2Q83A 3D4QA 3IQ7A 2W5AA 2F49A 5AAGA 2YIWA 5F94A 3WF8A 2X1NA 5C9CA 4JI9A 4GYIA 3SW7A 1R0PA 4FTMA 3U8WA 2VWWA 5EQYA 4UB7A 2BAJA 4IWPA 1F0QA 3E93A 3NNXA 3O8TA 2E9UA 5HE2A 3F9NA 3NYVA 1OPKA 4I6FA 2WMTA 3H0ZA 2WTKC 4MXZA 4FT5A 4YBJA 2GS7A 3F3TA 4MCVA 5AX3A 3RAHA 4AGUA 3R02A 3NVKI 4RX8A 5HNIX 2JDTA 4D4VA 2HELA 4O84A 4MF0A 3FYKX 4NM5A 5IH4A 3U6HA 3RGFA 3G15A 4JS8A 2WQBA 3BHUA 3KU2A 5ICPA 2EU9A 3LQ5A 2G2HA 3F3UA 3CEKA 3UYSA 2VNYA 1LP4A 3TNQB 1QPDA 4O7NA 3LM0A 5AV3A 4G34A 1YDRE 2XNNA 3LFFA 3LFBA 3U9CA 4FSNA 4UMQA 4YZCA 1CMKE 3BHHA 2C0IA 4IMYA 4C2VA 4FL3A 5IA1A 3R73A 3EMGA 4LOQA 5CSPA 5T3QA 2PVKA 3BLQA 3N51A 2WAJA 1YWNA 3BWFA 1WFCA 1ZRZA 3KULA 4FT0A 5AP1A 5HO6A 3ANQA 3NDMA 4J96A 4EHEA 5M09A 3BU3A 1Q8TA 1JKTA 2W99B 5FG8A 2HIWA 3TJCA 4RVMA 1J3HA 2UW0A 5DBXA 4DITA 3A7JA 2PUNA 3C4FA 1UVRA 2OFUA 3KXXA 3FZ1A 5HU3A 4NT4A 3WZEA 4G1WA 1H0VA 2V5QA 3CTHA 4IZYA 4EH9A 4NL0A 3UTOA 4EHZA 4D9TA 3Q04A 1BLXA 3PY3A 5CAVA 3BYOA 3C0GA 2IO6A 5EFQA 5FXQA 3V5WA 4DT8A 4RIYB 3DAJA 4UV0A 3AD5A 4PL4A 4AA4A 2WIPA 2ZM3A 3E87A 3POZA 3REPA 5A6NA 1BI7A 3BEGA 4BKYA 3AC1A 3GOPA 5DR2A 4C2WA 4EYMA 3QRTA 4C36A 4QP8A 2IVVA 4XLIA 2Z2WA 3HV7A 4C4EA 1H8FA 3IG7A 4GK3A 3KMWA 2VTSA 2XYNA 5CLPA 4GW8A 2EWAA 3UOHA 4FR4A 4G5PA 4ZMFA 1IEPA 4U80A 3OCTA 3T9TA 3MJ2A 3R0TA 2H8HA 4L6QA 5FBNC 5HE1A 4YGAA 3L8PA 1GAGA 5HCXA 3GU5A 4ERKA 5I9XA 2XNEA 3I81A 5BVOA 3GENA 3R22A 3H4JA 3P86A 3RJCA 5CQUA 4FIJA 3NYOA 5ETAA 2C6KA 3W10A 4DFUA 4QMOA 1OKZA 3ZDUA 1FOTA 4E6AA 4LUEA 1IAHA 4CSVA 2ITPA 1VJYA 2W96B 5AUYA 3NAYA 2DQ7X 2JIIA 3DCVA 3CLYA 3R1YA 3WI6A 2ITQA 2WO6A 3RVGA 1BKXA 1VR2A 5BUJA 2QOKA 5FTGA 2YLFA 1H1SA 3SW4A 2REIA 4S2ZA 4BDJA 2BUJA 3KKVA 3MV5A 3FI4A 4H3PA 4ALVA 4F08A 5CT7A 2WU7A 4K77A 4DGNA 2HXQA 3UG2A 4JQEA 2H9VA 3QZIA 4L3JA 5HG5A 4IH8A 3FQEA 5CNNA 2F9GA 3FMKA 5LXMA 1WZYA 4UALA 5AUUA 1KUTA 4A4OA 3DY7A 4IVCA 4PDOA 1U54A 2XIKA 3NMUF 2HYYA 3RTPA 5E9EA 2ERKA 2UV2A 2VWVA 1E1XA 3PXZA 4BCPA 2GNJA 2PPQA 3E8EA 3LPBA 4DH5A 1APME 4R3PA 5ITAA 4W4VA 1OIQA 2ERZE 3ZFYA 4OBQA 3OUNB 4W8DA 4EYJA 1XH5A 4WKQA 2VX1A 1M2RA 3UMWA 5IZFA 5KHXA 2P4IA 3BX5A 2J51A 4JAJA 3UP2A 3TV6A 4YTIA 2HZ0A 3CKWA 2QR8A 3AOXA 3KB7A 4PDSA 5ANEA 5ETCA 2RGPA 3G33A 3K5UA 3OW3A 3V8SA 3A8XA 4IDTA 3Q5IA 3NUXA 4PUZA 3EQPA 5FWKK 5IQCA 3PA4A 5C8NA 2W5HA 1KE5A 2R3PA 1UKHA 4IZ5A 3BQRA 4JQ8A 5HLNA 4IAZA 4GFGA 4RFMA 2C5YA 4U40A 5KMOA 2VTJA 