4O0YA

Back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
publication title Back Pocket Flexibility Provides Group II p21-Activated Kinase (PAK) Selectivity for Type I 1/2 Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o0yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o0yA01
4CCBA 5CU0A 4U8ZA 2ITQA 4OT5A 2Y0AA 2RKUA 4FSTA 4BYIA 1WBVA 4WKQA 4DT9A 4F09A 2FB8A 4DLIA 2BTSA 3LQ8A 2OF4A 3HV7A 3LXLA 4K6ZA 3VS7A 3QD2B 3U55A 4IJ9A 4WSYA 2FSMX 4DGLC 5CSVA 2XNMA 3QHWA 4IDVA 1ZMWA 4IB5A 4TW9A 3MH2A 3BBTB 4D1ZA 5HLPA 1Q62A 4EKLA 3VBVA 4NT4A 4Y46A 3VIDA 1TKIA 2VGPA 3FV8A 3UPZA 2C5OA 4HCVA 2VRXA 5EK7A 2W1HA 3QWKA 4H39A 3BHTA 3OEZA 5E4HA 2UZBA 4M68A 5FEEA 4APPA 4BGQA 4QP6A 1LUFA 2XM9A 2X4FA 4AACA 2XVDA 3OCTA 4C58A 4EWHA 4RFZA 2ERZE 4GYGA 4IHPA 3GCSA 4TWCA 4S30A 3VUKA 4BCQA 4MCVA 4U3YA 3KMWA 2JAMA 3ACJA 5HESA 4UMUA 5DR6A 5HCZA 1Z5MA 3UP7A 3GOKA 4IM0A 1U59A 4XP0A 5AV3A 4UMRA 1PXMA 3DTWA 5BNJA 4O6LA 3N4TA 4MH7A 5GZ8A 1M17A 2C6IA 4AZEA 5AAEA 4RA5A 5FTGA 5CXHA 2BIKB 3HEGA 2ONLA 5DEYA 4E4LA 2OICA 4GT4A 2GNGA 4GFOA 1VJYA 3RGFA 3CR0A 4N0SA 5DWRA 1YXUA 5FP6A 3Q32A 3CCNA 2QR8A 3DY7A 3ZONA 2G2FA 2NNWB 3IOPA 2G01A 2CGXA 3OCBA 1Q97A 2ESMA 2XA4A 2CHLA 2CMWA 2XKDA 4FV8A 3VW6A 3MDYA 4DEEA 4XLIA 3IDPA 3EWHA 4FT3A 3R1NA 4V04A 5DN3A 1KV2A 4Q5EA 4E4NA 3RAKA 4EK6A 3VRYA 4XRJA 3TV6A 3P9JA 3NNWA 2W5BA 4FVRA 4I93A 4LUDA 4X3FC 3SXFA 1PYXA 1UA2A 2XJ0A 5HO6A 3TNHA 4GK2A 3LXNA 2HY81 3AC1A 5EM6A 5ACBC 2RFNA 4L42A 4JDIA 2BTRA 3LPBA 1OPKA 4O1OA 1P2AA 5A4LA 3TDWA 3GCUA 4FSQA 2W1ZA 3R01A 1ZRZA 3L1SA 2GHMA 4JQ7A 4XBUA 4GL9A 4ZTHA 1OIQA 2R3PA 3BIZA 5HG9A 5DYJA 4G3DA 4PUZA 4BDEA 3ZZWA 3N9XA 2Y6MA 3DXPA 3FLNC 4FG8A 3TWJA 4ASEA 3W2PA 4QMTA 2XKCA 4HPUE 3ZRLA 3LMIA 2HWOA 2W4OA 4U44A 2X1NA 3FBVA 5L6PA 4U81A 1O6KA 4Z7HA 5HVKA 3FC2A 5M06A 3DLSA 4QMWA 4C4IA 4CFVA 3LAUA 3IS5A 3PSBA 4PX6A 4RIWA 1M2RA 2Y7JA 5I9WA 3FEGA 1LR4A 2CLQA 3UNJA 4O7SA 2UV2A 3E8DA 3KC3A 5AP3A 2OIBA 2XIYA 4G2FA 3ORNA 2I7QA 3A4OX 5F95A 2H6DA 3TI1A 4BF2A 2X6DA 4QTBA 1HOWA 2HZ4A 4W4XA 4CT1A 3DKGA 3ERKA 2HXQA 3GQLA 1JVPP 5BQ0A 4R3RA 3NRMA 2BIYA 2GQGA 3A2CA 3FQSA 3MTFA 2BAQA 3G0FA 3ZUVA 4MD7E 3ULZA 2YIYA 4EK4A 4ERKA 4G16A 1RJBA 4BDJA 1JKKA 3PY3A 3Q4UA 4UWYA 2QG7A 3UIMA 4FBXA 2J4ZA 5DR2A 5IQFA 4KS8A 3ZFMA 5L2QA 2W7XA 3R2BA 3HRCA 4V01A 2VTMA 2A2AA 1UNGA 2J0JA 4MTAA 2XNEA 3HA6A 4PTCA 2QI8A 1RW8A 4IANA 3QD0A 3AD4A 3QTWA 3NDMA 1ZYLA 3VJOA 3MI9A 3C13A 4OBPA 4J97A 3BEGA 2UW6A 4XOZA 4GUBA 3FXZA 5LVPA 4DG2E 4LGHA 4IVAA 5A54A 2UW0A 4QYHA 2GSFA 4YZBA 5AUWA 4D4VA 1Z57A 1OKWA 4A4XA 3PPKA 4QP4A 3DS6A 1V1KA 2JLDA 2QKRA 2W5AA 4IX3A 4QP9A 5AP1A 5FM2A 3TNWA 3OUKA 2O65A 4FC0A 3CY3A 4KSPA 4ZZNA 2JBPA 4HJOA 1Y6BA 4JRNA 2EXCX 3KXHA 3W32A 4RX5A 5LQFA 2YN8A 3D0EA 5H9BA 1RE8A 4AG8A 4ZSAA 4RWKA 4ACMA 5A46A 5JRQA 3NUAA 4FTLA 1JAMA 2VGOA 2WMWA 4GT3A 4TYGA 4Z9LA 2BRGA 3QZIA 4EH6A 2J2IB 4GW8A 2UUEA 5IPJA 2XIXA 4FYOA 1Z9XA 5M07A 4PTGA 2WAJA 1TQMA 2R3HA 4P5ZA 1CDKA 3DBEA 4L8MA 2CKOA 1R39A 3B2WA 4KNBA 4ZP5A 4D4YA 2XK3A 4ZK5A 3VO3A 3C0HA 1PYEA 5DH3A 3QYZA 3FI3A 1WVYA 2GTMA 5E8VA 2OGVA 2PYWA 3NW7A 5I3RA 4AP7A 3SGCA 3WF8A 3PIXA 3UE4A 1PXLA 4R1YA 3IDCA 3MPMA 3QA0A 4KIPA 5JKGA 4OW8A 2P2HA 4FG7A 4EOIA 4JQ8A 4DC2A 1H1QA 1Y91A 2AYPA 2JFLA 2P2IA 2RFDA 3SXSA 4CZYB 4G3GA 3E64A 4DFBA 2YABA 4F0IA 3QD3A 5DT3A 3ZO2A 2OZAB 4HOKA 5B2MA 1JKLA 4IM2A 4Y83A 5KX8A 1W82A 5KKRC 3RK5A 3SLSA 3LVPA 3RK7A 3E88A 4BCJA 3RPOA 1VYWA 2UW4A 2OZOA 5CEKA 1YOMA 2XH5A 2VZ6A 1BL7A 1H8FA 1M14A 3FYJX 5GJFA 3B2TA 5IA2A 4BGGA 2NO3A 5CF8A 1GZ8A 3BU3A 1OUKA 4YHJA 5CNNA 2QNJA 3C9WA 3R30A 5AX3A 4CFNA 1URWA 5AUVA 4FT0A 5E8UA 2LGCA 2Y8OA 3AQVA 5HICA 1SZMA 3WF9A 3QXOA 4R8QA 2WMXA 4W4WA 2IVVA 4AT4A 4USEA 5HHWA 3KCKA 5JGBA 2ZV8A 4JG6A 3MVHA 1J91A 5CZIA 4BDGA 1ZARA 3LFBA 4NUSA 3ET7A 4Y73A 2QLUA 3DK6A 1PF8A 1ZZLA 4L3PA 2XNOA 4G5PA 5KZIA 4I5PA 4A4OA 1XBCA 4IAAA 4JBPA 4B0GA 2ZB1A 4JX7A 3KRLA 2XK7A 3Q9WA 4XP2A 2UW7A 3F3WA 1L3RE 3G6GA 5F9EA 4AOJA 5M56A 2BILB 4BYJA 4EYJA 5A9UA 3ZLXA 5M09A 3LLAA 4FTCA 4DGOA 2BKKA 3OY1A 4I92A 1CMKE 2OFUA 1OM1A 4QOXA 3QUEA 3VS0A 4MBIA 3ZUUA 4JS8A 4QTAA 2DQ7X 2PVFA 4AS0A 4QTCA 4DTBA 2XIKA 1GIIA 1PJKA 1V0OA 4FSYA 4MQ1A 5EYKA 3TEIA 2VX0A 2PHKA 3HKOA 3Q5ZA 2O5KA 1S9IA 3KU2A 3NUPA 4BHNA 3O2MA 4FOBA 3WZJA 4C61A 4F1OA 4AW2A 3K54A 5HLNA 4YTHA 3BU5A 3LCKA 5ANJA 3UTOA 2QCSA 2X81A 3TZMA 4FTRA 3W55A 2Z2WA 4FTNA 3LFQA 4RJ4A 3O71A 5CWZA 5D10A 3R9NA 2C6OA 1H01A 3THBA 2IG7A 3GC7A 3OCGA 3MVLA 3MYGA 1F5QA 3Q96A 4LUEA 3FMLA 3C0IA 4BHZA 3R1YA 5CU4A 4DFXE 4EQCA 3QTZA 4WRSA 3IKAA 3F61A 3FAAA 4C0TA 4WOVA 3TNIA 4XP3A 1DI9A 4K33A 1FVVA 1UWJA 1QPDA 1CKPA 5JGDA 2QHNA 3FZTA 4O7VA 3QTUA 3ITZA 3OWKA 2O8YA 4XG3A 3COHA 2V7OA 5HU9A 2BZKB 4ITHA 2WZJA 4WUNA 4N57A 4DEAA 5I9ZA 4IDTA 5TR6A 2H8HA 3B8QA 2QLQA 4RRVA 4FG9A 3QU0A 5IH6A 3TZ9A 3HV4A 4FICA 2UZLA 2R9SA 2UZWE 4I6BA 2VAGA 4FV5A 5DGZA 4IE9A 5E8SA 3AC3A 1PXJA 3HX4A 3TNQB 2BRNA 3ETAA 4FA2A 1PXOA 2BKZA 3JVRA 3GXLA 3UMXA 1WFCA 3PJ3A 4E6QA 2X4ZA 2HWPA 3IW8A 2C3LA 2YJRA 3KB7A 1SVEA 4QMSA 3H4JA 2ZV9A 4CEGA 4D2VA 5EQEA 4FNYA 4X3FA 