4GSBA

Monoclinic crystal form of the apo-erk2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
343
Chain Sequence
b'PEMVRGQVFDVGPRYTNLSYIGEGMVCSAYDNLNKVRVAIKKISPFEHQTYQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Monoclinic crystal form of the apo-ERK2
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 111
structure length 343
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gsbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gsbA01
5F1ZA 4K77A 3ZZEA 3BHTA 4ZEGA 2PVFA 4YNOA 4EZ7A 2G1TA 1JKTA 4FV7A 4EHGA 4L3JA 2C4GA 3HMMA 3P08A 3QD0A 3E92A 1QPCA 2VWXA 5EOLA 4BKZA 3C4EA 4E6CA 2CHLA 2O63A 1H24A 5IA4A 3TTIA 5IUHA 3DBQA 2OH4A 3JVRA 4FA2A 1YI4A 3VUGA 4BBMA 4DEAA 3V5PA 5KMKA 4O7WA 3PY0A 4IX5A 3DKCA 5C9CA 3ENHA 2PTKA 5I0BA 3ALOA 3KREA 4TYEA 2UW6A 1PMUA 2C3JA 3EN9A 4RC4A 1Q3DA 5C8MA 4CFMA 4BI2A 1BX6A 4AN9A 2XM9A 4IBMA 3ZU7A 3QKKA 1BMKA 1QPDA 4C33A 3KY2A 4QTAA 4AFEA 3F3TA 4JL9A 3H9FA 1R78A 2X8DA 1UKHA 1KE7A 3H10A 3R8PA 4C7TA 1LR4A 2VD5A 2XBAA 3DQWA 3MIYA 4PDSA 3VS2A 3W55A 5HX8A 4EJ7A 1SVHA 2XNMA 2VWYA 4LOPA 1JSTA 3UIBA 3G5DA 1IA9A 2HXLA 4R7IA 5AUVA 4F63A 3KN6A 2IVUA 3KK8A 3FMMA 3K2LA 2CDZA 3PRFA 3QZHA 3EFLA 4GJ2A 3VBYA 3IGOA 2QI8A 4CYJA 4YZ9A 3BE9A 4U40A 4CTBA 2J5EA 4LRMA 3G9LX 4A9TA 2G2HA 4BGHA 3HUCA 3NX8A 2J0KA 5HU9A 4GIHA 2QVSE 1YDRE 3VW8A 1OMWA 3A7JA 4FNZA 1V0BA 3CQUA 3NCZA 4IAAA 3KRXA 3BYVA 3WF5A 5IUIA 3U55A 4HZSA 2YWVA 4MNEB 1KE9A 1VYWA 3GC0A 3F6XA 3P23A 4G16A 5HBJA 1L8TA 2W17A 4YUQA 3NSZA 3D7TA 2OU7A 3TNHA 3LXNA 4ASDA 4CYIA 4EH6A 4FKLA 3BBWA 3R22A 5G6VA 4FK6A 1H8FA 4H58A 4C02A 5AA8A 4RVKA 4NFMA 5HO7A 4J52A 4QMSA 4EK3A 4GCJA 4QMTA 4BI1A 4BCIA 2O0UA 2BZJA 4UN0C 4OAVB 1GNGA 5I9WA 3WZDA 3OOMA 1WVWA 3CQWA 4DTBA 4K0YA 1Q24A 5FGKA 3GGFA 1Y6BA 4C8BA 2X4ZA 4F09A 2H96A 4S2ZA 4GUBA 1H08A 5GJGA 2ZM3A 3MA3A 5LMAA 4DH1A 5JQ8A 3HP2A 4EJNA 3PSBA 3LAUA 3U6HA 2YACA 3PE2A 5G1XA 4MTAA 5DVRA 3ORKA 4JBVA 4FKTA 5KHWA 3U9CA 2OJFE 2VNWA 3EFJA 3NUYA 3PG3A 2EUFB 2V5QA 1WBTA 3FE3A 3LJ0A 2OJ9A 2Y6MA 4HOKA 3BWJA 2QU6A 5HICA 1OPKA 4AZFA 4G31A 2P33A 4YTFA 5DR2A 3WF9A 4D2WA 3ZOSA 3AD5A 2W05A 1H07A 2F7ZE 2QOCA 2C3LA 3Q53A 2PY3A 2W1HA 3ACKA 5IUGA 1FINA 4NW6A 4CRLA 1BUHA 2R0UA 3D14A 3VUTA 1OIQA 1ZRZA 2OF4A 3OWJA 1FPUA 4UV0A 4WG4A 3ZYAA 1ND4A 3KK9A 1P5EA 4ZAUA 5AFVA 2PE2A 2A19B 4O27B 1OPLA 1Q99A 3L9NA 3R8UA 2YISA 3AC3A 4C0TA 4YLLA 2BAQA 2QG5A 3BX5A 3KMWA 4EBVA 2QNJA 3Q5IA 4NM0A 4U80A 3THBA 4IVDA 4D1XA 2YM8A 3EHAA 1PXNA 3G33A 5I3OA 4IH8A 4BKJA 3B2TA 1STCE 3HDMA 5EKOA 4PP9A 5FBOA 2J50A 3LCOA 3DAJA 4BDHA 4O7VA 5ANGA 4BHNA 3DKOA 4IAFA 3UYTA 2UW0A 3P79A 2VO3A 3MB7A 3EN4A 3FJQE 3O0GA 4M0ZA 4YLKA 3COIA 3FZ1A 4IHPA 2VTSA 2IO6A 5AP7A 3TNPC 2UW4A 2RG6A 4Y8DA 3RAWA 4CT2A 3ZRLA 5M4UA 3P1AA 3VUHA 5ACBC 4ZTHA 3LCTA 5ANIA 4O0XA 4ACDA 2IW6A 3BLHA 4PTEA 5EW8A 3ZLYA 4K8AA 3A7HA 4QYYA 5E1SA 3PVBA 4CSVA 4YO4A 3JS2A 4LGDA 2CNVA 4YU2A 3D83A 3TJDA 4M97A 4WIHA 3DU8A 4ZSAA 2JDSA 3VQUA 3DFCB 5ANKA 2O64A 3MFRA 4LV8A 1YOLA 2IZTA 3SAYA 4BFMA 3R63A 3OCGA 1P14A 3NNXA 3FI4A 3OXTA 4GH2A 2UW7A 3NNWA 4YJSA 3QZFA 1GZOA 5L8KA 4MXZA 3UO5A 1YKRA 4E4LA 1PXOA 3ELJA 3UPZA 3BV2A 4WBOA 3UG2A 4PNIA 5M55A 5HKMA 2V22A 3Q2MA 3T3VA 5KNJA 4CTCA 2PUIA 1QL6A 4X6RA 1MRVA 4Z9LA 3CCNA 3NMUF 3BQRA 4FZ6A 1E1VA 2F7XE 3EL7A 3QGYA 1U5QA 3HV3A 3ZC5A 4ENXA 4R78A 5KZ0A 2ITNA 2C47A 4KABA 3I6WA 3UO4A 4HNFA 4F7LA 4QNAA 4C4GA 4ZSGA 2VTAA 5DNRA 5H8EA 3EYGA 5AMNA 3TKHA 4YHJA 4GMYA 3UP2A 2ZDTA 5HHWA 4XG6A 4BCOA 4XP2A 4R5YA 2A2AA 2OW3A 4G2FA 2VTOA 4DEHA 3K54A 4RT7A 4I23A 4Y5HA 4ACGA 3LHJA 4FZDB 2WELA 3K5VA 5DGZA 4OR5A 2YFXA 3W1FA 3AGMA 4YC3A 4C37A 4FKIA 3CE3A 2WPAA 2WIHA 3L8VA 4IACA 4DA5A 3U4UA 3LLTA 2BFXA 2VX3A 4IZ5A 3N4VA 4X3JA 3HGKA 2F7EE 4KIOA 3DBCA 1KV2A 1WBWA 2HK5A 2J6MA 3W8QA 1CSNA 5ITAA 3UQCA 3F2NA 4F9YA 4ANQA 4G3EA 4I3ZA 4XV9A 5CEPA 4BY9E 4N70A 3UNJA 2ETRA 3QD3A 4JQEA 2C0OA 2GSFA 2ITPA 2Z7RA 2BMCA 2E9UA 2NRYA 5FM2A 3DJ5A 4OTRA 2HZNA 4OTPA 4F99A 1WBNA 3ATTA 4XNEA 2GNJA 5J1WA 4HCTA 3PJ1A 4WNMA 5DN3A 5GNKA 4EKKA 2GHLA 3TG1A 1JBPE 4KKGA 5EDQA 2J0JA 4B6LA 3AT2A 3QTUA 5HTBA 3WE4A 3KA0A 4AW5A 2J0LA 2PMOX 3NRMA 3C0IA 4LOQA 5M57A 3PPJA 4H3BA 4RWKA 3HRCA 3CPCA 4TNBA 4XEYA 5FP6A 3QC4A 2PULA 3E3PA 4R1VA 3FZPA 2G2IA 5AUZA 5JFVA 5AV2A 5A6OA 1GAGA 4NTSA 3CQEA 1RW8A 4RJ5A 4NW5A 2F9GA 4QMNA 2VX0A 3N9XA 2QOIA 3AOXA 3QQJA 4UXQA 4W4YA 4F9CA 3I1AA 3RNIA 4TL0A 4FKWA 3M2WA 4RLLA 4V0GA 3RWQA 4EUUA 1F5QA 4OTHA 1XBAA 4XOYA 4ZTLA 4BBFA 5HIBA 2BIYA 3KXNA 3OG7A 2GTMA 3QD2B 3QLGA 3W2QA 1ZMVA 3UOJA 5GINE 3FMJA 3LOKA 3NVKI 4CQGA 2JFMA 2R0IA 3ZBXA 2VTMA 5D12A 3DQXA 2E9NA 2JC6A 2CN8A 4FVQA 4R5SA 4MNFA 3P7AA 3QTQA 2QD9A 4N6ZA 5C03A 2AC3A 4L42A 3QA0A 4J1RA 5J9ZA 4FV5A 1O6KA 2PWLA 4YURA 4FV4A 5EI2A 4G34A 1Q8YA 3TUCA 5IH5A 3VVHA 4BC6A 2YCFA 4YBKA 1R0PA 4S31A 3LMIA 3R9OA 3B8QA 2I40A 2WIPA 3KKVA 4AA4A 1FMOE 1AD5A 3I60A 5M53A 2C69A 4ITIA 1M2PA 4FL2A 3DTWA 3FY0A 4OT6A 4W8EA 4LUDA 5KO1A 4DFUA 3FMNA 1KOAA 4XP3A 4I41A 3JUHA 3NUUA 3OWPA 4R7HA 4ACCA 4NEUA 5H3QA 4RMZA 1LUFA 3EQBA 4U5JA 2OXXA 5EYDA 3PA5A 2XF0A 4NM5A 3DA6A 2P0CA 2DQ7X 4NYEA 