1IASA 2NNWB 4V04A 3VN9A 4QT1A 2YIQA 4W9WA 4KB8A 3KRRA 5CZHA 4YTHA 5HIDA 5KKRB 4FTCA 4X2JA 4TYJA 4ZTSA 1G8SA 3HV3A 2BFYA 4F7NA 4FK6A 5B0XA 3BPRA 3P9JA 2QNJA 4G3FA 3WF9A 4F7LA 4YJVA 2X7GA 3P79A 2RG6A 1Y57A 3ZFXA 4PMPA 2R3RA 3NGAA 2XA4A 2YFXA 4FZ6A 1H1PA 4R3RA 5E8XA 5IKWA 3WE8A 1GY3A 5M4FA 4IHPA 4QMTA 2HENA 4DFYA 2R0IA 4FSTA 2XIXA 3PFQA 3ORKA 2F7XE 4QYEA 4BCQA 4FTQA 2QKWB 5K9IA 1RW8A 4Y5QA 1JSTA 4CFUA 1Q8WA 2VTIA 4P5ZA 4PQNA 2CCIA 2XF0A 4RX9A 4YLKA 3JR1A 4EKLA 4XEYA 5IQDA 3E64A 4YUQA 1Q4LA 1ZYCA 4DTAA 1NXKA 4O1PA 3FMMA 2CHLA 2OW3A 2XNPA 3DAKA 3I6WA 4TWPA 4L3PA 3OXTA 2CCHA 4ZLOA 3BCEA 3WF5A 3PSBA 4U97A 4EK6A 3OUKA 1WAKA 5JQ5A 3LQ3A 3UQFA 5CY3A 4FVRA 3U55A 2QOLA 3TV7A 4FV1A 4YJOA 3R8LA 1YW2A 5CSXA 1OPJA 3NX8A 5AP3A 3PJ3A 3PVUA 4JDJA 4E20A 2OFVA 3NRMA 3SGCA 4A4XA 1WBPA 2ZB1A 4KKEA 3VC4A 3QA8A 2A4LA 3MY5A 4DHFA 4EI4A 5CAUA 3A2CA 4GG7A 5AP6A 2BKKA 4QP3A 5JGAA 3RK7A 1OECA 4FG9A 3HV4A 3UPXA 4BI2A 4C37A 3HX4A 1REJA 5AV2A 4MF1A 5AP2A 3ZXTA 3QQGA 4C4GA 2G1TA 4TZRA 2E2BA 4Y73A 4XG7A 4YHFA 2W1IA 2YIXA 4QMWA 3LCKA 3GU4A 4CG9A 2FYSA 3KRJA 4TYGA 3PVWA 3NUSA 4NJDA 5AX9A 5M06A 3UBDA 4LOOA 4JDHA 3SKCA 3IW4A 1WBSA 4FSYA 5AUVA 1P5EA 1PXMA 2X8DA 2C0TA 3HV5A 4EH6A 1IAJA 1ZY5A 2YITA 4HNIA 3ALOA 3FLYA 3ORMA 1BUHA 2ITTA 4RX5A 4LYNA 3L9NA 2P55A 4ZIMA 1SNXA 3LXPA 4TRLA 4EEVA 2Z8CA 5DEWA 3FLZA 4U3ZA 5D41A 3QD4A 5J9LA 2VWYA 3EQRA 3VUTA 3BWJA 2GHGA 2OZAA 3FY0A 3DTWA 3S3IA 1M2QA 4M66A 5AV4A 1IG1A 4C8BA 2ETMA 5BQ0A 3SAYA 4H36A 3TL8A 2O0UA 3LMGA 5E8ZA 2IW6A 3HVCA 5E1EA 3ZH8A 4U7ZA 3RPOA 2WTWA 4FT3A 3NUAA 3D5UA 3LCDA 4FSUA 5FLFA 1XBCA 4A9YA 4YMJA 3ZFMA 3DJ5A 4JRNA 3W2SA 3G2FA 3QKLA 1KV1A 3R8VA 4BB4A 3MB7A 3BQCA 5AAFA 5IA4A 4XUFA 3OC1A 3NNWA 4WUAA 3F88A 3OD6X 2PZPA 1RJBA 2W1HA 2AUHA 3A7GA 3PIZA 4RPVA 4RLKA 4XG2A 5CVHA 5A3XA 1JWHA 4AA5A 4EUUA 4FT7A 2WNTA 4Z3VA 1M2PA 1WCCA 3CBLA 4PX6A 4AZFA 2JC6A 4FGBA 4ZLZA 2UZNA 2JAVA 1YWRA 1ZYJA 3D5VA 4JVGA 4AE6A 2B9HA 3FMDA 2C5NA 4L8MA 3U6JA 2CKOA 1FGIA 3O71A 4AOIA 3R9DA 3A7HA 3DTCA 4NZWB 4MBLA 4XOZA 5DLSA 5KMIA 5ANJA 4EZ3A 2R3IA 2QURA 3FI3A 4M68A 3Q9WA 3TNWA 3WZDA 2QOQA 3OXZA 4QMZA 5AUWA 1YXXA 3QWKA 2R3KA 3QD2B 4RLLA 3TKUA 5BYLA 2ZDTA 3NUUA 3BE9A 3R83A 1QPJA 5J95A 5DMZA 3RAWA 2DS1A 2BHEA 5J7HA 4AZTA 4YO4A 1WBVA 5AV0A 3F5GA 4YSMA 3FZSA 3LMIA 4A4LA 2VN9A 3UZRA 3TUCA 5IA0A 4C59A 4O96A 4CZTA 3ULZA 4TN6A 2B52A 3N4VA 