4GSBA

Monoclinic crystal form of the apo-erk2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
343
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGMVCSAYDNLNKVRVAIKKISPFEHQTYQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Monoclinic crystal form of the apo-ERK2
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 111
structure length 343
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gsbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gsbA01
3BHYA 4FV2A 3UC3A 3HECA 2XM8A 4JVGA 2ZB0A 5ETFA 4C3FA 3RWPA 4S33A 4EQUA 4APPA 5EI6A 4XX9A 4NL0A 5AIRA 3I0OA 3ZSIA 4D0XA 5F4NA 4G3GA 4RZWA 3F5UA 3TV4A 4C2WA 1WZYA 4PNKA 4NUSA 5IQCA 4R7HA 2QG7A 1LR4A 1L3RE 2OW3A 4K18A 4W4WA 4I0RA 3VN9A 5L6PA 4XV2A 5GJGA 1ZMVA 4DG2E 3R83A 3QTWA 4O2PA 4CVAA 4QP3A 2R0UA 4ALWA 3KN5A 3UIXA 3MFSA 5FM2A 4AAAA 3UOHA 3QTUA 5CSHA 4GKIA 4JBOA 2JFMA 3OUKA 4U81A 5H8GA 1NXKA 3IPHA 4LMNA 4CFFA 4W4VA 4FGRA 4IWQA 3QZHA 5CQWA 2W1HA 1TQPA 4HCUA 1DI9A 2QOIA 3TKUA 4D4YA 5HVKA 4UB7A 4BBMA 3QA0A 2UZLA 3PVBA 4EH6A 5CLPA 3ZONA 2XZSA 4FICA 3TNPC 4UXLA 3EMGA 2QHNA 3LAUA 4IMYA 4NW5A 3MSSA 4RRVA 4L8MA 3G15A 3VS5A 2Y0AA 5DH3A 3GENA 1K2PA 4AGWA 3K3JA 3R00A 4L01A 4ZZMA 1O6LA 3C5IA 4ASXA 4DEAA 1KUTA 5HVYA 4O0VA 5BVDA 4FTMA 2C5VA 3LW0A 4D2WA 1KOAA 4NJDA 3DQWA 4Z55A 4U45A 2FA2A 2X7GA 4IX6A 4GJ2A 1YXTA 5ETAA 3OBGA 5FG8A 1UNGA 2A1AB 3NCGA 4EQCA 4ZZNA 4S2ZA 1V0PA 4IVCA 4QP8A 2O64A 2DUVA 2BRHA 3OCBA 4RIOA 4XRLA 2ITVA 3KXNA 4EK3A 5A4LA 2A19B 2QLUA 4KRCA 4PV0A 3ZYAA 1H27A 2FSMX 4LGHA 4NJ3A 5CY3A 4HGEA 4RVMA 4O86A 3RAHA 1TQIA 4G5JA 3RALA 2X2KA 3UNZA 1LP4A 5B7VA 1Q8TA 2XK6A 4J53A 4R3PA 5LMAA 5M55A 5DMZA 3KVWA 4W8DA 5BUEA 4NKAA 4F08A 1WBTA 5AR4A 2QCSA 4ZTQA 5A6OA 5J1VA 1SM2A 2VTNA 4DFBA 2YDKA 3BLRA 4F7NA 3ORPA 5JQ8A 5FXSA 1ZRZA 3VBXA 1ND4A 1MRVA 5ACKA 3ZO2A 1FMKA 4OAUC 4FV3A 5EM7A 2PK9A 5J9YA 2R3KA 1PXIA 3RKBA 4A9SA 3HVCA 2B7AA 4IJPA 3VF8A 5M57A 3RM6A 4R7IA 2FSOX 4HGLA 5A4EA 4L3PA 4EWQA 2VWBA 4FV4A 2YDIA 1ZLTA 4AQCA 2R7IA 3NGAA 2OF4A 3WYXA 3MTFA 2VNYA 3LFSA 4F4PA 4ZY6A 3IW7A 3NIZA 4FC0A 3TV6A 3RGFA 3VUDA 4NZWB 4DAWA 5DT3A 4J8NA 5CEMA 2UZTA 2JITA 1R0EA 3GFEA 5E7RA 2FSLX 5AP4A 3DDPA 2VO7A 2F7EE 4XP0A 3ANQA 4FODA 5EW9A 4O21A 5HO6A 4DITA 4O7TA 4K6ZA 1GIHA 3EQPA 4G34A 3ZSGA 4IE9A 2WGJA 3UIMA 4B8LA 4L7FA 4XV3A 1KE9A 4GU9A 4DFZE 5J1WA 2XMYA 3GI3A 4FUXA 3DJ5A 4CXAA 4DC2A 3QTIA 4HCVA 4FG7A 2WQEA 4U3ZA 4NCTC 1LEWA 4NIFA 4BCPA 3VJOA 3COHA 3DJ7A 3AGMA 3VHEA 5CASA 1BL7A 2WQOA 4PMSA 5GZ8A 4RQKA 2WFYA 3KXGA 3C1XA 3HV5A 3NNWA 1M7QA 4H58A 4O0UA 4AZWA 3D4QA 1WAKA 5JQ5A 1CMKE 5C8NA 2RG5A 5AM6A 3NW6A 5CU6A 4QMUA 2QC6A 4ANQA 2R3FA 2VN9A 3NAYA 3ZFYA 3MI9A 3PP0A 3VIDA 3ZC6A 2WMSA 1GZKA 1XBBA 4A06A 3LXKA 2B55A 4I4FA 1HCKA 2ITUA 5LOHA 1OIRA 2EB2A 2GDOA 4GK4A 4CKIA 5IEVA 3LQ3A 2E9NA 2J0JA 3KXHA 4XG4A 4Y95A 5IA2A 2CNQA 4BR3A 4RQVA 3I5ZA 5K9IA 3A60A 3GXLA 4M68A 4BRXA 2VX1A 1VJYA 3PG1A 4FI1A 5L8JA 1JQHA 3AT2A 4FKIA 5LQFA 4W8EA 3QZIA 3CJGA 4IX3A 2WTWA 3HNGA 4U80A 4AN2A 5LMKA 2IJMA 2PMOX 3F3UA 2P0CA 2P55A 1P4OA 4W4XA 2W1ZA 2WB8A 1IRKA 4LOOA 5JZNA 2IW8A 3SXRA 3W16A 5HBJA 4BDGA 5IEXA 5KUPA 2W1IA 3AT4A 3EQGA 2Z2WA 1I44A 3FJQE 3DKGA 5B2MA 3LJ2A 2XNPA 4XG7A 2FSTX 3EYHA 4ACCA 4FVRA 3KRXA 5LJJA 4IZ5A 4Y46A 4AG8A 3ZZWA 1GIJA 5L2TA 4NW6A 3PPJA 2R3HA 4E73A 4F64A 4YLJA 2PULA 5D10A 5AV3A 3D7ZA 4KA3A 5IZFA 3WF7A 5HIBA 2RG6A 1KV2A 1PHKA 4FT5A 4FNWA 4IHPA 2RF9A 2F2CB 4AGDA 3K5VA 3NYOA 5HE2A 5G1XA 5L8LA 3ORMA 2WMAA 4ANBA 1Q62A 1YVJA 3MPAA 3FLZA 3OW4A 2J2IB 4YZNA 5FD2A 3ODYX 3KC3A 2BTRA 4FIIA 4JBPA 1UU8A 2XK7A 3CBLA 4ZS0A 3S2PA 4DH7A 2ZV2A 2VUWA 4FIFA 3A4PA 4G16A 5DT0A 4DFNA 2P3GX 3Q53A 4X2FA 5EH0A 3ZMMA 3GU5A 3O50A 2XK8A 3KA0A 4MKCA 2Y4IC 2VTSA 4X7QA 5AUUA 2GPHA 3A8XA 3KEXA 5DHJA 5DYJA 2Z7SA 5HNIX 3R8ZA 3DXQA 4CFXA 2PVMA 1VEBA 4FKJA 3G6HA 3EQRA 3QTZA 5HICA 4AZFA 3DQXA 1YHVA 4FOBA 3ACKA 3AC3A 4QTEA 3C4XA 2QOQA 4IB0A 4QTAA 3TXOA 3Q4CA 4AZEA 3P7CA 3LKMA 1QPCA 3TZMA 4MD8E 4AA4A 4YMJA 3AMBA 2I7QA 5EYMA 4IBMA 3FMHA 4QNAA 5M56A 4F9WA 3ZUVA 4FF8A 4JNWA 5AAGA 3KQ7A 3MIAA 2C4GA 2ZAZA 2QR8A 3P7BA 3NUNA 5GZ9A 2BUJA 3FYKX 3R1YA 1Q8ZA 2CKQA 3SOCA 4QTDA 4GT5A 5EYKA 3FBVA 1H00A 4QMPA 3OCSA 4EK6A 4KIOA 2VD5A 3WE8A 5BX0A 3L9NA 4TY1A 5FXRA 4E93A 3QCYA 4HZRA 4DYMA 3A7FA 3EQIA 3UP2A 4JQ7A 3F3WA 1YHSA 5E91A 4YJUA 3L8PA 3GQIA 5I0BA 4HJOA 5AJQA 1H1RA 4DFYA 1J1CA 3SQQA 3A61A 4M0YA 4KNBA 2WMXA 5IDNA 4I5CA 4PTEA 5HZNA 3GEQA 2GSFA 3GU7A 3POZA 4WOVA 4DGNA 2GNJA 1OECA 3K2LA 3V5WA 4EWHA 3FMNA 3MJ1A 5BMMA 2I6LA 2GQRA 4ZMFA 4RA4A 3UNKA 5E4HA 4ANLA 2GNIA 3D5UA 3EHAA 3K54A 4QQTA 5TE0A 5IPJA 3FLQA 2KTYA 4FKRA 4JIAA 5LXMA 1J7LA 2VZ6A 3E8NA 3OP5A 5HNGA 4D28A 3HKOA 1WVYA 4IVAA 5LWNA 3QGWA 5JN2A 3VQHA 2X4ZA 3UOKA 4A9YA 1SNXA 4RLKA 2YM7A 5DLSA 5L4QA 1WVXA 3N9XA 2W4OA 3QXOA 3R9RA 3SGCA 5M53A 3MJ2A 2X7OA 2YZAA 3IK3A 4NFNA 5DE2A 5HO7A 2W5HA 3FKLA 4H3QA 3OY1A 1W83A 4PTCA 4FV7A 1U59A 5ACBC 4C57A 5KKRC 2BIKB 4F6UA 5M08A 1QPEA 4PPBA 3H4JA 2C5YA 4BWPA 5AA9A 1BI7A 3PFQA 4B9DA 1M14A 3BCEA 1XR1A 3FZOA 4N6ZA 3DTWA 5FTOA 5AUTA 3QHRA 3BPRA 1H07A 4MYGA 5KKRB 5AWMA 