1YXSA 4GFMA 4M14A 3KN5A 4O7YA 5CY3A 5M08A 4XHKB 3ZLWA 2RIOA 3ZSGA 3OT3A 3QRJA 5IQGA 4MBLA 4C34A 1W98A 4UEUA 3V01A 4BDHA 4CLJA 4HYHA 5CEMA 2CN8A 4GK4A 4HNFA 4AZTA 4DBNA 3D5UA 2YHVA 2WMRA 1GZKA 2O0UA 2HY0A 2WQBA 3A7HA 3T9IA 5H8GA 3ORTA 2WMVA 4D4SA 3WI6A 5JT2A 4F7LA 2ITTA 3OC1A 5T6KA 4CFFA 2QHMA 4EH8A 3BE2A 3M1SA 5AV2A 4YR8A 2PZPA 4F1MA 1QMZA 4K1BA 3VF8A 5HNIX 3UQFA 4IWPA 4I6FA 2C68A 4EZ7A 4Z16A 3NIZA 3OY3A 4BTFA 4MNFA 4FKWA 2IVUA 4Y5QA 2OJJA 4K2RA 5FDXA 4D58A 1YVJA 4I0SA 1H26A 2R3NA 2C0OA 4I94A 3C4WA 3NW5A 4YTIA 5M4UA 1W8CA 4Z3VA 1M7NA 5H2UA 5DOSA 3LFSA 5TE0A 4IAFA 2Z7SA 4UB7A 4WBOA 4UXLA 1GIJA 3CD3A 1SVHA 2W1IA 3FZRA 2F7EE 3EQIA 4IC8A 3LHJA 4CVAA 2J5EA 3FHIA 1OL2A 4WG4A 5AIRA 4ALWA 3I7BA 4GG5A 4DEBA 5IH4A 4BKYA 3KEXA 4YMJA 3DFCB 3W18A 4ARKA 4BC6A 3LQ3A 3QLGA 4DINA 1WMKA 3NYXA 4TKSA 3UOLA 5IQCA 3NW6A 5BYYA 2JKQA 5AR7A 1OKYA 4BCKA 1GNGA 4D2WA 4IX6A 4QMZA 1YQJA 3SX9A 3VHKA 2GMXA 3ZBXA 1ZZ2A 5EW9A 3R7EA 4TYJA 1U4DA 4WG5A 4NM3A 3G0EA 1XH4A 5JZNA 1W0XC 4EH2A 3CE3A 4O0XA 4O7ZA 3RM7A 3BQCA 4IJPA 3G9LX 4F4PA 3D2KA 3QRIA 4O7TA 4ITJA 4O38A 3TN8A 5K9IA 3DXQA 5KMMA 2GU8A 4RC3A 2WMSA 3F88A 3O7LB 3DPKA 3QD4A 3BLRA 4FIGA 3P7BA 2XZSA 5K5NA 5IQEA 3SHEA 4BTJA 2VWIA 5CSWA 4BZDA 1A48A 3K5UA 4C59A 4RT7A 2GHGA 3ZFXA 4I6HA 2OBJA 3OXTA 4A4LA 2ZM3A 2BPMA 3FZ1A 4PPBA 2GNIA 3NWWA 3PY1A 3EYGA 4YZDA 4BBFA 4EHZA 5IEVA 3KA0A 3RBWA 4KINA 4ZLZA 3IDBA 4QPSA 4C4EA 3LMHA 2QODA 3NMUF 4U3ZA 4C57A 2PE0A 3O23A 5E90A 3P08A 4ACHA 3I0OA 1BMKA 2PWLA 3E93A 4TWNA 4C7TA 4N6YA 4JR3A 3HAVA 4O86A 3FZPA 4U45A 5AP7A 2JDRA 4DA5A 5E8YA 3D94A 5TF9A 3ENMA 4R5YA 1FOTA 4ZZMA 4RX8A 1OIYA 4MHAA 3MFTA 4V0GB 4XG7A 1GY3A 3E87A 4NKAA 1XWSA 3EQDA 1PMVA 1U5QA 1S9JA 1ZAOA 3NZ0A 4FEQA 4FZ6A 2X7OA 3W10A 4C4JA 2C3KA 3BYMA 2C5NA 4CG9A 4QO9A 4ZSGA 3FY0A 4AAAA 1JKSA 2PMNX 4L52A 4PMMA 5CLPA 3BV2A 1Q5KA 2F4JA 3ZSIA 1DM2A 2YM4A 2WQOA 3OHTA 3PY0A 4LI5A 2R3IA 3EHAA 4R6VA 5EFQA 4ZSEA 4C4FA 4DITA 4FSMA 5CAVA 3QHRA 1BI7A 4ZOGA 3BPRA 3R9RA 1H4LA 1OIRA 3T9TA 3F9NA 5IA4A 1PMEA 2ETKA 1WBNA 4AXAA 5AUTA 4EH3A 1LEZA 4BCOA 3V51A 4RC2A 4W4VA 4BBEA 5GZ9A 2W1DA 4FSNA 5DT0A 4DLJA 3EKNA 3TKHA 5EHLA 4TNBA 2YITA 1K9AA 3QRUA 4I23A 4IB1A 2IPXA 3A7FA 2PMIA 4CKRA 4FV2A 1A06A 1UWHA 2ITWA 4PL4A 2WQMA 2Y4IB 3ZBFA 4ACDA 3V3VA 4C62A 1IA9A 1R0PA 3HMIA 4EHEA 3U6IA 1WVXA 4M69B 3I79A 4FV4A 5C27A 3W16A 2C1BA 4BKJA 5L2SA 4F6WA 3UQCA 3G33A 3NX8A 4PDYA 3UBDA 1OBDA 5HTIA 2EU9A 5I9UA 2C6KA 3OBGA 2E2BA 5HORA 2GNHA 2OLCA 4O7RA 3R73A 1UU8A 1Q8YA 3DJ7A 1YWNA 4EOSA 3UDBA 3D14A 3EOCA 2WB8A 4YC6A 2RF9A 5LMAA 3TT0A 5DIAA 5M55A 4O83A 4KAOA 4MBJA 5FDPA 2R0UA 4M8TA 4WUAA 2WTCA 4IWQA 4KD1A 1PXKA 1M52A 5GJGA 3ORLA 5BVWA 3PE1A 4HCUA 4U0IA 2X7FA 2O64A 1WBTA 3H0ZA 3JUHA 4FL3A 2UW8A 1QL6A 1YHSA 2BAJA 2C69A 4OLIA 5BUIA 3UMWA 2C3JA 5CEQA 3DB6A 4CG8A 2UW9A 5CAOA 4EUTA 5HIEA 1DAWA 4O7WA 3I6WA 5CS6A 1PKGA 4FKGA 4MXYA 4YJPA 5AP5A 4DH8A 3IW7A 5CALA 2JIUA 4JT3A 3V5TA 4L67A 4ANQA 4ASXA 5IISA 3PIZA 3U6HA 2G2HA 2PY3A 3MW1A 3EN5A 5IUHA 1NVSA 4FTJA 2WQNA 4XG9A 1WAKA 2CDZA 3FYKX 4MNEB 2VX3A 4G3EA 4FSWA 2UVYA 3BLHA 4UY9A 4ZXTA 3R00A 4QMXA 4D55A 4GKIA 4R7HA 4QRCA 4LRMA 3TV7A 4ASDA 4S33A 2YZAA 4IC7A 5CF6A 1VEBA 2C6LA 3UP2A 4XG2A 4X21A 4H3QA 3TIYA 2BMCA 2UW5A 2HW6A 3DJ6A 3F3ZA 4TY1A 5D1JA 5DI1A 2WEIA 5TO8A 3BQRA 3CEKA 2EXMA 4I4FA 3F3UA 4RWIA 1F0QA 4KB8A 3OOMA 4J52A 4P5QA 5L8JA 5BYZA 4NTSA 2B9IA 4X2JA 3RWPA 5GJDA 5BVDA 3W2CA 3KXXA 1OL6A 3HP5A 3UG1A 4YU2A 4WA9A 4CFMA 4H05A 1FQ1B 3R1SA 5LWNA 4FTAA 1FVTA 2BRHA 3I6UA 3LOKA 4ANNA 5GINE 2GFSA 2VTPA 3TACA 2CPKE 3RP9A 3DQXA 3E8NA 1PY5A 4PTEA 3HVCA 4DGMA 5J5SA 2Y4PA 3KULB 4FKPA 4KABA 5I0BA 5LVLA 5ICPA 4R5SA 4UN0C 5IZFA 4FKJA 2IVSA 3JY0A 4GJ2A 5L8LA 2JIIA 2QOFA 3KXNA 3H30A 4FV9A 4OTWA 4S31A 3LJ1A 5IA5A 3VF9A 4UYAA 5ETAA 4GK3A 2YDJA 4QYYA 3P86A 3H9RA 4E93A 5JFWA 1GZNA 2PPQA 1R0EA 4XV2A 5HEZA 3F7ZA 3VS2A 2PUIA 3DAEA 4YJUA 4FIIA 1JSUA 3QQFA 1PHKA 1YDTE 4FNXA 2FSOX 5ETCA 4M97A 1U54A 5C1QB 2IJMA 3E3BX 3OD6X 2RG5A 5FM3A 4GSBA 4KKGA 4HGLA 3BV3A 3MJ2A 2Q0BA 4B6LA 2WOTA 4KIOA 4YLLA 5IEXA 2XMYA 2X8EA 3N51A 2JDVA 2XM8A 3K3IA 3UNKA 2R5TA 3RM6A 3D83A 4FYNA 5EOBA 3TKIA 3DFAA 3QQKA 3EFKA 5A4QA 3QCYA 1KWPA 4B4LA 5HG7A 4RLKA 4F7JA 2GPHA 3SVVA 1KOBA 2P55A 4ANOA 4JX3A 4PMPA 2G15A 4Z55A 1NT2A 3JPVA 3PSCA 3Q52A 2I0EA 4EONA 2GS6A 5F94A 4QTDA 3MVMA 3PA4A 5AA8A 1ZY4A 3V8SA 3ULIA 5BVFA 1CSNA 3MN3A 5EI8A 4LRKA 2R3GA 2WTWA 3DK7A 3R63A 5CU3A 5A3XA 2QOKA 4UZHA 4GFGA 2HCKA 3O8UA 4KBKA 4ZY4A 5LOHA 5CSXA 2HELA 4RIXB 2E9NA 3R1QA 4AN2A 2R4BA 2VTQA 2OH0E 3VBWA 1QCFA 2FGIA 3DXNA 3LCOA 3R7GA 1UVRA 4FZAB 4CXAA 1GJOA 2WTIA 4AZVA 2JGZA 1PXIA 4TWPA 3ORZA 1ZOEA 3R8UA 3TNPC 4JBQA 4JDJA 4ZJVA 5HTCA 2PVYA 4XEYA 4OTQA 1OPLA 4WG3A 5E92A 5HGIA 3WF6A 1J7UA 3DKFA 2B9HA 2QG5A 4FUXA 2CNVA 1G5SA 3EQBA 4FZDB 2IW9A 4CTCA 4C4HA 2YIQA 4YJVA 4BB4A 4BDAA 5CAPA 2B9JA 1V0PA 1I44A 4FV6A 5AR2A 3PG1A 4I20A 3TDVA 1Q99A 3BHUA 2C1AA 1Q8ZA 3CGOA 4CFXA 4UXQA 2J0KA 4KIQA 2WHBA 5KHWA 3FDNA 2BZHB 3I5NA 4C38A 4RJ7A 1TQPA 2PVJA 1PRYA 4NK9A 4YTFA 3DA6A 2C6DA 3EQCA 2O2UA 4IW0A 4DF3A 2Y6OA 