5DR6A 2PMIA 1Q3DA 2V22A 5DN3A 4ASXA 2V7OA 2UW7A 4EOIA 4ANLA 4EH8A 5KMMA 2BFXA 3F5XA 3NUNA 4NTTA 3UODA 3ZU7A 3V51A 4DBNA 3TTJA 2QHMA 2CGVA 4EH7A 4O82A 4CGAA 4MNEA 5ACBC 5JK3A 2I40A 3S00A 3TIYA 3CQEA 3W2PA 4DGGA 4DF3A 3DLZA 1SVHA 1WBNA 3LFSA 2UZTA 4CZUA 4FV2A 1V0OA 3HMMA 3R04A 1CDKA 4FKWA 4LRJA 3V04A 3V8WA 3ZLWA 3HAVA 4GK2A 3P7AA 4OUCA 3UPZA 3OEZA 1URWA 2DWBA 3IOPA 1T46A 3Q9XA 2PVHA 3RK5A 3UO6A 2BKZA 5TOZA 2W1CA 4DN5A 5JT2A 1SVGA 3Q5ZA 4LGGA 4PTEA 5TO8A 4UXQA 1UKIA 4HYUA 3DB8A 4FTOA 3W16A
chains in the Genus database with same CATH superfamily
4QMNA 3BBTB 4FE2A 3TNHA 4ZSAA 2X39A 4O38A 5EDRA 4F64A 5FD2A 1OVEA 4HVSA 2O63A 5DT0A 3CIKA 4USFA 4YLJA 2HOGA 4WRSA 4HYIA 4FK3A 2J0IA 2GSFA 5HCZA 4P4CA 3COMA 2WZJA 3Q2JA 5HEZA 3O7LB 1RE8A 4JQ7A 4RC3A 4F6WA 1M14A 3W0SA 2HXLA 2B9JA 4H58A 3AC8A 4QOXA 4HYHA 3LFQA 3CJFA 2XZSA 1J7IA 3I0OA 2XK8A 3NAXA 2YCQA 2FSTX 2YJRA 4JL9A 4YZ9A 2VX0A 3AGLA 2WQEA 3FZRA 4PDPA 5BMSA 3NZ0A 2KULA 4GMYA 1MRVA 2QU5A 4FV9A 3QQLA 3P1AA 2GNFA 5IH5A 5K0XA 4RJ5A 3F3ZA 3OT3A 4QP1A 5HD7A 1OL1A 4PTGA 2G01A 2YN8A 3EQCA 4O0XA 2QOBA 4EBVA 2F2UA 4GSBA 5KE0A 3BE2A 4ZSLA 1OGYA 5KUPA 2Z7SA 3K54A 5AJQA 1H27A 1MP8A 3EOCA 5CTPA 5DFPA 5IQFA 4YJRA 4CZYB 1GIIA 5EKOA 4S33A 2PVFA 3AKLA 5A9UA 1YXTA 4CFMA 2PZYA 5JFVA 5K4JA 3I7CA 4ERWA 3ORNA 3KULB 4GFMA 3K5VA 4J52A 3FMJA 5C01A 2X8EA 4UX9A 2VO6A 2BAKA 3TZ8A 2PZIA 4KIPA 4NKAA 3GVUA 5DA3A 3VF9A 3WZKA 3JUHA 1Y6BA 4KKGA 4Z16A 1SYKA 3VS5A 3QRUA 2OKRA 5AP7A 4C4HA 3O8PA 4TT7A 3VS6A 4L67A 5A4EA 1QCFA 4UY9A 4QQTA 5KX8A 5AR8A 2I0YA 1XWSA 4RMZA 3VIDA 2EUFB 2VAGA 1TZDA 3Q2MA 5IMEA 3UIBA 2C3LA 1XJDA 4FVPA 2R3GA 2CJMA 3KRWA 5HHWA 3HMOA 2IZTA 3PE1A 4AWIA 4IAAA 5AR7A 5BUEA 3I5ZA 2J90A 4KBAA 4BICA 1E1VA 4OTIA 2QOHA 3S4QA 4D55A 2JKOA 3FE3A 5GNKA 3UIUA 4EOOA 4CG8A 3HA6A 3MWUA 5TE0A 3TNPC 4E8AA 5L2WA 3RINA 3AC5A 3KC3A 3FUPA 5LQFA 5CAPA 2XCHA 5EI2A 1ATPE 3RCDA 1BI8A 3GCSA 3ZDIA 1OIRA 2O64A 3EFLA 2F4JA 4R6VA 3ODZX 4TTHB 4NWMA 2C47A 2BRBA 4KKHA 3VNTA 5EOBA 4WUNA 4O6EA 4IX4A 2OJ9A 5EQEA 2YABA 3WBLA 3EKNA 3EB0A 3ZLXA 3ATTA 4O83A 3OXIA 4MX9A 4MQ1A 5CF5A 3H10A 3TCPA 2XB7A 3TWJA 4M97A 1FPUA 4DFBA 3C4XA 4JT3A 2QOCA 2WTDA 4AS0A 4DFNA 3GP0A 4OW8A 4XMOA 4BDGA 4JAIA 1YXVA 4HJOA 4DEIA 4BCHA 4CMTA 3V8TA 2ETKA 2PZ5A 4FNXA 3SXSA 4O6LA 2QOOA 3RI1A 3EQDA 3FI2A 4J1RA 2XK9A 3KXGA 3VBYA 1MQBA 3OEFX 3RPSA 4FEUA 2YZLA 4RX7A 