2VWZA 4CKRA 2AUHA 3FLWA 3KREA 4O96A 3SXFA 4CFVA 2BTSA 4FSNA 3JS2A 5GZAA 3BYVA 3IOKA 1U54B 3MFUA 4C4EA 3LCOA 5HX6A 1OGUA 4J52A 3O0GA 4YZMA 3FUPA 3GU6A 1Y6BA 3AT3A 3TIYA 4AOIA 4CG8A 3HV3A 3DV3A 4WG3A 4FT0A 4RIXB 1BL6A 5JSMA 2PVNA 2VTTA 4GG5A 4HGTA 4JDJA 2V7AA 4F9CA 4L7SA 3BWJA 4O0YA 3UVPA 5A6NA 1UU7A 5D9HA 3TZ9A 1X8BA 3PSBA 4CGAA 3CGFA 5JFSA 5CSWA 3FDNA 3VO3A 3N4TA 3Q4TA 4U8ZA 3R7EA 4EYMA 4YJQA 2OH0E 3DNDA 3BGZA 4BTKA 4C4JA 1YDTE 3P08A 3VS6A 2C3JA 2EVAA 2HAKA 4EJ7A 4JQEA 3LCTA 5KNJA 2GQSA 1B38A 1FVVA 4RIWA 3SDJA 4HW7A 4E6CA 4AGUA 3D5VA 3PJ8A 3WF8A 3QL8A 2XCKA 3UPXA 3Q6WA 4XUFA 1E9HA 1VR2A 3FV8A 4LRJA 2OFVA 2XKDA 5E8UA 1H1SA 4KSPA 4QNYA 5T3QA 3SX9A 3VW8A 3MA6A 5E8XA 2YITA 3TUCA 1P2AA 5C27A 4D5HA 4BL1A 3OXZA 4X6RA 3HRCA 5D7VA 1YWVA 1YDRE 3MIYA 3GVUA 5IEYA 3DAKA 5FP5A 3COMA 1PXLA 3QC9A 4BCOA 4G3FA 2PSQA 5EFQA 3H30A 4E7WA 2C30A 2GTMA 2H8HA 3ZM9A 2YACA 4MEDA 3KXMA 5TO8A 3ITZA 2VWXA 5T6KA 4PPAA 5AUWA 4R78A 4QP7A 1V0OA 4HNIA 2DYLA 1F3MC 3QA8A 4LL0A 3BKBA 4UMRA 4KB8A 3ZFMA 1NA7A 4J7BA 3SHEA 3C9WA 5LMBA 5BYLA 4C38A 5JH6A 5B2LA 3QTQA 5LWMA 4FTOA 4B7TA 4O7YA 1XH8A 1QMZA 3BHHA 2UW7A 2W4KA 3IQ7A 4CLJA 4R7BA 2Z8CA 1PRYA 5E8VA 3E8CA 5KMKA 4BIBA 5FDPA 5HTBA 3ZH8A 3V5TA 5BYYA 3AC8A 4HYHA 4S30A 3UQFA 2PPQA 3CC6A 2ITWA 3CLYA 1JSTA 2OG8A 3QWJA 3ZUTA 3QTXA 5E1SA 5J5TA 4NEUA 3JPVA 4E6QA 3TM0A 3P23A 4JIKA 4QYGA 4PQNA 4AWIA 1J7UA 1REKA 3OWLA 3DKCA 3FPMA 3I7CA 2XKCA 4M97A 1ZYJA 4JDHA 3VS3A 4FEUA 2J0IA 3C7QA 2UZOA 3DCVA 4PTGA 4PDPA 4GFGA 1TQMA 4RJ7A 2BKZA 1YRPA 4FL3A 4TYHA 1L8TA 3QLFA 4JX7A 3R2YA 1OIUA 4JR3A 3TKHA 2PZ5A 2R3PA 2ZJWA 4K0YA 3AD5A 3ZLSA 2XK3A 3R9NA 4ZTLA 4Q9ZA 2YIXA 4TWPA 1S9IA 3POOA 2I0EA 4FMQA 5IA5A 3FXZA 4DH5A 3NDMA 5AA8A 3GFWA 3ZDIA 3HLLA 4I22A 5AP6A 2BALA 5FTGA 4GV1A 2AC3A 2OIBA 4EH5A 2WTIA 4YO4A 3JYAA 3CGOA 2CN8A 4QRCA 1H25A 2BAQA 4RA5A 5BVEA 5EQPA 3AD4A 2OICA 3P5KA 3WZKA 1PXOA 1XHAA 5T68A 3BU3A 1M2PA 4YJTA 5EM5A 4ACHA 4EH8A 4LQMA 4F9YA 5LCJA 2BCJA 2UVZA 2W1EA 3A62A 3V5PA 3VS4A 5A14A 1Q99A 4J1RA 3MDYA 3AC1A 4M12A 2UVXA 4XG9A 3NWWA 3OTVA 3S95A 3C4CA 5BVOA 3RWQA 3GBZA 4D1SA 3R0TA 3VHKA 1HOWA 1IAJA 3BE2A 4MCVA 1NY3A 3LFBA 5EKNA 2KULA 3W8QA 2PL0A 4O84A 4MBIA 3LM0A 3EH9A 4FZDB 5DIAA 4CZYB 3CKWA 5KMMA 5KMLA 5E9EA 1YOMA 4IEBA 3NYVA 4FEVA 2BZHB 3AGLA 1YI3A 2JBPA 4Q5EA 4C36A 1XBAA 2JKOA 3LQ8A 3VJNA 3H9FA 4AW0A 2VWUA 4BB4A 4JS8A 3F61A 3QYWA 3AOXA 2H6DA 5BVWA 5BVKA 4DEGA 1IG1A 3BHUA 3LMGA 4R8QA 2X6DA 4BZOA 4GCJA 4M8TA 5JFWA 4TYIA 2WMVA 2B52A 3R9OA 4UV0A 2Z60A 4FE2A 5KMOA 5GIOE 5JK3A 1PXNA 1WBWA 4DTAA 1ZYSA 1BYGA 3L9LA 3Q4UA 3E62A 5H9BA 4AS0A 2JC6A 1MQ4A 1J91A 4HZSA 5H2UA 3EJ1A 3WF6A 4ANOA 5HTCA 2G2FA 3OC1A 4MXAA 3MH3A 4ZZOA 3W8LA 4UYAA 5GJFA 3CKXA 3DDQA 3H0YA 1H26A 3V8TA 1OPKA 3B8QA 2C68A 2P33A 2VTHA 4IVDA 3TTIA 1JSUA 4C59A 1E1VA 3HRBA 4Z7HA 5EK7A 1UA2A 2HZ0A 4RSSA 5CEIA 4IH8A 5AP0A 2GU8A 3IW5A 4QMYA 3ZRLA 3FZTA 3I6UA 1ZXEA 3F5PA 2F7XE 4GFOA 4JI9A 4QMWA 4GEOA 3JVSA 5DEYA 2WMRA 5I3OA 4RVLA 3FYJX 2IN6A 3S3IA 1JVPP 4O7NA 2ZM1A 3HP5A 4TT7A 4QQJA 4BIEA 4YJPA 4WG4A 3LCKA 4O38A 4OTHA 2UV2A 5EI2A 1RE8A 4RX7A 5KHXA 2X8EA 4V0GB 3FQHA 3F7WA 3LJ0A 3ZZEA 4L67A 4UWBA 5FP6A 4BFMA 4AOTA 2WMTA 4JLCA 4QQCA 2B9JA 5EDPA 3PRFA 5FEQA 3ZSHA 5K3YA 4O7RA 1ZYCA 1YWRA 1Q8WA 3PIZA 4XG3A 3HZTA 2QONA 3E93A 5CSPA 5JKGA 2WD1A 2G1TA 4IAZA 4R5SA 3ZOSA 3F2RA 3C4EA 4ANMA 1AQ1A 4L68A 5AX9A 2I0YA 3KF4A 2X0GA 5ANIA 2WPAA 3HUCA 3OVVA 3MH1A 4N70A 4EH3A 4BDHA 3DBCA 4E4XA 1DI8A 2BHHA 5HU9A 5B2KA 4EK8A 4FVQA 3GC8A 4NM5A 4P5ZA 4DEBA 4LOQA 2UVYA 4ALVA 3PIXA 4USEA 2OZAA 1J1BA 3CR0A 4BWXA 4EOIA 5HD4A 2BZIB 2YA9A 1Q41A 2GS6A 5KZ0A 2W0JA 4YZCA 5JEBA 4GYGA 3QX2A 3RK7A 3BYOA 2W1FA 3L8XA 2QKWB 2RFSA 1IA8A 2JDVA 4XJ0A 4FIGA 5TT7A 4DEDA 4BTJA 3LFDA 3EYGA 4L46A 4FT7A 5E8ZA 4I0TA 4HCTA 3U51A 4IFCA 3OEFX 2JIVA 4I5HA 4ERWA 4YTFA 5EDQA 1I09A 3NUYA 2B53A 3E5AA 4BCNA 4WUAA 1Y8YA 4LM5A 3W32A 4L53A 4EK5A 1JWHA 2C6TA 5CF5A 5I9ZA 4K11A 1FVTA 2BZJA 4MXXA 3GU4A 4F9BA 1O6KA 4TL0A 2C6LA 4AN9A 4U97A 1UWJA 3LVPA 4DH3A 3OTUA 2C0IA 4IW0A 2ZDUA 1FMOE 4KBCA 1FBNA 2XS0A 2EXCX 3DPKA 4FK3A 3UO5A 2XJ2A 1J7IA 2IVUA 1OPLA 3IGOA 1CKJA 3NS9A 3CTHA 3PA5A 4PL5A 3LQ5A 1Q5KA 5CZIA 4BI0A 4FTNA 4GIHA 4L52A 4W4YA 4JRNA 2E9VA 4AFEA 4E6DA 1XO2B 5EI8A 2QQ7A 2OK1A 5BNJA 4GFMA 3KB7A 1Z57A 2GNGA 4JG6A 4DG0E 1Y57A 2VTMA 3VUHA 4QPMA 4RVKA 4P7EA 5GJDA 4EC8A 3SOAA 4YTCA 4FTCA 4IB3A 4CQGA 2VO3A 5J87A 3EFLA 1QPJA 3E87A 3QQKA 3R6XA 2QOBA 3I79A 5BPYA 3Q5ZA 1SNUA 3VW6A 4AGCA 2B0QA 4EHEA 4V04A 3V04A 3R73A 3GP0A 5JGDA 2WZJA 2FO0A 3A99A 4NK9A 3G90X 5CXHA 4QYFA 5L2SA 1Y6AA 3WZJA 5KHWA 5A4QA 5IQAA 4FKVA 4HOKA 5J9LA 5IH6A 2PVRA 3E88A 1SYKA 4TXCA 2XBJA 1M7NA 1ZOHA 2W1GA 3O96A 3DZQA 4K2RA 4Q9SA 4L00A 2OJJA 5EM8A 2CLXA 4RX8A 2QOHA 3W55A 4OW8A 1EH4A 5M09A 2OIQA 4NSTA 3CCNA 5TOZA 5D7AA 3LM5A 5KX8A 3TV7A 1YQJA 3V6RA 2VGOA 5M51A 4KRDA 4D2SA 4X6QC 4X3FA 1OBDA 4JAIA 4O0WA 3PIYA 1GJOA 3QAME 4RWKA 4Y5HA 4ANSA 4DG3E 1JKTA 4JRVA 2G2HA 2R5TA 3VS0A 4EL9A 5IMXA 1FGKA 2QOOA 3JXWA 2VV9A 4EBVA 3U8WA 1PW2A 3PYYA 3E8DA 4BWKA 3DB6A 3BX5A 1OI9A 3LZBA 4XBRA 4F0FA 5BUJA 1ERKA 