5DG5A 3ZC5A 3DNEA 5IQIA 1UU9A 2BR1A 4FKLA 4PMSA 3BWJA 3DKCA 4LMUA 3NUUA 4AA4A 2X2MA 5EW3A 1OBGA 5EH0A 2PE2A 4ORKA 4AX8A 4E6DA 3CQUA 3RHXA 2E9VA 4JIAA 2H9VA 4O91A 2AC3A 4IEBA 1SNUA 4TZRA 3R8VA 4I41A 4KUJA 2VV9A 4J99A 2WO6A 4L68A 2FSLX 3HL7A 4YPSA 5CF5A 4GIIA 1OB3A 2W9ZB 4NFMA 4HVGA 4YZMA 4AGUA 5BVEA 3H10A 3C1XA 3DBCA 3HYHA 4J7BA 2WMTA 2DUVA 4ZJJA 1XBAA 2YJSA 4W8EA 4J95A 3BHVA 3OTVA 3NCGA 3QZGA 5CVFA 4LM5A 2HENA 4EH7A 3G15A 4BWKA 3CJFA 4QQJA 5EI6A 1DS5A 1YDSE 3D7TA 1O6YA 5T3QA 4BDBA 4BI0A 2ERKA 4EUUA 2HXLA 3C7QA 4RX9A 3GU4A 3Q3BA 3QWJA 4KRDA 3QQHA 2B0QA 3Q53A 3Q9ZA 3HV3A 4R7BA 2X6EA 4FK6A 3ZCLA 2BFYA 4KKEA 4X2GA 2ZB0A 1ZYSA 3D15A 1UNLA 2UVXA 3ZDIA 4C37A 3DBFA 5B7VA 3KY2A 2YLFA 4G5JA 4MQ2A 5FXSA 4BZNA 3ZRMA 3CC6A 2J9MA 3SRVB 4C3RA 1OIUA 3OROA 5K4JA 3EL7A 4BCIA 2R3QA 2VWUA 4BDCA 1RQQA 3ZU7A 2C0TA 2OIQA 3JS2A 5I3OA 4BDDA 5ITAA 3GVUA 3EN7A 1KSWA 3KRXA 4N4SA 4TPTA 2RFSA 5F4NA 5M57A 5FBOA 1IA8A 2R3LA 3PXKA 2R3FA 3L9PA 5M4IA 3UVPA 4WIHA 1P5EA 4R3PA 2YIRA 4X0MA 3ALOA 3G90X 1YXTA 3KXZA 5HCXA 3AC8A 5ANOA 4D1XA 5JH6A 4BL1A 4J8MA 1OKVA 2J0MB 3DGKA 4FK3A 3F69A 4H36A 4W9XA 4AUAA 4CZUA 3O50A 5IQDA 2KTYA 3PJ2A 3F7WA 5K3YA 2DS1A 2YCRA 4ANSA 4AW5A 1ERKA 5CQUA 3HMOA 3VUGA 4APCA 3UOJA 3WZKA 4QMVA 4D4RA 5AR3A 3P78A 4QP3A 3EFJA 4XV9A 1ZWSA 2GS7A 3QGWA 3CIKA 3U4UA 4NIFA 4YZCA 4DGNA 4XX9A 5CU6A 4G6OA 1A9UA 5EM7A 3PWDA 5A4TA 1H00A 3KCFA 3MPTA 3RMFA 5J9ZA 4YJOA 3F5PA 4PL5A 4O21A 4RLLA 1H1RA 4GCJA 2EB3A 4WNPA 3NS9A 1PW2A 5I5ZA 3V5WA 5CASA 2PMLX 3O96A 4C8BA 4EHGA 4MYGA 3ZXTA 2J6MA 4MXOA 4R7IA 2J0LA 2HOGA 3HP2A 3ZRKA 2PL0A 4HGTA 4OTHA 4E1ZA 1CKIA 4N70A 4W4YA 3VN9A 4ERWA 3C4CA 4G9RA 4K11A 1MP8A 5A4EA 3PLAE 4U79A 4CYJA 5AWMA 2XNBA 2ACXA 4RIWB 5HCYA 3KKVA 3QQUA 3SOCA 3W2RA 3MFSA 3W2SA 1IR3A 5J1VA 4AA0A 4I24A 4A9UA 1JSTA 4KKHA 3UYTA 3R02A 1NW1A 3UJGA 5DPVA 3NGAA 3Q2JA 3LCDA 4FTOA 2PU8A 2R3OA 1XHAA 4IB0A 3ROCA 4FSZA 2WTKC 3KVWA 2XBJA 3TZ7A 1BX6A 2JDTA 3KK8A 3L9MA 5HBJA 3GOPA 2A0CX 2X7GA 3E7VA 2QOOA 4FL2A 3SXRA 5AX9A 2XP2A 3UIXA 2UZNA 3DT1A 4KWPA 4NJ3A 5CVGA 5M53A 1ZYCA 3A62A 5DFPA 4AT5A 4WHZA 4YC8A 5LJJA 4FF8A 3KQ7A 4NEUA 5C8MA 1YXXA 2QD9A 1UKIA 2CGUA 4HGSA 4D2TA 4E4MA 1QPEA 4YO4A 2B54A 5KMKA 2CCIA 4K18A 3CD8A 2JKMA 3TKUA 4OGRA 2JKKA 4PL3A 4RFYA 2UW3A 3PJ1A 3S95A 4C02A 4CMUA 4F64A 5IA0A 5LMBA 3SA0A 3Q9YA 5AAFA 3HNGA 1T45A 2ITUA 4Y85A 4AT3A 2BRMA 3AMAA 4AE6A 4D9UA 1LPUA 3EFWA 4KS7A 3SG8A 4EOKA 4YBJA 1YW2A 2YCFA 3QGYA 4XLVA 4RIYA 4FV3A 3A7GA 4AE9A 2SRCA 1OL7A 2JDSA 4AA5A 5HX6A 4YGAA 1QPCA 2I0HA 3FZSA 4FV0A 4FUYA 4L45A 1WBPA 4EC8A 5A14A 5E1SA 1EH4A 3DAJA 4NKSA 4DTKA 3PPJA 3VS4A 4DAWA 4D2SA 5JK3A 4WT6A 5HIDA 5EI2A 4O0VA 5AMNA 4ACCA 5FRIA 4JJRA 3HRBA 2XEYA 3IK3A 1WCCA 3H0YA 4W8DA 2IO6A 5AP6A 3FHRA 3PA3A 4AWIA 5KHXA 3Q4TA 3AC2A 4IVCA 2XKFA 3V8WA 3DB8A 5AR5A 2YCQA 3ATSA 4FVQA 4RIOA 4A07A 3UGCA 5EQYA 5FQDC 1ZY5A 4DBXA 4MK0A 3MB7A 4MVFA 4WSQA 4UBAA 5H8EA 5DLSA 3MPAA 3N4UA 3MA3A 4IIRA 2C4GA 3RPRA 3F2RA 5DRDA 4RGJA 2R3KA 1KE5A 3PE2A 5DVRA 4M0YA 4GYIA 3H9FA 4Y95A 3R71A 2VWWA 4XS2A 3UC4A 1T46A 5AV4A 2YM3A 2Q83A 1B38A 1BLXA 3FLQA 3MFRA 3D7ZA 2BAKA 2ITVA 3EN4A 4MXAA 5E9EA 3U8WA 1AD5A 5IKWA 2XCKA 3MA6A 1QPJA 4RJ8A 4TWOA 1E9HA 4U7ZA 3VHEA 3PPZA 3FY2A 4FGBA 2J0IA 3MFUA 4FKSA 3A8WA 4GMYA 2CGVA 5HE0A 3WARA 4YHFA 2AC5A 4YZ9A 5IH5A 2VWYA 3OXZA 1HCLA 4RVTA 3S2PA 4KSQA 4K0YA 3SV0A 4FMQA 2VWXA 3ORMA 1OPJA 5I9YA 1WZYA 3D5WA 4ZY5A 3QUPA 2B53A 2WELA 3ORXA 3NIEA 5BMMA 1JLUE 5C03A 4B8MA 5TKDA 4M12A 3BRBA 3ODZX 3BU6A 4DH1A 2YM5A 2X8DA 1L8TA 2ZDUA 4FTUA 4GKHA 5GZAA 3AC4A 4QMLA 3MIAA 2VO3A 5HI2A 3S1HA 2OWBA 2WKMA 3KK9A 3R7OA 4WO5A 3VC4A 4CGAA 5LVMA 1K3AA 4P4CA 2I1MA 3PIYA 4ZS0A 3R8MA 3QXPA 2B4SB 3RHKA 3QX2A 4OBQA 3QTXA 3AD6A 2RG6A 5AP0A 3DCVA 3UO4A 3V5PA 4D5HA 4USFA 3CS9A 4FKOA 2RFEA 3ID6C 2W1EA 2B7AA 3BLQA 3K2LA 3Q4CA 3VJNA 3BGPA 5DMZA 3O0GA 4E7WA 1LEWA 2JC6A 3V5QA 3S4QA 2BHEA 3FMKA 3JVSA 3DBDA 4L01A 4RSSA 5LXMA 3QTSA 2J5FA 5K5XA 2WXVA 5ACKA 3ZLSA 4MAOA 5HD4A 4X7QA 2RGPA 3VULA 3CSVA 2PVKA 4XJ0A 3GT8A 2GS2A 4EKKA 4FSRA 2ZM4A 3ODYX 4FTMA 5AR8A 4BCPA 4OTRA 3NYNA 1YXVA 3EYHA 4RJ3A 4NU1A 4V05A 4KBAA 2XIRA 3OP5A 3HV6A 3PXFA 3PRIA 2C6TA 3EB0A 4OTIA 4DFZE 1ATPE 1XBBA 3QTQA 4FT7A 2ZVAA 1JSVA 2CLXA 3RTPA 4F99A 2XRWA 3MESA 1IRKA 4MF1A 4RBLA 5ANEA 3QX4A 1V0BA 4LFIA 4C3PA 4MWIA 2F2CB 2R64A 3IQ7A 2Z02A 2I40A 4QT1A 4O0SA 4ZMFA 2JEDA 4JG8A 5AFVA 4PNIA 1LP4A 3RPYA 5C9CA 3UZTA 3ORIA 2R0IA 3QQGA 4IWOA 4PDPA 4RVLA 4LL0A 4AW1A 3ANRA 3SKCA 4M13A 3SQQA 4YSMA 3OCSA 2VD5A 4NW5A 2BDWA 5BVNA 4F6UA 3LFEA 3EL8A 3R7IA 5CNOA 4CT2A 3KN6A 2VX1A 3Q5IA 4FKUA 2ITOA 2WU7A 4G9CA 4QPAA 3UC3A 4ENXA 4YJTA 2JKOA 3AD5A 2PUPA 3BGZA 2YIXA 2PZIA 3LCSA 4GJ3A 3LMGA 3FQEA 2UVZA 3NUYA 5H3QA 3ORPA 3HMMA 3GP0A 2OSCA 3Q4ZA 4FIFA 4JBVA 3WE8A 3EQFA 4YBKA 3PXRA 4DT8A 3HMNA 2EVAA 4BWXA 3WIGA 4X3FB 4C3FA 3UNZA 1PMUA 5LVOA 3RCJA 4IFCA 5CEIA 5BVOA 1Q8WA 2ITPA 2HIWA 5CAUA 4H3BA 3EN6A 4E5AX 3P7CA 1MUOA 4IM3A 5EOLA 3QUDA 5HNBA 4AGCA 2UZVA 5HZNA 3MS9A 2C30A 5CANA 2DWBA 1HCKA 5D41A 2YDIA 5KMOA 3ZZEA 2BALA 4DG0E 5FG8A 5JQ5A 5IEYA 3PVGA 