4O0YA

Back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Back Pocket Flexibility Provides Group II p21-Activated Kinase (PAK) Selectivity for Type I 1/2 Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
total genus 96
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o0yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o0yA01
4MBIA 5DT4A 5KCVA 3UZRA 4OTRA 3GGFA 1F3MC 3CSVA 4XEYA 4KBAA 4FOCA 2Z7QA 5AJQA 4G3FA 2PUIA 2QONA 3BI6A 3OCBA 4JXFA 5DWRA 4V04A 4L46A 5FG8A 4OR5A 1UV5A 5L6PA 3FAAA 3HRBA 5EYDA 4NM0A 5JMSA 3EN5A 3FHIA 3D7ZA 2QO7A 4GG7A 3A8XA 4FL1A 5GJGA 5HE1A 4CKRA 2CGWA 2ERKA 1PXOA 3NUSA 4YHFA 3VS7A 3QUPA 4WG5A 3A7IA 4EYMA 5AIRA 5LWNA 4YJSA 3FLQA 4NCTC 1PHKA 4CFFA 3REPA 5IQBA 4XLIA 3FZSA 4GK2A 3B2WA 3BHTA 4Z7HA 2H9VA 3CTJA 3CD3A 3D2KA 2F7EE 5J7HA 2EU9A 1PRYA 1YVJA 3JS2A 2W9FB 2WU7A 3O51A 4BDBA 3GP0A 5KBQA 3W32A 3KMWA 4XV2A 4FEWA 3VRZA 1R39A 5A9UA 5BVFA 4C34A 1XHAA 2RFEA 4G5JA 4XG8A 4BCKA 5AA8A 4KS7A 2W05A 4P7EA 4IMYA 3MESA 4MWIA 5J1VA 3FI3A 4EH2A 5HE2A 3SLSA 4ANNA 4FTUA 4C33A 3N4UA 3TDVA 3SXFA 5DE2A 2CPKE 4DG3E 3WZDA 2EVAA 2WTKC 1HCLA 3FMMA 3IW8A 2XS0A 3OD6X 2PMNX 4HJOA 2YWPA 3SV0A 5ACKA 2YISA 4M97A 4XG2A 2WTJA 4FODA 4PX6A 2YERA 3CKXA 4CEGA 1IA9A 5HVYA 3WZUA 1OECA 2WQNA 5AAFA 5EM6A 2BTRA 5ANJA 3W2PA 2X6EA 4GVJA 4F0FA 1RDQE 3DAKA 4C3FA 4I4EA 2UW7A 4AQCA 5CVHA 1UNLA 2HZ4A 2WKMA 3EYGA 3LCDA 4O0WA 5CXHA 4B4LA 1H1SA 5AADA 4FKPA 3TZ7A 4EYJA 1L8TA 3AMBA 4UXLA 2PVLA 2O64A 4XX9A 4E5BA 1SNUA 4R3CA 4TWPA 3O8PA 3EIDA 3QTWA 5GIPE 5H8EA 2XM8A 4QYEA 4CXAA 3FQSA 3KCFA 4RFMA 3PFQA 1G8AA 3RCJA 4EOPA 2BALA 2GQSA 1R0EA 3GT8A 1KOBA 4O7TA 2ITXA 5ITAA 3EL8A 5KE0A 3QTSA 2BAQA 3PE2A 4FTJA 5DVRA 3U6JA 5EYMA 1PXIA 3QQGA 2VWIA 3EMGA 4YR8A 1FBNA 2FO0A 2OWBA 3E7OA 1BL6A 3OTUA 4NJDA 