3FI3A 4IB1A 5CXZA 4QMTA 4YLKA 4AT3A 4EJNA 4UXQA 3R28A 4GJ3A 1JOWB 1GIIA 3U55A 1GZNA 1ZOEA 4HGSA 1U5QA 4J71A 4MQ2A 4XCUA 3W1FA 3HAVA 5HG9A 2W99B 2JAMA 2WO6A 3LMHA 3VC4A 3VULA 4F70A 4O0SA 5IQHA 4ITIA 4FBXA 4WBBB 3C50A 3LLAA 4QMXA 4CCBA 3UQCA 2CDZA 4F6WA 2PZRA 2PUIA 4L42A 3PVWA 4MXYA 4O6EA 2YJRA 4KIPA 5ANDA 3FAAA 2J4ZA 3FXXA 4FG9A 1HCLA 3Q2MA 1XH9A 3R04A 2C3LA 2O0UA 3KK9A 2UZEA 4JBQA 4H3BA 3QU0A 2NPQA 4WSQA 2BMCA 4AE6A 4QP9A 4Z16A 3PA3A 4ZLZA 1DAYA 1F0QA 2XNBA 5IQGA 4P5QA 5HOAA 3NUAA 2Q0NA 4FT3A 4TKSA 1PXKA 4XG2A 3TIZA 4WSYA 1V0BA 5FXQA 1QPDA 3DK3A 2GHLA 3FXWA 5EG3A 4AE9A 4GMYA 4IFGA 4E4NA 3UZRA 1A9UA 4EOPA 3N4VA 4GU6A 3KK8A 1KWPA 2GHGA 4R6VA 5IDPA 1NT2A 3TJDA 4NIFB 5DR9A 2OU7A 2Y6MA 4C4IA 3FE3A 1PYEA 5FM3A 4FOCA 4XLIA 1OIQA 2ZVAA 1BUHA 3RAWA 3GGFA 4QD6A 3H9RA 4JOAA 2QHMA 3WIKA 3HX4A 3PXZA 3OCGA 5A46A 2IZSA 4OBQA 4LGDA 3ENHA 1OVEA 2JGZA 5AV1A 2R3GA 1WBOA 2Z02A 3ZO4A 3TWJA 2HELA 4EH4A 4EZ7A 3KGAA 1H4LA 4FV6A 4RJ5A 2PMNX 1YDSE 5AUVA 3ZXZA 4YC8A 2W7XA 4FNZA 4M0ZA 3ERKA 4RLLA 3GCQA 1ZYLA 1M2RA 2XKEA 4NM3A 3OMVA 4O6LA 5D12A 3MB7A 1P4FA 2ZMCA 4EORA 1PXJA 1QL6A 5KE0A 4EOSA 3NVKI 4YURA 4PWNA 3GC0A 3ODZX 2LGCA 4JG8A 2O63A 2OH4A 4FTQA 2J6MA 5AR3A 2RIOA 2OXYA 2R3RA 1NVQA 2CCHA 2CN5A 4I41A 4DTKA 2BFYA 4ZS4A 3G9NA 3Q9WA 3UYSA 1BKXA 2GNLA 3COIA 2R3LA 3LFFA 3PY0A 4OBPA 4QP4A 5IF1A 1YWNA 2YM3A 4FKUA 3CEKA 1WCCA 4IX4A 3VRYA 4D2RA 4YLLA 5FBNC 5IA4A 2BPMA 4QTCA 1LEZA 2XVDA 4QMOA 5J7HA 3UIBA 2PVLA 1YI6A 3QRUA 4J95A 5EHLA 4O7ZA 2Y4PA 1OITA 4U40A 4RC2A 5AP5A 3VBQA 3D7TA 3CIKA 4C3PA 2YN8A 4ZSAA 5KBRA 3UO4A 3DBQA 3T9IA 2UW5A 3WE4A 2HWOA 1LPUA 4ZLYA 2C6EA 3PRIA 4GK2A 5GNKA 4CSVA 4ZXTA 4F6SA 1H0VA 5BMSA 3GCVA 1TVOA 5HO8A 2IG7A 4FSMA 4EC9A 3OUNB 4LUDA 4BDEA 3TN8A 5I4NA 3HV7A 3R8MA 3LIJA 2CKPA 3L8SA 4DFXE 2PZIA 2GCDA 5CS6A 3NNUA 4MVFA 2QOCA 3U9NA 3JVRA 4ZSJA 5K0KA 3H9OA 3PLAE 3OWKA 2REIA 3QUPA 3IW6A 1PF8A 2YDJA 3MS9A 3QYZA 4BCGA 4DEEA 4O82A 3IGGA 2JKMA 4L3JA 4CLIA 4RG0A 3E63A 3Q60A 3QTRA 3ZLWA 5IQBA 4UN0C 2BDJA 3HV4A 1OZ1A 4K9YA 3SG8A 3EWHA 2ERKA 4EZ3A 3DZOA 4BF2A 3PTGA 2UW3A 3KRLA 5AAEA 1GZ8A 4LYNA 2VO6A 5HBHA 2VU3A 2XF0A 1OUKA 4QPAA 3R01A 3KY2A 4NCTA 3UTOA 1JKLA 4C3RA 3MFRA 3UZTA 3JY0A 4U42A 3VUKA 1PMEA 4RGJA 2XJ1A 4EZ5A 3T3UA 2V22A 4G3CA 3ZTXA 2J5FA 2HXLA 4HYSA 3TKIA 2VTIA 3I0QA 3GC7A 3F3ZA 1JKSA 5A4CA 2ETRA 2UW8A 4FX3A 4WNOA 3RMFA 5AP7A 3ZC5A 4Z7GA 2PY3A 1RQQA 2X9EA 4PL4A 4MD9E 4MXCA 1OBGA 3MTLA 4F63A 3BBTB 1RDQE 3ZHPC 4MQ1A 4ZTNA 4O81A 4ENXA 1SVEA 1Q97A 4YSJA 1XQZA 3QD2B 4XHKB 3AMYA 4DLJA 3QD0A 3SXSA 2R3MA 4EOMA 2WELA 2C6DA 3PXFA 2VWIA 3I4BA 3IONA 5HE1A 4F65A 3VBWA 5IA3A 2VRXA 2HY0A 3AXWA 3E3BX 5M4UA 4DGMA 3F5GA 2C0TA 3BWFA 4XP3A 3DAJA 4NFMA 3NCZA 3IDPA 2UZNA 4GW8A 2J90A 4BCIA 3V01A 5KMNA 3WARA 1R3CA 2CNVA 3FMLA 3HGKA 3R30A 4AW5A 4IM0A 4IC7A 4OAVB 3R7OA 4UMUA 2GMXA 1IR3A 3FI4A 3OW3A 3Q96A 3QUEA 2CGWA 2CPKE 5HD7A 5CEPA 4TTHB 5EHOA 1UWHA 5HX8A 3F3TA 5IA0A 3OFMA 5JT2A 4FGBA 3HYHA 3BELA 3ET7A 2LAVA 2W9FB 5DEWA 2ZV8A 5BVNA 4X0MA 4QP2A 3KRJA 1ZY5A 4FUYA 4CRSA 3N51A 1R0PA 4HYUA 5EQYA 1ZYDA 4D9UA 3FMDA 4M7IA 4HVHA 4FA2A 4Y73A 2R9SA 2ERZE 1OKZA 2H9VA 1G8SA 3FY0A 2PUUA 3NYXA 4A9UA 3FI8A 4NYEA 3RHXA 4BCKA 3E3PA 3OWJA 3KMWA 2HENA 3EQHA 3QUDA 4YJVA 5CAOA 2IZRA 3E7OA 3B8RA 3MVHA 5CVGA 3R8PA 2FUMA 3VRZA 3QTSA 1PMNA 1M2QA 2AYPA 2BDWA 2PE1A 3O51A 5CTPA 5A4TA 1G5SA 3PG3A 3D2IA 4FZ6A 4L6QA 4PRJA 4YSMA 4YJOA 4TRLA 5FQDC 4YTIA 3WYYA 5IMEA 4BGHA 5IU2A 3EN7A 5AX3A 2BRNA 4X21A 2C3IB 3RINA 3FZ1A 2IVVA 4CTBA 3GQLA 4EOQA 4DT8A 4KBKA 4XMOA 3ORLA 4OLIA 2C5OA 3NUSA 3V5JA 1J3HA 1PXMA 3ZBFA 5CENA 3PP1A 3BGPA 5CX9A 4FTUA 2SRCA 1GY3A 2X9FA 3KXXA 3QQFA 4KABA 3UZPA 2RGPA 4JL9A 4V05A 3RPOA 1W8CA 1JLUE 4RIWB 1M52A 3RZFA 4C02A 4ZY5A 2W4JA 3F3VA 5IKWA 2PZYA 4YJSA 3PWYA 3COKA 4FYOA 4OTGA 3NVMB 5IQEA 5L2WA 3QQHA 2WQBA 1FINA 1H1WA 4BGGA 3KMMA 4PMPA 3RVGA 3R8UA 4IAFA 1YXUA 4H1JA 1Q24A 4CZUA 3A4OX 4S34A 3REPA 3VWAA 4M15A 1OL7A 3C51A 3WIGA 2FH9A 2GNFA 4PPCA 1P5EA 4EQMA 5M4CA 3OWPA 3QALE 3LFEA 1T45A 4D58A 2YWPA 3D83A 4UYNA 2HW6A 4G6OA 2BR1A 2ESMA 3EL8A 2BIYA 4KIQA 4EOJA 2UZDA 5CSXA 2OBJA 4ACGA 3F9NA 4PL3A 3O7LD 4BN1A 5AV4A 5F20A 4AW1A 3CTQA 4D2TA 4GYIA 1ZAOA 4Z3VA 3BI6A 4EK4A 4C61A 4FL1A 2XRUA 2JIIA 3FHRA 2C69A 3FKNA 3SLSA 3EZRA 3MW1A 5CI7A 4JT3A 4BDBA 4C37A 4TYGA 4ENYA 2CKOA 4FSWA 5A54A 3UPZA 2JKQA 4FL2A 3NYNA 2WIHA 3MH2A 3T9TA 2WTVA 4GIIA 3C0IA 3MA3A 4F7LA 4GH2A 2HZNA 5CVHA 3RPSA 4X2NA 3QCQA 4K1BA 4FEWA 3OHTA 4IQ6A 3WZDA 5M4FA 2EXMA 2J0MB 4IAAA 3ZXTA 4BCJA 2WTJA 2X81A 4JDIA 2WU6A 3GB2A 4KWPA 5CU2A 1SMHA 4ZY4A 4FSZA 2B1PA 4PMTA 4PP7A 4O91A 1YOLA 5A9UA 2EB3A 2XNGA 4TYHB 4EEVA 2PMIA 3MY1A 4I23A 3MPMA 5DT4A 2JD5A 2C5XA 2DS1A 3KL8A 5LCKA 4BDAA 3IOPA 4WNKA 5K0XA 2FVDA 5C1QB 4BBEA 2QG5A 5JGBA 3MV5A 5C4KA 4QYYA 4RIXA 3MBLA 3UJGA 4OTWA 2YCQA 2DQ7X 4IACA 4WIHA 2GQGA 3VUMA 4NM7A 4MXZA 3T8OA 4FK6A 3DS6A 3F6XA 3FWQA 4J98A 1H28A 4D1ZA 3NPCA 4XRJA 5JFVA 4HVGA 5FBOA 5AMNA 1PMUA 4ZJVA 4O1OA 4PDYA 2YM6A 2EU9A 4F1TA 2F4JA 3FKOA 3QKKA 3CS9A 4NU1A 5CEKA 4BY9E 4DBNA 3B2TA 1Y91A 4DA5A 4UMPA 3AC2A 2VTOA 1UNHA 