2GFSA 3ZRMA 5IG1A 3DDPA 5JMSA 3KRLA 4IBMA 4ZXTA 2HWPA 5HE0A 3QHRA 3VQHA 4BIBA 3B2TA 3EYGA 4NCTA 5J79A 5M07A 3FV8A 1UU8A 4DH3A 2YERA 4I5PA 4IACA 4NW5A 2E9PA 5IU2A 4O7RA 3W0PA 3PVGA 3JS2A 3K2LA 2R7IA 1U54B 2VTQA 4U9AA 3RAIA 4NH1A 3OBJA 4FV7A 1ZYDA 3OF0A 1XHAA 3Q6WA 4IC7A 3TT0A 3BEAA 4Y72A 5HVYA 4I4FA 2ETRA 2ITNA 3CD8A 4X6RA 2GTMA 2XJ0A 5FXSA 2J0KA 2PL0A 3A7FA 2BAQA 4G3EA 4ZJVA 1XMLA 3QZGA 4U3YA 2R3FA 4JBOA 2VU3A 2YJSA 2R3QA 2B4SB 1PXOA 4Q9ZA 3BHYA 2O8YA 4O0SA 4BIEA 3PPZA 4ACDA 4FUXA 2X0QA 2YHVA 5EYKA 4ZZOA 2CMWA 3TMOA 3G5DA 2JKKA 4AZWA 2WELA 4WSYA 3LFAA 1T45A 3EFKA 3UO4A 4BDFA 4IIRA 2CKQA 2GMXA 2ZMCA 4BZOA 1FMOE 4RWLA 3DU8A 3FL4A 3LCSA 4AN9A 1YHVA 4BWPA 2VTOA 2Y4IC 5FM2A 2QI8A 2ZYBA 4GT3A 5J87A 1OI9A 1NY3A 3SHEA 3PXQA 4BZDA 3OTVA 3L8XA 5I3OA 2FSLX 2UZVA 3NLBA 3CTJA 3PSCA 5AV1A 4KIKA 4NKSA 3EFJA 3T3UA 3E3PA 2BHHA 2JBOA 3OROA 4IAYA 5D7AA 3AG9A 3WARA 5EI6A 1SM2A 1ZMWA 4PMMA 2JDOA 2PWLA 1BX6A 5AMNA 2PZRA 2W05A 4DEDA 1ST0A 1SMHA 1BMKA 5KCVA 4UWCA 4DGMA 3EFWA 5CT0A 5LMAA 4AQKA 2JEDA 1NVSA 2QOFA 4GRBA 3V5LA 3MFUA 3PYYA 1P14A 2PE0A 3C50A 3LFCA 3HNGA 5FTQA 4OTHA 4AW5A 2YISA 4U45A 2WHBA 3CCNA 3V6SA 2UZLA 3EQBA 1XMMA 2RF9A 2X6EA 3RZFA 4DHJA 2WTVA 1ZARA 2H96A 2JIVA 2ZVAA 4K9YA 3FLNC 3IOKA 3BZ3A 3HP2A 3WZUA 1GNGA 3ORIA 4L00A 2CDZA 4MXYA 4DTBA 5GZ8A 4ITHA 2AC3A 3I6UA 2YDKA 1G8JA 5FGKA 4S32A 2Z02A 2FO0A 2XK3A 3ZHPC 4A06A 1YOLA 3NR9A 4JBVA 5HBEA 5EOLA 4BDDA 2OF4A 3ZZWA 3RM6A 3VHKA 3QYZA 5CSVA 4D2WA 1PMEA 4ACHA 2I7QA 4F7JA 3OCBA 5LVNA 4WT6A 4ANMA 3R00A 1GZ8A 5I0BA 4AGWA 2VWBA 4BDAA 3O17A 4F1MA 4AE9A 4EKKA 2PMLX 4BDBA 5FBOA 4HNFA 1ZZLA 4ZOGA 4BYJA 2R5TA 4EH3A 4OAUC 4N6YA 3GUBA 4GT4A 4GH2A 5FM3A 4XP0A 4YO6A 1JOWB 5DE2A 3GCQA 2X7FA 4IX3A 4LMUA 4I22A 1SVEA 4I1ZA 4MNFA 3PPKA 4NM3A 1VLRA 3MFTA 3QALE 4BDHA 2BVAA 4NCTC 5KMJA 1KOAA 4QTCA 1UA2A 4B99A 3SV0A 1A48A 3PLSA 4FNWA 5DVRA 5EG3A 3OG7A 2J0MB 4FOCA 4GYGA 4XP2A 4ACMA 3ZSGA 5IPJA 5H8EA 5CYIA 2YM8A 2CGXA 2OZAB 4V0GA 3PZEA 4YZMA 3BYUA 5A14A 3RHXA 2WTIA 1OL2A 3QCSA 2XARA 4DCEA 2OIDA 4QYFA 4BHNA 1H24A 4KRCA 4E6DA 3ZO4A 4DFLA 2WD1A 3KK9A 1YHSA 3SDJA 3FYJX 4BTJA 5CU3A 2ITXA 3RHKA 4BFMA 4E93A 1LPUA 3QC4A 5BV3A 1W83A 3ZC6A 4AW2A 3ORLA 5LJJA 2OH4A 4X2NA 4DG3E 4PL5A 1XH7A 2YWPA 3PRIA 3QU0A 4KAOA 4FV5A 5AAEA 4C62A 5M4IA 5A4TA 4BDEA 4LI5A 3UDBA 4F9AA 5I9UA 4RA4A 2RSVA 3CTQA 4FKLA 1H4LA 5HIBA 4YTFA 5L4QA 