3FMEA 4U7ZA 4D5KA 5FDPA 2BRGA 2XK3A 4QP2A 5HG9A 4DCEA 5I5ZA 4WO5A 3U6JA 3LLAA 3SX9A 5D7AA 3RZFA 2XJ0A 5EI6A 3U4WA 3FXWA 1FBNA 4MYGA 2W9FB 4NZWB 4PL4A 1I44A 1YHVA 3EWHA 1YXUA 4HCVA 3FAAA 4TWOA 2J9MA 4G1WA 2CKEA 2XYNA 4AA5A 1ZYDA 3UMXA 3V8SA 3IPHA 5B0XA 3BEAA 3PE1A 4O0TA 5FG8A 4BB4A 3AT3A 2UW5A 4I4FA 3TZ8A 4UWCA 2X9FA 3KRWA 2XK6A 4CQEA 3TUBA 4YJOA 5DEYA 1Q3WA 2PMLX 4C4HA 4CLIA 4PDPA 3C4ZA 3Q96A 4ZOGA 5AR5A 3SDJA 3UYSA 3HA6A 4FEVA 5IH4A 3M11A 4F64A 5IMXA 2HXQA 3KXZA 3RVGA 1VJYA 1TQIA 3FMKA 4GVAA 3Q4TA 2XIXA 2C6KA 5AR8A 3VS3A 3S95A 4RPVA 3OBGA 4JDJA 4C4IA 5DI1A 4QQTA 3CD8A 2X8IA 4BIEA 5JH6A 3U6IA 3U54A 1HCLA 3K3JA 4IEBA 1H1PA 5CXHA 2X7GA 3V5TA 4BDIA 3UVRA 1B39A 2X2KA 3QYWA 4NIFA 3UIXA 4G17A 4DGGA 2R3GA 4BZNA 3FQEA 3ZCLA 4AT3A 2I0EA 5JFSA 5L2WA 3SG9A 1PF8A 2W1DA 2ERZE 3Q60A 5E8ZA 1UA2A 5GHVA 3FL4A 5CEKA 4FV9A 2UZVA 3HKOA 4IVCA 5HGIA 3VAPA 4ZS4A 3VS7A 5E8WA 2P2IA 4FICA 4H3PA 1JLUE 4NT4A 3PA4A 4FL1A 4E93A 4ZY6A 3FXXA 3VUIA 2P4IA 5A4CA 4G3FA 4L46A 1F0QA 4UMTA 4RC2A 5DPVA 5T3QA 3IW7A 3ORIA 4W4XA 4FT7A 3SOAA 4BIDA 5B2KA 4PMPA 2XH5A 2ZB0A 2OIDA 3FUPA 4XRJA 4D4RA 2XEZA 2CGVA 4XOZA 4QO9A 5LARA 3T3UA 4QTBA 4RQVA 2JIUA 3ZO4A 2XK7A 3CS9A 4L3LA 3KULB 5IG1A 5CQWA 4CRSA 5BUJA 4X21A 4GEOA 1PKDA 5CAPA 1OL6A 2WZJA 3FSFA 3PIZA 2HENA 1IAHA 4FGRA 4QP9A 2YAAA 3D15A 2PYWA 5L8LA 3BI6A 3H4JA 4W9WA 1JNKA 3DZOA 4FSMA 2BALA 4ORKA 1JSUA 3RM6A 4BI0A 3R83A 2H6DA 4QMZA 5J5SA 4FSWA 3NVMB 2C6EA 3TV4A 1XH8A 4FTCA 3E3BX 1IEPA 3RGFA 1WBVA 4JX3A 3IW8A 1IAJA 3NYNA 4DEEA 2Q0BA 3QF9A 5TOZA 3KMUA 3NUPA 4FZ7A 5E90A 3QCQA 4BCHA 4E5WA 4HVSA 4U9AA 3NDMA 2BDJA 3PXKA 4F1MA 4QMVA 5BVDA 3TDWA 4E20A 4JG6A 5AA9A 4H1JA 3BPRA 4RX5A 2DWBA 3HMNA 3L8SA 3WYYA 5A9UA 2OI4X 3GC7A 2F4JA 2JDRA 3P4KA 3RK7A 5JFWA 3KXXA 2FH9A 4NCTC 2Z2WA 3QGWA 2WU7A 4LYNA 5IQGA 3DAKA 4H3QA 1BLXA 1UU8A 2GQRA 1Q8TA 2BZHB 3LXPA 1GZ8A 3TKIA 3GBZA 1KUTA 1JPAA 4EWHA 4ZZMA 3C0GA 1OKZA 3QTIA 2PU8A 1OI9A 4ASEA 3EZVA 3RAIA 2YA9A 4ONAA 4CCUA 3F3VA 2BROA 3QHWA 4XG8A 4ZSJA 2G2FA 3F66A 3I5NA 4PMTA 1H0VA 3EQIA 4PMSA 4AW1A 2X6EA 4IAZA 3HAMA 3GOKA 2JDVA 5HVJA 1O6YA 4JXFA 3GU6A 2BUJA 3FLQA 4J99A 4JVGA 5EYCA 2OSCA 5JMSA 3NS9A 4A9UA 3WE8A 3FHIA 4BDFA 4GFGA 4EOJA 4GIIA 5EM6A 4NJ3A 1CDKA 2Z02A 3KF7A 2WKMA 3R04A 5M4IA 5IQDA 2OO8X 4BR3A 4QYHA 2IZUA 4AUAA 1U54A 3ZRKA 2QOHA 4IVAA 5ACKA 1ZOHA 4FTMA 4M13A 5AV3A 1RQQA 3LE6A 3VQHA 5KMNA 3EFKA 2XNPA 4CV8A 4FIIA 4EK8A 1G8SA 3P5KA 1OL5A 5L2QA 3U9NA 5M51A 3CPBA 4EH3A 5DE2A 4M69A 5EM8A 3CSVA 5FQDC 4YJQA 4V01A 3R7YA 3QALE 3IO7A 2R2PA 2RF9A 2RKUA 2C5YA 2HELA 4F6UA 1M2RA 4OBOA 5AR4A 1Z57A 3HDNA 4FSRA 5GJDA 4MXAA 3QUDA 1M52A 2YZLA 3HAVA 4O7TA 3K3IA 4IX3A 3KU2A 2A4LA 3SC1A 4M7IA 3K5UA 5DT4A 3MYGA 3R02A 1H28A 2F2CB 2GHMA 2OG8A 1H0WA 1ZYCA 3FBVA 4XV1A 4BTFA 2HCKA 4FV2A 3UZTA 2BZKB 3D2IA 4DFZE 4O22A 2X2LA 3I79A 4DH8A 3A2CA 5K4JA 4YZNA 3QX4A 5JFXA 1WVYA 1HOWA 3UODA 4JI9A 3UJGA 1OBGA 4O96A 4AZSA 4QMOA 1MRYA 3I7CA 5D7VA 5D11A 2YN8A 4WBBB 4RX7A 4C3PA 1TKIA 1KE5A 4MKCA 3CBLA 3ZM9A 5J79A 4DC2A 3MH3A 3F61A 4O0SA 5HI2A 4EYMA 5CVGA 5FRIA 4Y5QA 3PXQA 4QYGA 3CLYA 1H1WA 2XUUA 3G2FA 4H1MA 4XLVA 4ASZA 2PSQA 3R6XA 4X3FC 3ZDUA 3D94A 2WHBA 5FTQA 5BPYA 2R3HA 1J1CA 5EW9A 3R2BA 5GIOE 4ITJA 2RFSA 1NW1A 4O21A 3KB7A 1JWHA 2Y4IB 3C1XA 4AZVA 2ITOA 3MB6A 5JEBA 1FGIA 3RP9A 2CGXA 4FIEA 4AGDA 3QXOA 4Y46A 2IN6A 4F1TA 4FOCA 4RJ8A 4ACMA 4FSQA 4ZZNA 4FV8A 5KBRA 4F7SA 3FV8A 5EQPA 3WI6A 4EH8A 1XH9A 4RVLA 3QU0A 3DK7A 2P3GX 4LFIA 5HORA 3DBDA 4MWHA 5CTPA 1OITA 3MDYA 4IWPA 5IEXA 2C3IB 1J91A 2OJJA 3F3WA 4J71A 4HYIA 4EL9A 3BE2A 4YTCA 2BCJA 2YJSA 2OK1A 2QONA 4LMNA 1RJBA 3PG1A 4QMXA 3FXZA 4D58A 1V0OA 3CIKA 3F69A 4FV0A 5LOHA 1JOWB 2IZSA 3NZ0A 3R1NA 4FTQA 1UWJA 2VZ6A 3PZHA 2ZMCA 2QODA 2PUUA 3OT8A 3FMHA 5TR6A 4EH9A 4YNEA 3II5A 3Q9XA 4M8TA 3QL8A 5HOAA 4G6LA 4DT9A 4XG3A 4IXPA 3OT3A 4DBXA 2JD5A 3DOGA 3AQVA 5CT7A 2I1MA 3VC4A 3FZTA 4JBQA 4USFA 2FGIA 5J9YA 5GZ8A 2X0GA 4CMTA 4OAUC 2H34A 5C4LA 4UX9A 2CGWA 4AOJA 2ZV7A 2W1IA 2ZAZA 3QZIA 3E93A 3QC9A 4RFZA 3VN9A 4A7CA 2FYSA 3ENMA 4JRVA 2UZOA 4ZZOA 5EOBA 3NAYA 4O38A 3SRVB 3CY3A 4IAKA 4P4CA 2J4ZA 2XIZA 1Q97A 4XBRA 2DS1A 5AM6A 5CXZA 4DT8A 2X9EA 5J7BA 5JKGA 2UZEA 2CGUA 3RJCA 3WF8A 4ZIMA 1QCFA 4CZYB 2J2IB 1K9AA 2EVAA 5JQ5A 1KSWA 4FEQA 4KWPA 2OXYA 3HA8A 3D7TB 3LM5A 1KE6A 4E73A 4NM3A 4B7TA 3PP1A 4BRXA 1PKGA 4JR3A 1NXKA 3C5UA 4UMRA 3LCKA 2GFCA 2C6LA 4FTLA 2V62A 3PJ8A 5CSHA 3ZHPC 4BZDA 4EOKA 3ERKA 4G3GA 1ZY4A 3LFSA 3KRRA 1Q62A 2XA4A 4HJOA 4Y72A 4KINA 4FKSA 3W2CA 3QKMA 3W32A 1ZOGA 4RVTA 4IAIA 3IQ7A 3RHXA 4FSUA 4RJ7A 2XKDA 3Q32A 2B9FA 3QCYA 3IDCA 4I5MA 2WMVA 3WZUA 1YWRA 4RSSA 3FI3A 4P5QA 3DFAA 4ZLOA 5CEOA 3PWDA 4IZYA 4MHAA 4E5BA 3O8TA 1J7LA 3SG8A 4MVFA 5IDPA 1XH7A 2QO2A 3PVWA 4JG7A 2IVTA 3VNTA 5LWMA 3GFWA 4MD7E 4QYEA 2WGJA 3NAXA 4KSQA 4DFBA 3Q04A 3TUDA 2B9IA 2QQ7A 3W2SA 5FXRA 3CR0A 1UU7A 2VTTA 1M14A 2P2HA 3GP0A 2WNTA 4V05A 4WT6A 3PWYA 3QWJA 2IZRA 3PZEA 4M15A 3GU7A 4IAYA 3ZSIA 1KE8A 3LFFA 4LM5A 3GCUA 4QMWA 5HG5A 2VWZA 4XP0A 2WB8A 3RPVA 3W10A 3SRVA 5IA2A 4U3YA 2E9OA 4M66A 4XG7A 4ALVA 2HWPA 3LQ3A 4HZRA 5AP4A 1KWPA 