4DFLA 5JN2A 3A61A 4QPMA 1JKTA 3Q04A 4UALA 2PVMA 4IACA 2CKQA 1SNXA 4X2NA 2P4IA 4F6SA 3NR9A 1H1PA 1Q3WA 2GNFA 3CTJA 3CQWA 3I81A 4HGEA 4D0XA 4D0WA 5J7BA 4B99A 2ZMDA 4I1ZA 4F0FA 3OWJA 2QU6A 2QO2A 3BYSA 5BMSA 4IFGA 3TJDA 2XNGA 3G5DA 4CSVA 3TM0A 5TOZA 2CCHA 2PE1A 3KREA 3ZYAA 3KMUA 5EDRA 3KMMA 4ZSJA 3R7YA 4O0UA 5AUUA 5FUTA 4RJ6A 3DJ5A 1JBPE 3VRZA 2I0VA 4S32A 1MRVA 3VBYA 3LKMA 3SG9A 2BZIB 5EM8A 5CU2A 2WFYA 4K77A 3HMPA 2W5HA 3FZOA 3NAXA 2C0IA 2RSVA 5FBNC 4QMMA 4YNEA 5EDQA 5K0XA 3PP0A 4X6RA 2WEVA 5E8XA 5GHVA 3RALA 2IVTA 3RCDA 5JQ8A 4RWJA 5EHYA 3VBXA 4JVGA 3DTCA 5IQHA 4XG6A 4ZTSA 3V04A 1H1SA 4DYMA 3POOA 2C5VA 5CAQA 4EK8A 5CEOA 3LW0A 2FVDA 2E9OA 5CI6A 4UYNA 3WIKA 2ETRA 3MGYA 4FKVA 2VTLA 5CSPA 4X2FA 3UOHA 3KFAA 1J1CA 4I3ZA 3KULA 4IZ5A 3UYSA 4Q2AA 2XS0A 3RWQA 4OAUC 2VTHA 1Y8YA 2B1PA 2P33A 3MV5A 4M84A 5AV1A 5I9VA 4B8LA 1YWVA 1G8AA 3FLYA 2C6MA 4MF0A 3ZLYA 2W06A 4CQGA 3KGAA 3UIBA 3O8TA 5L4QA 4CKIA 4F70A 3F3VA 4EJ7A 1BI8A 2OJFE 3RZFA 2XB7A 4DG3E 3EIDA 2OH4A 2J50A 2VWBA 4J53A 4OBOA 3RJCA 4ZJIA 3V5LA 4GV1A 3MSSA 4NFNA 3W1FA 2W05A 1REKA 2VTAA 3L8XA 3MY0A 3PYYA 4QP1A 4RZVA 4RVKA 3VS3A 3ENHA 3VUDA 5ETIA 3TXOA 5AP2A 3LCTA 4E5BA 4NM0A 3F5GA 1I09A 3WYXA 4TYHB 3QZFA 5FEDA 4ZLYA 4NWMA 3CGFA 4XCUA 1JNKA 5FD2A 4R77A 3PDTA 4FL1A 5IQAA 3ZEPA 4EOPA 4II5A 3UG2A 3F5UA 3GEQA 4CV9A 1KE8A 2V55A 1F3MC 3U4WA 4PY1A 4U40A 4L44A 3WBLA 1GIHA 5J87A 3ZC6A 3O8PA 4FE2A 1OMWA 2NPQA 5HVJA 3OMVA 1NVRA 3I5ZA 5ANIA 3T3UA 1TQIA 2JBOA 5E91A 5IDNA 2WGJA 4GT5A 5TT7A 3PZHA 2WTVA 5BUJA 3EQRA 4QP7A 3QBNA 4NCTC 4QNYA 2J51A 3L8VA 5IG1A 4I0TA 1FINA 3GCPA 4CRSA 3NNVA 3GQIA 3UQGA 1ZMVA 4E8AA 2V5QA 2CKPA 5IA1A 4UZDA 4I21A 2ITXA 3LFCA 1FGKA 5KKRB 5LWMA 3WZDA 3S0OA 3FMJA 3TL8A 4A06A 3QL8A 3OWLA 4BCMA 1Y8GA 3GBZA 4BKZA 3BWFA 1KUTA 2YM6A 4FT9A 3SC1A 2I0YA 3FI4A 2OXYA 4CFWA 3BYUA 1P4OA 3EH9A 4O27B 4B7TA 3EMGA 3SAYA 3P23A 4TXCA 3WOWA 5JMSA 4L53A 2YAAA 3U87A 3W2QA 1WBWA 1JWHA 4FZ7A 4R3CA 4QQ5A 3RVGA 3VQHA 4F9BA 4YSJA 3MVJA 4QD6A 3VAPA 4PPCA 5CTPA 5G6VA 1H1WA 2QU5A 2WTDA 4YPDA 4QYEA 4DN5A 4NTTA 1BYGA 4E6CA 3DU8A 4YURA 1ZXEA 3ZM9A 2F7ZE 2H34A 3FMNA 4KIKB 4OTDA 2GCDA 3NUNA 2Q0NA 1WBOA 3MTLA 3OOGA 4ZZOA 2EXEA 3LXPA 5IUIA 3WF7A 4BWPA 1BUHA 4EQMA 3AG9A 2FYSA 3CTHA 3HUCA 4ITIA 4JOAA 4J71A 4WRGA 3R9HA 4XMOA 3MY1A 4LV5A 4D9TA 5GIOE 4XG8A 2JIVA 3II5A 4RWLA 3ZXZA 2HZIA 1FMKA 3QRTA 4IVBA 4BDFA 4BFMA 4U80A 4C33A 1OUYA 4L7SA 2VO0A 2QQ7A 1XQZA 2W9FB 2XK8A 3P1AA 4QYGA 4LOOA 4LG4A 5HE2A 3QFVA 4AN3A 4LOPA 2W1CA 3E8CA 1WBSA 4RC4A 3GC9A 5HVYA 3RNYA 4EOOA 4AOTA 4YZNA 4HVDA 1UV5A 4IAKA 3H3CA 5ETFA 1J1BA 5LCJA 4BTKA 5J1WA 5J9LA 2PMOX 2VNWA 3DV3A 3FMEA 3TTJA 2QOHA 4UMTA 1OVEA 4AZFA 4EOQA 3C4EA 2XCHA 2VTSA 3HDNA 3IG7A 3A4PA 3IO7A 3LZBA 4MX9A 5EHOA 4F9AA 1OL5A 3TUDA 2EWAA 4R78A 2WIHA 1YHWA 3LFFA 3R8ZA 2GDOA 2UZOA 4CMOA 2VNYA 3I0QA 3LE6A 3FKNA 3IW6A 5FGKA 3I60A 5FLFA 2VO6A 5CEPA 2E9UA 3PP1A 3SW4A 3HA8A 2PK9A 2OI4X 3E62A 2WPAA 3UOKA 1Q3DA 3MWUA 3HDMA 1KE9A 5KMNA 1R1WA 1O6LA 3NUXA 1VR2A 1RDQE 1OI9A 4X6QC 3U6JA 1H25A 3SRVA 4RA4A 1FPUA 2XJ1A 2WMQA 3CKWA 2XK4A 1ZOHA 3CTQA 4O7LA 4TN6A 5EQPA 4I5MA 3M11A 4RPVA 3WYYA 4A7CA 3SW7A 3RINA 4C36A 3ZFYA 3WZEA 3V6RA 3MBLA 3QAME 4MXZA 3W8LA 3Q60A 3VUMA 4E6AA 2GQSA 3ZH8A 3QCXA 4AZWA 4ZAUA 2ITZA 1XR1A 5J7HA 4E26A 3ALNA 4G34A 4UWBA 4ACGA 3LLTA 4HZSA 4FVPA 3F5XA 3GENA 2A19B 1KE6A 5FTOA 3R9DA 5BVKA 5CF4A 4PRJA 3E8EA 5L3AA 4UWCA 3IPHA 4FSUA 4XG4A 4YLKA 3IW4A 4S34A 4H1JA 4DGGA 3FI8A 3GCVA 2J7TA 2OW3A 3KRRA 3NSZA 3V6SA 3PXYA 3KF4A 3NUSA 1E1XA 1KOAA 1XKKA 3TCPA 2G2IA 2XK6A 4EHVA 5HE1A 4MWHA 1ND4A 1APME 5J79A 4FODA 4DH7A 1J3HA 4OUCA 3A7JA 4L00A 1KV1A 3GU7A 2XEZA 4RMZA 3RI1A 4E5WA 5KO1A 1SM2A 4TRLA 2X2KA 1Q24A 4LQMA 3E92A 3FMMA 4OTPA 4PMTA 4Q5HA 5J9YA 3QF9A 2X9EA 3CKXA 3DDPA 2G1TA 4ALUA 4U97A 3G6HA 4ONAA 4EQUA 4O7NA 4TNDA 4U41A 2PVHA 4U5JA 4LRJA 5EDPA 1MRYA 5IU2A 5EYMA 2FO0A 4BY9E 3BZ3A 4JG7A 3VQUA 1XH7A 4E20A 4PP7A 4ZS4A 2OZAA 1BKXA 5B2KA 4HYSA 2G9XA 4YO6A 5AM6A 2JAVA 4ZTMA 5LMKC 3OF0A 4YC3A 1YOJA 2CN5A 3GFEA 3R21A 2Y9QA 4EI4A 3A7IA 4FGRA 1U54B 4RX7A 2CNUA 3REPA 5KBRA 4GEOA 4DFNA 3C51A 3AGMA 3IGOA 5E7RA 4HCTA 4BDKA 4AFJA 4FKTA 2GNLA 4JDHA 4FV1A 3LM5A 2EB2A 4IZAA 2P0CA 1OGUA 3UVRA 4E3CA 3O7LD 3VS5A 4Q9ZA 4BI2A 2ETMA 3IGGA 5E8ZA 5EG3A 2QO9A 4DCAA 3A60A 4ZIMA 3R9OA 2CSNA 1DAYA 4QMPA 4JI9A 5AR4A 3VVHA 4CV8A 2PUNA 2BHHA 3LJ0A 3F3TA 5J5TA 2X2LA 3FL4A 3CXWA 4PDSA 4O0WA 3I4BA 2Z7QA 3L9LA 2XRUA 3M42A 3FXWA 3MH1A 3BYOA 3PG3A 3PWYA 3QLFA 5DT4A 2JITA 5AUZA 2RL5A 2ZV2A 5EW8A 5C8KA 4A9TA 3PRFA 2IZSA 4UMPA 1Q61A 3C4XA 1KE7A 4GG7A 4P2KA 5DEWA 3TJCA 3TZ8A 4HVSA 4FKRA 4QMUA 1TVOA 3C4ZA 3MIYA 3RPVA 5HOAA 3RAWA 3DZQA 3B8RA 3ACKA 4OTFA 5HBEA 4PWNA 4O84A 4G3CA 4FTTA 4XNEA 3U9CA 4FTKA 1UU7A 3QALE 2Y4IC 4IADA 3S00A 2UZTA 2VN9A 1ZYJA 1NY3A 2QVSE 5FTQA 4FIEA 4KBCA 3Q6WA 3PA5A 4XBRA 4R1VA 4FIJA 3E7OA 4ALVA 2OJGA 1CTPE 3ZO3A 4NJDA 2A1AB 2XF0A 4WBBB 4NH1A 3R8LA 3BYVA 3FQHA 1PKDA 3LFDA 2YZLA 4FEVA 2C3IB 5H8BA 1SYKA 4KA3A 3D5XA 4CNHA 4FZFB 3CLYA 5K0KA 5KZ0A 1MRUA 5JFSA 2GQRA 4ZY6A 1E1VA 1H27A 2LAVA 3QQLA 4EH9A 