4CFNA 4WD5A 2ITZA 2X2LA 2YISA 5EHYA 5LVOA 5K4JA 2BKKA 2VWWA 2UUEA 5HG8A 4D2PA 1W0XC 2J5EA 5TF9A 2ZV7A 2BAJA 3UBDA 3CQEA 4DFLA 3P0MA 3BQCA 4B4LA 2ITXA 4FV0A 5JZJA 4M3QA 3TT0A 4G2FA 3DB8A 3UQGA 5GIPE 3NW7A 3M42A 2Y7JA 3ROYA 2OXDA 3OOGA 3QCSA 3VF9A 1CDKA 4C62A 4DGOA 4WRSA 1GNGA 3A7IA 4RT7A 5FGKA 4CD0A 4D4VA 1Q4LA 2WAJA 3DBFA 1CM8A 4U44A 3SD0A 4FSUA 2JEDA 4QO9A 3UE4A 2W9ZB 3FC2A 3EQFA 4IAKA 3TCPA 5M06A 5F1ZA 2ITOA 3VBYA 4CNHA 2PTKA 2O2UA 2IW9A 4BZDA 4DE4A 2XEYA 3RK5A 3PVGA 3KMUA 2XEZA 3H0ZA 1UU9A 3F88A 2VTLA 4E20A 2GHMA 2WMWA 2NRUA 5H8BA 3VQUA 4II5A 3W2SA 4RIYA 2GS7A 1XBCA 4OT5A 3BYSA 3TNWA 3CQWA 5LVLA 1WFCA 3PSDA 4LOPA 2OIDA 5CU4A 4F7JA 3FI2A 3MVMA 4FSRA 4CMUA 2WTCA 1BMKA 1G8AA 1KE7A 5EW3A 2R4BA 2W96B 3E92A 5HIEA 4E8AA 2ONLC 2WXVA 2J51A 1PKGA 4Z9LA 3TUDA 5LVNA 3MYGA 2ITQA 4CYIA 4D0WA 4BHZA 2XK9A 2CMWA 2CNUA 2V0DA 3EQCA 4MNEA 4I92A 4BVUA 5DR6A 3QRKA 3G5DA 4KKGA 4QMMA 4R5YA 1YKRA 3KULA 5E8TA 3M2WA 4BCMA 4LMUA 1ZARA 2JKKA 1OL6A 3GU8A 4IWOA 4BGQA 3L9PA 4CT2A 3NNVA 4QYHA 5HEZA 3UDBA 4F09A 4X2JA 3BBWA 4FTKA 2OSCA 5J79A 4WHZA 2ZB1A 4G1WA 4FNXA 4JX3A 4U41A 4YTHA 4MHAA 5I9UA 4ZLOA 1H8FA 2PVJA 3LXLA 2ETKA 3GCUA 3Q9XA 5F9EA 5KBQA 2OFUA 4OTQA 4C4FA 3O23A 3QX4A 4GL9A 3PPZA 3DY7A 4FKPA 2B4SB 3DT1A 5DOSA 3CP9A 3G2FA 3N4UA 1B6CB 2FB8A 3H3CA 3O17A 3NR9A 2CGUA 1JBPE 2CHLA 4QMVA 4FV1A 3SRVA 3NAXA 3FL5A 4N6YA 4I1ZA 4BKYA 3UC4A 3MH0A 4BDIA 1IASA 3EFKA 5CANA 4IAYA 1PKDA 2C5NA 3IDCA 4RC3A 4YPSA 4EUTA 2OF2A 4KBAA 4ZTSA 3I81A 2VWYA 4R77A 3ORIA 4OTPA 2QNJA 5CU0A 1DM2A 5KO1A 4CFWA 2HXQA 4AA5A 4S32A 4RFYA 3RNIA 2R3NA 5LVPA 1DS5A 5ICPA 2WTKC 4RVTA 4JXFA 1KOBA 1PYXA 3R2BA 1WVWA 4ZJIA 1Q61A 4G3DA 5HTIA 2WOTA 4H3PA 1H01A 5HE0A 4AP7A 4BCQA 2BILB 2XJ0A 1RJBA 2Y9QA 3BV2A 4J99A 4DEIA 2J0KA 2WTKB 2J50A 4GUEA 4MWHA 5HG5A 3W10A 4RJ4A 4A7CA 1RW8A 2IPXA 4OTDA 4O7LA 1FQ1B 5E8SA 4BCFA 3FMEA 5HE3A 5HQ0A 5D1JA 1K3AA 3KVXA 3RAIA 2QO9A 2J7TA 1U5RA 4QMSA 1W82A 3QWKA 4AXAA 1KE8A 2ZV9A 4EHGA 2F9GA 1Q3WA 3ORKA 1MRUA 2ETMA 3R1NA 4NM0A 4UZHA 2UZBA 3DBDA 5HGIA 4NTSA 4RJ8A 4LRKA 5C26A 4BI2A 3D15A 2WQMA 4RFMA 3VNTA 1Q3DA 3PJCA 5HCZA 3HL7A 5E90A 3OZ6A 3RP9A 4I6BA 4YZBA 4IWDA 1ZY4A 2F57A 3DU8A 3HMNA 3UIUA 3CQUA 4ACMA 3ORXA 3DNEA 3QF9A 4QQ5A 4CMTA 4FKLA 2YZLA 3MVJA 2J0LA 2WU7A 2YIQA 3D5WA 4WBOA 2WMQA 4IADA 4KUJA 2V5QA 5IUHA 3P7AA 1M17A 3RTPA 4V01A 4FG8A 4DFUA 3SA0A 1MP8A 2QU6A 3IW4A 4IDVA 4K77A 4XOYA 4U9AA 2UW9A 2YLEA 3HDMA 2X6EA 3VS2A 4QMQA 3A7HA 3FLYA 1OL5A 4HPTE 4I3ZA 4RC4A 5L6OA 5E8WA 2QODA 4NTTA 4I4EA 4LRMA 3MB6A 3EFJA 4KIKA 4S31A 5HI2A 3M11A 2XBAA 1REJA 2VWVA 4I6QA 2PUNA 2CJMA 3DA6A 3O8UA 2WKMA 5EQEA 5ANOA 3LCSA 2C6KA 4BTMA 2PE0A 5AV2A 3UP7A 5DPVA 1PXPA 2IWIA 2YM5A 4R3CA 3HMIA 3I5NA 4X3FB 3W2RA 4AX8A 2G2IA 4FR4A 4BDFA 2NRYA 3AG9A 4ZK5A 5FTQA 4DHFA 5JMSA 2OJIA 1W84A 2OWBA 3CY3A 4FIHA 2IZTA 3VBVA 3DFCB 3D94A 4MTAA 4OGRA 4OT6A 5DR2A 4P90A 4W9XA 5HVJA 4AA0A 3O71A 4OTFA 3KKVA 3LJ1A 3DGKA 2GTNA 5AP1A 1BLXA 1GAGA 3ZM4A 3O7LB 2RSVA 4KD1A 4C7TA 4MWIA 1A06A 2C1AA 2ZMDA 4IDTA 5TR6A 4C4GA 2UZUE 2YEXA 3KCFA 1WBSA 5HCYA 5J95A 5CAUA 3TZ8A 1XWSA 5GINE 4O27B 3GCSA 2X8DA 5FWKK 3HRFA 4I0SA 3ZRKA 3TTJA 2B54A 5AUXA 4D1XA 4JAJA 4M69A 3ENMA 4AFJA 1E1XA 1CKPA 1YW2A 4QT1A 1T46A 2OGVA 5H8EA 4ORKA 2C6OA 3W2CA 4A07A 1V1KA 4GSBA 4AUAA 3TDVA 3PZEA 2CKEA 4JR7A 4U7ZA 3ALOA 3WZUA 4YC6A 5JRSA 3LFNA 4U43A 2A4LA 2PMLX 3VBTA 5EKOA 2BAKA 1ZZLA 4U5JA 3U6HA 3ELJA 3NUUA 4GVAA 5ANJA 3RK9A 3U6JA 1H08A 2W5AA 3OY3A 2VAGA 4FVPA 4EHZA 2RFNA 3EL7A 3CJFA 3A7JA 4MF0A 5CQUA 3P9JA 4UMQA 1XH7A 2O65A 4C34A 3V8WA 2PHKA 4GUBA 4QPSA 1AGWA 3Q5IA 3SW7A 2OO8X 4IAIA 4EKKA 5DG5A 5DN3A 3W33A 5J9ZA 4CV9A 2VX0A 3KXZA 2WIPA 1AD5A 4JBVA 3ZBXA 5CALA 4FTLA 4AN3A 4DLIA 5DGZA 4MD7E 5F94A 4R1VA 5FLFA 3HEGA 4HYIA 3U9CA 5I9VA 3EN4A 3R7UA 5L8KA 1MQBA 3PWDA 2YCSA 4I24A 4LL5A 4YHTA 3R8VA 3RPVA 3ZFXA 4HVIA 2WHBA 4GT3A 2YJSA 2VNWA 1ZOGA 4MNFA 3JR1A 5K4IA 3DBEA 4IVBA 4D2VA 2HWPA 2GFCA 2Y8OA 2VTQA 2XM9A 1PMVA 2WMUA 4IANA 3P86A 3E8EA 1KV1A 4X2KA 1W98A 4FV5A 3F2NA 4AU8A 2HIWA 4FEXA 4UBAA 3FPQA 3I6WA 3UG2A 4CQEA 3S4QA 2HOGA 3ORTA 3QCXA 2DWBA 2QOLA 4EBWA 3C13A 4IZ7A 3FEGA 1JSVA 3MESA 4KAOA 1SZMA 2J9MA 1CTPE 3PVUA 4MAOA 5CT0A 3UGCA 4AZTA 5J7BA 2W05A 3QQJA 3BGQA 3CXWA 5IQIA 2BZKB 4FV9A 2H96A 3C4ZA 5CI6A 2QURA 5E1EA 5L2QA 3AQVA 4G6NA 3MPTA 4FZAB 4FKSA 5CT7A 3TNIA 1LUFA 5LMKC 3D7TB 4UWYA 2EUFB 2JDSA 2YERA 3Q6UA 4I6FA 4H05A 3QKMA 4BZNA 3I60A 4FKQA 2XYUA 3LOKA 2VX3A 1OB3A 2BHEA 4UMTA 5AR7A 5FDXA 5HIDA 3K5UA 4XOZA 3CTJA 4IB5A 3M1SA 4O22A 2I0HA 4TWCA 2RKUA 3RM7A 5KMJA 4NH1A 4F99A 5IQFA 2R64A 2XUUA 4B8MA 2A2AA 2C0OA 4AF3A 5EOBA 2WMBA 2XRWA 4ZSGA 4YUQA 4QMZA 5KMIA 2YHVA 3DXPA 3QRTA 4I5PA 2ITNA 1OMWA 2V62A 4CV8A 5AR8A 4E4LA 3BRBA 2YAAA 2W1CA 5CAQA 2XIKA 1FGIA 5BQ0A 4XG6A 4A9TA 3PXYA 5J5SA 4QMNA 5FEDA 2IVSA 2V55A 2PZPA 3FL4A 4XS2A 4IM3A 1VYZA 4TYEA 3TJCA 4FKWA 4WT6A 4TW9A 3TI1A 1MUOA 4KINA 3UO6A 3Q3BA 1OPJA 4OR5A 4OUCA 2OJGA 3NUXA 4PUZA 5HG7A 2WEIA 3R9HA 4NT4A 3ZEWA 5C4LA 3QQUA 4Y83A 5C8KA 3BQRA 3IDBA 4MBJA 4YHJA 1VZOA 4XG8A 2YIYA 5AUZA 3RPRA 3ORZA 4WNMA 5TKDA 4B0GA 3WF9A 