2YCFA 3SG9A 3FWQA 5I5ZA 3UO5A 4BGGA 4RA5A 5JRQA 3VS1A 3DZQA 3ZO3A 4F09A 2OLCA 4RT7A 2OF2A 4AGCA 4ZK5A 1UWHA 3DBCA 3CJGA 2BDWA 2XALA 3FXWA 4FKQA 3ZLYA 4AACA 5TT7A 3IDBA 4CT2A 4U5JA 5EDQA 4H3QA 4C38A 4O4CA 2VZ6A 4XRLA 3BELA 1BYGA 5IUHA 3LFNA 4WOVA 5FEQA 3U51A 4TL0A 2B53A 4TY1A 4MWHA 3PG3A 5E8UA 3T3VA 3ENHA 3PTGA 4QPAA 2FB8A 2E9NA 4LL5A 4N0SA 3ZEPA 2O2UA 1GZNA 2J0LA 2UZBA 4Z9LA 1O9UA 3QTZA 5ANDA 3TV4A 3DBQA 3I4BA 3LIJA 1PYEA 2W7XA 4I5CA 4CFXA 4IQ6A 3OY3A 3KF7A 3RWPA 4AG8A 3NSZA 3BLRA 2BALA 3QTWA 2C3KA 4IZAA 3VBXA 3C5IA 1JLUE 3NEWA 4CKJA 5BVNA 3LCTA 3DZOA 4WBOA 5IEYA 2BDJA 3O7LD 3UZPA 4F6SA 1U5QA 3UDZA 1FMKA 3HLLA 1H25A 4LGDA 4ZSEA 4MNEB 2XH5A 4HVIA 2G2FA 3FMNA 3U9NA 4XG9A 4AXAA 4CTBA 1J7LA 4CYJA 1J1BA 4L9IA 3GCUA 4QMXA 4ALUA 2ITOA 2J50A 4K6ZA 4OGRA 4EWQA 2HK5A 4EC9A 2Y7JA 3HV6A 3VBTA 3BL7A 1BL6A 3HZTA 2VGPA 4O27B 4C58A 2Q0BA 2OI4X 3POOA 3W18A 4KSPA 1URCA 1L3RE 1OUKA 2G15A 4YJTA 3M1SA 3DOGA 3MFRA 1PYXA 2XIYA 3GOKA 4KBCA 3VBVA 4DG0E 3PJ8A 2Z7LA 3VUHA 4FTTA 3LHJA 3BKBA 1SNUA 3A99A 4L7FA 4PF4A 4I41A 4RZWA 2Y4PA 3UDSA 4FIGA 4LL0A 2PVLA 3UNZA 4HCVA 3UYTA 4JIAA 2R3OA 4IVBA 3PSDA 4M12A 3QYWA 1ZOHA 4QMYA 3FKOA 5ACKA 3V5TA 4ACGA 5C4KA 3AQVA 5IQHA 2I1MA 3UNJA 2QD9A 3QL8A 1DI8A 5B2KA 4ANNA 2C6IA 2IN6A 4KABA 2I0VA 5M4UA 1NW1A 4ZMEA 2X4ZA 4XX9A 4G6NA 4I24A 5IMXA 2O65A 3C5UA 4X0MA 3ITZA 3DGKA 4UMTA 4LMNA 4WA9A 3OTUA 3BYSA 3TZ7A 1JAMA 2ZAZA 4I6HA 5AUZA 5HGIA 4PRJA 4FSZA 4E26A 4AZVA 4FX3A 5AP0A 4DHZA 4W4YA 1YDTE 2B7AA 4QP2A 5K3YA 2H6DA 2C6OA 1KE9A 5HVKA 4Y85A 5HORA 4O7ZA 4DHIB 4F63A 4MKCA 2XRWA 4DEGA 5HBHA 3CPCA 3DS6A 4D0XA 2GPHA 4DCAA 5CEQA 4QMVA 3AKJA 4LV7A 5EQPA 5CVGA 4KNBA 4CRLA 4OAVB 5IQGA 3W33A 2PUUA 3Q32A 4CRSA 4A9TA 4M0YA 4ZZNA 5H8BA 4EOKA 3AD6A 3LKMA 3TZMA 2UZUE 3VHEA 2PVNA 3QFVA 1P4OA 1H01A 1YVJA 4JG6A 4EK8A 4WNKA 3EQHA 3OOMA 3GC0A 5FRIA 1CM8A 1R78A 5EW8A 5HTIA 4LQMA 2Y4IB 5A54A 3KREA 5KMNA 2CNUA 1JSUA 3ACKA 3MTLA 5JQ8A 4EQMA 2C6LA 4OTDA 2QO7A 4TWOA 3QX2A 3MDYA 4F70A 2RFDA 5AIRA 4Y95A 2E9OA 5E1SA 4BCMA 2JD5A 4L7SA 4F99A 5J1WA 3PXYA 2JIUA 4FODA 2VO3A 3UIXA 4K8AA 2R0UA 4E6CA 5B2LA 4AQCA 3TTIA 3LCOA 4QQ5A 2W0JA 3PFYA 3UC4A 3C0HA 3KXHA 4JG7A 5CI6A 1G5SA 1PY5A 3EL7A 4ZY6A 3VWAA 4O4FA 4O4BB 4X3JA 3VW6A 3SG8A 3ORXA 4C4FA 5LMBA 3MN3A 3O51A 4F1OA 2QQ7A 2X2MA 3C7QA 4CVAA 3IONA 4BGHA 1JKLA 3AMAA 4JNWA 3QGYA 4ZEGA 3AT4A 4BVUA 4HGTA 