5HBHA 5E8TA 3SDJA 4ZTQA 4CMTA 4U6RA 3CP9A 4PQNA 3R7UA 2O63A 2VTNA 4EBVA 2PULA 5A4CA 3F2AA 4BCGA 2FH9A 5C4LA 3VUHA 4EK5A 2W1GA 3PZEA 4NCTA 5DE2A 4IH8A 4LYNA 4F7SA 1YRPA 4U9AA 5EYCA 5AAGA 1NXKA 3OS3A 3VBQA 4IAIA 4I4EA 4LGDA 5M4FA 4ZTRA 1XH6A 2YIWA 4G3FA 4JQEA 2VWVA 4JR7A 4F9YA 5BYLA 3S3IA 4O82A 3VS6A 5JSMA 3AGLA 3Q6UA 2IN6A 3ZMMA 5AIKA 4EWQA 2YCSA 2IW8A 4Y5HA 3R6XA 3FLWA 3W8QA 2JDOA 4RQKA 2IW6A 3EZRA 5AJQA 3OG7A 3OW3A 1AGWA 4L3JA 2JFMA 4GU9A 3HGKA 2VWZA 3PFQA 2QOLA 4AW0A 2BCJA 2FUMA 4QMNA 3R28A 1J7IA 3F6XA 4LMNA 2P3GX 1H28A 1REJA 4CFUA 2BROA 3BEAA 3OT8A 1Y57A 3RAIA 2BZJA 4DE4A 4F08A 1YHVA 2CKEA 3NYOA 4U42A 2VTOA 1PXNA 4FEUA 4JAIA 3NVMB 4MEDA 5KBQA 3D7TB 3ZO4A 4M67A 5HO7A 2BDFA 4FI1A 5KMLA 1XJDA 3UVQA 5AADA 3VW8A 1XH5A 1GZOA 3F66A 4JAJA 3ZDUA 2OKRA 3KVXA 3TTIA 4MD8E 4RQVA 1PMNA 4HVHA 4D2RA 4QYFA 2ITYA 3C4FA 2ZAZA 3JXWA 3ZS5A 3LM0A 2GTNA 5C01A 5AV0A 2H96A 2OJIA 1IAJA 3F82A 2OF2A 2YERA 3DNDA 5IUGA 4GUEA 4OR5A 4I0RA 3FJQE 4CCUA 4FR4A 4FEWA 2QC6A 3NLBA 4PPAA 3GC0A 3COKA 2X39A 2F49A 3OBJA 5ANGA 5C4KA 3AT4A 4QP2A 4WNKA 4MD9E 3U54A 1M7QA 2CGWA 4HW7A 2W96B 1VYZA 1W83A 4BIDA 2WD1A 3CPBA 4F7NA 3IECA 3CBLA 3P5KA 3RK9A 2PTKA 3NVKI 4G6LA 3A8XA 3RAHA 3PXZA 4CLIA 2UZUE 3ELJA 2BRBA 2PVLA 3UO5A 4BI1A 3UZRA 3EN9A 2BFXA 3HV5A 4D5KA 2C47A 1ZLTA 3BHYA 4J1RA 1AQ1A 4FT5A 4IAZA 4PP9A 4EOMA 3FL5A 3FKOA 4X2KA 2W4JA 3LFAA 4FOCA 3R0TA 4N6ZA 4A9YA 4EL9A 4M3QA 4F1TA 4DTAA 2A27A 5EYDA 3DAKA 4EJNA 4HVIA 3AMBA 3G9NA 5AUYA 4AF3A 3NNXA 4JRVA 5FEQA 4O2ZA 1JOWB 4I5HA 4M7IA 2OU7A 4XV1A 5B2LA 4ANLA 5HNGA 3G51A 3D5VA 3FSFA 2X9FA 5A6OA 5KMJA 4PV0A 2EUFB 4TYEA 2ZM1A 4IZYA 3FSKA 5L6OA 3BKBA 3HUBA 3OWPA 5DNRA 3P0MA 3DDQA 4NIFB 5BUEA 1U46A 3GU6A 3PJCA 4AGDA 4OAVB 3IW5A 4BR3A 4TL0A 2V22A 2WQEA 4PDOA 2NRYA 4M0ZA 1ZYDA 2Z7LA 5ANKA 5CT7A 4NSTA 4NL0A 4FNZA 3NAYA 3QCSA 3GB2A 3CJGA 3PSDA 5HTBA 4L3LA 2YWVA 3FLSA 3KRWA 2WMUA 5DBXA 4CD0A 5LCKA 5J95A 4TT7A 3WE4A 2QKWB 4H3PA 5M44A 4L9IA 2V7AA 4F9CA 3DK3A 3OUNB 3AMYA 3QZHA 3NPCA 3GU5A 4O1PA 2XNNA 3R83A 3R8PA 1SVGA 2X0GA 5HLWA 4QNAA 3QYWA 2VUWA 2YM7A 3D4QA 4YHTA 4BVUA 2Z8CA 4FKQA 3PTGA 3COIA 4QQCA 2HZ0A 5AUXA 3ZSHA 2W17A 3IOKA 4GRBA 3MY5A 4QTEA 4IAYA 4IB3A 3ZM4A 4YJSA 1OKZA 4ASZA 2V62A 2J90A 3JYAA 2JD5A 3DLZA 3GC8A 4DH3A 3E3PA 2PZYA 3QCQA 4FTQA 2UZEA 4S2ZA 5LVNA 5HE3A 4A9SA 1H08A 2YFXA 5L6WL 5CXZA 1SMHA 2Z7RA 3RKBA 3UODA 5I9XA 3FXXA 1G3NA 2WOUA 3JR1A 3EQGA 3ROYA 2QURA 2GFCA 4XUFA 1X8BA 4BIEA 4JLCA 1R78A 5D11A 3W2OA 4E4XA 4ENYA 5AEPA 5HU3A 3GGFA 4G31A 1Q41A 2NP8A 2HW7A 3ORKA 4G1WA 4BCFA 4QMOA 4EORA 2XK9A 1DI8A 4QMYA 4EZ5A 3AC5A 3P79A 2C5YA 3C0GA 4J98A 3C5UA 4H58A 3N4VA 3NNUA 4EK3A 2ZYBA 1W7HA 4L6QA 3DOGA 4C2VA 4PF4A 3QKMA 2W99B 3ZOSA 5LMKA 3DZOA 4Q9SA 5F20A 4D1SA 5AA9A 1XH8A 1MQ4A 3VWAA 3NYVA 1JQHA 2WTJA 4G17A 4V0GA 5DR9A 5HQ0A 3NCZA 3WZUA 5KE0A 5DRBA 2OK1A 4RIYB 4BGHA 4Y8DA 3FWQA 3TIZA 3VUIA 5KUPA 4IZ7A 4L43A 3F2NA 1ZOGA 4LOQA 3ZO1A 4O0YA 4E73A 3GI3A 4MXXA 1P4FA 1H07A 1IEPA 4JNWA 1PXPA 4UMQA 5CYIA 3K3JA 3KF7A 2FA2A 3CQEA 5JRSA 3PXQA 3E63A 3EJ1A 4DFUA 2OXDA 2R3JA 3FKLA 3OXIA 2IZTA 3R7VA 1FGIA 3L9NA 3SD0A 2XUUA 2R7IA 3LIJA 4EYMA 2ZDTA 4GVJA 4CKJA 5HG5A 5EM5A 4QQTA 2VTJA 5CZHA 3VNTA 5D9HA 4AQCA 3MH3A 4DHFA 4EH5A 4AZSA 4D2PA 5EKNA 3HLLA 2YA9A 3LQ5A 4GS6A 3MJ1A 3TG1A 2PSQA 3IONA 4C35A 5C26A 5IMEA 1UNHA 4M69A 4IMYA 4UV0A 2WU6A 5C8NA 4NM7A 5GIPE 4NZWB 5A6NA 4K9YA 3T8OA 3OW4A 4RVMA 1NA7A 5D12A 4EEVA 5BX0A 5K4IA 2HYYA 2VTRA 4BTMA 3OVVA 5FXRA 3WILA 2HZNA 2PUUA 2AUHA 5E8WA 3U9NA 2R3MA 2PZRA 4LV8A 4BCHA 5JFVA 3RZBA 5HIBA 3K5VA 1B39A 1CKJA 3C50A 4O0TA 2ONLC 3BE9A 4YLJA 4YTCA 4CZTA 3BCEA 5JFXA 4NYEA 4O96A 1UU3A 4L7FA 4TYHA 4BICA 2OIDA 4YUQA 3COMA 5JZJA 3ZHPC 2YAKA 3DQWA 5KNJA 4G6NA 5ANDA 5CENA 2FSTX 2YDKA 3L8SA 5CSHA 5KMIA 5JEBA 4D28A 5JGAA 1OECA 1Y6AA 1STCE 1YI4A 2WIPA 4J8NA 4MXCA 4P7EA 2QONA 3FC1X 5CT0A 5IDPA 5IA3A 2QOIA 5L2WA 1GOLA 3QRKA 2YACA 3MB6A 2F7XE 3UZPA 3EKKA 1FBNA 5GNKA 5L2IA 4H1MA 1OL1A 4BN1A 4USDA 4IQ6A 3DBQA 1OZ1A 3CPCA 3ATTA 3BHHA 3OEFX 4IXPA 4GVAA 2OXXA 4GIHA 5DA3A 3TV4A 3O51A 4GH2A 4MNEA 4AU8A 4ZSLA 1YWRA 3GUBA 4C4GA 1H24A 4FIHA 4WD5A 2XJ2A 4QMQA 3ZTXA 1Q8TA 2REIA 2GNJA 2W4KA 5CI7A 3FE3A 4O81A 3H9OA 3O17A 1CM8A 3QC9A 2F9GA 4GU6A 4U43A 4EZ3A 1IAHA 1UKHA 2A4LA 4XV3A 3PVWA 4O6EA 3FI2A 4BCNA 2OFVA 3UPXA 1XO2B 4FTIA 4RG0A 4Y72A 3LXKA 2KULA 2XBAA 4JBOA 1O9UA 2F57A 3V8TA 4RJ5A 4F0GA 4FEXA 2HK5A 4WNOA 5FXQA 4CRLA 4TYIA 4AOIA 3Q9XA 4BBMA 2VTIA 2Z60A 2ZMCA 3BBWA 2NRUA 2QOCA 1H0WA 4M66A 4F63A 3QA8A 4IWDA 4L46A 3QTIA 3P4KA 5IQBA 2WMAA 3QTRA 3QQJA 4FKIA 3R2YA 4CYIA 2IZRA 4AGWA 5EKOA 4DCEA 1YKRA 4IX5A 4JDKA 4YJQA 4KIKA 4ZTNA 4B9DA 3NEWA 2YISA 1M2PA 5M4CA 3ZEWA 1JPAA 3PLSA 4FNWA 5M51A 4ZTLA 4RFMA 5CVHA 4BIBA 4I6QA 3HECA 1R3CA 4YJNA 2BVAA 3KXGA 4XH6A 2ZJWA 3M2WA 2OJ9A 5D7VA 4NW6A 3OFMA 2VTTA 1BL6A 5L8KA 4HYIA 5KCVA 4CTBA 2F2UA 2B55A 1FVRA 1GAGA 2BDJA 2GHLA 1U5RA 5HX8A 4K8AA 4A9RA 2YLEA 4EH4A 2IZUA 2QOQA 1K2PA 4IBMA 4ZLOA 3UO6A 2XIZA 3ANQA 4BZOA 5E1EA 3HZTA 4Z7GA 3TUBA 5D7AA 4NM5A 4F9WA 4KRCA 3T3VA 2XKEA 1YI6A 1YOLA 3BX5A 5CQWA 