4D4SA 4EI4A 5M44A 1DAWA 1FVRA 3OEZA 4ONAA 2PYWA 2BROA 4U79A 3TEIA 3FLSA 3I7BA 5E92A 2Y6OA 4BYJA 2QVSE 3R02A 4GS6A 4FKTA 3L9MA 4C4HA 3SC1A 3WOWA 5IA1A 3OS3A 1XKKA 3PPKA 4M13A 1ATPE 2C1BA 5E8YA 1BX6A 4ACDA 2QO7A 3NEWA 3FQSA 3C0GA 4FYNA 3QKLA 4FSYA 1Z9XA 2ITTA 2QI8A 4O7VA 3DJ6A 4GVJA 4E1ZA 3OROA 3C0HA 3FSFA 4RPVA 5EDRA 3UMXA 4L43A 2YIWA 4FTRA 4FT9A 4DEHA 3DOGA 2X4FA 4JQ8A 4APCA 4BIDA 4FSTA 2UW4A 4MF1A 4YPDA 2O5KA 3F5XA 4TWOA 4J8MA 3R7YA 3G33A 3W2PA 1OKYA 5K5NA 3ZRMA 3C5UA 4EUUA 2V7OA 4QP1A 3UVRA 1KE6A 5DRDA 3AC4A 3V5LA 4M14A 3CY2A 3ZU7A 2NO3A 3VUTA 4C8BA 4CEGA 5CAPA 4BDDA 4PX6A 5JRQA 3AC5A 4U6RA 3TNQB 4XV1A 3RZBA 3OT3A 4CMOA 4E26A 4AT5A 1Z5MA 1CSNA 3QLGA 1OM1A 2UZVA 4U0IA 2ITYA 3CD3A 5DRBA 4P2KA 4XBUA 2JDRA 3PJ1A 5AR2A 4AZSA 1NVSA 3TZ7A 3BU5A 3DKFA 5CSVA 1UKIA 4RJ6A 4DH8A 3BZ3A 3WZEA 4B99A 4I5MA 4EYJA 3Q32A 4WG5A 4IZAA 4I20A 2QD9A 4L45A 4JJRA 1WBVA 3CPCA 3PSCA 2ZOQA 4N4SA 1GZOA 2PUPA 3BIZA 1NVRA 2XIYA 1YXVA 3LCDA 5AUYA 4C35A 4AT4A 1JAMA 3IS5A 4C33A 4E3CA 3BHTA 4I93A 4ZIMA 4I94A 4EOLA 2XA4A 3H10A 4YHFA 2JDTA 4ZTHA 2JDOA 4CRLA 5CF6A 2Y4IB 1H0WA 3V6SA 3ZEPA 4G6LA 3HDNA 2X7FA 3KRWA 4BDCA 3R1SA 1UNLA 3QD3A 3VUGA 3IW8A 3PJ2A 3HA6A 2ACXA 5AM7A 4DTBA 3MY0A 3A7GA 2BRGA 4IX5A 2CSNA 4MBLA 3PY1A 3DTCA 4RWIA 3O2MA 4N0SA 2NNWB 2XKFA 4C2VA 5ETIA 3NLBA 3ATTA 4EKLA 4KKHA 4A4XA 1H1QA 3G51A 4CTCA 2R3OA 3G9LX 3LMIA 2CLQA 2VTRA 2YM8A 3EN5A 3E64A 4ZTRA 3LPBA 4RMZA 5IG1A 4TN6A 2ITPA 5AIKA 3HUBA 4WA9A 2QU5A 3R21A 1ZWSA 3R9DA 4J96A 2GFSA 3IECA 3QZFA 1FPUA 3BHVA 1OKWA 4CZTA 4BYIA 4B6LA 2YM4A 3TDWA 5AP2A 4QP6A 4XV9A 3HA8A 4RJ3A 3BLQA 3ZUUA 1Y8GA 4TZRA 4N57A 4QYEA 4O0TA 3MVLA 4D4RA 2W1DA 4RBLA 3ULZA 2OLCA 1NW1A 3F66A 4DT9A 4BKJA 3TUBA 4AW2A 3RPYA 1YOJA 4D5KA 4UEUA 5FRIA 4R3RA 5EM6A 3R8LA 3G6GA 4E5AX 2WOUA 4GT4A 3Q9ZA 4UZDA 4YO6A 4H36A 4FIEA 3THBA 4YZDA 4X3JA 5CAVA 5IH4A 2JBOA 3S00A 3PA4A 5IH5A 3HMOA 5KZIA 3DLZA 2R3JA 4XH6A 4LV5A 2XIZA 5JGAA 2R7BA 1O9UA 5HESA 3VUIA 3P78A 2F49A 4ALUA 1H24A 2VTJA 3LLTA 3I1AA 5IUIA 1SVGA 2P2HA 5DVRA 3WI6A 4A9RA 4BICA 3UNJA 4ANNA 1XH4A 1WBNA 1ZZ2A 3IG7A 3KRRA 4TWNA 4TYJA 2XH5A 2YCFA 2YLFA 3TNHA 3O8PA 4YGAA 3NRMA 3ZO1A 4EONA 4BHNA 5AEPA 4USFA 2OXXA 2W06A 3CE3A 5C03A 5EW8A 2O3PA 3DKOA 3R7GA 4FEQA 2ZDTA 4Y8DA 3FMJA 2B9FA 4GK3A 2OJ9A 2Z7QA 5EYCA 5AAFA 5HORA 1URWA 3DAEA 3QC4A 3R22A 3R7IA 3Q04A 3BYUA 3NSZA 4P4CA 4MH7A 2W17A 2VTPA 5AV0A 2UZWE 3EQDA 4QMLA 5DNRA 5F95A 4YU2A 3U87A 2PVHA 2OKRA 4XP2A 5I9XA 3NMUF 4ZSLA 4FIJA 2IVTA 2X2MA 2HY81 4FKOA 2PWLA 4RFZA 3K3IA 5ANGA 3RI1A 5HLWA 1WBPA 5JFXA 3EB0A 4YJNA 3D9VA 4ZAUA 3RBWA 4ITHA 4C0TA 1JKKA 3PE2A 3DFAA 4PDOA 2R2PA 1OIYA 3PXRA 3BLHA 3R7VA 2Q83A 2C6MA 4FZFB 3G0FA 1F5QA 4LG4A 2IW6A 4UWCA 2I0VA 4ZJJA 5C8MA 3GUBA 3MGYA 2EXEA 4UY9A 2BRBA 2P2IA 2VGPA 3R63A 4M67A 4YNEA 5CVFA 3PUPA 5M4IA 2RL5A 4W9WA 4F0IA 1YXSA 5CZHA 4E4MA 4E5WA 5HBEA 4EOOA 5LARA 3U6IA 3QGYA 2YIRA 3OD6X 1U54A 1JPAA 4AACA 5IQDA 1B39A 4DCAA 2VTAA 4O2ZA 4F0GA 2QLQA 4PF4A 2R3QA 3QFVA 1A48A 3PJ3A 2UW0A 1OKVA 2XIXA 4NWMA 4FV8A 3NIEA 4OBOA 4YC3A 5H3QA 3HAMA 4FTTA 4L3LA 4E6AA 4WRGA 3TG1A 2XNEA 3LFQA 2UW6A 4RWLA 3OXIA 4ZOGA 2Q0BA 4YBKA 3HV6A 4KSQA 3FQEA 3CPBA 2JFLA 3QRIA 1TKIA 4KS8A 2PVYA 4D55A 3WBLA 1U46A 2IO6A 3C4FA 4R1YA 4BTFA 2BFXA 5HHWA 3LE6A 4EOKA 4WNPA 2GS2A 3BU6A 3FZPA 4IZYA 4AOJA 3W2OA 1OUYA 3D0EA 5LVMA 1QCFA 3FMMA 4G9RA 5IUGA 4O83A 4O1PA 3RAKA 3QBNA 5DWRA 3EZVA 4JG7A 1YXXA 2XK4A 4FTJA 1UU3A 5C9CA 3S0OA 3RHKA 4Q2AA 5HNBA 2HW7A 3SG9A 3VS1A 2HCKA 5I9YA 1XJDA 3CD8A 5DBXA 3ACJA 4MK0A 3UG1A 4RIYB 3ZLYA 3F7ZA 2W5BA 4FNYA 3OT8A 3A2CA 2QOKA 3FLNC 1Q8YA 4KS7A 4MX9A 1WMKA 3V3VA 4ERKA 5EOLA 3EOCA 4X2GA 3ALNA 3U4UA 4BDJA 5M07A 4CCUA 3PY3A 4J97A 2R0IA 3LFAA 3IO7A 4KKEA 5L3AA 1ZMWA 4ZEGA 3AMAA 4LUEA 4MNEB 3GOPA 4OTIA 1PJKA 2B9HA 2ZM4A 4M84A 3QQGA 4BCHA 4Y85A 4ZP5A 3EKNA 5B0XA 1KE5A 1CKIA 3BV3A 3KULB 2JLDA 4F9AA 5CEOA 1G3NA 2OI4X 2WTDA 2XCHA 4JDKA 4QTBA 5CNOA 4NKSA 3RNYA 3VS7A 3F82A 4ASZA 5HU3A 4CYJA 2Z7RA 3EFWA 1OL2A 2RFEA 4BC6A 3Q2JA 4FSQA 3UMWA 3DK6A 2B9IA 1R39A 2QO2A 1XH5A 4GRBA 3P4KA 5BVFA 1JNKA 4PP9A 3D14A 4ASDA 3E7VA 4LFIA 1H1PA 4ITJA 5CF4A 1ZMUA 2YFXA 3MFTA 4F7SA 5FUTA 3P79A 4DINA 4HNFA 4YJRA 3PXQA 1YI4A 3LFCA 5DI1A 3LHJA 2E9OA 3U54A 2E9UA 3C4WA 3SRVB 4GG7A 4O0RA 2YAKA 4XYFA 2C3KA 4EHVA 5D11A 2I40A 3EKKA 1XH6A 4YZ9A 5G6VA 2C47A 3G0EA 3OG7A 4E5BA 5K5XA 3VAPA 3W2QA 2X39A 3OCTA 3W18A 3VVHA 3L8VA 4IIRA 4RZVA 5AFVA 2H34A 4G9CA 3V8SA 3T3VA 3UYTA 3KCKA 4L9IA 3FY2A 1R78A 2YABA 2F2UA 5HKMA 1YHWA 4K33A 3PXKA 4LV8A 4Y5QA 3P1AA 5CWZA 2PU8A 3DXNA 2BVAA 2ZM3A 4ID7A 4BDKA 1FOTA 4CT1A 5L2IA 2FYSA 2XB7A 4IWPA 3OOMA 2P4IA 3D5XA 3ULIA 5CF8A 2BDFA 4HPUE 2PVKA 4TPTA 4PY1A 2XYNA 4XNEA 5D41A 3QQLA 4O0XA 5C01A 4G3EA 3ZCLA 4ASEA 1UKHA 3GC9A 1R1WA 4HVDA 2JAVA 4DCEA 4Q5HA 3UODA 4CG9A 4LI5A 4IJ9A 2XNOA 4G17A 4BKZA 4O7WA 1SVHA 4UX9A 4L44A 2OZOA 3SW4A 3TACA 1BI8A 5CYIA 4O7SA 4BBFA 4QOXA 3HMPA 5IISA 1Q8UA 3ETAA 3EN9A 4IC8A 4ZMEA 3HMMA 3KF7A 4PNIA 4EH2A 5I5ZA 2A0CX 4IXPA 2I1MA 2EWAA 2OZAB 3SVVA 2HZ4A 1P14A 3RCDA 3UVQA 2A27A 2YCRA 4M66A 4A4LA 3KN6A 5CU3A 1W7HA 