4UN0C 3QRKA 4FYNA 4IAFA 5E8YA 3KXGA 3FSKA 4HVDA 3RAHA 5IEYA 5DNRA 2RFDA 2GCDA 2QR7A 2WTIA 1GJOA 2Q83A 3ZMMA 4TN6A 3OS3A 4RA5A 2W1ZA 4D0WA 1PXJA 1U54B 4FTMA 4MK0A 3UIBA 4BBMA 5LMKC 1FMKA 3AT3A 4GJ2A 2WIHA 5KMJA 5K4IA 3AC8A 4FA2A 3VQHA 2YLFA 4GT4A 4DEGA 4QMLA 3MWUA 5ETIA 2JDOA 4IZ5A 3F66A 2AUHA 4RJ8A 4AX8A 4RC2A 5J5TA 3D2IA 4XLVA 3L1SA 1QCFA 4O7NA 2OH4A 1H26A 3OUNB 4UWYA 3JY9A 3L8SA 3V6RA 2CGUA 3VS4A 2WMBA 5KMIA 4DBXA 4P5ZA 1DI8A 3UOKA 4USFA 3OHTA 1GIIA 5ANIA 1YXVA 3HMPA 5HVKA 3ANQA 4ACCA 5A4CA 1Q8YA 4RVKA 4ALVA 5DRBA 3G0EA 4I5PA 1XBCA 4QMVA 4E4NA 1CMKE 4TYJA 3FC1X 2C47A 4C57A 1J1BA 4EH6A 5HD4A 1WBPA 3PRIA 2BZJA 3P79A 3E88A 3G9LX 4AFEA 4B8LA 4O7SA 5IISA 2XB7A 2IN6A 5CTPA 4JX3A 2HZ0A 3TUCA 3T9TA 5BVOA 5BMMA 2HELA 1WVXA 4XCUA 2F7ZE 3QC9A 4QMWA 1MRUA 3Q5ZA 4O0TA 4FVRA 4L6QA 4WNOA 5DEYA 4BCIA 5EHLA 5B2KA 1KE9A 3UIMA 3F5XA 3R30A 3TV7A 2XBJA 3E7VA 4IVBA 3GNIB 4ZSEA 5L8JA 1JKLA 2ZB1A 4WOVA 3TNHA 2FSOX 4V0GA 4FV5A 4FMQA 4YTFA 4EH5A 4AZVA 4TYHB 1UVRA 2UZTA 2ZYBA 4BZOA 3BRBA 5LARA 3I7BA 5JFXA 2XKDA 2VTJA 1Y6BA 4JQEA 1OGUA 5M44A 4NCTA 4E6AA 2UVYA 3NUXA 2OO8X 4I23A 4O6LA 5AP3A 3FMJA 1KOAA 3FHRA 2WXVA 1MRYA 4D9TA 5AM7A 4E3CA 3HP2A 4NIFA 5KMKA 3HP5A 1R78A 3Q2MA 4CZYB 2I6LA 5BUEA 1RE8A 3MY0A 3GQLA 2OKRA 2ESMA 2UUEA 3PWYA 2QG7A 3KMMA 4TTHB 2R3RA 4KKHA 4GFGA 3ROYA 2C5YA 4APPA 2G01A 1ZOGA 4O1PA 3R1YA 4CNHA 5BUJA 2Y8OA 1DM2A 4R3RA 5M06A 4HYHA 4WNKA 3ZSHA 4C2WA 3K5UA 2WMQA 2C6DA 4AOIA 4IAAA 5HORA 3D83A 4FVQA 3KRXA 4XNEA 5CQWA 3HA8A 3LXPA 5BNJA 4X21A 1JKSA 3Q4UA 3QZHA 3V5PA 3TCPA 4FKIA 3A4OX 4PDSA 3LXKA 4RLKA 1Z9XA 3GFWA 3PIYA 4G6NA 4GVAA 4NM5A 4G6OA 4BDCA 5I9YA 3HUBA 3A62A 3GI3A 4J71A 3G51A 4X2GA 2ITNA 3QWKA 3MFUA 3LM0A 4Y95A 5H8BA 3RBWA 5ETAA 1YXXA 4NSTA 5L8KA 5C4KA 1ZYCA 4I92A 3NPCA 3VULA 5CI7A 