2XJ2A 3VW6A 3HYHA 2Y7JA 2J51A 3GU8A 2B55A 4NJDA 4EI4A 3KGAA 4KSPA 4WKQA 4TWPA 4O7NA 5CI6A 4O82A 1M7QA 3KN5A 4NM7A 1FVVA 5AP1A 2YDKA 4FV6A 4WSYA 5EH0A 3FY2A 5HG7A 3DB6A 5IA1A 4DFNA 2NPQA 2NRUA 3COKA 1R0EA 3EIDA 1NY3A 5HESA 4O91A 4Q5EA 4W4WA 4C2VA 3V5QA 4D9UA 3ZH8A 4AX8A 4O2PA 3MH0A 3V04A 1PHKA 3ZONA 4DE4A 2VWWA 4RWJA 4L43A 5C8NA 4N4SA 4DGLC 4E6AA 4U41A 4IWOA 4CCBA 2FSLX 4I5PA 4KIPA 1LPUA 3CP9A 3D4QA 3F3UA 4HYHA 1K3AA 3BEGA 3WF7A 4HW7A 3OCSA 4GKIA 4IE9A 3ROYA 5DYJA 4L44A 4NFNA 4UXLA 4OT5A 2BFYA 3CTHA 3MIAA 3COHA 3ZEPA 4BDJA 2PVHA 2VWVA 2ZV9A 4ANBA 4D2VA 1Q8WA 4ANSA 1BYGA 3Q9ZA 1Q8UA 4AT4A 2CNQA 1GY3A 3W16A 3HNGA 3AT4A 2R3PA 4I93A 2IVVA 5L2SA 4C4FA 4I0SA 5FBNC 2YIWA 3ZLWA 3OY3A 4IZ7A 3HUBA 5CU2A 3TIZA 1ZOEA 4MBIA 4AGWA 1OL1A 4DFLA 4USEA 3GQIA 1G8AA 4BDCA 5DT3A 1UKIA 4LV5A 2VTLA 1SYKA 4KKEA 4ZTMA 5KBQA 1GOLA 2XKFA 1DI8A 3E8EA 5FXSA 4YTIA 4BGQA 3IOKA 2X1NA 2HW6A 5DRDA 1WMKA 4EOQA 2V7OA 4Z7GA 3P9JA 2I7QA 3CD3A 4TYGA 5DRBA 3ANQA 4AN3A 1WZYA 1OUYA 3WF6A 1IR3A 1W98A 1OGUA 3PPZA 3RINA 2ZM4A 3KVXA 3W2RA 2BVAA 2VGPA 4TY1A 3ID6C 5FTOA 2XKEA 3NIZA 3BV3A 4AACA 2G9XA 3RALA 3Q52A 4CG9A 4WHZA 2YIYA 4GU6A 5CANA 1NVSA 3GEQA 3E8DA 3FKNA 3P7CA 2JDTA 5HO8A 2X39A 3RCJA 4EWQA 3OD6X 3QHRA 4TYHA 1P4FA 5JGBA 3EN5A 1O9UA 4XRLA 3CKXA 5HTCA 2YDJA 3IGGA 2VTIA 3MVHA 4IQ6A 1UU3A 2C1BA 5DBXA 4BCQA 3QQKA 4BDEA 4E3CA 5BVWA 3EQGA 4U45A 5LMKC 5C26A 3DJ7A 2IJMA 3L9LA 4XCUA 1YDTE 1A9UA 4Y85A 2QURA 4I0RA 4U42A 2YM3A 1PW2A 3OTVA 2UZNA 5T6KA 4C62A 4Z55A 3SA0A 4HCUA 4BDGA 3ATSA 1VZOA 2YJRA 3C4FA 4EHZA 1AQ1A 4K1BA 2RIOA 3A7FA 5ANOA 5CSPA 3DXQA 1WBOA 2XCHA 3LPBA 1PXJA 4JG8A 4Q5HA 5AAGA 2LGCA 4PTGA 2W4JA 5AIKA 3FPMA 4QP7A 4APCA 3BQCA 5IEVA 4TPTA 3S4QA 4IDTA 5JRSA 3UE4A 5BX0A 2CNUA 2FUMA 2NP8A 4BDDA 3NYOA 3MN3A 5CF8A 4M84A 1MUOA 2PL0A 2WAJA 3B2WA 5GZAA 4AQCA 3EYHA 4QMYA 2VV9A 1W7HA 3QLFA 3UOKA 3M42A 3LVPA 4QP1A 3FQHA 4F0IA 1YI6A 4GU9A 4BDKA 3LIJA 4CMUA 4D2TA 3RCDA 3WILA 3DS6A 2RG5A 5CQUA 3TTJA 3PDTA 3PRIA 4KNBA 5E91A 3RAKA 4QRCA 3BELA 4PL5A 4K6ZA 5F9EA 2YABA 4FYOA 4CEGA 5IF1A 4GT3A 5K5NA 4XYFA 3NLBA 3FWQA 4RX8A 4OGRA 1DS5A 3T8OA 4EBWA 4V0GB 1Q5KA 2FVDA 1E9HA 4FT0A 3NUSA 4N0SA 4UMQA 4XX9A 4ZJJA 3RMFA 4EORA 4EZ3A 5C8KA 5E9EA 1ZARA 3LXLA 3AGLA 4FX3A 3R0TA 4KIQA 4NSTA 2WMXA 3ZUUA 3GU4A 3OUKA 4FV1A 4WG3A 4JLCA 2HZ0A 3KEXA 3UG1A 3VF9A 3MBLA 2KTYA 2FB8A 4PX6A 3QAME 4CXAA 4DBNA 3UQFA 2QHNA 1UNHA 3E5AA 5E1EA 4O2ZA 5IQBA 3ZSHA 1FVRA 3I0QA 4F6SA 4KS8A 4QQCA 4GKHA 1WCCA 3PLSA 4I24A 4QNYA 4QT1A 3MFSA 1CMKE 4ZTNA 4JQ7A 4F6WA 1YOJA 3VHKA 4TT7A 5HCYA 2ONLC 1DI9A 3GUBA 3TV6A 5M06A 1OIYA 5HE1A 4ANLA 3VJNA 4WNKA 3G9NA 2W1FA 3JXWA 1WAKA 4GFOA 4TWCA 2I0VA 4KBAA 4ZP5A 1YQJA 2AYPA 3U87A 4MWIA 3S0OA 1WBSA 3KMMA 2FSMX 3CTQA 3Q6WA 3Q2JA 2OZOA 1W84A 3E8CA 4ZTQA 3JYAA 5A14A 4MXCA 3MY1A 4JAIA 5H2UA 2UZDA 3EOCA 1SVGA 2KULA 3MH1A 4QPAA 3H30A 3PLAE 2PUPA 2VTRA 4AFJA 4BICA 4F0FA 3R1QA 4IZAA 2NNWB 1J7IA 3DBEA 2BPMA 2XMYA 2PMNX 3CGFA 5KMIA 3AC1A 2EXCX 3VIDA 4ERWA 3AMAA 2WMWA 5ETAA 4JQ8A 4MXYA 3TCPA 4IC8A 3OP5A 1DAWA 4UYAA 5DOSA 1GIJA 3AC2A 2CCIA 3AD4A 3DTCA 3RWPA 5C4KA 4FOBA 5HLNA 1KV1A 4S33A 1ZWSA 1R1WA 4J8MA 5CEQA 3PYYA 5J9LA 4Q2AA 4GW8A 4FTAA 4LI5A 4I94A 5C01A 4HNIA 3EKNA 4OTFA 3R71A 4I6HA 2B53A 4L7SA 4EZ5A 1MP8A 3FYKX 2ETKA 4IANA 3F7WA 4FTIA 5BVNA 2FSTX 2O3PA 2XJ1A 3KRLA 4F9WA 2R9SA 4ZJVA 3BYUA 2VO0A 3BU6A 2GFSA 4AA0A 2BDWA 3OMVA 4GYIA 4C35A 5LJJA 3V51A 3O7LD 1JSVA 2R3RA 2WQNA 3VBTA 4ZTSA 4WNOA 4C36A 4RRVA 3W33A 2W1GA 2O2UA 4RJ3A 2R64A 3QTXA 3RPOA 3FQSA 2ZM1A 5EQEA 4NIFB 5GZ9A 5JZJA 2J0IA 2AC5A 3ORTA 4HPUE 3QD4A 4KBCA 4UZHA 3TWJA 4D0WA 2WFYA 4MBJA 2BZIB 3QRKA 3LM0A 2ITUA 1ATPE 2OIBA 2WQBA 4TWNA 4O0RA 5CZHA 5DA3A 4IM0A 5AJQA 3ZS5A 4P90A 4U44A 3ULZA 5DMZA 3VUKA 2BHHA 2JGZA 4TYJA 5L2IA 3C0HA 4XG9A 2QU5A 4FIFA 2ACXA 1PXKA 4NH1A 1BI7A 4D4SA 1JKSA 3T9TA 4IB5A 5AAFA 3RPSA 3FPQA 3SW7A 4C59A 2QOQA 4DGNA 5H8GA 4TYIA 3MPMA 2UZTA 3LFQA 4RJ4A 2JDOA 5D41A 4RLKA 1XH4A 4ZK5A 4MXXA 2HZIA 2Z7SA 2YM6A 5HBHA 4DF3A 3UGCA 4OTQA 3VS5A 3BBTB 5HVYA 2YIXA 1ZZ2A 4ALUA 5ETFA 4JIKA 4K11A 4FEXA 2SRCA 3R7GA 5HE2A 3EZRA 2GMXA 3W8LA 2Y0AA 4DTKA 4M67A 4BCMA 2VO6A 3BGZA 4GG7A 4RVMA 4W4VA 3R2YA 4IFCA 2W06A 5KE0A 5LXMA 2HZ4A 2VTHA 2R3LA 4RFYA 1OECA 1QPJA 5HD7A 2YWPA 5HU3A 4YMJA 4G9RA 4RBLA 5LCJA 2A1AB 4IWDA 4GT5A 2PK9A 4RX9A 2VX1A 2UZWE 3IW6A 2WTKB 4TKSA 1U59A 2RGPA 4E4NA 1YW2A 4ZSLA 4AZTA 4IIRA 1TQMA 2WMRA 4BL1A 4WOVA 3TNWA 3BHVA 3FLNC 3LFBA 2PUNA 2BRHA 4HVHA 1XJDA 3R1YA 1XKKA 5AR3A 3BHUA 1XO2B 4LRKA 4JRNA 5F94A 2Z7QA 2X8EA 3UP7A 2B9HA 4U8ZA 2XNOA 3LW0A 4DH5A 3FDNA 3MFUA 5HE3A 2E2BA 2V0DA 2BAKA 3SXSA 3MVMA 4Z7HA 4FYNA 3KF4A 1UNGA 2J5FA 2XNBA 1WBPA 4O6EA 5D1JA 5LVNA 4YZCA 1Q4LA 4QQ5A 5EDPA 4FT9A 4UB7A 3DY7A 1UNLA 4FIHA 5CAUA 4AT5A 1CKIA 5TT7A 3MESA 1O6LA 2HW7A 2OZAA 3DGKA 3LFDA 4ZSEA 3TKUA 4R3RA 2HAKA 2XRWA 2BILB 3BLQA 3VO3A 2EB2A 3DCVA 4G9CA 4FTKA 5HG8A 3DV3A 3IG7A 2BRNA 2PPQA 3KRJA 4U6RA 2GNGA 4YTHA 2WQEA 1X8BA 3NUNA 5AX3A 3GCPA 3C4CA 3UQGA 4D2RA 4AOIA 2QR7A 4JOAA 3RAHA 3VBXA 5BVKA 5BQ0A 5ETIA 4JDIA 5IA0A 2A27A 5DT0A 3GXLA 2WMQA 5HIDA 