3OBJA 5AADA 2JIUA 4WUNA 3ATSA 2CGXA 2FGIA 4EH9A 5BUIA 3TL8A 4D9TA 4G31A 1IAHA 3EIDA 2CCIA 2O8YA 3V5QA 3EQBA 3ANRA 5BYZA 4UALA 3ZLXA 2QOFA 4PMMA 1UVRA 3Q9YA 1O6YA 3FC1X 2G01A 1URCA 4CKJA 3MN3A 3FMKA 2XP2A 3IKAA 4F1MA 2PVFA 4MXOA 4EH7A 2ONLA 3Q52A 4ARKA 4YBJA 4RX9A 4WKQA 3F2AA 2XNMA 4WO5A 4TNDA 4CFUA 3QHWA 3UOLA 4DGGA 1K9AA 2AC5A 4RX5A 3PLSA 3NX8A 2HYYA 4F1OA 1VYWA 2RFDA 2CGVA 1OL1A 5I9WA 4DN5A 2X8IA 3LXNA 5HCXA 2NP8A 3MWUA 3ZDUA 3WILA 2YWVA 1IA9A 3SV0A 2WQNA 5AR5A 1GOLA 2GNHA 3ZO3A 4KIKB 4GKHA 2IZUA 3Q4ZA 5ANEA 4ZSEA 3GT8A 3ZS5A 4C58A 2HZIA 2G15A 3PDTA 4DH1A 5ITAA 3JY9A 5I3RA 3RJCA 3V51A 3D2KA 3LXPA 2XNNA 4BI1A 4A4OA 2BRMA 3SAYA 3A8WA 3ORNA 4FTIA 3FSKA 3NW5A 4XLVA 4AZVA 2E9PA 4PDSA 2QKRA 3BYMA 3R71A 3R1QA 4FZ7A 5EYDA 3PE1A 3BEAA 3L1SA 1S9JA 3B2WA 4Y72A 4OTRA 2WEVA 4FKGA 4I21A 5DFPA 2E2BA 3BEGA 4IM2A 4H1MA 4YP8A 5ANKA 5DA3A 3QRJA 4CFMA 3GCPA 3O8TA 1UV5A 3WF5A 3FZRA 2WNTA 4YNOA 4FTAA 3OF0A 3AD6A 4V0GA 5ETCA 4U3YA 3U4WA 5HLPA 4H39A 3S1HA 1MRYA 4USDA 2R3IA 4TNBA 5GHVA 3ROCA 4YR8A 4RWJA 2OJFE 3KU2A 3BE9A 3F69A 4X3FC 1APME 1STCE 3EN6A 3PZHA 5CNNA 4DF3A 2HK5A 2X1NA 3NZ0A 4I6HA 5L6WL 3SKCA 5KCVA 3MY5A 5AP3A 4DGLC 3NNXA 3FHIA 4M69B 2G9XA 5CEQA 3GOKA 1PY5A 4XEYA 3FZSA 1IEPA 3DLSA 4LGGA 2QR7A 5J8IA 3GNIB 5FEEA 4G5PA 2ZYBA 3CSVA 2C6IA 3DK7A 2F7ZE 1KSWA 2VO0A 4K8AA 3NUPA 2Z7LA 3II5A 3QD4A 3JUHA 3HP2A 4ZTMA 4HVSA 3QZGA 3KFAA 5A3XA 5HLNA 4DBXA 3UOJA 1U4DA 3QXPA 3ID6C 2XIRA 2PE2A 3OXTA 3RCJA
chains in the Genus database with same CATH superfamily
3BHYA 4FV2A 3UC3A 3HECA 2XM8A 4JVGA 2ZB0A 5ETFA 4C3FA 3RWPA 4S33A 4EQUA 4APPA 5EI6A 4XX9A 4NL0A 5AIRA 3I0OA 3ZSIA 4D0XA 5F4NA 4G3GA 4RZWA 3F5UA 3TV4A 4C2WA 3ML1A 1WZYA 4PNKA 4NUSA 5IQCA 4R7HA 2QG7A 1LR4A 1L3RE 2OW3A 4K18A 4W4WA 4DHZA 4I0RA 3VN9A 5L6PA 4XV2A 5GJGA 1ZMVA 4DG2E 3R83A 3QTWA 4O2PA 4CVAA 4QP3A 2R0UA 4ALWA 3KN5A 3UIXA 3MFSA 5FM2A 4AAAA 3UOHA 3QTUA 5CSHA 4GKIA 4JBOA 2JFMA 3OUKA 4U81A 5H8GA 1NXKA 3IPHA 4LMNA 4CFFA 4W4VA 4FGRA 4IWQA 3QZHA 5CQWA 2W1HA 1TQPA 4HCUA 1DI9A 2QOIA 3TKUA 4D4YA 5HVKA 4UB7A 4BBMA 3QA0A 2UZLA 3PVBA 4EH6A 5CLPA 3ZONA 2XZSA 4FICA 3TNPC 4UXLA 3EMGA 2QHNA 3LAUA 4IMYA 4NW5A 3MSSA 4RRVA 4L8MA 3G15A 3VS5A 2Y0AA 5DH3A 3GENA 1K2PA 4AGWA 3K3JA 3R00A 4L01A 4ZZMA 1O6LA 3C5IA 4ASXA 4DEAA 1KUTA 5HVYA 4O0VA 5BVDA 4FTMA 2C5VA 3LW0A 4D2WA 1KOAA 4NJDA 3DQWA 4Z55A 3UDSA 4U45A 2FA2A 2X7GA 4IX6A 4GJ2A 1YXTA 5ETAA 3OBGA 3O5AA 5FG8A 1UNGA 2A1AB 3NCGA 4EQCA 4ZZNA 4S2ZA 1V0PA 4IVCA 4QP8A 2O64A 2DUVA 2BRHA 3OCBA 4RIOA 4XRLA 2ITVA 3KXNA 4EK3A 5A4LA 2A19B 2QLUA 4KRCA 4PV0A 3ZYAA 1H27A 2FSMX 3W0OA 4LGHA 4NJ3A 5CY3A 4HGEA 4RVMA 4O86A 3RAHA 1TQIA 4G5JA 3RALA 2X2KA 3UNZA 1LP4A 5B7VA 1Q8TA 2XK6A 4J53A 4R3PA 5LMAA 5M55A 4LV7A 5DMZA 3KVWA 4W8DA 5BUEA 4NKAA 4F08A 1WBTA 5AR4A 2QCSA 4ZTQA 5A6OA 5J1VA 1SM2A 2VTNA 4DFBA 2YDKA 3BLRA 4F7NA 3ORPA 5JQ8A 5FXSA 1ZRZA 3VBXA 1ND4A 1MRVA 5ACKA 3ZO2A 1FMKA 4OAUC 4FV3A 5EM7A 2PK9A 2A98A 5J9YA 2R3KA 1PXIA 3RKBA 4A9SA 3HVCA 2B7AA 4IJPA 3VF8A 5M57A 3RM6A 4R7IA 2FSOX 4HGLA 5A4EA 4L3PA 4EWQA 2VWBA 4FV4A 2YDIA 1ZLTA 4AQCA 2R7IA 3NGAA 2OF4A 3WYXA 3MTFA 2VNYA 3LFSA 4F4PA 4ZY6A 3IW7A 3NIZA 4FC0A 3TV6A 3RGFA 3VUDA 4NZWB 4DAWA 5DT3A 4J8NA 5CEMA 2UZTA 2JITA 1R0EA 3GFEA 5E7RA 2FSLX 5AP4A 3DDPA 2VO7A 2F7EE 4XP0A 3ANQA 4FODA 5EW9A 4O21A 5HO6A 4DITA 4O7TA 4K6ZA 1GIHA 3EQPA 4G34A 3ZSGA 4IE9A 2WGJA 3UIMA 4B8LA 4L7FA 4XV3A 1KE9A 4GU9A 4DFZE 5J1WA 2XMYA 3GI3A 4FUXA 3DJ5A 4CXAA 4DC2A 3QTIA 4HCVA 4FG7A 3W0QA 2WQEA 4U3ZA 4NCTC 1LEWA 4NIFA 4BCPA 3VJOA 3COHA 3DJ7A 3AGMA 3VHEA 5CASA 1BL7A 2WQOA 4PMSA 5GZ8A 4RQKA 2WFYA 3KXGA 3C1XA 3HV5A 3NNWA 1M7QA 4H58A 4O0UA 4AZWA 3D4QA 1WAKA 5JQ5A 1CMKE 5C8NA 2RG5A 5AM6A 3NW6A 5CU6A 4QMUA 2QC6A 4I6LA 4ANQA 2R3FA 2VN9A 3NAYA 3ZFYA 3MI9A 3PP0A 3VIDA 3ZC6A 2WMSA 1GZKA 1XBBA 4A06A 3LXKA 2B55A 4I4FA 1HCKA 2ITUA 5LOHA 1OIRA 2EB2A 2GDOA 4GK4A 4CKIA 5IEVA 3LQ3A 2E9NA 2J0JA 3KXHA 4XG4A 4Y95A 5IA2A 2CNQA 4BR3A 4RQVA 3I5ZA 5K9IA 3A60A 3GXLA 4M68A 4BRXA 2VX1A 1VJYA 3PG1A 4FI1A 5L8JA 1JQHA 3AT2A 4FKIA 5LQFA 4W8EA 3QZIA 3CJGA 4IX3A 2WTWA 3HNGA 4U80A 4AN2A 5LMKA 2IJMA 2PMOX 3F3UA 2P0CA 2P55A 1P4OA 4W4XA 2W1ZA 2WB8A 1IRKA 4LOOA 5JZNA 2IW8A 3SXRA 3W16A 5HBJA 4BDGA 5IEXA 5KUPA 2W1IA 3AT4A 3EQGA 2Z2WA 1I44A 3FJQE 3DKGA 5B2MA 3LJ2A 2XNPA 4XG7A 2FSTX 3EYHA 4ACCA 4FVRA 3KRXA 5LJJA 4IZ5A 4Y46A 4AG8A 3ZZWA 1GIJA 5L2TA 4NW6A 3PPJA 4AQKA 2R3HA 4E73A 4F64A 4YLJA 2PULA 5D10A 5AV3A 3D7ZA 4KA3A 5IZFA 3WF7A 5HIBA 2RG6A 1KV2A 1PHKA 4FT5A 4FNWA 4IHPA 2RF9A 2F2CB 4AGDA 3K5VA 3NYOA 5HE2A 5G1XA 5L8LA 3ORMA 2WMAA 4ANBA 1Q62A 1YVJA 3MPAA 3FLZA 3OW4A 2J2IB 4YZNA 5FD2A 3ODYX 3KC3A 2BTRA 4FIIA 4JBPA 1UU8A 2XK7A 3CBLA 4ZS0A 3S2PA 4DH7A 2ZV2A 2VUWA 4FIFA 3A4PA 4G16A 5DT0A 4DFNA 2P3GX 3Q53A 4X2FA 5EH0A 3ZMMA 3GU5A 3KIOC 3O50A 2XK8A 3KA0A 4MKCA 2Y4IC 2VTSA 4X7QA 5AUUA 2GPHA 3A8XA 3KEXA 5DHJA 4QDEA 5DYJA 2Z7SA 5HNIX 3R8ZA 3DXQA 4CFXA 2PVMA 1VEBA 4FKJA 3G6HA 3EQRA 3QTZA 5HICA 4AZFA 3DQXA 1YHVA 4FOBA 3ACKA 3AC3A 4QTEA 3C4XA 2QOQA 4IB0A 4QTAA 3TXOA 3Q4CA 4AZEA 3P7CA 3LKMA 1QPCA 3TZMA 4MD8E 4AA4A 4YMJA 