5EI8A 4EK3A 2X9FA 4F4PA 1M17A 3LW0A 5FDXA 2R3NA 3F6XA 3DK3A 5CU6A 1UNLA 5I9WA 2Z7RA 5JGDA 1XH9A 2R7BA 4BCOA 4L01A 2XS0A 3H9FA 3MY1A 5FTOA 5IQBA 5DOSA 5C4LA 4QMSA 1ZYSA 4J8NA 2X2LA 3WOWA 3Q60A 4L3LA 4BRXA 4RJ3A 4FZDB 4FKTA 5L8LA 4FIIA 4QQCA 3W8LA 4WNOA 2GNHA 3UOKA 5ANGA 2YCSA 5DWRA 4BL1A 3S1HA 3B2WA 4D2SA 3CQWA 5AA9A 2JKMA 1Z5MA 2P2IA 2V55A 2OICA 2WTKB 4W4XA 4NM7A 3PVBA 3A60A 4OBPA 2WEVA 5CSHA 3QQHA 3GU8A 1G3NA 2XNOA 4I23A 4L42A 3BV3A 3EQFA 3HUBA 3Q4TA 3V01A 4D0WA 4YZDA 4ZTMA 3ZSIA 4IX5A 4MTAA 5FDPA 3FMEA 1H08A 4IFCA 2GNIA 3MFSA 5BPYA 2VUWA 3GT8A 4PP9A 4QPSA 4G2FA 2YM6A 4AOJA 2C6DA 4FIHA 4J95A 4M7IA 4NUSA 1GJOA 4ZP5A 2XM9A 3EZRA 4FKGA 2VTHA 3O50A 5EM5A 3UVQA 2GTNA 3N4TA 1ZWSA 3F7ZA 4GUBA 5BUIA 4FKJA 3AGMA 3GC7A 4R7BA 4YJUA 4YZBA 1XO2B 2NYAA 2GNLA 5M57A 2CKEA 2X6DA 4X3FA 2XBJA 3EYHA 4IWQA 4BTFA 2ZM4A 4USEA 2XKFA 3D7TA 1O6KA 3PP1A 1H28A 4IB3A 4D2TA 4EHGA 3FEGA 1OL6A 3ZO2A 3QHWA 3HDMA 4FTRA 4FKRA 3ZRKA 2Z60A 5CZIA 2J4ZA 4WNMA 5CU4A 3BGQA 4O7TA 2QO9A 3WZJA 4ZZMA 4U6RA 5EW9A 3E63A 3ROCA 5JH6A 4DT9A 3ZS5A 4O7SA 4J53A 3CGFA 5BNJA 5M55A 4WG5A 4H1MA 4QO9A 5D9HA 2AYPA 4HPTE 2C3JA 2BTRA 4HCTA 4FKVA 3EWHA 4N70A 4O86A 4X2GA 4NK9A 4RJ4A 4E3CA 3ZOSA 3DFAA 2JFLA 3TXOA 3W1FA 3UNKA 3PJCA 3R01A 4MBJA 3V6RA 3EQIA 3KVXA 4DEAA 5AUTA 1Q24A 4TKSA 4WSQA 3M11A 2YM5A 3VAPA 5IDNA 4H3BA 4PNKA 4DFXE 2UZDA 4MXAA 2O3PA 1Q8ZA 1V0PA 4S30A 3DKFA 1LR4A 4O2ZA 4MXOA 3ZRLA 4AZSA 3TDVA 4FTKA 3OMVA 4KIKB 2PVJA 3Q4UA 2XUUA 3AXWA 2BCJA 4M15A 4RIWA 1XBBA 2GU8A 1ZOGA 4EQUA 4RJ7A 4O2PA 3DKGA 4TWNA 3ZONA 5LWNA 5IEXA 3MB6A 5HO7A 4FSMA 3UOJA 1FGKA 3ET7A 3IDCA 1OZ1A 4DG2E 3MVLA 1FVTA 5LWMA 4M69A 2PK9A 4UBAA 4DLJA 4ASZA 4GL9A 4U42A 5J1VA 4AT3A 3PUPA 3QKMA 4EBWA 3JPVA 4P2KA 2UW6A 4B8MA 4F0IA 2UW5A 4YP8A 4IAFA 2BZJA 2XKEA 4II5A 4FG7A 5DRDA 4CFVA 3RCJA 4BR3A 4FOBA 3JVRA 4GU6A 5A46A 2PYWA 1Y8GA 4R7IA 4HYSA 3SC1A 4O22A 3A62A 2QC6A 2WQNA 3NWWA 4GU9A 4XBUA 4XS2A 4DLIA 3NIEA 4C3RA 3G9LX 5FQDC 5ANKA 3KCKA 5EM6A 4TW9A 3WILA 1M7QA 4AT5A 1R0EA 3L9PA 3QD0A 4J8MA 4NYEA 2ITYA 4Y83A 2WMSA 4LG4A 4OBOA 1L8TA 4Y46A 4F1TA 4BDCA 4EL9A 1H1QA 1H07A 5KO1A 3ID6C 5JFSA 3RPYA 4QNAA 3R7GA 3RNYA 4EUTA 2XAMA 2BMCA 3RNIA 2HW7A 4RQVA 4G3GA 3Q9ZA 4XV1A 4YJSA 4F9BA 4L45A 4FEVA 4BCJA 2VWIA 2XKDA 3MA3A 1YKRA 4ID7A 1OKWA 4RSSA 5F9EA 4JR7A 1OGUA 2J0JA 3IGOA 4QMPA 3FAAA 2B55A 3C1XA 2W1FA 4RBLA 4BBFA 4BI1A 