2V5QA 1PXPA 3C4XA 3OEZA 4QTEA 2ACXA 2JDTA 4L00A 4S32A 5AUWA 3E5AA 3VBVA 2QLUA 3EZVA 4BDKA 2VTTA 2WAJA 4GS6A 2BVAA 3IDBA 3UG1A 3QD3A 4GU9A 4CFUA 5C4LA 2BRNA 4MCVA 3QD0A 4TYGA 1JVPP 3O8UA 2YEXA 5FBNC 3MDYA 3Q9YA 5IMXA 3HDNA 3COIA 1H08A 3TZ9A 1SM2A 3NVKI 3V8WA 3VJOA 3TNIA 3DDPA 1DI9A 3LM5A 3QGYA 3O23A 3KXMA 4L52A 5EH0A 4L7SA 4DCEA 2PTKA 3R73A 4CZUA 2CKQA 1A9UA 5IEVA 2I40A 4ANLA 3DJ5A 5AX3A 2OXDA 4PMPA 3ORNA 2YCRA 4LG4A 1ZWSA 4BTKA 2GNGA 2OJJA 3OW4A 3FI8A 4YTCA 3R01A 2HYYA 2WTDA 3TUBA 3R2YA 2GHMA 4IVDA 4L3LA 5AV0A 4HVSA 2OJFE 3AOXA 3C4WA 3OTVA 4YNEA 3RNIA 2VAGA 4NT4A 4E93A 4AZWA 2F9GA 3OOGA 1LR4A 1L3RE 3QYZA 4GFOA 3PYYA 2VNYA 3DQWA 1JSVA 3OZ6A 4IAYA 5AV2A 3ZBXA 5E1SA 4B8MA 1BYGA 3PJ8A 4ID7A 3SHEA 3OBGA 3Q2JA 1QPJA 3DQXA 4L3PA 4MKCA 5ANDA 1YWNA 3P4KA 3SW4A 4DYMA 2XK3A 2R3NA 2XZSA 3KRWA 5ANEA 4YP8A 4WBBB 3GQIA 3SQQA 4N57A 4MXOA 4USEA 2VTPA 3HRFA 4OBQA 4ACHA 5CSHA 2WMXA 4OTFA 4OTGA 3TWJA 1STCE 3AC5A 3G6HA 4RFZA 3WIKA 4I41A 5AEPA 3QKLA 4A06A 4EZ5A 1AD5A 5HE0A 3ORKA 4S2ZA 3RM6A 5BX0A 3MY1A 4FKQA 3MVHA 4O7WA 2REIA 1BL7A 2ETKA 4GSBA 4AA0A 2KULA 3D9VA 5DH3A 4FGRA 3TV4A 3BU3A 2R3OA 4J96A 3NYOA 3ALNA 5IUIA 3WF8A 4X0MA 2XBAA 3A7HA 3DKOA 4Y72A 4KIKA 4BCPA 3DXPA 4M13A 2QOOA 4KS8A 3AMYA 4NM3A 3MN3A 2YCQA 5AV1A 3BKBA 5HD7A 1YWVA 2NP8A 3F3WA 3W1FA 3IOPA 4B9DA 4LOPA 2CN8A 3RAIA 2F2UA 3FPQA 1YHVA 4UMQA 3VHKA 4BYJA 3OWKA 5L2IA 3HV4A 3HAMA 1ZMVA 3TG1A 4QPSA 5TO8A 5JGDA 4YJRA 4CMOA 3C5UA 4FG9A 4Q9ZA 1XH9A 4FT5A 4ZTHA 5I9VA 1WBOA 3V5QA 3UE4A 3FMNA 3IONA 4IHPA 4KAOA 3RPYA 3BIZA 3VAPA 2PVKA 4CQEA 5C26A 4PDOA 5DLSA 3H9OA 3IECA 1UNHA 3JVRA 4FG7A 5CEQA 3R7EA 5BVWA 3P0MA 3C5IA 2WTKB 4O6EA 5EW8A 1E1XA 5A54A 3MY5A 1OPKA 4F09A 3B8QA 3KF4A 3FSFA 3AC3A 5HGIA 3G6GA 2CNQA 1WBWA 1R0PA 3DB6A 3V5WA 3HV3A 4CYIA 2ZV8A 