3AMBA 2I7QA 5EYMA 4IBMA 2XAOA 3FMHA 4QNAA 5M56A 4F9WA 3ZUVA 4FF8A 4JNWA 5AAGA 3KQ7A 3MIAA 2C4GA 2ZAZA 2QR8A 3P7BA 3NUNA 5GZ9A 2BUJA 3FYKX 3R1YA 1Q8ZA 2CKQA 3SOCA 4QTDA 4GT5A 5EYKA 3FBVA 1H00A 4QMPA 3OCSA 4EK6A 4KIOA 2VD5A 3WE8A 5BX0A 3L9NA 4TY1A 5FXRA 4E93A 3QCYA 4HZRA 4DYMA 3A7FA 3EQIA 3UP2A 4DDGA 4JQ7A 3F3WA 1YHSA 5E91A 4YJUA 3L8PA 3GQIA 5I0BA 4HJOA 5AJQA 1H1RA 4DFYA 1J1CA 3SQQA 3A61A 4M0YA 4KNBA 2WMXA 5IDNA 4I5CA 4PTEA 5HZNA 3GEQA 2GSFA 3GU7A 3POZA 4WOVA 4DGNA 2GNJA 1OECA 3K2LA 3V5WA 4EWHA 3FMNA 3MJ1A 5BMMA 2I6LA 2GQRA 4ZMFA 4RA4A 3UNKA 5E4HA 4ANLA 2GNIA 3D5UA 3EHAA 3K54A 4QQTA 5TE0A 5IPJA 3FLQA 2KTYA 4FKRA 4JIAA 5LXMA 1J7LA 2VZ6A 3E8NA 3OP5A 5HNGA 4D28A 3HKOA 1WVYA 4IVAA 5LWNA 4DDIA 3QGWA 5JN2A 3VQHA 2X4ZA 3UOKA 4A9YA 1SNXA 4RLKA 2YM7A 5DLSA 5L4QA 1WVXA 3N9XA 2W4OA 3QXOA 3R9RA 3SGCA 5M53A 3MJ2A 2X7OA 2YZAA 3IK3A 4NFNA 5DE2A 5HO7A 2W5HA 3FKLA 4H3QA 3OY1A 1W83A 4PTCA 4FV7A 1U59A 5ACBC 4C57A 5KKRC 2BIKB 4F6UA 5M08A 1QPEA 4PPBA 3H4JA 2C5YA 4BWPA 5AA9A 1BI7A 3PFQA 4B9DA 1M14A 3BCEA 1XR1A 3FZOA 4N6ZA 3DTWA 5FTOA 5AUTA 3QHRA 3BPRA 1H07A 4MYGA 5KKRB 5AWMA 2VWZA 4CKRA 2AUHA 3FLWA 3KREA 4O96A 3SXFA 4CFVA 2BTSA 2ZFYA 4FSNA 3JS2A 5GZAA 3BYVA 3IOKA 1U54B 3MFUA 4C4EA 3LCOA 5HX6A 1OGUA 4J52A 3O0GA 4YZMA 3FUPA 3GU6A 1Y6BA 3AT3A 3TIYA 4AOIA 2IF8A 3HV3A 4CG8A 3DV3A 4WG3A 4FT0A 4RIXB 1BL6A 5JSMA 2PVNA 2VTTA 4GG5A 4HGTA 4JDJA 2V7AA 4F9CA 4L7SA 3BWJA 4O0YA 3UVPA 5A6NA 1UU7A 5D9HA 3TZ9A 1X8BA 3PSBA 4CGAA 3CGFA 5JFSA 5CSWA 3FDNA 3VO3A 3N4TA 3Q4TA 4U8ZA 3R7EA 4EYMA 4YJQA 2OH0E 3DNDA 3BGZA 4BTKA 4C4JA 1YDTE 3P08A 3VS6A 2C3JA 2EVAA 2HAKA 4EJ7A 4JQEA 3LCTA 5KNJA 2GQSA 1B38A 1FVVA 4RIWA 3SDJA 4HW7A 4E6CA 4AGUA 3D5VA 3PJ8A 3WF8A 3QL8A 2XCKA 3UPXA 3Q6WA 4XUFA 1E9HA 1VR2A 3FV8A 4LRJA 2OFVA 2XKDA 5E8UA 1H1SA 4KSPA 4QNYA 5T3QA 3SX9A 3VW8A 3MA6A 5E8XA 2YITA 3TUCA 1P2AA 1XMMA 5C27A 4D5HA 4BL1A 3OXZA 4X6RA 3HRCA 5D7VA 1YWVA 1YDRE 3MIYA 3GVUA 5IEYA 3DAKA 5FP5A 3COMA 1PXLA 2X0QA 3QC9A 4G3FA 4BCOA 2PSQA 5EFQA 3H30A 4E7WA 2C30A 2GTMA 2H8HA 3ZM9A 2YACA 4MEDA 3KXMA 5TO8A 3ITZA 2VWXA 5T6KA 4PPAA 5AUWA 4R78A 4QP7A 1V0OA 4HNIA 2DYLA 1F3MC 3QA8A 4LL0A 4O4CA 3BKBA 4UMRA 4KB8A 3ZFMA 1NA7A 4J7BA 3SHEA 3C9WA 5LMBA 5BYLA 4C38A 5JH6A 5B2LA 3QTQA 5LWMA 4FTOA 4B7TA 4O7YA 1XH8A 1QMZA 3BHHA 2UW7A 2W4KA 3IQ7A 4CLJA 4R7BA 2Z8CA 1PRYA 5E8VA 3E8CA 5KMKA 4BIBA 5FDPA 5HTBA 3ZH8A 3V5TA 5BYYA 3AC8A 4HYHA 4S30A 3UQFA 2PPQA 3CC6A 2ITWA 3CLYA 1JSTA 2OG8A 3QWJA 3ZUTA 3QTXA 5E1SA 5J5TA 4NEUA 3JPVA 4E6QA 3TM0A 3P23A 4JIKA 4QYGA 4PQNA 4AWIA 1J7UA 1REKA 3OWLA 3DKCA 3FPMA 3I7CA 2XKCA 4M97A 1ZYJA 4JDHA 3VS3A 4FEUA 2J0IA 3C7QA 2UZOA 3DCVA 4PTGA 4PDPA 4GFGA 1TQMA 4RJ7A 2BKZA 1YRPA 4FL3A 4TYHA 1L8TA 3QLFA 4JX7A 3R2YA 1OIUA 4JR3A 3TKHA 2PZ5A 2R3PA 2ZJWA 4K0YA 3AD5A 3ZLSA 2XK3A 3R9NA 4ZTLA 4Q9ZA 2YIXA 4TWPA 1S9IA 3POOA 2I0EA 4FMQA 5IA5A 3FXZA 4DH5A 3NDMA 5AA8A 3GFWA 3ZDIA 3HLLA 4I22A 5AP6A 2BALA 5FTGA 4GV1A 2AC3A 2OIBA 4EH5A 2WTIA 4YO4A 3JYAA 3CGOA 2CN8A 4QRCA 1H25A 2BAQA 4RA5A 5BVEA 5EQPA 3AD4A 2OICA 3P5KA 3WZKA 1PXOA 1XHAA 5T68A 3BU3A 1M2PA 4YJTA 5EM5A 4ACHA 4EH8A 4LQMA 4F9YA 5LCJA 2BCJA 2UVZA 2W1EA 3A62A 3V5PA 3VS4A 5A14A 1Q99A 4J1RA 3MDYA 3AC1A 4M12A 2UVXA 4XG9A 3NWWA 3OTVA 3S95A 3C4CA 5BVOA 3RWQA 3GBZA 1G8JA 4D1SA 3R0TA 3VHKA 1HOWA 1IAJA 3BE2A 4MCVA 1NY3A 3LFBA 4AXCA 5EKNA 2KULA 3W8QA 2PL0A 4O84A 4MBIA 3LM0A 3EH9A 4FZDB 5DIAA 4CZYB 3CKWA 5KMMA 5KMLA 5E9EA 1YOMA 4IEBA 3NYVA 4FEVA 2BZHB 3AGLA 1YI3A 2JBPA 4Q5EA 4C36A 1XBAA 2JKOA 3LQ8A 3VJNA 3H9FA 4AW0A 2VWUA 4BB4A 4JS8A 3F61A 3QYWA 3AOXA 2H6DA 5BVWA 5BVKA 4DEGA 1IG1A 3BHUA 3LMGA 4FRFA 4R8QA 2X6DA 4BZOA 4GCJA 4M8TA 5JFWA 4TYIA 2WMVA 2B52A 3R9OA 4UV0A 2Z60A 4FE2A 5KMOA 5GIOE 5JK3A 1PXNA 1WBWA 4DTAA 1ZYSA 1BYGA 3L9LA 3Q4UA 3P5JC 3E62A 5H9BA 4AS0A 2JC6A 1MQ4A 1J91A 4HZSA 5H2UA 3EJ1A 3WF6A 4ANOA 5HTCA 2G2FA 3OC1A 4MXAA 3MH3A 4ZZOA 3W8LA 4UYAA 5GJFA 3CKXA 3DDQA 3H0YA 1H26A 2X0OA 3V8TA 1OPKA 3B8QA 2C68A 2P33A 2VTHA 4IVDA 3TTIA 1JSUA 4C59A 1E1VA 3HRBA 4Z7HA 5EK7A 1UA2A 2HZ0A 4RSSA 5CEIA 4IH8A 5AP0A 2GU8A 3IW5A 4QMYA 3ZRLA 3FZTA 3I6UA 1ZXEA 3F5PA 2F7XE 4GFOA 4JI9A 4QMWA 4GEOA 3JVSA 5DEYA 2WMRA 5I3OA 4RVLA 3FYJX 2IN6A 3S3IA 1JVPP 4O7NA 2ZM1A 3HP5A 4TT7A 4QQJA 4BIEA 4YJPA 4WG4A 3LCKA 4O38A 4OTHA 2UV2A 5EI2A 1RE8A 4RX7A 5KHXA 2X8EA 4V0GB 3FQHA 3F7WA 3LJ0A 3ZZEA 4L67A 4UWBA 5FP6A 4BFMA 4AOTA 2WMTA 4JLCA 4QQCA 2B9JA 5EDPA 3PRFA 5FEQA 3ZSHA 5K3YA 4O7RA 1ZYCA 1YWRA 1Q8WA 3PIZA 4XG3A 3HZTA 2QONA 3E93A 5CSPA 5JKGA 2WD1A 2G1TA 4IAZA 4R5SA 3ZOSA 3F2RA 3C4EA 4ANMA 1AQ1A 4L68A 5AX9A 2I0YA 3KF4A 2X0GA 5ANIA 2WPAA 3HUCA 3OVVA 3MH1A 4N70A 4EH3A 1ST0A 4BDHA 3DBCA 4E4XA 1DI8A 2BHHA 5HU9A 5B2KA 4EK8A 4FVQA 3GC8A 4NM5A 4P5ZA 4DEBA 4LOQA 2UVYA 4ALVA 3PIXA 4USEA 2OZAA 1J1BA 3CR0A 4BWXA 4EOIA 5HD4A 2BZIB 2YA9A 1Q41A 2GS6A 5KZ0A 2W0JA 4YZCA 5JEBA 4GYGA 3QX2A 3RK7A 3BYOA 2W1FA 3L8XA 2QKWB 2RFSA 1IA8A 2JDVA 4XJ0A 4FIGA 5TT7A 4DEDA 4BTJA 3LFDA 3EYGA 4L46A 4FT7A 5E8ZA 4I0TA 4HCTA 3U51A 4IFCA 3OEFX 2JIVA 4I5HA 4ERWA 4YTFA 5EDQA 1I09A 3NUYA 2B53A 3E5AA 4BCNA 4WUAA 1Y8YA 4LM5A 3W32A 