4UX9A 4RZWA 3D2IA 3OZ6A 3U51A 3PVBA 4EOJA 4YP8A 4AN9A 4I5CA 2BUJA 3SOAA 4EBWA 3VUTA 2XNPA 4AFEA 1J7LA 3PJ8A 2CNQA 3FUPA 2B9FA 3GNIB 3GFWA 3LFNA 3RNIA 4M15A 5LARA 3OTUA 5HG8A 3PVUA 3BGQA 3GU8A 3ZUTA 2YWPA 4OTGA 4YNOA 3FMHA 1H0VA 5HO8A 3RPSA 2HAKA 5I4NA 4ZMEA 3FPQA 3EQHA 1OITA 1WVWA 2QR7A 4RIXA 5B0XA 2C5XA 2IWIA 3I1AA 2W0JA 4DFYA 4IVDA 2R3RA 3GCQA 3PUPA 4LGGA 5AM7A 4DEIA 1B6CB 1FMOE 3EZVA 3L8PA 3FPMA 4J96A 4XYFA 4F65A 1Q4LA 2PVRA 4ANMA 3D9VA 2I6LA 1IG1A 3C5IA 3R22A 3KRJA 1G8SA 2R2PA 3HRFA 3BI6A 2R7BA 2WMBA 3AT2A 3A99A 2E9PA 4FV7A 2QOBA 5HD7A 2YEXA 3LJ2A 3R04A 5F1ZA 3W33A 1YI3A 1P14A 3VBTA 3V5JA 4BRXA 4HYUA 2C6EA 2VU3A 4HZRA 3FLZA 2ITNA 5AP4A 3KL8A 4JXFA 4XOYA 5T68A 2YM8A 4TTHB 2WTKB 3EFLA 4DEGA 4DH5A 5BPYA 3EQPA 3E5AA 4O0RA 5IF1A 3AXWA 3QC4A 4MKCA 3MH0A 1W84A 2WNTA 3Q2MA 4ZEGA 1XH9A 4C2WA 5J8IA 4BDIA 4P90A 5CX9A 1ZMUA 2OO8X 2XYNA 3QKKA 4ID7A 4JIKA 3UIUA 4EC9A 4I22A 2QO7A 1MQBA 2PZ5A 4LL5A 3I7CA 3JY9A 2DYLA 3VS1A 4X3JA 1NVQA 4DEHA 3HAMA 2CJMA 3POZA 5FP5A 4ANBA 4OT6A 3QKLA 4YJRA 2ZV7A 2O3PA 4QP8A 4PNKA 1IASA 4HPTE 4O2PA 1M2QA 2OG8A 3DKOA 1YDRE 3BELA 5HKMA 2X8IA 5G1XA 3CY2A 4FX3A 4CQEA 3AOXA 4IX4A 4XRLA 2PVNA 4HNIA 4EOLA 4JL9A 4O22A 5DHJA 4DEDA 5L2TA 2XYUA 3TUCA 1VZOA 2B52A 2ZOQA 5IMXA 1URCA 2VO7A 1Q8UA 2UZDA 3AT3A 3KXMA 3G2FA 3P7AA 5FWKK 4W9WA 3WF5A 3FMDA 2V0DA 4WNMA 2W1FA
chains in the Genus database with same CATH superfamily
4CCBA 5CU0A 4U8ZA 2ITQA 4OT5A 2Y0AA 2RKUA 4FSTA 4BYIA 1WBVA 4WKQA 4DT9A 4F09A 3W0QA 2FB8A 4DLIA 2BTSA 3LQ8A 2OF4A 3HV7A 3LXLA 4K6ZA 3VS7A 3QD2B 3U55A 4IJ9A 4WSYA 2FSMX 4DGLC 5CSVA 2XNMA 3QHWA 4IDVA 1ZMWA 4IB5A 4TW9A 3MH2A 3BBTB 4D1ZA 5HLPA 1Q62A 4EKLA 3VBVA 4NT4A 4Y46A 3VIDA 1TKIA 2VGPA 3FV8A 3UPZA 2C5OA 4HCVA 2VRXA 5EK7A 2W1HA 3QWKA 4H39A 3BHTA 3OEZA 5E4HA 2UZBA 4M68A 5FEEA 4APPA 4BGQA 4QP6A 1LUFA 2XM9A 2X4FA 4AACA 2XVDA 3OCTA 4C58A 4EWHA 4RFZA 2ERZE 4GYGA 4IHPA 3GCSA 4TWCA 4S30A 3VUKA 4BCQA 4MCVA 4U3YA 3KMWA 2JAMA 3ACJA 5HESA 4UMUA 5DR6A 5HCZA 1Z5MA 3UP7A 3GOKA 4IM0A 1U59A 4XP0A 5AV3A 4UMRA 1PXMA 3DTWA 5BNJA 4O6LA 3N4TA 4MH7A 5GZ8A 1M17A 2C6IA 4AZEA 5AAEA 4RA5A 5FTGA 5CXHA 2BIKB 3HEGA 2ONLA 5DEYA 4E4LA 4AXEA 2OICA 4GT4A 2GNGA 4GFOA 1VJYA 3RGFA 3CR0A 4N0SA 5DWRA 1YXUA 5FP6A 3Q32A 3CCNA 2QR8A 3DY7A 3ZONA 2G2FA 2NNWB 3IOPA 2G01A 2CGXA 3OCBA 1Q97A 2ESMA 2XA4A 2CHLA 2CMWA 2XKDA 4FV8A 3VW6A 3MDYA 4DEEA 4XLIA 3IDPA 3EWHA 4FT3A 3R1NA 4V04A 5DN3A 1KV2A 4Q5EA 4E4NA 3RAKA 4EK6A 3VRYA 4XRJA 3TV6A 3P9JA 3NNWA 2W5BA 4FVRA 4I93A 4LUDA 4X3FC 3SXFA 1PYXA 1UA2A 2XJ0A 5HO6A 3TNHA 4GK2A 3LXNA 2HY81 3AC1A 5EM6A 5ACBC 2RFNA 4L42A 4JDIA 2BTRA 3LPBA 1OPKA 4O1OA 1P2AA 5A4LA 3TDWA 3GCUA 4FSQA 2W1ZA 3R01A 1ZRZA 3L1SA 2GHMA 4JQ7A 4XBUA 4GL9A 4ZTHA 1OIQA 2R3PA 3BIZA 5HG9A 5DYJA 4G3DA 4PUZA 4BDEA 3ZZWA 3N9XA 2XALA 2Y6MA 3DXPA 3FLNC 4FG8A 3TWJA 4DDIA 4ASEA 3W2PA 4QMTA 2XKCA 4HPUE 3ZRLA 3LMIA 2HWOA 2W4OA 4U44A 2X1NA 3FBVA 5L6PA 4U81A 1O6KA 4Z7HA 5HVKA 3FC2A 5M06A 3DLSA 4QMWA 4C4IA 4CFVA 3LAUA 3IS5A 3PSBA 4PX6A 4RIWA 1M2RA 2Y7JA 5I9WA 3FEGA 1LR4A 2CLQA 3UNJA 4O7SA 2UV2A 3E8DA 3KC3A 5AP3A 2OIBA 2XIYA 4G2FA 3ORNA 2I7QA 3A4OX 5F95A 2H6DA 3TI1A 4BF2A 2X6DA 4QTBA 1HOWA 2HZ4A 4W4XA 4CT1A 3DKGA 4DHZA 1W2CA 3ERKA 2HXQA 3GQLA 1JVPP 5BQ0A 4R3RA 3NRMA 2BIYA 2GQGA 3A2CA 3FQSA 3MTFA 2BAQA 3G0FA 3ZUVA 4MD7E 3ULZA 2YIYA 4EK4A 4ERKA 4G16A 1RJBA 4BDJA 1JKKA 3PY3A 3Q4UA 4UWYA 2QG7A 3UIMA 4FBXA 2J4ZA 5DR2A 5IQFA 4KS8A 3ZFMA 5L2QA 2W7XA 3R2BA 3HRCA 4V01A 2VTMA 2A2AA 1UNGA 2J0JA 4MTAA 2XNEA 3HA6A 4PTCA 2QI8A 1RW8A 4IANA 3QD0A 3AD4A 3QTWA 3NDMA 1ZYLA 3VJOA 3MI9A 3C13A 4OBPA 4J97A 3BEGA 2UW6A 4XOZA 4GUBA 3FXZA 5LVPA 4DG2E 4LGHA 4IVAA 5A54A 2UW0A 4QYHA 2GSFA 4YZBA 5AUWA 4D4VA 1Z57A 1OKWA 4A4XA 3PPKA 4QP4A 3DS6A 1V1KA 2JLDA 2QKRA 2W5AA 4IX3A 4QP9A 5AP1A 5FM2A 3TNWA 3OUKA 2O65A 4FC0A 3CY3A 4KSPA 4ZZNA 2JBPA 4HJOA 1Y6BA 4JRNA 2EXCX 3KXHA 3W32A 4RX5A 5LQFA 3ML1A 2YN8A 3D0EA 5H9BA 1RE8A 4AG8A 4ZSAA 4RWKA 4ACMA 5A46A 5JRQA 3NUAA 4FTLA 1JAMA 1W2DA 2VGOA 2WMWA 4GT3A 4TYGA 4Z9LA 2BRGA 3QZIA 4EH6A 2J2IB 4GW8A 2UUEA 5IPJA 2XIXA 4FYOA 1Z9XA 5M07A 4PTGA 2WAJA 1TQMA 2R3HA 4P5ZA 1CDKA 3DBEA 4L8MA 2CKOA 1R39A 3B2WA 4KNBA 4ZP5A 4D4YA 2XK3A 4ZK5A 3VO3A 3C0HA 1PYEA 5DH3A 3QYZA 3FI3A 1WVYA 2GTMA 5E8VA 2OGVA 2PYWA 3NW7A 5I3RA 4AP7A 3SGCA 3WF8A 3PIXA 3UE4A 1PXLA 4R1YA 3IDCA 3MPMA 3QA0A 4KIPA 5JKGA 4OW8A 2P2HA 4FG7A 4EOIA 4JQ8A 4DC2A 1H1QA 1Y91A 2AYPA 2JFLA 2P2IA 2RFDA 3SXSA 4CZYB 4G3GA 4MUQA 3E64A 4DFBA 2YABA 4F0IA 3QD3A 5DT3A 3ZO2A 2OZAB 4HOKA 5B2MA 1JKLA 4IM2A 4Y83A 5KX8A 1W82A 5KKRC 3RK5A 3SLSA 3LVPA 3RK7A 3E88A 4BCJA 3RPOA 1VYWA 2UW4A 2OZOA 5CEKA 1OGYA 1YOMA 2XH5A 2VZ6A 1BL7A 1H8FA 1M14A 3FYJX 5GJFA 3B2TA 5IA2A 4BGGA 2NO3A 5CF8A 1GZ8A 3BU3A 1OUKA 4YHJA 5CNNA 2QNJA 3C9WA 3R30A 5AX3A 1W2FA 1URWA 4CFNA 5AUVA 4FT0A 5E8UA 2LGCA 2Y8OA 3AQVA 5HICA 1SZMA 3WF9A 3QXOA 4R8QA 2WMXA 4W4WA 2IVVA 4AT4A 4USEA 5HHWA 3KCKA 5JGBA 2ZV8A 4JG6A 3MVHA 1J91A 5CZIA 4BDGA 1ZARA 3LFBA 4NUSA 3ET7A 4Y73A 2QLUA 3DK6A 1PF8A 1ZZLA 4L3PA 2XNOA 4G5PA 5KZIA 4I5PA 4A4OA 1XBCA 4IAAA 4JBPA 4B0GA 