4G5JA 3IK3A 3H0YA 3N51A 3QKLA 1U54B 2VTQA 3HV7A 3NUXA 4GL9A 1XBBA 3QCSA 4AE6A 4BCPA 4FTTA 2Z8CA 1H26A 3F5UA 4LQMA 5AP0A 3CGOA 3OF0A 3OS3A 4OTIA 4MXOA 2AUHA 2DYLA 3F5XA 3M1SA 4M69B 4BHZA 4DG0E 4BDBA 4PV0A 5JGAA 3RZBA 4J95A 3ITZA 1CKPA 5IZFA 2WQMA 4ZY5A 4I1ZA 3BYSA 3FZSA 4S34A 2WMBA 2YCQA 2VWBA 4GT4A 2OIQA 4LRJA 3OROA 5LVOA 3PJ2A 3U51A 3MJ2A 3TNQB 3E87A 5FDXA 3GB2A 5CSVA 3SD0A 3R1SA 3S1HA 3ZFXA 3G6GA 5L3AA 3ODZX 3D9VA 3QTRA 3R7UA 4FSNA 3I7BA 1PYXA 3SOCA 5D9HA 4F65A 4UMPA 2W96B 4NKAA 2W1CA 4J96A 3VJOA 2C3KA 3TT0A 3FMDA 4W9XA 3ODYX 3HLLA 3FC2A 2J7TA 3OCTA 4LOOA 3SXRA 4QQJA 3DT1A 3C51A 3PXZA 4PL3A 4FT3A 3PIYA 1PMNA 2XK8A 3VF8A 2QOLA 3VBQA 3VUMA 3I0OA 4JIAA 3IKAA 1Z5MA 2CJMA 3OOGA 4HPTE 2R4BA 2VTPA 3FC1X 5A3XA 4IB3A 4D28A 4RIXB 5HQ0A 3TI1A 3OZ6A 2PZIA 1J7UA 4CNHA 1R3CA 3OEZA 4EQMA 5CF6A 5M4CA 3O51A 4GG5A 4FZAB 5AX9A 1VYZA 3ZO3A 1S9JA 4FG7A 4X7QA 4YZBA 4ZMFA 4EUTA 4P5ZA 4EK6A 1OIUA 3V8TA 3PVUA 2XKCA 4XS2A 5I3RA 2NO3A 2Y9QA 4AS0A 3O8PA 4DEIA 5FUTA 2VTNA 4O83A 5BVOA 3QQLA 5HO6A 1LP4A 4LMUA 4PPBA 3UZPA 4CKIA 5A54A 4FBXA 2OBJA 4FG9A 3UDBA 5CAQA 3N4TA 5L8JA 3HMOA 5AM7A 4RA5A 5CU3A 2XEYA 1WVXA 3EKKA 5E8XA 2XIYA 4S30A 5HBEA 1CTPE 3AXWA 4CFVA 3L8XA 3KXMA 3QFVA 4H36A 4OTGA 5FWKK 3MWUA 3O2MA 4ZLYA 3G90X 3NGAA 1ERKA 2PMIA 4O7RA 1PXLA 5E7RA 4BBEA 4CT1A 4L7FA 3LFNA 3CC6A 3BIZA 4F08A 1KOBA 4GK3A 4J8NA 4MF0A 1XQZA 5JK3A 4HVGA 3KCKA 3LQ5A 4BTJA 4Z16A 3Q5ZA 3VS4A 3R7IA 3QQUA 4II5A 3E8NA 5C1QB 3QQGA 3DJ6A 4FSTA 4JDKA 4CFUA 3OXIA 3DXNA 4FTUA 4IJPA 3ORPA 1YXXA 5GJFA 4L68A 4C38A 3A4PA 4C61A 5KX8A 5IQFA 4KAOA 4WSQA 4EH7A 4IM2A 4UALA 3VS0A 3S00A 4X6QC 5K0KA 3QBNA 4IADA 3IOPA 1P2AA 4JS8A 2ZV8A 3FYJX 4FC0A 5AUYA 4BGGA 5HVKA 5EYMA 1IASA 4RIXA 3C4WA 3IW4A 2B9JA 3LKMA 4DYMA 3EN7A 4AAAA 1PMEA 2HYYA 4U3ZA 3HEGA 4E6DA 5EDRA 2XNEA 5JGDA 4XV3A 1V0PA 4DN5A 4LL5A 3R8LA 1YRPA 2A0CX 3QYZA 2BDFA 4AG8A 1UV5A 2OKRA 4LL0A 4R3CA 5AIRA 3JY9A 4R1YA 4QMUA 4XH6A 5I9YA 3R28A 2UVZA 2ZOQA 3H9OA 4F9BA 5HNBA 2E9VA 3C9WA 5IA3A 2ITQA 2GPHA 4HVIA 2WTWA 4RFMA 5E8UA 4L00A 4F1OA 4YZMA 3PY1A 5LMBA 3ZLSA 3NNUA 1FMKA 3NW5A 3PJ3A 3ORMA 4YLJA 3VWAA 3MTFA 5IKWA 2R7BA 4A06A 5AUXA 3V3VA 3CKWA 4JR7A 4XLIA 3UVPA 3AC8A 4JX7A 2XIRA 5BVFA 4MQ2A 4AWIA 2REIA 3MVLA 4Z3VA 1PMVA 2ITTA 2V7AA 4FUXA 5ANJA 4A4XA 4RIWA 3QRUA 1CKJA 1DAYA 3REPA 4MF1A 5KUPA 3SVVA 3BGQA 2QOOA 4CZTA 4EYJA 3VS6A 1UU9A 2WTDA 4IWQA 3IDPA 3OHTA 3ZM4A 2Q83A 4UWYA 2GNIA 3BGPA 4KRCA 5HZNA 2HWOA 4YO6A 3GC9A 2JBOA 5KHXA 3C7QA 4FTNA 2R3JA 4EOPA 2ITYA 2WD1A 2XK9A 2BKKA 2BRBA 2CSNA 4YJTA 4QOXA 4CFXA 2ETMA 4WRSA 2CKPA 4DAWA 2UZLA 4B99A 1ZY5A 1PRYA 1R39A 4YJUA 1IRKA 3BU3A 1NA7A 4JBOA 2R3IA 3BHHA 2R3NA 1T46A 3G0EA 3POOA 1B38A 4IMYA 4XJ0A 3QQHA 5CVHA 1Y6AA 1NVRA 3AD6A 4ZS0A 4AZEA 5IQEA 3CY2A 2JIVA 3IONA 4FT5A 4KIKB 3ORXA 2F57A 3HL7A 4L3PA 4QTDA 1OVEA 4OW8A 2VTJA 2W99B 2PZYA 4E4XA 2GQGA 3P0MA 4JNWA 4BWPA 1OKVA 4I5CA 5BVEA 2BAJA 5KMLA 1V1KA 4FNXA 3GFEA 1ZYLA 4WRGA 4TRLA 3MV5A 3O71A 2CCHA 2PZ5A 3LZBA 4QMLA 3DLSA 4AN2A 2IPXA 4MBLA 4FKVA 5IU2A 2ZVAA 2HY0A 2ZMDA 4IW0A 4AXAA 4IFGA 1FQ1B 4ASXA 1NVQA 4E1ZA 4D1SA 3R7OA 3VULA 3KFAA 1YVJA 3OFMA 4GFMA 4DINA 1OM1A 2FSOX 4TZRA 1SM2A 3FI2A 3ZXZA 5M09A 4Y73A 4K2RA 2UW3A 2B7AA 2X81A 5HEZA 1JQHA 4ANNA 3AC4A 3Q4CA 3C4XA 5DR6A 3OVVA 3BYMA 3ZMMA 2QG7A 4H39A 1PYEA 2W7XA 3A99A 3FHRA 4X2FA 3TXOA 4FV3A 3ZUVA 4BYIA 5L6OA 4FE2A 2W5BA 4FSZA 5E92A 4D0XA 1MQBA 4E6QA 2IG7A 2WOUA 1UWHA 4L52A 2OICA 2QO7A 5E4HA 4MAOA 4CKRA 4R8QA 1H27A 4GJ3A 5H8BA 4G3DA 1W82A 2YAKA 3U8WA 3BHYA 3DKFA 2JFLA 4FEWA 1YHSA 4QYFA 4X2NA 5CF5A 3I4BA 3GU5A 4YR8A 2W1EA 4KKHA 3V5JA 3HZTA 3ZFYA 2YITA 3QWKA 4QMPA 1T45A 4MQ1A 2CN5A 5AAEA 5A6NA 5ANDA 5CAVA 2OLCA 4GVJA 3V6SA 1REJA 4FEUA 3ZUTA 4UEUA 4PNKA 4M3QA 3G15A 3Q3BA 4C34A 4KIKA 4W8DA 5EM7A 3W2PA 5BYYA 3NPCA 3GVUA 4FIJA 2IW8A 3PXFA 2JAVA 4WUAA 3RK5A 4EEVA 1ZLTA 2Y4PA 1REKA 5HCZA 2QO9A 2JKOA 2X7OA 3OW3A 3QXPA 3R8MA 4R7BA 2GCDA 1JKLA 4TYHB 1OKWA 4GK2A 2OFVA 5CT0A 5EHYA 3MPAA 4GSBA 4HYUA 4TNDA 1Z9XA 4D4VA 3AMYA 2PHKA 2I0YA 5L2TA 4EQUA 4CFWA 3MGYA 1QMZA 2JLDA 5J5TA 3R9DA 2HIWA 3ZSGA 4PP7A 4B8MA 3D5UA 2EXEA 2WTKC 2ZDUA 3MPTA 4FK3A 5L6WL 4P7EA 1G3NA 3QUPA 3WZEA 3O17A 3W18A 2C6OA 3PP0A 3QTWA 1K2PA 3ACJA 4K18A 5HLWA 1W8CA 4M0YA 3KQ7A 4E5AX 4EKLA 3H0ZA 5BUEA 5EK7A 2QKRA 4NKSA 5DH3A 1IA8A 4ENYA 5FEDA 3SW4A 3O23A 4USDA 4HGSA 3LCSA 3EQPA 2BIKB 2W4KA 3QRTA 2JAMA 4QP6A 3PFQA 4B4LA 4O1PA 3EQDA 1BI8A 4J53A 2JKMA 5JN2A 2OFUA 3I81A 4IB1A 3WZKA 3BWFA 5I9ZA 1OIRA 3EL8A 3OC1A 3PSDA 4KRDA 5EHLA 4A07A 3RBWA 4C4EA 5A4LA 1Y8YA 3E63A 4IJ9A 5ETCA 3A8WA 3EQFA 4IX6A 3E7VA 4PDOA 2WMAA 4UY9A 3ORZA 5L4QA 5FEEA 4MX9A 4BDAA 1ZYSA 3DNEA 2YM5A 4EH5A 5CEMA 4TN6A 3KCFA 2OF2A 3MI9A 1YHWA 3R30A 2E9PA 4RA4A 2LAVA 3RK9A 4F0GA 5KMMA 2ZB1A 2GNHA 5E8SA 5AP6A 5C27A 2DUVA 5DEWA 3RM7A 3ULIA 3BZ3A 4DH7A 4DLIA 2VWUA 1U46A 4M14A 5AV4A 5CSWA 5IEYA 1OL7A 5FM3A 4FKJA 4BN1A 4MNEA 2C5NA 3WIKA 2CKOA 1H00A 2YIRA 2UZBA 5EW3A 3VBWA 2Q0NA 3V5WA 3ZDIA 1XWSA 2OJIA 2XP2A 3ETAA 4QTCA 3G0FA 3R00A 3G51A 4M68A 1YOMA 4YGAA 2C6IA 3RNYA 4ID7A 4EK5A 5HX6A 4IX4A 4YHTA 4G5PA 