4L53A 4EK5A 1JWHA 2C6TA 5CF5A 5I9ZA 4K11A 1FVTA 2BZJA 4MXXA 3GU4A 4F9BA 1O6KA 4TL0A 2C6LA 4AN9A 4U97A 1UWJA 3LVPA 4DH3A 3OTUA 2C0IA 4IW0A 2ZDUA 1FMOE 4KBCA 1FBNA 2XS0A 2EXCX 3DPKA 4FK3A 3UO5A 2XJ2A 1J7IA 2IVUA 1OPLA 3IGOA 1CKJA 3NS9A 3CTHA 3PA5A 4PL5A 3LQ5A 1Q5KA 5CZIA 4BI0A 4FTNA 4GIHA 4L52A 4W4YA 4JRNA 2E9VA 4AFEA 4E6DA 4MUQA 1XO2B 5EI8A 2QQ7A 2OK1A 5BNJA 4GFMA 3KB7A 1Z57A 2GNGA 4JG6A 4DG0E 1Y57A 2VTMA 3VUHA 4QPMA 4RVKA 4P7EA 5GJDA 4EC8A 3SOAA 4YTCA 4FTCA 4IB3A 4CQGA 2VO3A 5J87A 3EFLA 1QPJA 3E87A 3QQKA 3R6XA 2QOBA 3I79A 5BPYA 3Q5ZA 1SNUA 3VW6A 4AGCA 2B0QA 4EHEA 4V04A 3V04A 3R73A 3GP0A 5JGDA 2WZJA 2FO0A 3A99A 4NK9A 3G90X 5CXHA 4QYFA 5L2SA 1Y6AA 3WZJA 5KHWA 5A4QA 5IQAA 4FKVA 4HOKA 5J9LA 5IH6A 4AXFA 2PVRA 3E88A 1SYKA 4TXCA 2XBJA 1M7NA 1ZOHA 2W1GA 3O96A 3DZQA 4K2RA 4Q9SA 4L00A 2OJJA 5EM8A 2CLXA 4RX8A 2QOHA 3W55A 4OW8A 1EH4A 5M09A 2OIQA 4NSTA 3CCNA 5TOZA 5D7AA 3LM5A 5KX8A 3TV7A 1YQJA 3V6RA 2VGOA 5M51A 4KRDA 4D2SA 4X6QC 4X3FA 1OBDA 4JAIA 4O0WA 3PIYA 1GJOA 3QAME 4RWKA 4Y5HA 4ANSA 4DG3E 1JKTA 4JRVA 2G2HA 2R5TA 3VS0A 4EL9A 5IMXA 1FGKA 2QOOA 3JXWA 2VV9A 4EBVA 3U8WA 1PW2A 3PYYA 3E8DA 4BWKA 3DB6A 3BX5A 1OI9A 3LZBA 4XBRA 4F0FA 5BUJA 1ERKA 3FI3A 4IB1A 5CXZA 4QMTA 4YLKA 4AT3A 4EJNA 4UXQA 3R28A 4GJ3A 1JOWB 1GIIA 3U55A 1GZNA 1ZOEA 4HGSA 1U5QA 4J71A 4MQ2A 4XCUA 3W1FA 3HAVA 5HG9A 2W99B 2JAMA 2WO6A 3LMHA 3VC4A 3VULA 4F70A 4O0SA 5IQHA 4ITIA 4FBXA 4WBBB 3C50A 3LLAA 4QMXA 4CCBA 3UQCA 2CDZA 4F6WA 2PZRA 2PUIA 4L42A 3PVWA 4MXYA 4O6EA 2YJRA 4KIPA 5ANDA 3FAAA 2J4ZA 1ST4A 3FXXA 4FG9A 1HCLA 3Q2MA 1XH9A 3R04A 2C3LA 2O0UA 3KK9A 2UZEA 4JBQA 4H3BA 3QU0A 2NPQA 4WSQA 2BMCA 4AE6A 4QP9A 4Z16A 3PA3A 4ZLZA 1DAYA 1F0QA 2XNBA 3UDTA 5IQGA 4P5QA 5HOAA 3NUAA 2Q0NA 4FT3A 4TKSA 1PXKA 4XG2A 3TIZA 4WSYA 1V0BA 5FXQA 1QPDA 3DK3A 2GHLA 3FXWA 5EG3A 4AE9A 4GMYA 4IFGA 4E4NA 3UZRA 1A9UA 4EOPA 3N4VA 4GU6A 3KK8A 1KWPA 2GHGA 4R6VA 5IDPA 1NT2A 3TJDA 4NIFB 5DR9A 2OU7A 2Y6MA 4C4IA 3FE3A 1PYEA 5FM3A 4FOCA 4XLIA 1OIQA 2ZVAA 1BUHA 3RAWA 3GGFA 4QD6A 3H9RA 4JOAA 2QHMA 3WIKA 3HX4A 3PXZA 3OCGA 5A46A 2IZSA 4OBQA 4LGDA 3ENHA 3W0NA 1OVEA 2JGZA 5AV1A 2R3GA 1WBOA 2Z02A 3ZO4A 3TWJA 2HELA 4EH4A 4EZ7A 5BV3A 3KGAA 1H4LA 4FV6A 4RJ5A 2PMNX 1YDSE 5AUVA 3ZXZA 4YC8A 2W7XA 4FNZA 4M0ZA 3ERKA 4RLLA 3GCQA 1ZYLA 1M2RA 2XKEA 4NM3A 3OMVA 4O6LA 5D12A 3UDZA 3MB7A 1P4FA 2ZMCA 4EORA 1PXJA 1QL6A 5KE0A 4EOSA 3NVKI 4YURA 4PWNA 3GC0A 3ODZX 2LGCA 4JG8A 2O63A 2OH4A 4FTQA 2J6MA 5AR3A 2RIOA 2OXYA 2R3RA 1NVQA 2CCHA 2CN5A 4I41A 4DTKA 2BFYA 4ZS4A 3G9NA 3Q9WA 3UYSA 1BKXA 2GNLA 3COIA 2R3LA 3LFFA 3PY0A 4OBPA 4QP4A 5IF1A 1YWNA 2YM3A 4FKUA 3CEKA 1WCCA 4IX4A 3VRYA 4D2RA 4YLLA 5FBNC 5IA4A 2BPMA 4QTCA 1LEZA 2XVDA 4QMOA 5J7HA 3UIBA 2PVLA 1YI6A 3QRUA 4J95A 5EHLA 4O7ZA 2Y4PA 1OITA 4U40A 4RC2A 5AP5A 3VBQA 3D7TA 3CIKA 4C3PA 2YN8A 4ZSAA 5KBRA 3UO4A 3DBQA 3T9IA 2UW5A 3WE4A 2HWOA 1LPUA 4ZLYA 2C6EA 3PRIA 4GK2A 5GNKA 4CSVA 4ZXTA 4F6SA 1H0VA 5BMSA 3GCVA 1TVOA 5HO8A 2IG7A 4FSMA 4EC9A 3OUNB 4LUDA 4BDEA 3TN8A 5I4NA 3HV7A 3R8MA 3LIJA 2CKPA 3L8SA 4DFXE 2PZIA 2GCDA 5CS6A 3NNUA 4MVFA 2QOCA 3U9NA 3JVRA 4ZSJA 5K0KA 3H9OA 3PLAE 3OWKA 2REIA 3QUPA 3IW6A 1PF8A 2YDJA 3MS9A 3QYZA 3AKJA 4BCGA 4DEEA 4O82A 3IGGA 2JKMA 4L3JA 4CLIA 4RG0A 3E63A 3Q60A 3QTRA 3ZLWA 5IQBA 4UN0C 2BDJA 3HV4A 1OZ1A 4K9YA 3SG8A 3EWHA 2ERKA 4EZ3A 3DZOA 4BF2A 3PTGA 2UW3A 3KRLA 5AAEA 1GZ8A 4LYNA 2VO6A 5HBHA 2VU3A 2XF0A 1OUKA 4QPAA 3R01A 3KY2A 4NCTA 3UTOA 1JKLA 4C3RA 3MFRA 3UZTA 3JY0A 4U42A 3VUKA 1PMEA 4RGJA 2XJ1A 4EZ5A 3T3UA 2V22A 4G3CA 3ZTXA 2J5FA 2HXLA 4AXEA 4HYSA 3TKIA 2VTIA 3I0QA 3GC7A 3F3ZA 1JKSA 5A4CA 2ETRA 2UW8A 4FX3A 4WNOA 3RMFA 5AP7A 3ZC5A 4Z7GA 2PY3A 1RQQA 2X9EA 4PL4A 4MD9E 4MXCA 1OBGA 3MTLA 4F63A 3BBTB 1RDQE 3ZHPC 4MQ1A 4ZTNA 4O81A 4ENXA 1SVEA 1Q97A 4YSJA 1XQZA 3QD2B 4XHKB 3AMYA 4DLJA 4QDVA 3QD0A 3SXSA 2R3MA 4EOMA 2WELA 2C6DA 3PXFA 2VWIA 3I4BA 3IONA 5HE1A 4F65A 3VBWA 5IA3A 2VRXA 2HY0A 3AXWA 3E3BX 5M4UA 4DGMA 3F5GA 2C0TA 3BWFA 4XP3A 3DAJA 4NFMA 3NCZA 3IDPA 2UZNA 4GW8A 2J90A 4BCIA 3V01A 5KMNA 3WARA 1R3CA 2CNVA 3FMLA 3HGKA 3R30A 4AW5A 4IM0A 4JMQA 4IC7A 4OAVB 3R7OA 4UMUA 2GMXA 1IR3A 3FI4A 3OW3A 3Q96A 3QUEA 2CGWA 2CPKE 5HD7A 5CEPA 4TTHB 5EHOA 1UWHA 5HX8A 3F3TA 5IA0A 3OFMA 5JT2A 4FGBA 3HYHA 3BELA 3ET7A 2LAVA 2W9FB 5DEWA 2ZV8A 5BVNA 4X0MA 4QP2A 3KRJA 1ZY5A 4FUYA 4CRSA 3N51A 1R0PA 4HYUA 5EQYA 1ZYDA 4D9UA 3FMDA 4M7IA 4HVHA 4FA2A 4Y73A 2R9SA 2ERZE 1OKZA 2H9VA 1G8SA 3FY0A 2PUUA 3NYXA 4A9UA 3FI8A 4NYEA 3RHXA 4BCKA 3E3PA 3OWJA 3KMWA 2HENA 3EQHA 3QUDA 4YJVA 5CAOA 2IZRA 3E7OA 3B8RA 3MVHA 5CVGA 3R8PA 2FUMA 3VRZA 3QTSA 1PMNA 1M2QA 2AYPA 2BDWA 2PE1A 3O51A 5CTPA 5A4TA 1G5SA 3PG3A 3D2IA 4FZ6A 4L6QA 4PRJA 4YSMA 4YJOA 4TRLA 5FQDC 4YTIA 3WYYA 5IMEA 4BGHA 5IU2A 3EN7A 5AX3A 2BRNA 4X21A 2C3IB 3RINA 3FZ1A 2IVVA 4CTBA 3GQLA 4EOQA 4DT8A 4KBKA 4XMOA 3ORLA 4OLIA 2C5OA 3NUSA 3V5JA 1J3HA 1PXMA 3ZBFA 5CENA 3PP1A 3BGPA 5CX9A 4FTUA 2SRCA 1GY3A 2X9FA 3KXXA 3QQFA 4KABA 3UZPA 2RGPA 4JL9A 4V05A 3RPOA 1W8CA 1JLUE 4RIWB 1M52A 3RZFA 4C02A 4ZY5A 2W4JA 3F3VA 5IKWA 2PZYA 4YJSA 4QEBA 3PWYA 3COKA 4FYOA 4OTGA 3NVMB 3VONA </