2ZB1A 4JX7A 3KRLA 2XK7A 3Q9WA 4XP2A 2UW7A 3F3WA 1L3RE 3G6GA 5F9EA 4AOJA 5M56A 2BILB 4BYJA 4EYJA 5A9UA 3ZLXA 5M09A 3LLAA 4FTCA 4DGOA 2BKKA 3OY1A 4I92A 1CMKE 2OFUA 1OM1A 4QOXA 3QUEA 3VS0A 4MBIA 3ZUUA 4JS8A 4QTAA 2DQ7X 2PVFA 4AS0A 4QTCA 4DTBA 2XIKA 1GIIA 1PJKA 1V0OA 4FSYA 4MQ1A 5EYKA 3TEIA 2VX0A 2PHKA 3HKOA 3Q5ZA 2O5KA 3W0OA 1S9IA 3KU2A 3NUPA 4BHNA 3O2MA 4FOBA 3WZJA 4C61A 4F1OA 4AW2A 3K54A 5HLNA 4YTHA 2A98A 3BU5A 3LCKA 5ANJA 3UTOA 2QCSA 2X81A 3TZMA 4FTRA 3W55A 2Z2WA 4FTNA 3LFQA 4RJ4A 3O71A 5CWZA 5D10A 3R9NA 2C6OA 1H01A 3THBA 2IG7A 3GC7A 3OCGA 3MVLA 3MYGA 1F5QA 3Q96A 4LUEA 3FMLA 3C0IA 4BHZA 3R1YA 5CU4A 4DFXE 4EQCA 3QTZA 4WRSA 3IKAA 3F61A 3FAAA 4C0TA 4WOVA 3TNIA 4XP3A 1DI9A 4K33A 1FVVA 1UWJA 1QPDA 1CKPA 5JGDA 2QHNA 3FZTA 4O7VA 3QTUA 3ITZA 3OWKA 2O8YA 4XG3A 3COHA 2V7OA 5HU9A 2BZKB 4ITHA 2WZJA 4WUNA 4N57A 4DEAA 5I9ZA 4IDTA 5TR6A 2H8HA 3B8QA 2QLQA 4RRVA 4FG9A 3QU0A 5IH6A 3TZ9A 3HV4A 4FICA 2UZLA 2R9SA 2UZWE 4I6BA 2VAGA 4FV5A 5DGZA 4IE9A 5E8SA 3AC3A 1PXJA 3HX4A 3TNQB 3AKKA 2BRNA 3ETAA 4FA2A 1PXOA 2BKZA 3JVRA 3GXLA 3UMXA 1WFCA 3PJ3A 4E6QA 2X4ZA 2HWPA 4AXFA 3IW8A 2C3LA 2YJRA 3KB7A 1SVEA 4QMSA 3H4JA 2ZV9A 4CEGA 4D2VA 5EQEA 4FNYA 4X3FA 4AAYA 1YXSA 4GFMA 4M14A 3KN5A 4O7YA 5CY3A 5M08A 4XHKB 3ZLWA 2RIOA 3ZSGA 3OT3A 3QRJA 5IQGA 4MBLA 4C34A 1W98A 4UEUA 3V01A 4BDHA 4CLJA 4HYHA 5CEMA 2CN8A 4GK4A 4HNFA 4AZTA 4DBNA 3D5UA 2YHVA 2WMRA 1GZKA 2O0UA 2HY0A 2WQBA 3A7HA 3T9IA 5H8GA 3ORTA 2WMVA 4D4SA 3WI6A 5JT2A 4F7LA 2ITTA 3OC1A 5T6KA 4CFFA 2QHMA 4EH8A 3BE2A 3M1SA 5AV2A 4YR8A 2PZPA 4F1MA 1QMZA 4K1BA 3VF8A 5HNIX 3UQFA 4IWPA 4I6FA 2C68A 4EZ7A 4Z16A 3NIZA 3OY3A 4BTFA 4MNFA 4FKWA 2IVUA 4Y5QA 2OJJA 4K2RA 5FDXA 4D58A 1YVJA 4I0SA 1H26A 2R3NA 2C0OA 4I94A 3C4WA 3NW5A 4YTIA 5M4UA 1W8CA 4Z3VA 1M7NA 5H2UA 5DOSA 3LFSA 5TE0A 4IAFA 2Z7SA 4UB7A 4WBOA 4UXLA 1GIJA 3CD3A 1SVHA 2W1IA 3FZRA 2F7EE 3EQIA 4IC8A 3LHJA 4CVAA 2J5EA 3FHIA 1OL2A 4WG4A 5AIRA 4ALWA 3I7BA 4GG5A 4DEBA 5IH4A 3UDTA 4BKYA 3KEXA 4YMJA 3DFCB 3W18A 4ARKA 4BC6A 3LQ3A 3QLGA 4DINA 1WMKA 3NYXA 4TKSA 3UOLA 5IQCA 3NW6A 5BYYA 2JKQA 5AR7A 1OKYA 4BCKA 1GNGA 4D2WA 4IX6A 4QMZA 1YQJA 3SX9A 3VHKA 2GMXA 3ZBXA 1ZZ2A 5EW9A 3R7EA 4TYJA 1U4DA 4WG5A 4NM3A 1TZDA 3G0EA 1XH4A 5JZNA 1W0XC 4EH2A 3TMOA 3CE3A 4O0XA 4O7ZA 3RM7A 3BQCA 4IJPA 3G9LX 4F4PA 3D2KA 3QRIA 4O7TA 4ITJA 4O38A 3TN8A 5K9IA 3DXQA 5KMMA 2GU8A 4RC3A 2WMSA 3F88A 3O7LB 3DPKA 3QD4A 3BLRA 4FIGA 3P7BA 2XZSA 5K5NA 5IQEA 3SHEA 4BTJA 2VWIA 5CSWA 4BZDA 2XAOA 1A48A 3K5UA 4C59A 4RT7A 2GHGA 3ZFXA 4I6HA 2OBJA 3OXTA 4A4LA 2ZM3A 2BPMA 3FZ1A 4PPBA 2GNIA 3NWWA 3PY1A 3EYGA 4YZDA 4BBFA 4EHZA 5IEVA 3KA0A 3RBWA 4KINA 4ZLZA 3IDBA 4QPSA 4C4EA 3LMHA 2QODA 3NMUF 4U3ZA 4C57A 2PE0A 3O23A 5E90A 3P08A 4ACHA 3I0OA 1BMKA 2PWLA 3E93A 4TWNA 4C7TA 4N6YA 4JR3A 3HAVA 2IF8A 3FZPA 4O86A 4U45A 5AP7A 2JDRA 4LDTA 5E8YA 4DA5A 3D94A 5TF9A 3UDZA 3ENMA 4R5YA 1FOTA 4ZZMA 4RX8A 1OIYA 4MHAA 3MFTA 4V0GB 4XG7A 1GY3A 3E87A 4NKAA 1XWSA 3EQDA 1PMVA 1U5QA 1S9JA 1ZAOA 3NZ0A 4FEQA 4FZ6A 2X7OA 3O5AA 3W10A 4C4JA 2C3KA 3BYMA 2C5NA 4CG9A 4QO9A 4O4FA 3FY0A 4ZSGA 4AAAA 1JKSA 2PMNX 4L52A 4PMMA 5CLPA 3BV2A 1Q5KA 2F4JA 3ZSIA 1DM2A 2YM4A 2WQOA 3OHTA 3PY0A 4LI5A 2R3IA 3EHAA 4R6VA 5EFQA 4ZSEA 4C4FA 4DITA 4FSMA 5CAVA 3QHRA 1BI7A 4ZOGA 3BPRA 3R9RA 1H4LA 1OIRA 3T9TA 3F9NA 5IA4A 1PMEA 2ETKA 1WBNA 4AXAA 5AUTA 4EH3A 1LEZA 4BCOA 3V51A 4RC2A 4W4VA 4BBEA 5GZ9A 2W1DA 4FSNA 5DT0A 4DLJA 3EKNA 3TKHA 5EHLA 4TNBA 2YITA 1K9AA 3QRUA 4I23A 4IB1A 2IPXA 3A7FA 2PMIA 4CKRA 4FV2A 1A06A 1UWHA 2ITWA 4PL4A 2WQMA 2Y4IB 3ZBFA 4ACDA 3V3VA 4C62A 1IA9A 1R0PA 3HMIA 4EHEA 3U6IA 1WVXA 4M69B 3I79A 4FV4A 5C27A 3W16A 2C1BA 4BKJA 5L2SA 4F6WA 3UQCA 3G33A 3NX8A 4PDYA 3UBDA 1OBDA 5HTIA 2EU9A 5I9UA 2C6KA 3OBGA 2E2BA 5HORA 2GNHA 2OLCA 4O7RA 3R73A 1UU8A 1Q8YA 3DJ7A 1YWNA 4EOSA 3UDBA 3D14A 3EOCA 2WB8A 4YC6A 2RF9A 5LMAA 3TT0A 5DIAA 5M55A 4O83A 4KAOA 4MBJA 5FDPA 2R0UA 4M8TA 4WUAA 2WTCA 4IWQA 4KD1A 1PXKA 1M52A 5GJGA 3ORLA 5BVWA 3PE1A 4HCUA 4U0IA 2X7FA 2O64A 1WBTA 3H0ZA 3JUHA 4FL3A 4BJJA 4O4DA 2UW8A 1QL6A 2IEWA 1YHSA 2BAJA 2C69A 4OLIA 5BUIA 3UMWA 2C3JA 5CEQA 3DB6A 4AXDA 2UW9A 5CAOA 4CG8A 4EUTA 5HIEA 1DAWA 4O7WA 3I6WA 5CS6A 1PKGA 4FKGA 4MXYA 4YJPA 5AP5A 4DH8A 3IW7A 5CALA 2JIUA 4JT3A 3V5TA 4L67A 4ANQA 4ASXA 5IISA 3PIZA 3U6HA 2G2HA 2PY3A 3MW1A 3EN5A 5IUHA 1NVSA 4FTJA 2WQNA 4XG9A 1WAKA 2CDZA 3FYKX 4MNEB 2VX3A 4G3EA 4FSWA 2UVYA 3BLHA 4UY9A 4ZXTA 3R00A 4QMXA 4D55A 4GKIA 4R7HA 4QRCA 4LRMA 3TV7A 4ASDA 4S33A 2YZAA 4IC7A 5CF6A 1VEBA 2C6LA 3UP2A 4XG2A 4X21A 4H3QA 3TIYA 2BMCA 2UW5A 2HW6A 3DJ6A 3F3ZA 4TY1A 5D1JA 5DI1A 2WEIA 5TO8A 3BQRA 3CEKA 2EXMA 4I4FA 3F3UA 4RWIA 1F0QA 4KB8A 3OOMA 4J52A 4P5QA 5L8JA 5BYZA 4NTSA 2B9IA 4X2JA 3RWPA 5GJDA 5BVDA 3W2CA 3KXXA 1OL6A 3HP5A 3UG1A 4YU2A 4WA9A 4CFMA 4H05A 1FQ1B 3R1SA 5LWNA 4FTAA 1FVTA 2BRHA 3I6UA 3LOKA 4ANNA 5GINE 2GFSA 2VTPA 3TACA 2CPKE 3RP9A 3DQXA 3E8NA 1PY5A 4PTEA 3HVCA 4DGMA 5J5SA 2Y4PA 3KULB 4FKPA 4KABA 5I0BA 5LVLA 5ICPA 4R5SA 4UN0C 5IZFA 4FKJA 2IVSA 3JY0A 4GJ2A 5L8LA 2JIIA 2QOFA 3KXNA 3H30A 4FV9A 4OTWA 4S31A 3LJ1A 5IA5A 3VF9A 4UYAA 