4BCQA 3HVCA 3PRFA 1W8CA 1OKVA 3EQRA 3GC8A 4AOTA 4Z9LA 3BYMA 4C4GA 3U55A 3R9HA 3PUPA 2HOGA 4RX9A 4O7VA 3R7IA 4ASEA 3FYKX 3D5UA 1LEZA 1Y8YA 3F69A 2WMTA 4D55A 4ONAA 1M52A 3MJ1A 4W8EA 4E6QA 2JKOA 3TTJA 5IH6A 4YZ9A 4LMNA 3II5A 4KKEA 2CLQA 5IMEA 4L7FA 4BDGA 5JH6A 2JFLA 1IRKA 4RIWA 1FVTA 2C6TA 3VRYA 4PV0A 2YIQA 5CLPA 3KL8A 3IKAA 2O63A 5FEQA 1XR1A 1M2QA 5EHYA 4BTFA 2OFUA 5BYZA 1KSWA 3CPBA 2F7XE 4UYNA 2UZDA 4FSRA 4O38A 4R1VA 3UVPA 3WARA 4E26A 3SA0A 4R7BA 2BDJA 1YDSE 4I22A 2XNNA 2GDOA 2VWWA 2YIRA 3ORXA 1PMNA 3TJCA 2CDZA 4KINA 3CC6A 4QQ5A 5I3OA 3ROCA 3CTQA 5BMSA 3QXPA 3HAVA 5BUIA 1JLUE 5KMMA 3PSCA 4JT3A 2CMWA 4A07A 2YJRA 4D5HA 2QOIA 4I0SA 3TNWA 3FMLA 4BN1A 4MXYA 4QMUA 3OWLA 4LFIA 3PY1A 4QP6A 2OJIA 3E87A 3H9FA 1J1CA 4ACGA 2Z7RA 3ZUUA 5E8SA 4BKJA 5K9IA 4ENYA 2HXLA 3G33A 3TN8A 5AP6A 3I79A 1QPEA 4RX8A 5FQDC 1OBGA 3KQ7A 3PG1A 2WNTA 3VBWA 1H1PA 3CS9A 1J3HA 3CEKA 3EQGA 3QQKA 5TT7A 5LMKA 1B38A 3EHAA 3VVHA 3ZDUA 2I7QA 2NRYA 3NNWA 4FZ6A 3NNVA 3U8WA 3ZXZA 5KMOA 5HTIA 3LQ3A 2YA9A 3EN6A 5ANOA 5JRSA 3D5XA 2V0DA 5AUXA 1H00A 1OL1A 2GTNA 2OSCA 1XBAA 2XMYA 3V04A 2OIQA 4IB3A 4UX9A 1OIRA 3EFWA 5L4QA 3R8PA 2A27A 5DR9A 4NU1A 3RP9A 4F7JA 4HW7A 3OXZA 1WVYA 3A7JA 4JX7A 4YBKA 4AWIA 3DK7A 3F3UA 1H1RA 1XWSA 3BV3A 4QQTA 3DXNA 1ZXEA 4XBUA 2EB2A 1H0WA 3GC7A 3VUIA 2F4JA 4O0UA 5M57A 4M84A 4J98A 4ACDA 1FVVA 3W2QA 2CGXA 1VJYA 3I0OA 4JDHA 4A9TA 3PXRA 4TY1A 3T3UA 4F63A 3WZKA 3QXOA 5B2MA 3JYAA 3TT0A 3H0YA 3VIDA 5B2LA 3V5JA 3NAXA 5L2QA 4R3PA 2R0IA 4RJ5A 4AZSA 3DZQA 4DT9A 5IUHA 4IZYA 2PL0A 5CZHA 2QHNA 1ZOHA 3F61A 4FTLA 3VUGA 5E4HA 5FLFA 4RJ6A 5FWKK 5IQEA 2JC6A 5JT2A 4BIDA 5CASA 3DB8A 2ZM3A 1IG1A 5AP0A 2X2LA 5CZIA 3ZEWA 3VBQA 5BQ0A 4RVLA 4HCVA 1ZARA 1Q8WA 3NUYA 1ZYSA 5ACBC 5HQ0A 2OF2A 3BGZA 3OC1A 2A4LA 3R8MA 4BGQA 3FC2A 2DWBA 