5CEMA 3DXPA 4FZ7A 4RVKA 4DA5A 4AAAA 3LFEA 1K3AA 3PP0A 1YWVA 1YOMA 3H9OA 2UW4A 2OXDA 4EJNA 1NT2A 4EORA 3ETAA 3MH2A 3HP5A 4PWNA 5CQWA 3S95A 3IW6A 4WBBB 2E9VA 4XH6A 3ATSA 3ZM9A 5KHWA 4EHVA 3GI3A 5DHJA 4E5AX 1F5QA 2QHNA 4YURA 2SRCA 1WVXA 3MIYA 4GKIA 5A4CA 4X3FC 2X81A 3SD0A 2RFSA 3L9MA 5KMLA 4UZDA 4GFOA 1WBWA 5CEOA 3VJOA 3UC3A 2ZM1A 3PG1A 4V0GB 2QOIA 2BROA 5FEEA 3COHA 2WEIA 2R4BA 3FZPA 5E92A 2UZOA 3SOAA 3UVRA 1ZAOA 3ZBFA 3HGKA 4QPMA 3VUKA 3H0YA 3R7YA 5E91A 4JRVA 4EH2A 3RBWA 3TG1A 3PWYA 2GFCA 3FMHA 2XEYA 3KRXA 3QTXA 3P08A 4FSWA 3LXLA 4PV0A 4XJ0A 2VO0A 3D0EA 5AIKA 3W2RA 1YI4A 5HICA 2ZJWA 1ND4A 5EW3A 4C61A 3VBQA 2I6LA 3PXKA 3O23A 4X21A 1BL7A 3G6HA 4APPA 2VTLA 3FZOA 3MBLA 3R1NA 5IH6A 3NNVA 4Q2AA 3I5NA 3THBA 4BJJA 2G2IA 2QONA 3C4ZA 5IA3A 2VTPA 2WMRA 4XOYA 4APCA 4CMOA 4GJ3A 4TXCA 3E8CA 3D15A 3W2QA 2B0QA 4AP7A 4D2PA 4DAWA 4AFJA 3Q53A 2C1BA 4ASDA 3LXKA 3QAME 4G9CA 3LJ1A 2BRMA 3MVJA 4AA0A 1PXIA 4EQCA 5A4QA 4EC8A 3K3IA 3MJ1A 3U4UA 2I0EA 2H34A 3Q9YA 3R8MA 3HL7A 4M84A 4FTIA 4E6QA 3QUEA 3SXRA 3TN8A 3QTQA 2YAKA 4M8TA 2QU6A 3LOKA 1RDQE 1RQQA 1XH6A 2C4GA 2WFYA 2C5OA 2VRXA 3H30A 4IX6A 3AMYA 4QYYA 4RIXA 2FA2A 5CAQA 5LOHA 2OXXA 4F6UA 3VRZA 2PUPA 3FL5A 5AP5A 3DK6A 3TZ9A 1H26A 3G6GA 4AW1A 3QQJA 1TQPA 2J5EA 3RZBA 4BCKA 4JMQA 2BILB 2GHMA 4BN1A 3U6IA 4CYIA 4ZS4A 1GIJA 1WBTA 3DBFA 1OIYA 3QTUA 4V01A 4AW0A 3G90X 2CNVA 3BYMA 3CQUA 3RKBA 3EH9A 3UIMA 1O6YA 4FMQA 4RC2A 4IWDA 1TQMA 5CASA 3HRFA 5L2QA 1JKKA 4O0WA 4BZNA 2GQSA 3BL9A 1OMWA 4J99A 2XKCA 1H0WA 3VS3A 2WMAA 4J97A 1LEWA 1R39A 5HZNA 2OSCA 3F5UA 5CEPA 4DEEA 2NRUA 2V7AA 3PXRA 3QX4A 1Q3WA 2HCKA 4R1VA 3V5PA 4LUDA 4EJ7A 1JSVA 2OJGA 2X7OA 5H3QA 4XYFA 3T9IA 5T68A 4DH7A 1XH8A 5J9ZA 4OTFA 3M42A 2PU8A 4FV4A 4D4YA 3ALNA 3HAMA 2O5KA 2XNBA 3DKOA 2BZHB 5HBJA 2C5VA 2HWOA 4FKIA 2PVYA 3GBZA 4AAYA 4JXFA 5J9YA 4QDEA 3E3BX 5K5XA 4ZLYA 4AF3A 1NVQA 1YRPA 1OB3A 3FJQE 4CFNA 4F9WA 3FSFA 4RFYA 5K0KA 5GJGA 5E90A 4FYOA 4ZJJA 1I09A 4FL1A 3TIZA 3T8OA 5CEIA 4K1BA 2WXVA 5HI2A 2XVDA 2X0PA 4AN3A 2WMUA 3CGOA 4E4NA 1S9JA 2OBJA 5GIPE 3RWQA 3W0RA 3MY0A 3MI9A 2YAAA 3WYYA 2Z7QA 4LRKA 2WPAA 2BZKB 4QTDA 3W55A 1W7HA 2C3IB 3CY3A 4XBRA 2OJJA 3FKLA 4U0IA 3BLAA 4ANBA 4F9YA 3JYAA 1VEBA 2RFEA 3U54A 3I1AA 1VZOA 2B1PA 4MD8E 3TEIA 5HG9A 1KE8A 3EQGA 5BVEA 3FBVA 4DH8A 3Q6UA 3D2IA 4R8QA 4HZSA 4NSTA 1EH4A 4RC4A 4C33A 3NVMB 4AT4A 4I21A 4C34A 1LUFA 