5ETAA 4GK3A 3UDSA 2YDJA 4QYYA 3P86A 3H9RA 4E93A 4QEBA 5JFWA 1GZNA 2PPQA 1R0EA 4XV2A 5HEZA 3F7ZA 3VS2A 2PUIA 3DAEA 4YJUA 4FIIA 1JSUA 3QQFA 1PHKA 1YDTE 4FNXA 2FSOX 5ETCA 4M97A 1U54A 5C1QB 2IJMA 3E3BX 3OD6X 2RG5A 5FM3A 4GSBA 4KKGA 4HGLA 3BV3A 3MJ2A 2Q0BA 4B6LA 2WOTA 4KIOA 4YLLA 5IEXA 2XMYA 2X8EA 3N51A 2JDVA 2XM8A 3K3IA 3UNKA 2R5TA 3RM6A 3D83A 4FYNA 5EOBA 3TKIA 3DFAA 3QQKA 3EFKA 5A4QA 3QCYA 1KWPA 4B4LA 5HG7A 4RLKA 4F7JA 2GPHA 3SVVA 1KOBA 2P55A 4ANOA 4JX3A 4PMPA 2G15A 4Z55A 1NT2A 3JPVA 3PSCA 3Q52A 2I0EA 4EONA 2GS6A 5F94A 4QTDA 3MVMA 3PA4A 5AA8A 1ZY4A 3V8SA 3ULIA 5BVFA 1CSNA 3MN3A 5EI8A 4LRKA 2R3GA 2WTWA 3DK7A 3R63A 5CU3A 5A3XA 4AXCA 2QOKA 4UZHA 4GFGA 2HCKA 3O8UA 4KBKA 4ZY4A 5LOHA 5CSXA 2HELA 4RIXB 2E9NA 3R1QA 4AN2A 2R4BA 2VTQA 2OH0E 3VBWA 1QCFA 2FGIA 3DXNA 3LCOA 3R7GA 1UVRA 4FZAB 4CXAA 1GJOA 2WTIA 4AZVA 2JGZA 1PXIA 4TWPA 3ORZA 1ZOEA 3R8UA 3TNPC 4JBQA 4JDJA 4ZJVA 5HTCA 2PVYA 4XEYA 4OTQA 1OPLA 4WG3A 5E92A 5HGIA 3WF6A 1J7UA 3DKFA 2B9HA 2QG5A 4FUXA 2CNVA 1G5SA 3EQBA 4FZDB 2IW9A 4CTCA 4C4HA 2YIQA 4YJVA 4BB4A 4BDAA 4O4BB 5CAPA 2B9JA 1V0PA 1I44A 4FV6A 5AR2A 3PG1A 4I20A 3TDVA 1Q99A 3BHUA 2C1AA 1Q8ZA 3CGOA 4CFXA 4UXQA 2J0KA 4KIQA 2WHBA 5KHWA 3FDNA 3AKLA 2BZHB 3I5NA 4C38A 4RJ7A 1TQPA 2PVJA 1PRYA 4NK9A 4YTFA 3DA6A 2C6DA 3EQCA 2O2UA 4IW0A 4DF3A 2Y6OA 5DG5A 3ZC5A 3DNEA 5IQIA 1UU9A 2BR1A 4FKLA 4PMSA 3BWJA 3DKCA 4LMUA 3NUUA 4AA4A 2X2MA 5EW3A 1OBGA 5EH0A 2PE2A 4ORKA 4AX8A 4E6DA 3CQUA 3RHXA 2E9VA 4JIAA 2H9VA 4O91A 2AC3A 4IEBA 1SNUA 4TZRA 3R8VA 4I41A 4KUJA 2VV9A 4J99A 2WO6A 4L68A 5BV3A 2FSLX 3HL7A 4YPSA 5CF5A 4GIIA 1OB3A 2W9ZB 4NFMA 4HVGA 4YZMA 4AGUA 5BVEA 3H10A 3C1XA 3DBCA 3HYHA 4J7BA 2WMTA 2DUVA 4ZJJA 1XBAA 2YJSA 4W8EA 4J95A 3BHVA 3OTVA 3NCGA 3QZGA 5CVFA 4LM5A 2HENA 4EH7A 3G15A 4BWKA 3CJFA 4QQJA 5EI6A 1DS5A 1YDSE 3D7TA 1O6YA 5T3QA 4BDBA 4BI0A 2ERKA 4EUUA 2HXLA 3C7QA 4RX9A 3GU4A 3Q3BA 3QWJA 4KRDA 3QQHA 3KIOC 2B0QA 3Q53A 3Q9ZA 3HV3A 4R7BA 2X6EA 4FK6A 3ZCLA 2BFYA 4KKEA 4X2GA 2ZB0A 1ZYSA 3D15A 1UNLA 2UVXA 3ZDIA 4C37A 3DBFA 5B7VA 3KY2A 2YLFA 4G5JA 4MQ2A 5FXSA 4BZNA 3ZRMA 3CC6A 2J9MA 3SRVB 4C3RA 1OIUA 3OROA 5K4JA 3EL7A 4BCIA 2R3QA 2VWUA 4BDCA 1RQQA 3ZU7A 2C0TA 2OIQA 3JS2A 5I3OA 4BDDA 5ITAA 3GVUA 3EN7A 1KSWA 3KRXA 4N4SA 4TPTA 2RFSA 5F4NA 5M57A 5FBOA 1IA8A 2R3LA 3PXKA 2R3FA 3L9PA 5M4IA 3UVPA 4WIHA 1P5EA 4R3PA 2YIRA 4X0MA 3ALOA 3G90X 1YXTA 3KXZA 5HCXA 3AC8A 5ANOA 4D1XA 5JH6A 4BL1A 4J8MA 1OKVA 2J0MB 3DGKA 4FK3A 3F69A 4H36A 4W9XA 4AUAA 4CZUA 3O50A 5IQDA 2KTYA 3PJ2A 3F7WA 5K3YA 2DS1A 2YCRA 4ANSA 4AW5A 1ERKA 5CQUA 3HMOA 3VUGA 4APCA 3UOJA 3WZKA 4QMVA 4D4RA 5AR3A 3P78A 4QP3A 3EFJA 4XV9A 1ZWSA 2GS7A 3QGWA 3CIKA 3U4UA 4NIFA 4YZCA 4DGNA 4XX9A 5CU6A 4G6OA 1A9UA 5EM7A 3PWDA 5A4TA 1H00A 3KCFA 3MPTA 3RMFA 5J9ZA 4YJOA 3F5PA 4PL5A 4O21A 4RLLA 1H1RA 4GCJA 2EB3A 4WNPA 3NS9A 1PW2A 5I5ZA 3V5WA 5CASA 2PMLX 3O96A 4C8BA 4EHGA 4MYGA 3ZXTA 2J6MA 4MXOA 4R7IA 2J0LA 2HOGA 3HP2A 3ZRKA 2PL0A 4HGTA 4OTHA 4E1ZA 1CKIA 4N70A 4W4YA 3VN9A 4ERWA 3C4CA 4G9RA 4K11A 1MP8A 5A4EA 3PLAE 4U79A 4CYJA 5AWMA 2XNBA 2ACXA 4RIWB 5HCYA 3KKVA 3QQUA 3SOCA 3W2RA 3MFSA 3W2SA 1IR3A 5J1VA 4AA0A 4I24A 4A9UA 1JSTA 4KKHA 3UYTA 3R02A 1NW1A 3UJGA 5DPVA 3NGAA 3Q2JA 3LCDA 4FTOA 2PU8A 2R3OA 1XHAA 4IB0A 3ROCA 4FSZA 2WTKC 3KVWA 2XBJA 3TZ7A 1BX6A 2JDTA 3KK8A 3L9MA 5HBJA 3GOPA 2A0CX 2X7GA 3E7VA 2QOOA 4FL2A 3SXRA 5AX9A 2XP2A 3UIXA 2UZNA 3DT1A 4KWPA 4NJ3A 5CVGA 5M53A 1ZYCA 3A62A 5DFPA 4AT5A 4WHZA 4YC8A 5LJJA 4FF8A 3KQ7A 4NEUA 5C8MA 1YXXA 2QD9A 1UKIA 2CGUA 4HGSA 4D2TA 4E4MA 1QPEA 4YO4A 2B54A 5KMKA 2CCIA 4K18A 3CD8A 2JKMA 3TKUA 4OGRA 2JKKA 4PL3A 4RFYA 2UW3A 3PJ1A 3S95A 4C02A 4CMUA 4F64A 5IA0A 5LMBA 3SA0A 3BL7A 3Q9YA 5AAFA 3HNGA 1T45A 2ITUA 4Y85A 4AT3A 2BRMA 3AMAA 4AE6A 4D9UA 1LPUA 3EFWA 4KS7A 3SG8A 4EOKA 4YBJA 1YW2A 2YCFA 3QGYA 4XLVA 4RIYA 4FV3A 3A7GA 4AE9A 2SRCA 1OL7A 2JDSA 4AA5A 5HX6A 4YGAA 1QPCA 2I0HA 3FZSA 4FV0A 4FUYA 4L45A 1WBPA 4EC8A 5A14A 5E1SA 1EH4A 3DAJA 4NKSA 4DTKA 3PPJA 3VS4A 4DAWA 4D2SA 5JK3A 4WT6A 3NFGB 5HIDA 5EI2A 4O0VA 5AMNA 4ACCA 5FRIA 4JJRA 3HRBA 2XEYA 3IK3A 1WCCA 3H0YA 4W8DA 2IO6A 5AP6A 3FHRA 3PA3A 4AWIA 5KHXA 3Q4TA 3AC2A 4IVCA 2XKFA 3V8WA 3DB8A 5AR5A 2YCQA 3ATSA 4FVQA 4RIOA 4A07A 3UGCA 5EQYA 5FQDC 1ZY5A 4DBXA 4MK0A 3MB7A 4MVFA 4WSQA 4UBAA 5H8EA 5DLSA 3MPAA 3N4UA 3MA3A 4IIRA 2C4GA 3RPRA 3F2RA 5DRDA 4RGJA 2R3KA 1KE5A 3PE2A 5DVRA 4M0YA 4GYIA 3H9FA 4Y95A 3R71A 2VWWA 4XS2A 3UC4A 1T46A 5AV4A 2YM3A 2Q83A 1B38A 1BLXA 3FLQA 3MFRA 3D7ZA 2BAKA 2ITVA 2X0PA 3EN4A 4MXAA 5E9EA 3U8WA 1AD5A 5IKWA 2XCKA 3MA6A 1QPJA 4RJ8A 4TWOA 1E9HA 4U7ZA 3VHEA 3PPZA 3FY2A 4FGBA 2J0IA 3MFUA 4FKSA 3A8WA 4GMYA 2CGVA 5HE0A 3WARA 4YHFA 2AC5A 4YZ9A 5IH5A 2VWYA 3OXZA 1HCLA 4RVTA 3S2PA 4KSQA 4FRFA 4K0YA 3SV0A 4FMQA 2VWXA 3ORMA 1OPJA 5I9YA 1WZYA 3D5WA 4ZY5A 3QUPA 2B53A 2WELA 3ORXA 3NIEA 5BMMA 1JLUE 5C03A 4B8MA 5TKDA 4M12A 3BRBA 3ODZX 3BU6A 4DH1A 2YM5A 2X8DA 1L8TA 2ZDUA 4FTUA 4GKHA 5GZAA 3AC4A 4QMLA 3MIAA 2VO3A 5HI2A 3S1HA 2OWBA 2WKMA 3KK9A 3R7OA 4WO5A 3VC4A 4CGAA 5LVMA 1K3AA 4P4CA 2I1MA 3PIYA 4ZS0A 3R8MA 3QXPA 2B4SB 3RHKA 3QX2