4DFXE 5AEPA 3GCSA 3JY0A 4Q9ZA 3ZLXA 1YXSA 4M12A 4FMQA 4JT3A 3EH9A 2CLXA 2R3QA 4CLJA 3SQQA 5BYLA 3TZ7A 3DKGA 3OXZA 5B2LA 3FZOA 4FKOA 5CSXA 1S9IA 3GI3A 2H8HA 4X0MA 2YCSA 4X2KA 5IQHA 3NW7A 2YCRA 3OY1A 4FVPA 4FVRA 4D2PA 3R01A 4XHKB 1SVEA 4ALWA 4BTMA 4J97A 2WTCA 3DB8A 4N57A 4FL3A 3W2OA 3R7EA 3SGCA 3F82A 1AGWA 3R8ZA 3TACA 4ERKA 3FEGA 3JVSA 4HGEA 1U5RA 4RJ6A 4YP8A 4C4JA 5AUUA 4EHEA 3E7OA 5DG5A 3DDPA 5CS6A 4A9YA 2JBPA 3R9HA 3SLSA 2W1ZA 4J7BA 3UPXA 4YJPA 2WMUA 1PJKA 4NCTA 5AUWA 5I9UA 4C57A 3A7GA 1E1XA 3BRBA 3H3CA 2C6MA 3BKBA 4O81A 3MW1A 4FKRA 3F2AA 2YDIA 1B6CB 3VS1A 3RI1A 2R5TA 3LFEA 3DK3A 3PPKA 4RC3A 3DBFA 3FLZA 3P78A 3QZGA 3GENA 4DGOA 5B2MA 5IQCA 1PXMA 1YWVA 4AW2A 4EOLA 3TV7A 4LUEA 4KUJA 3ZBFA 5KMJA 5I9VA 5IH6A 5TKDA 3TDVA 3GT8A 3MVJA 3SKCA 4O7YA 5KKRB 4D2SA 4DFYA 5AWMA 2F2UA 3AC5A 1VEBA 3POZA 5HLPA 5LQFA 4U81A 4ZJIA 1TVOA 4RIOA 4X3FB 1I09A 1YWNA 3RKBA 2UW8A 3UNKA 2YERA 4GYGA 3EB0A 3Q9YA 1OPJA 4I20A 4O0YA 4ZXTA 4C3RA 3RHKA 4PDYA 4DITA 1FVTA 4FKGA 4E26A 3GC8A 2PVKA 3OWKA 4AGCA 4F9AA 5I9XA 2VN9A 4ANMA 3LJ1A 4YC6A 5LVPA 2OJGA 4EOMA 2PVJA 3UO6A 3WBLA 3NW6A 4FKUA 4GRBA 4H05A 3DDQA 2IW9A 5LCKA 2BTRA 3IDBA 3D0EA 4UMUA 4BCNA 2JKKA 1WFCA 4OLIA 2BHEA 4I0TA 4FNYA 2QCSA 3UOHA 5K5XA 3FL5A 4ZY4A 4IC7A 4BVUA 2QC6A 5I4NA 2WOTA 4I92A 3MY0A 5T68A 1H1QA 2O65A 2O8YA 4FSYA 4YHFA 4FGBA 4XG2A 4BKYA 2ITZA 1SMHA 5L6PA 4ZTRA 2WEIA 2W4OA 2R7IA 4IVBA 4LGGA 3F7ZA 4PTCA 4CGAA 5CNOA 1LEWA 3QTZA 4K9YA 2Z7LA 4BTKA 1GZNA 4P2KA 2XNNA 5EI8A 3FKLA 3TEIA 2GNFA 5K3YA 4EOOA 2I0HA 5IMEA 4I6FA 1H1SA 3QA8A 4F4PA 2CLQA 3GCQA 1Y8GA 1W83A 3TNIA 2UW9A 2Y4IC 4U0IA 1ZAOA 5A46A 2BR1A 4FR4A 4O0WA 2WO6A 3LQ8A 2G15A 5DIAA 4U97A 3IS5A 2VRXA 5HCXA 3C13A 5DR9A 1JAMA 2CPKE 2X2MA 4X3FA 3I6UA 4OBPA 5IA5A 3ROCA 1HCKA 2UVXA 4EOIA 2UVYA 2ZV2A 3A7IA 4BZOA 4D9TA 5CY3A 5A4EA 3S2PA 3UVQA 4FF8A 3F9NA 4EQCA 2G01A 5F95A 2XNGA 3A4OX 3AG9A 1OZ1A 1MQ4A 3A8XA 3NCGA 3HV6A 4FTRA 2JIIA 2XBJA 4L8MA 4CFFA 3A61A 3H9RA 2VAGA 3CEKA 4EC8A 2BRMA 4NWMA 2C30A 5FP5A 4YZDA 5HNIX 1NT2A 5JZNA 3TZMA 5J1VA 3ZC6A 5J7HA 3ZRMA 2VGOA 4MK0A 5CX9A 2PVRA 3PTGA 3BU5A 4O7ZA 4K33A 5IQIA 3HRFA 1G5SA 5TO8A 2PE0A 5ANEA 3OTUA 3OBJA 3D5XA 4I6BA 4FODA 3WIGA 2WEVA 3R21A 4AGUA 4YSMA 3KXHA 4AOTA 5AADA 3MH2A 4RZVA 2PVNA 4Q9SA 3GOPA 4OBQA 3PA3A 5E8YA 3VRZA 3UC3A 1ZXEA 3F5PA 2WTVA 3UIUA 4JDHA 4A4LA 3O50A 4KB8A 4DG2E 2QLUA 2B0QA 3MS9A 3DK6A 4RWIA 2Z60A 4U43A 1BL6A 5FEQA 3BYOA 4CMOA 4DGMA 3D7ZA 2ITWA 4ITHA 3ZO2A 2OZAB 4F7NA 4TXCA 2UV2A 1JVPP 3L8PA 4AZWA 3Q6UA 4OTDA 4S32A 2GHGA 5CEIA 2JITA 4B0GA 5IPJA 4KBKA 5B7VA 2OXDA 3E88A 4QMQA 4DEDA 4PUZA 3EN6A 3F3ZA 1J1BA 5DFPA 5FD2A 1DM2A 3S3IA 4DH3A 2QOFA 2XIKA 1SZMA 4PPAA 5HIEA 1H1RA 2YEXA 2WTJA 3RPYA 2W0JA 2OH0E 3HECA 3JR1A 1OL2A 3FZRA 3MSSA 3ZXTA 2XVDA 1ZMUA 2B1PA 3DLZA 4BF2A 2B4SB 1OUKA 1APME 3SXFA 4B9DA 4DEGA 4KD1A 2QR8A 3D5WA 1PY5A 4G3CA 2YIQA 4YJVA 2WTIA 4ARKA 5CNNA 4EC9A 2RSVA 3TJCA 2EU9A 4ZLZA 1H01A 4FKQA 1P4OA 3ORLA 3P7BA 4QP4A 4BWXA 5M07A 4D5HA 2EXMA 2GS2A 4BCFA 5M56A 4HGTA 4AF3A 4BCGA 4CG8A 2Y8OA 2WMSA 4I5HA 4L9IA 3ZEWA 4D4YA 5LWNA 3LFCA 5BMMA 3CXWA 4B8LA 4QP3A 1A48A 5HE0A 3O7LB 1J3HA 4I4EA 5EFQA 5TE0A 3T9IA 4YC8A 3TL8A 2C5XA 4NUSA 3HVCA 4N6YA 4O7SA 2XCKA 4BCJA 3F2RA 4A9RA 4AE9A 5EM5A 4KA3A 5CWZA 2EWAA 3DNDA 4MD8E 4FTJA 2IWIA 3FMLA 3O96A 4EH2A 3HMIA 3WARA 2QLQA 5CI7A 5KCVA 5HD4A 3E62A 4XV2A 5K4IA 1RE8A 2ZYBA 3LXKA 3UZRA 3F5GA 1Y91A 3A60A 2OWBA 3NYXA 3V01A 3ORNA 2F49A 3PY3A 3F88A 4YJRA 4ANOA 5H9BA 4EONA 5J87A 4QTEA 1VR2A 3GNIB 2IVSA 5BYZA 2XS0A 4YJNA 3TZ9A 3ZZWA 3SV0A 4O84A 1Q41A 2B54A 2V55A 5CASA 2C0TA 2YLFA 2GTNA 4D1ZA 5EG3A 2XM8A 5AR7A 3CJGA 3OUNB 3VBVA 5TF9A 5EQYA 3FKOA 3PIXA 4A4OA 3NNVA 4YPDA 3O8UA 3V8WA 3OWLA 2YZAA 4LGHA 5KMOA 3JPVA 1XR1A 2PVMA 4GV1A 3R9NA 3EJ1A 1GIIA 1IG1A 4PF4A 5CALA 1RDQE 3NWWA 3QX2A 5HNGA 3ALNA 3RPRA 3DXPA 3R8VA 5F4NA 4EK4A 3SHEA 5M44A 3VHEA 4HGLA 4WA9A 4JJRA 4CFNA 4TTHB 4F7JA 4FIGA 2J90A 5CU0A 1M7NA 2O5KA 4PY1A 5BUIA 4FZFB 2YLEA 3A62A 4C3FA 4BIBA 4NU1A 3LMGA 3OCBA 3HRBA 4RWLA 2WXVA 5JSMA 4I22A 2FA2A 5K9IA 3GQLA 1YXVA 4E8AA 4EHVA 2PVYA 4E4MA 4FNWA 4FTOA 2GS6A 4FG8A 4R3PA 2B52A 2J0MB 3FSKA 3ZFMA 2RFDA 5CENA 3G6HA 4IM3A 4HVDA 1EH4A 2PE1A 2ITXA 3UOLA 3GCVA 3LJ2A 4QMMA 2R3FA 3PUPA 1M2QA 3V5LA 2XYUA 4NTTA 3TIYA 3HV5A 2P55A 3C5IA 3QRJA 2PVLA 4MH7A 3VRYA 1TQPA 3EMGA 5A4QA 2WQOA 3R73A 5CF4A 5AP2A 2R3KA 1YDSE 3R7VA 1JKKA 2GU8A 5IDNA 2GDOA 2CMWA 4GUEA 4X2JA 2ZJWA 4QD6A 3AMBA 4J98A 4L01A 4WG5A 2VWIA 4YPSA 3PXRA 3QQFA 2RFEA 2GQSA 4TW9A 2GNLA 2Y6OA 4ZMEA 2JKQA 4I21A 5HTIA 1CM8A 4DHFA 2X7FA 4APPA 1A06A 4PMMA 4RIYB 5DHJA 4AW0A 3UIMA 4RZWA 5EYKA 2PZPA 3HX4A 4U79A 1YI3A 1SNXA 2C68A 4PQNA 4HYSA 5ICPA 3KULA 5CYIA 3D2KA 5GIPE 1LEZA 3L9MA 3V6RA 2W9ZB 2BKZA 4F70A 5JT2A 3FLSA 4NL0A 2C0IA 2UZUE 3DAEA 5M08A 4IB0A 4BWKA 1FGKA 2HOGA 4Y83A 1OKYA 4WD5A 3FLYA 5FXQA 2XZSA 3UBDA 3N4UA 4DTAA 1H25A 3NIEA 3R9RA 4XG4A 3PJCA 5LMKA 1XHAA 3EFWA 3FI8A 4GK4A 4DEBA 2YM7A 4O0UA 5DWRA 3UNZA 1QPEA 2WU6A 2ERKA 4RIWB 3ZTXA 4CV9A 4O86A 3RTPA 1ZYJA 3BCEA 3BLRA 3P86A 4G6NA 5JRQA 4LG4A 3WYXA 5A4TA 4O7LA 4RG0A 