4TL0A 4CG8A 2QOBA 3CE3A 2WQBA 4HCUA 3IDPA 4OT6A 4FKWA 3UQFA 3AQVA 3OVVA 3F2RA 2PZ5A 2XNEA 3LQ5A 3ODZX 3QCQA 4XG4A 5CU0A 2YZAA 2CCIA 5E91A 1OPJA 5FEDA 4ZJJA 5AP1A 4ZEGA 2B53A 2ITZA 3LZBA 3CLYA 3R02A 3BELA 4FV3A 3JVSA 3R9DA 3UIXA 5A4EA 2I0VA 2VWBA 1JAMA 4IE9A 1OVEA 1Q97A 3MBLA 2X4FA 3RAWA 3FPMA 2VGPA 4JBOA 3PXYA 3QD2B 4FUXA 4Y85A 5HIBA 1JSUA 2E9VA 3UPZA 2ZAZA 4DEDA 2C4GA 4UB7A 2VTAA 3CPCA 2WOTA 3H30A 3OROA 5GZ9A 3VUTA 1WMKA 3G0FA 1W84A 1YI6A 1E1VA 4G17A 4PMSA 4F1OA 4ZMFA 4Z3VA 3VS2A 2DYLA 2QOQA 3QD4A 5CAOA 5DR2A 3RPOA 1UNGA 4LI5A 3ZO3A 4X7QA 3EFJA 1ZY4A 4CRSA 5AAEA 3VS6A 1ZZLA 3BHVA 3GOKA 2Y0AA 4O7YA 4GIIA 5EQPA 3UOHA 2IW6A 4JIAA 2G2IA 5DR6A 2Z2WA 3K3IA 2RFSA 3Q96A 4O0VA 5HCYA 4JAIA 4AA5A 3PP1A 1OUKA 4D2VA 1OL7A 2ZV9A 5GHVA 4D0XA 2A0CX 4H39A 4EOOA 1OMWA 1YHWA 3MH2A 2WU6A 4IZAA 4P4CA 5HLNA 5AP2A 4QMZA 1WCCA 3FL4A 4BBFA 5AAGA 4U80A 4FKVA 5HCXA 4RG0A 2FSMX 3C0IA 1PKDA 4FNXA 2RGPA 5DHJA 3UQGA 4X2KA 4YC3A 4EOSA 4HPUE 4JRNA 2CJMA 3FUPA 3UPXA 3NWWA 4QMPA 5IH4A 3JY0A 4FV2A 2WMVA 4CLJA 4FIIA 5FRIA 5EG3A 3JXWA 4HNIA 2C6KA 2W17A 2YDIA 1ZOEA 5JZJA 2PVNA 2R7IA 2XNMA 3LAUA 2R0UA 3ZO1A 1J7UA 1CKJA 4CKJA 3DFAA 4DH7A 1H4LA 1CSNA 3FXWA 1GZNA 2FUMA 3DAJA 3O2MA 4GK4A 4UZDA 4BI0A 5TF9A 3V8TA 4C0TA 4N0SA 2F49A 5M09A 3L8XA 5CS6A 4I0TA 1AQ1A 3DAEA 4LOQA 3D5WA 3QC4A 2C5VA 4K77A 2V62A 4CKIA 5EDQA 4K6ZA 1ZRZA 4RWLA 4S31A 4NWMA 1UKIA 3R6XA 2BZKB 3PY0A 4OTWA 4V05A 2I1MA 2QODA 5CY3A 5ETFA 4DFYA 2R5TA 2RIOA 2OICA 3DNEA 3PZEA 1DAYA 2XP2A 4NH1A 3UO4A 3ORMA 4K9YA 4BCMA 5HNGA 3HZTA 5M4IA 3UZTA 3CJGA 3O7LB 2W1FA 5K0XA 1A48A 2SRCA 3AGLA 3IDCA 3QCXA 1ZYJA 3S4QA 3A2CA 4ZLYA 3MIAA 4QP3A 1ZAOA 3FLWA 3C4CA 4FIHA 3FBVA 3I5NA 4AW1A 3CJFA 1SVEA 4D1ZA 4O84A 1BKXA 3LFCA 1H27A 1Q5KA 2G9XA 1YXUA 3LFNA 3H4JA 2YM3A 4QQCA 4XS2A 