5IF1A 3CD3A 2A19B 2JFMA 2UZEA 4JX7A 3R71A 5HG7A 4PPBA 5EM7A 1A06A 4G17A 3RMFA 3CKXA 2W4OA 2YLEA 4LV8A 5IISA 4MH7A 5AEPA 3KGAA 3NW7A 4YC8A 2J2IB 5DPVA 5F4NA 3ZMMA 5JFWA 4R78A 3M2WA 4D4RA 3QLFA 4FJVA 1R3CA 3AT2A 2W17A 1YQJA 4XG3A 4MYGA 4DYMA 5KNJA 1M7NA 2A27A 2P3GX 3AT3A 3GXLA 3OHTA 4CMUA 2CLXA 4QNYA 3PY1A 5E8WA 4ZSGA 4BGQA 5L3AA 5IQEA 1B38A 3QTSA 2Q0NA 2CPKE 3IDPA 3I60A 5F1ZA 4XG6A 2PHKA 2ZDUA 3G0EA 5HKMA 2GHLA 1W98A 3IGGA 5A6OA 2W9FB 1ZZ2A 4PMTA 3DB6A 3ENMA 2LAVA 5LCJA 1JQHA 4UYNA 3UG1A 4FV6A 5AM7A 5BX0A 3MS9A 4FYNA 4S31A 4AXDA 4FEQA 4WHZA 4TWCA 4C7TA 4KS8A 3FC2A 4MBIA 4W4WA 5KZIA 3FI8A 3QD3A 4BDKA 2ITUA 2QLUA 4FC0A 4ZAUA 5DT4A 4XHKB 3ZLSA 3DV3A 4QMLA 5L6OA 5I4NA 2IW9A 1Q97A 3C0IA 2F57A 3BI6A 2WMXA 2WU6A 3R8UA 3KF4A 3ZCLA 2WQOA 4X7QA 4HGEA 3V5QA 3BHTA 2X4FA 4I0RA 4D58A 5DT3A 5IA5A 4CV8A 5LCKA 3NUPA 3DAEA 4ZTNA 3W2CA 3R7UA 3NNUA 2A2AA 2XBAA 2YZAA 4G31A 1YDSE 3R63A 2VTNA 5T6KA 2UVZA 3RK9A 3Q96A 4RJ6A 5L2IA 4AUAA 5M56A 5DGZA 2PVRA 2EXMA 4ZSJA 4DDGA 3CR0A 4C0TA 1JNKA 1GZKA 2YIRA 3HMPA 4HOKA 4JJRA 5GJDA 3MPMA 3OZ6A 2EB3A 4MQ2A 4QTBA 3WF6A 5EK7A 4W8EA 1PXLA 4C57A 1V1KA 2IZSA 2VWZA 4GIHA 3MVHA 1FVRA 3C4EA 3R7OA 2XJ1A 4TPTA 3ZZEA 2Y6OA 4FVQA 3R8ZA 3QXPA 3VVHA 1TKIA 1FVVA 1U5RA 4F65A 3TDWA 1K2PA 1PKGA 3LE6A 3QQUA 3VS4A 4F9CA 3ZSHA 4HPUE 4DGOA 5KMKA 2W1ZA 1TVOA 4IM0A 5HCYA 1OBGA 4Z7GA 3DNEA 3OFMA 4YNEA 4G3CA 3ZM4A 2CN5A 3I79A 5D12A 3OVVA 2XRUA 3O96A 3F3VA 5TR6A 2OXYA 1W82A 3AC4A 1STCE 5JSMA 4DDIA 3VO3A 1PXKA 4NEUA 4GIIA 1U4DA 4FNYA 1DM2A 4HGLA 4P5QA 4QMMA 4YC6A 3VUIA 4CTCA 3R9RA 4IZ7A 4R77A 2XIZA 3FXXA 4C02A 2ACXA 2IVSA 4G16A 3ZUUA 4BTKA 1PHKA 4GS6A 5H2UA 2UW3A 3NW5A 4N6ZA 3UQCA 3FPMA 3C51A 3PPJA 4YSJA 4EK5A 3CXWA 2GCDA 4MEDA 2J9MA 4MD9E 4X3FB 4I6LA 4XLVA 4RQKA 5IUIA 4D4SA 4BY9E 2QG5A 3D7TB 3ORTA 4PPCA 3UOLA 2JDRA 2C6TA 3VQUA 2C30A 1WMKA 3P7CA 3MTFA 3QBNA 3QCYA 5HE3A 3ZUTA 5CXZA 5AFVA 4FI1A 3LM5A 5J5TA 2ONLA 3B8RA 1X8BA 5CALA 2Y8OA 2YACA 2KTYA 1AGWA 4I92A 3MPTA 4IM2A 5D11A 4DTKA 2C0OA 4ZS0A 3TYKA 3VS7A 4HVDA 4CQGA 2CGUA 4DEBA 1FQ1B 2HZNA 4KS7A 3KVWA 4BHZA 4CFFA 5CF4A 4FGRA 1PXPA 3FHRA 3KCFA 4DINA 4M67A 5F20A 4TYEA 1KE7A 4NIFA 2XIRA 3DA6A 3KY2A 3A8WA 2YEXA 4BC6A 4AFEA 4MVFA 5TF9A 4C3FA 5BVDA 1P4FA 3EN4A 2R3JA 4FTNA 5JZNA 4E73A 4NTSA 4FTLA 3OP5A 2FUMA 3QTIA 4EONA 3OS3A 2C68A 5FXRA 4Y5HA 2WQMA 4OTPA 4C4IA 4EZ7A 5HD4A 3LQ8A 2QLQA