3MJ1A 1F3MC 3L9PA 4C58A 5AP5A 3CTJA 2VUWA 2ESMA 5CVFA 4AP7A 1H4LA 3QCXA 2WMTA 4UBAA 4XMOA 5E8VA 4CKJA 5IISA 4EOSA 4RGJA 3KXGA 2X6DA 5D10A 2VU3A 5CAOA 2I6LA 1Q61A 4QPSA 1XH5A 1GJOA 3PVGA 4G6OA 4QP8A 3NEWA 3WZJA 5LVMA 5KZIA 3KC3A 3D5VA 3MY5A 2EB3A 5BNJA 3LMHA 4UYNA 2YHVA 3DZQA 4R6VA 5AUTA 2JEDA 5FTGA 4DG3E 1U4DA 1W0XC 2YM4A 3MTLA 1L3RE 1GIHA 4QPMA 2FO0A 4X2GA 3OW4A 2C6TA 2CKQA 2XRUA 4L53A 4RIYA 3Q4ZA 3ANRA 1MRUA 3EQCA 4JBPA 4NK9A 1Y57A 2W5AA 4Y95A 5CU4A 3LCDA 1BKXA 5AR2A 5FLFA 4KS7A 5KKRC 3KL8A 4FKPA 1XBCA 4PWNA 1ZZLA 5EHOA 4DLJA 4EH4A 4ACHA 5IQAA 3NR9A 3CJFA 2QOBA 2W5HA 3IECA 3IW5A 3MFTA 3PXYA 4L45A 4YBJA 5J95A 4FUYA 3UC4A 3UTOA 2H9VA 3TN8A 4FI1A 4O0VA 5K0XA 5AV0A 4MD9E 3UMWA 3Q9WA 3Q4UA 4MEDA 2XK4A 2BTSA 4E7WA 4L6QA 3ET7A 3HV4A 3WOWA 2UUEA 2R3MA 2R3OA 2OGVA 3FLWA 4GS6A 4IDVA 3VUDA 1SNUA 2ITVA 2HY81 3E64A 4CD0A 4O1OA 1URCA 5F20A 5DLSA 4BYJA 3HMPA 4PPCA 5EKNA 2C5OA 2C5VA 4OUCA 4DCAA 4PRJA 5E8TA 3EQHA 3COMA 3L1SA 4A9SA 4JAJA 1BL7A 3OEFX 4RQKA 2XB7A 1FOTA 3HP5A 2VO7A 2C1AA 2QHMA 1OB3A 1PXIA 3QUEA 5CZIA 3PSCA 2C6DA 2ONLA 2RFNA 4MCVA 5AP3A 3DPKA 3KVWA 3QRIA 3LFAA 1PXPA 1XH6A 5BMSA 4XBUA 4D55A 2QOKA 5J8IA 3TM0A 3B8RA 4OTWA 4I6QA 1Q8ZA 3C50A 1M17A 5AV1A 4WUNA 3NUAA 2GS7A 3ZO1A 4AU8A 4WNPA 2VNYA 3NYVA 4CVAA 1URWA 5CLPA 5M4FA 4UWBA 1UVRA 1ZMWA 1OBDA 1YXTA 2PZRA 4O6LA 4UZDA 3EQRA 4C2WA 4V04A 4BCKA 4L67A 2X4FA 2QKWB 4R77A 4CZUA 2RL5A 3I5ZA 5LVLA 5CU6A 1GZKA 3QTSA 4YSJA 4XUFA 3MA6A
chains in the Genus database with same CATH superfamily
5F1ZA 2A98A 4K77A 3ZZEA 3BHTA 4ZEGA 2PVFA 4YNOA 4EZ7A 2G1TA 1JKTA 4FV7A 4EHGA 4L3JA 2C4GA 3HMMA 3P08A 3QD0A 3E92A 1QPCA 2VWXA 5EOLA 4BKZA 3C4EA 4E6CA 2CHLA 2O63A 1H24A 5IA4A 3TTIA 5IUHA 3DBQA 2OH4A 3JVRA 4FA2A 1YI4A 3VUGA 4BBMA 4DEAA 3V5PA 5KMKA 4O7WA 3PY0A 4IX5A 3DKCA 2X0QA 3ENHA 2PTKA 5C9CA 3ALOA 5I0BA 3KREA 4TYEA 2UW6A 1PMUA 2C3JA 3EN9A 4RC4A 1Q3DA 5C8MA 4CFMA 4BI2A 1BX6A 4AN9A 2XM9A 4IBMA 3ZU7A 3QKKA 1BMKA 1QPDA 4C33A 3KY2A 4QTAA 4AFEA 3F3TA 4JL9A 3H9FA 1R78A 2X8DA 1UKHA 1KE7A 3H10A 3R8PA 4C7TA 1LR4A 2VD5A 2XBAA 3DQWA 3MIYA 4PDSA 3VS2A 3W55A 5HX8A 4EJ7A 1SVHA 2XNMA 2VWYA 4LOPA 1JSTA 3UIBA 3G5DA 1IA9A 2HXLA 4R7IA 5AUVA 4F63A 3KN6A 2IVUA 3KK8A 3FMMA 3K2LA 2CDZA 3PRFA 3QZHA 3EFLA 4GJ2A 3VBYA 3IGOA 2QI8A 4CYJA 4YZ9A 3BE9A 4U40A 4CTBA 2J5EA 4LRMA 3G9LX 4A9TA 2G2HA 4BGHA 3BL9A 3HUCA 3NX8A 2J0KA 5HU9A 4GIHA 2QVSE 1YDRE 3VW8A 1OMWA 3A7JA 4FNZA 1V0BA 3CQUA 3NCZA 4IAAA 3KRXA 3BYVA 3WF5A 5IUIA 3U55A 4HZSA 2YWVA 4MNEB 1KE9A 1VYWA 3GC0A 3F6XA 3P23A 4G16A 5HBJA 1L8TA 2W17A 4YUQA 3AKJA 3NSZA 3D7TA 2OU7A 3TNHA 3LXNA 4ASDA 4CYIA 4EH6A 4FKLA 3BBWA 3R22A 5G6VA 4FK6A 1H8FA 4H58A 4C02A 5AA8A 4RVKA 4NFMA 5HO7A 4J52A 4QMSA 4EK3A 4GCJA 4QMTA 4BI1A 4BCIA 2O0UA 2BZJA 4UN0C 4OAVB 4LDTA 1GNGA 1XMMA 5I9WA 3WZDA 3OOMA 1WVWA 3CQWA 4DTBA 4K0YA 1Q24A 5FGKA 3GGFA 1Y6BA 4C8BA 2X4ZA 4F09A 2H96A 4S2ZA 4DDGA 4GUBA 4F78A 1H08A 5GJGA 2ZM3A 3MA3A 5LMAA 4DH1A 5JQ8A 3HP2A 4EJNA 3PSBA 3LAUA 3U6HA 2YACA 3PE2A 5G1XA 4MTAA 5DVRA 3ORKA 4JBVA 4FKTA 5KHWA 3U9CA 2OJFE 2VNWA 3EFJA 3NUYA 3PG3A 2EUFB 2V5QA 1WBTA 3FE3A 3LJ0A 2OJ9A 2Y6MA 4HOKA 3BWJA 2QU6A 5HICA 1OPKA 4AZFA 4G31A 2P33A 4YTFA 5DR2A 3WF9A 4D2WA 3ZOSA 3AD5A 2W05A 1H07A 2F7ZE 2QOCA 2C3LA 3Q53A 2PY3A 2W1HA 3ACKA 5IUGA 1FINA 4NW6A 4CRLA 1BUHA 2R0UA 3D14A 3VUTA 1OIQA 1ZRZA 2OF4A 3OWJA 1FPUA 4UV0A 4WG4A 3ZYAA 1ND4A 3KK9A 1P5EA 4ZAUA 5AFVA 2PE2A 2A19B 4O27B 1OPLA 1Q99A 3L9NA 3R8UA 2YISA 3AC3A 4C0TA 4YLLA 2BAQA 2QG5A 3BX5A 3KMWA 4EBVA 2QNJA 3Q5IA 4NM0A 4U80A 3THBA 4IVDA 4D1XA 2YM8A 3EHAA 1PXNA 3G33A 5I3OA 4IH8A 4BKJA 3B2TA 1STCE 3HDMA 5EKOA 4PP9A 5FBOA 2J50A 3LCOA 3DAJA 4BDHA 4O7VA 5ANGA 1G8KA 4BHNA 3DKOA 4IAFA 3UYTA 2UW0A 3P79A 2VO3A 3MB7A 3EN4A 3FJQE 3O0GA 4M0ZA 4YLKA 3COIA 2XAOA 3FZ1A 4IHPA 2VTSA 2IO6A 5AP7A 3TNPC 2UW4A 2RG6A 4Y8DA 3RAWA 4CT2A 3ZRLA 5M4UA 3P1AA 3VUHA 5ACBC 4ZTHA 3LCTA 5ANIA 4O0XA 4ACDA 2IW6A 3BLHA 4PTEA 5EW8A 3ZLYA 4K8AA 3A7HA 4QYYA 5E1SA 3PVBA 4CSVA 4YO4A 3JS2A 4LGDA 2CNVA 4YU2A 3D83A 3TJDA 4M97A 4WIHA 3TMOA 3DU8A 4ZSAA 2JDSA 3VQUA 4DDIA 3DFCB 5ANKA 2O64A 3MFRA 4LV8A 1YOLA 2IZTA 3SAYA 4BFMA 3R63A 3OCGA 1P14A 3NNXA 3FI4A 3OXTA 4GH2A 2UW7A 3NNWA 4YJSA 3QZFA 1GZOA 5L8KA 4MXZA 3UO5A 1YKRA 4E4LA 1PXOA 3ELJA 3UPZA 3BV2A 4WBOA 3UG2A 4PNIA 5M55A 5HKMA 2V22A 3Q2MA 3T3VA 5KNJA 4CTCA 2PUIA 1QL6A 4X6RA 1MRVA 4Z9LA 3CCNA 3NMUF 3BQRA 4FZ6A 1E1VA 2F7XE 3EL7A 3QGYA 3AKKA 1U5QA 3HV3A 3ZC5A 4ENXA 3W0MA 4R78A 5KZ0A 2ITNA 2C47A 4KABA 3I6WA 3UO4A 4HNFA 4F7LA 4QNAA 4C4GA 4ZSGA 2VTAA 5DNRA 5H8EA 3EYGA 5AMNA 3TKHA 4YHJA 4BJJB 4GMYA 3UP2A 2ZDTA 5HHWA 4XG6A 4BCOA 4XP2A 4R5YA 2A2AA 2OW3A 4G2FA 2VTOA 4DEHA 3K54A 4RT7A 4I23A 4Y5HA 4ACGA 3LHJA 4FZDB 2WELA 3K5VA 5DGZA 4OR5A 2YFXA 3W1FA 3AGMA 4YC3A 4C37A 4FKIA 3CE3A 2WPAA 2WIHA 3L8VA 4IACA 4DA5A 3U4UA 3LLTA 2BFXA 2VX3A 4IZ5A 3N4VA 4X3JA 3HGKA 2F7EE 4KIOA 3DBCA 1KV2A 1WBWA 2HK5A 2J6MA 3W8QA 1CSNA 5ITAA 3UQCA 3F2NA 4F9YA 4ANQA 4G3EA 4I3ZA 4XV9A 5CEPA 4BY9E 4N70A 3UNJA 2ETRA 3QD3A 4JQEA 2C0OA 2GSFA 2ITPA 2Z7RA 2BMCA 2E9UA 2NRYA 5FM2A 3DJ5A 4OTRA 2HZNA 4OTPA 4F99A 1WBNA 3ATTA 4XNEA 2GNJA 5J1WA 3VONA 4HCTA 3PJ1A 4WNMA 5DN3A 5GNKA 4EKKA 2GHLA 3TG1A 1JBPE 4KKGA 5EDQA 2J0JA 1TZDA 4B6LA 3AT2A 3QTUA 5HTBA 3WE4A 3KA0A 4AW5A 2J0LA 2PMOX 3NRMA 3C0IA 4LOQA 5M57A 3PPJA 4H3BA 4RWKA 3HRCA 3CPCA 4TNBA 4XEYA 5FP6A 3W0QA 3QC4A 2PULA 3E3PA 4R1VA 3FZPA 2G2IA 5AUZA 5JFVA 5AV2A 5A6OA 1GAGA 4NTSA 3CQEA 1RW8A 4RJ5A 4NW5A 2F9GA 4QMNA 2VX0A 3N9XA 2QOIA 3AOXA 3QQJA 4UXQA 4W4YA 4F9CA 3I1AA 3RNIA 4TL0A 4FKWA 3M2WA 4RLLA 4V0GA 3RWQA 4EUUA 1F5QA 4OTHA 1XBAA 4XOYA 4ZTLA 4BBFA 5HIBA 2BIYA 3KXNA 3OG7A 2GTMA 3QD2B 3QLGA 3W2QA 1ZMVA 3UOJA 5GINE 3FMJA 3LOKA 3NVKI 4CQGA 2JFMA 2R0IA 3ZBXA 2VTMA 5D12A 3DQXA 2E9NA 2JC6A 2CN8A 4FVQA 4R5SA 4MNFA 3P7AA 1XMLA 3QTQA 2QD9A 4N6ZA 5C03A 2AC3A 4L42A 3QA0A 4J1RA 5J9ZA 4FV5A 1O6KA 2PWLA 4YURA 4O4DA 4FV4A 5EI2A 4G34A 1Q8YA 3TUCA 5IH5A 3VVHA 4BC6A 2YCFA 4YBKA 1R0PA 4S31A 3LMIA 3R9OA 4QEBA 3B8QA 2I40A 2WIPA 3KKVA 4AA4A 1FMOE 1AD5A 3I60A 5M53A 2C69A 4ITIA 1M2PA 4FL2A 3DTWA 3FY0A 4OT6A 4W8EA 4LUDA 5KO1A 4DFUA 3FMNA 1KOAA 4XP3A 4I41A 3JUHA 3NUUA 3OWPA 4R7HA 4ACCA 4NEUA 5H3QA 4RMZA 1LUFA 3EQBA 4U5JA 2OXXA 5EYDA 3PA5A 2XF0A 4NM5A 3DA6A 4DHIB 2P0CA 2DQ7X 4NYEA 3FMEA 4U7ZA 4D5KA 5FDPA 3O5AA 2BRGA 2XK3A 4QP2A 5HG9A 4DCEA 5I5ZA 4WO5A 3U6JA 3LLAA 3SX9A 5D7AA 3RZFA 2XJ0A 5EI6A 3U4WA 3FXWA 1FBNA 4MYGA 2W9FB 4NZWB 4PL4A 1I44A 1YHVA 3EWHA 1YXUA 4HCVA 3FAAA 4TWOA 2J9MA 4G1WA 2CKEA 2XYNA 4AA5A 1ZYDA 3UMXA 3V8SA 3IPHA 5B0XA 3BEAA 3PE1A 4O0TA 5FG8A 4BB4A 3AT3A 2UW5A 4I4FA 3TZ8A 4UWCA 2X9FA 3KRWA 3PUFC 2XK6A 4CQEA 3TUBA 4YJOA 5DEYA 1Q3WA 2PMLX 4C4HA 4CLIA 4PDPA 3C4ZA 3Q96A 4ZOGA 5AR5A 3SDJA 3UYSA 3HA6A 4FEVA 5IH4A 3M11A 4F64A 5IMXA 2HXQA 3KXZA 3RVGA 1VJYA 1TQIA 3FMKA 4GVAA 3Q4TA 2XIXA 2C6KA 5AR8A 3VS3A 3S95A 4RPVA 3OBGA 4JDJA 4C4IA 5DI1A 4QQTA 3CD8A 2X8IA 4BIEA 5JH6A 3U6IA 3U54A 1HCLA 3K3JA 4IEBA 1H1PA 5CXHA 2X7GA 3V5TA 4BDIA 3UVRA 1B39A 2X2KA 3QYWA 4NIFA 3UIXA 4G17A 4DGGA 2R3GA 4BZNA 3FQEA 3ZCLA 4AT3A 2I0EA 5JFSA 5L2WA 3SG9A 1PF8A 2W1DA 2ERZE 3Q60A 5E8ZA 1UA2A 5GHVA 3FL4A 5CEKA 4FV9A 4AXFA 2UZVA 3HKOA 4IVCA 5HGIA 3VAPA 4ZS4A 3VS7A 5E8WA 2P2IA 4FICA 4H3PA 1JLUE 4NT4A 3PA4A 4FL1A 3W0SA 4E93A 3TYKA 4ZY6A 3FXXA 3VUIA 3W0RA 2P4IA 5A4CA 4G3FA 4L46A 1F0QA 4UMTA 4RC2A 5DPVA 5T3QA 3IW7A 3ORIA 4W4XA 4FT7A 3SOAA 4BIDA 5B2KA 4PMPA 2XH5A 2ZB0A 2OIDA 3FUPA 4XRJA 4D4RA 2XEZA 2CGVA 4XOZA 4QO9A 5LARA 3T3UA 4QTBA 4RQVA 2JIUA 3ZO4A 2XK7A 3CS9A 4L3LA 3KULB 5IG1A 5CQWA 4CRSA 5BUJA 4X21A 4GEOA 1PKDA 5CAPA 1OL6A 2WZJA 3FSFA 3PIZA 2HENA 1IAHA 4FGRA 4QP9A 2YAAA 3D15A 2PYWA 5L8LA 3BI6A 3H4JA 4W9WA 1JNKA 3DZOA 4FSMA 2BALA 4ORKA 1JSUA 3RM6A 4BI0A 3R83A 2H6DA 4QMZA 5J5SA 4FSWA 3NVMB 2C6EA 3TV4A 1XH8A 4FTCA 3E3BX 1IEPA 3RGFA 1WBVA 4JX3A 3IW8A 1IAJA 3NYNA 4DEEA 2Q0BA 3QF9A 5TOZA 3KMUA 3NUPA 4FZ7A 5E90A 3QCQA 4BCHA 4E5WA 4HVSA 4U9AA 3NDMA 2BDJA 3PXKA 4F1MA 4QMVA 5BVDA 3TDWA 4E20A 4JG6A 5AA9A 4H1JA 4DHZA 3BPRA 4RX5A 2DWBA 3HMNA 3L8SA 3WYYA 5A9UA 2OI4X 3GC7A 2F4JA 2JDRA 3P4KA 3RK7A 5JFWA 3KXXA 2FH9A 4NCTC 2Z2WA 3QGWA 2WU7A 4LYNA 5IQGA 3DAKA 4H3QA 1BLXA 1UU8A 2GQRA 1Q8TA 2BZHB 3LXPA 1GZ8A 3TKIA 3GBZA 1KUTA 1JPAA 4EWHA 1W2DA 3UDZA 4ZZMA 3C0GA 1OKZA 3QTIA 2PU8A 1OI9A 4ASEA 3EZVA 3RAIA 2YA9A 4ONAA 4CCUA 3F3VA 2BROA 3QHWA 4XG8A 4ZSJA 2G2FA 3F66A 3I5NA 4PMTA 1H0VA 3EQIA 4PMSA 4AW1A 2X6EA 4IAZA 3HAMA 3GOKA 2JDVA 5HVJA 1O6YA 4JXFA 3GU6A 2BUJA 3FLQA 4J99A 4JVGA 5EYCA 2OSCA 5JMSA 3NS9A 4A9UA 3WE8A 3FHIA 4BDFA 4GFGA 4EOJA 4GIIA 5EM6A 4NJ3A 1CDKA 2Z02A 3KF7A 2WKMA 3R04A 5M4IA 5IQDA 2OO8X 4BR3A 4QYHA 2IZUA 4AUAA 1U54A 3ZRKA 2QOHA 4IVAA 5ACKA 1ZOHA 4FTMA 4M13A 5AV3A 1RQQA 3LE6A 3VQHA 5KMNA 3EFKA 2XNPA 4CV8A 4FIIA 4EK8A 1G8SA 3P5KA 1OL5A 5L2QA 3U9NA 5M51A 3CPBA 4EH3A 5DE2A 4M69A 5EM8A 3CSVA 5FQDC 4YJQA 4V01A 3R7YA 3QALE 3IO7A 2R2PA 2RF9A 2RKUA 2C5YA 2HELA 4F6UA 1M2RA 4OBOA 5AR4A 1Z57A 3HDNA 4FSRA 5GJDA 4MXAA 3QUDA 1M52A 2YZLA 3HAVA 4O7TA 3K3IA 4IX3A 3KU2A 2A4LA 3SC1A 4M7IA 3K5UA 5DT4A 3MYGA 3R02A 1H28A 2F2CB 2GHMA 2OG8A 1H0WA 1ZYCA 3FBVA 4XV1A 4BTFA 2HCKA 4FV2A 3UZTA 2BZKB 3D2IA 4DFZE 4O22A 2X2LA 3I79A 4DH8A 3A2CA 5K4JA 4YZNA 3QX4A 5JFXA 1WVYA 1HOWA 3UODA 4JI9A 3UJGA 1OBGA 4O96A 4AZSA 4QMOA 1MRYA 3I7CA 5D7VA 5D11A 2YN8A 4WBBB 4RX7A 4C3PA 1TKIA 1KE5A 4MKCA 3CBLA 3ZM9A 5J79A 4DC2A 3MH3A 3F61A 4O0SA 5HI2A 3NFFB 4EYMA 5CVGA 5FRIA 4Y5QA 3PXQA 4QYGA 3CLYA 1H1WA 2XUUA 3G2FA 4H1MA 4XLVA 4ASZA 2PSQA 3R6XA 4X3FC 3ZDUA 3D94A 2WHBA 5FTQA 5BPYA 2R3HA 1J1CA 2X0OA 3R2BA 5EW9A 4ITJA 2RFSA 5GIOE 1NW1A 4O21A 3KB7A 1JWHA 2Y4IB 3C1XA 4AZVA 2ITOA 3MB6A 5JEBA 1FGIA 3RP9A 2CGXA 4FIEA 4AGDA 3QXOA 4Y46A 2IN6A 4F1TA 4FOCA 4RJ8A 4ACMA 4FSQA 4ZZNA 4FV8A 5KBRA 4F7SA 3FV8A 5EQPA 3WI6A 4EH8A 3ML1A 1XH9A 4RVLA 3QU0A 3DK7A 2P3GX 4LFIA 5HORA 3DBDA 4MWHA 5CTPA 1OITA 3MDYA 4IWPA 5IEXA 2C3IB 1J91A 2OJJA 3F3WA 4J71A 4HYIA 4EL9A 3BE2A 4YTCA 2BCJA 2YJSA 2OK1A 2QONA 4LMNA 1RJBA 3PG1A 4QMXA 3FXZA 4D58A 1V0OA 3CIKA 3F69A 4FV0A 5LOHA 1JOWB 2IZSA 3NZ0A 3R1NA 4FTQA 1UWJA 2VZ6A 3PZHA 2ZMCA 2QODA 2PUUA 3OT8A 3FMHA 5TR6A 4EH9A 4YNEA 3II5A 3Q9XA 4M8TA 3QL8A 5HOAA 4G6LA 4DT9A 4XG3A 4IXPA 3OT3A 4DBXA 2JD5A 3DOGA 3AQVA 5CT7A 2I1MA 3VC4A 3FZTA 4JBQA 4USFA 2FGIA 5J9YA 5GZ8A 2X0GA 4CMTA 4OAUC 2H34A 5C4LA 4UX9A 2CGWA 4AOJA 2ZV7A 2W1IA 2ZAZA 3QZIA 3E93A 3QC9A 4RFZA 3VN9A 4A7CA 2FYSA 3ENMA 4JRVA 2UZOA 4O4CA 4ZZOA 5EOBA 3NAYA 4O38A 3SRVB 3CY3A 4IAKA 4P4CA 2J4ZA 2XIZA 1Q97A 4XBRA 2DS1A 5AM6A 5CXZA 4DT8A 2X9EA 5J7BA 5JKGA 2UZEA 2CGUA 3RJCA 3WF8A 4ZIMA 1QCFA 4CZYB 2J2IB 1K9AA 2EVAA 5JQ5A 1KSWA 4FEQA 4KWPA 2OXYA 3HA8A 3D7TB 3LM5A 1KE6A 4E73A 4NM3A 4B7TA 3PP1A 4BRXA 1PKGA 4JR3A 1NXKA 3C5UA 4UMRA 3LCKA 2GFCA 2C6LA 4FTLA 2V62A 3PJ8A 5CSHA 3ZHPC 4BZDA 4EOKA 3ERKA 4G3GA 1ZY4A 3LFSA 3KRRA 1Q62A 2XA4A 4HJOA 4Y72A 4KINA 4FKSA 3W2CA 3QKMA 3W32A 1ZOGA 4RVTA 4IAIA 3IQ7A 3RHXA 4FSUA 4RJ7A 2XKDA 3NFGB 3Q32A 2B9FA 3QCYA 3IDCA 4I5MA 2WMVA 3WZUA 1YWRA 4RSSA 3FI3A 4P5QA 3DFAA 4ZLOA 5CEOA 3PWDA 4IZYA 4MHAA 4E5BA 3O8TA 1J7LA 2NYAA 4MVFA 5IDPA 3SG8A 1XH7A 2QO2A 3PVWA 4JG7A 2IVTA 3VNTA 5LWMA 3GFWA 4MD7E 4QYEA 2WGJA 3P5JC 3NAXA 4KSQA 4DFBA 3Q04A 3TUDA 2B9IA 2QQ7A 3W2SA 5FXRA 3CR0A 1UU7A 2VTTA 1M14A 2P2HA 3GP0A 2WNTA 4V05A 4WT6A 3PWYA 3QWJA 2IZRA 3PZEA 4M15A 3GU7A 4IAYA 3ZSIA 1KE8A 3LFFA 4LM5A 3GCUA 4QMWA 5HG5A 2VWZA 4XP0A 2WB8A 3RPVA 3W10A 3SRVA 5IA2A 4U3YA 2E9OA 4M66A 4XG7A 4ALVA 2HWPA 3LQ3A 4HZRA 5AP4A 1KWPA 2XJ2A 3VW6A 3HYHA 2Y7JA 2J51A 3GU8A 2B55A 4NJDA 4EI4A 3KGAA 4KSPA 4WKQA 4TWPA 4O7NA 5CI6A 4O82A 1M7QA 3KN5A 4NM7A 1FVVA 5AP1A 2YDKA 4FV6A 4WSYA 5EH0A 3FY2A 2XALA 5HG7A 3DB6A 5IA1A 4DFNA 2NPQA 2NRUA 3COKA 1R0EA 3EIDA 1NY3A 5HESA 4O91A 4Q5EA 4W4WA 4C2VA 3V5QA 4D9UA 3ZH8A 4DHJA 4AX8A 4O2PA 3MH0A 3V04A 1PHKA 3ZONA 4DE4A 2VWWA 4RWJA 4L43A 5C8NA 4N4SA 4DGLC 4E6AA 4U41A 2X0PA 4IWOA 4CCBA 2FSLX 4I5PA 4KIPA 1LPUA 3CP9A 3D4QA 3F3UA 4HYHA 1K3AA 3BEGA 3WF7A 4HW7A 3OCSA 4GKIA 4IE9A 3ROYA 5DYJA 4L44A 4NFNA 4UXLA 4OT5A 2BFYA 3CTHA 3MIAA 3COHA 3ZEPA 4BDJA 2PVHA 2VWVA 2ZV9A 4ANBA 4D2VA 1Q8WA 4ANSA 1BYGA 3Q9ZA 1Q8UA 4AT4A 2CNQA 1GY3A 3W16A 3HNGA 3AT4A 2R3PA 4I93A 2IVVA 5L2SA 4C4FA 4I0SA 5FBNC 2YIWA 3ZLWA 3OY3A 4IZ7A 3HUBA 5CU2A 3TIZA 1ZOEA 4MBIA 4AGWA 1OL1A 4DFLA 4USEA 3GQIA 1G8AA 4BDCA 5DT3A 1UKIA 4LV5A 2VTLA 1SYKA 4KKEA 4ZTMA 5KBQA 1GOLA 2XKFA 1DI8A 3E8EA 2XARA 5FXSA 4YTIA 4BGQA 3IOKA 2X1NA 2HW6A 5DRDA 1WMKA 4EOQA 2V7OA 4Z7GA 3P9JA 2I7QA 3CD3A 4TYGA 5DRBA 3ANQA 4AN3A 1WZYA 1OUYA 3WF6A 1IR3A 1W98A 1OGUA 3PPZA 3RINA 2ZM4A 3KVXA 3W2RA 2BVAA 2VGPA 4TY1A 3ID6C 5FTOA 2XKEA 3NIZA 3BV3A 4AACA 2G9XA 3RALA 3Q52A 4CG9A 4WHZA 2YIYA 4GU6A 5CANA 1NVSA 3GEQA 3E8DA 3FKNA 3P7CA 2JDTA 5HO8A 2X39A 3RCJA 4EWQA 3OD6X 3QHRA 4TYHA 1P4FA 5JGBA 3EN5A 1O9UA 4XRLA 3CKXA 5HTCA 2YDJA 3IGGA 2VTIA 3MVHA 4IQ6A 1UU3A 2C1BA 5DBXA 4BCQA 3QQKA 4BDEA 4E3CA 5BVWA 3EQGA 4U45A 5LMKC 5C26A 3DJ7A 2IJMA 3L9LA 4XCUA 1YDTE 1A9UA 4Y85A 2QURA 4I0RA 4U42A 2YM3A 1PW2A 3OTVA 2UZNA 5T6KA 4C62A 4Z55A 3SA0A 4HCUA 4BDGA 3ATSA 1VZOA 2YJRA 3C4FA 4EHZA 1AQ1A 4K1BA 2RIOA 3A7FA 5ANOA 5CSPA 3DXQA 1WBOA 2XCHA 3LPBA 1PXJA 4JG8A 4Q5HA 5AAGA 2LGCA 4PTGA 2W4JA 5AIKA 3FPMA 4QP7A 4APCA 3BQCA 5IEVA 4TPTA 3S4QA 4IDTA 5JRSA 3UE4A 5BX0A 2CNUA 2FUMA 2NP8A 4BDDA 3NYOA 3MN3A 5CF8A 4M84A 1MUOA 2PL0A 2WAJA 3B2WA 3W0OA 5GZAA 4AQCA 3EYHA 4QMYA 2VV9A 1W7HA 1G8JA 3QLFA 3UOKA 3M42A 3LVPA 4QP1A 3FQHA 4F0IA 1YI6A 4GU9A 4BDKA 3LIJA 4CMUA 4D2TA 3KIOC 3RCDA 3WILA 3DS6A 2RG5A 5CQUA 3TTJA 3PDTA 3PRIA 4KNBA 5E91A 3RAKA 4QRCA 3BELA 4PL5A 4K6ZA 5F9EA 2YABA 4FYOA 4CEGA 5IF1A 4GT3A 5K5NA 4XYFA 3NLBA 3FWQA 4RX8A 4OGRA 1DS5A 3T8OA 4EBWA 4V0GB 1Q5KA 2FVDA 1E9HA 4FT0A 3NUSA 4N0SA 4UMQA 4XX9A 4ZJJA 3RMFA 4EORA 4EZ3A 5C8KA 5E9EA 1ZARA 3LXLA 3AGLA 4FX3A 3R0TA 4KIQA 4NSTA 2WMXA 3ZUUA 3GU4A 3OUKA 4FV1A 4WG3A 4JLCA 2HZ0A 3KEXA 3UG1A 3VF9A 3MBLA 2KTYA 2FB8A 4PX6A 3QAME 4CXAA 4DBNA 3UQFA 2QHNA 1UNHA 3E5AA 5E1EA 4O2ZA 5IQBA 3ZSHA 1FVRA 3I0QA 4F6SA 4KS8A 4QQCA 4GKHA 1WCCA 3PLSA 4I24A 4QNYA 4QT1A 3MFSA 1CMKE 4ZTNA 4JQ7A 4F6WA 1YOJA 3VHKA 4TT7A 5BV3A 5HCYA 2ONLC 1DI9A 3GUBA 3TV6A 5M06A 1OIYA 5HE1A 4ANLA 3VJNA 4WNKA 3G9NA 2W1FA 3JXWA 1WAKA 4GFOA 4TWCA 2I0VA 4KBAA 4ZP5A 1YQJA 2AYPA 3U87A 4MWIA 3S0OA 1WBSA 3KMMA 2FSMX 3CTQA 3Q6WA 3Q2JA 2OZOA 1W84A 3E8CA 4ZTQA 3JYAA 5A14A 4MXCA 3MY1A 4JAIA 5H2UA 2UZDA 3EOCA 1SVGA 2KULA 3MH1A 4QPAA 3H30A 3PLAE 2PUPA 1W2FA 2VTRA 4AFJA 4BICA 4F0FA 3R1QA 4IZAA 2NNWB 1J7IA 3DBEA 2BPMA 2XMYA 2PMNX 3CGFA 5KMIA 3AC1A 2EXCX 3VIDA 4ERWA 3AMAA 2WMWA 5ETAA 4JQ8A 4MXYA 3TCPA 4IC8A 3OP5A 1DAWA 4UYAA 5DOSA 1GIJA 3AC2A 3AD4A 2CCIA 3DTCA 3RWPA 5C4KA 4FOBA 5HLNA 1KV1A 4S33A 1ZWSA 1R1WA 4J8MA 5CEQA 3PYYA 5J9LA 4Q2AA 4GW8A 4FTAA 4LI5A 4I94A 5C01A 4HNIA 3EKNA 4OTFA 3R71A 4I6HA 2B53A 4L7SA 4EZ5A 1MP8A 3FYKX 2ETKA 4IANA 3F7WA 4FTIA 2IEWA 5BVNA 2FSTX 2O3PA 2XJ1A 3KRLA 4F9WA 2R9SA 4ZJVA 3BYUA 2VO0A 3BU6A 2GFSA 4AA0A 2BDWA 3OMVA 4GYIA 4C35A 5LJJA 3V51A 3O7LD 1JSVA 2R3RA 2WQNA 3VBTA 4ZTSA 4WNOA 4C36A 4RRVA 3W33A 2W1GA 2O2UA 4RJ3A 2R64A 3QTXA 3RPOA 3FQSA 2ZM1A 5EQEA 4NIFB 5GZ9A 5JZJA 2J0IA 2AC5A 3ORTA 4HPUE 3QD4A 4KBCA 4UZHA 3TWJA 4D0WA 2WFYA 4MBJA 2BZIB 3QRKA 3LM0A 2ITUA 1ATPE 2OIBA 2WQBA 4TWNA 4O0RA 5CZHA 5DA3A 4IM0A 5AJQA 3ZS5A 4P90A 4U44A 3ULZA