3UDBA 4EH3A 1PY5A 2WB8A 2XYUA 3BLQA 3TZ8A 2YM4A 3EKNA 2QOCA 2R3IA 4JRVA 3EZRA 1XBBA 1OITA 1QMZA 4G3CA 5EKOA 2ITQA 4OAVB 4RIOA 3QAME 2H6DA 3Q4TA 4BWPA 3F7ZA 4NK9A 2OJGA 5A4TA 3RCDA 4WRSA 4AT4A 1CM8A 1JSTA 4WSYA 4JG8A 2UW9A 3DLSA 2GHGA 3QCYA 2IZUA 2GS7A 3BBWA 3LJ1A 3BU5A 4OTIA 2W5HA 3P7AA 3E92A 1YOJA 4J99A 3ZLYA 4DEAA 1M2PA 4H3BA 1TQPA 4S30A 5GZ8A 3DLZA 4O96A 3LMIA 1P14A 5DGZA 4DA5A 4MBLA 4N4SA 5IU2A 5KKRC 3BGPA 2CNUA 4FV7A 1NXKA 3NNUA 1Q61A 3DFCB 2GFSA 2AC5A 3LCOA 5AUYA 4CT2A 4E5AX 5M55A 1WFCA 4IWQA 4KABA 2OF4A 3NW6A 4YPSA 2YDKA 2ZV7A 1OL2A 3CQWA 4C7TA 4D1XA 2B9IA 2BTSA 4EC8A 4W8DA 2VZ6A 4NFNA 2C5OA 3FY0A 4FIEA 5M51A 5IA4A 3PXQA 5HOAA 3QLGA 3ZONA 3DPKA 3DTWA 2HIWA 4M68A 1YXSA 1E9HA 2YFXA 4J8NA 4MQ1A 4YLKA 3T9IA 3TJDA 3LCKA 3QLFA 4CTBA 4ZOGA 2VTMA 4L67A 1YI4A 3OT3A 3TKUA 3WI6A 1JNKA 2RG5A 2UZOA 3D4QA 4F6WA 4PMTA 4Q5HA 4RC4A 4BCNA 4PDYA 2VTIA 4RPVA 2UW8A 2Y4IB 3F88A 4O22A 4EONA 3U54A 5HICA 3MH3A 1DAWA 3NGAA 2G15A 2R3LA 1KE7A 2X8IA 4M0ZA 5IH5A 2FSLX 2W7XA 5DIAA 5DYJA 3KKVA 1HCKA 1XO2B 3HUCA 2J5EA 3M2WA 4IX5A 3K2LA 4MXCA 3KXHA 4IWDA 4QMOA 4FTIA 4EHGA 4DCAA 4JDKA 3FQHA 4NJ3A 2RSVA 3R8ZA 3PJ3A 4ZTLA 5AA9A 4IWOA 4F9YA 5CNOA 2PUUA 2C6EA 3E8DA 3L9MA 5G1XA 1J7IA 1IAHA 3IGOA 1UU8A 2PK9A 3FMDA 4ZSGA 4OTQA 3PVGA 5HE3A 3FY2A 4KWPA 4MNFA 4A9UA 4F9WA 3M42A 4BDJA 3PLSA 3C13A 3OCSA 1Y8GA 3R2BA 3E3PA 4FNWA 4I5MA 3O8TA 2HW7A 3AT4A 4ITHA 2FVDA 4MXXA 3RNYA 4F4PA 5I5ZA 5IG1A 5CU6A 4K0YA 3ZRMA 5KO1A 3LFDA 3Q9WA 2O65A 2C69A 5JQ8A 4KUJA 1UWJA 3ENHA 4CFVA 3UP2A 4ANSA 4XV1A 1VR2A 2J50A 1H25A 4FT0A 4FSMA 3PSBA 4DEHA 3GOPA 4ZSLA 4PF4A 5E8XA 2BIYA 2Y7JA 4CCBA 4C4IA 4YJOA 1V0PA 4FI1A 4DGNA 4BDFA 2ONLC 4EWQA 3R7UA 4IXPA 4HVHA 4KSPA 2XCKA 3TACA 2XNOA 4C59A 5HNIX 1J7LA 3GU6A 4ZLOA 4GKHA 3KK9A 4F99A 4JR7A 4EK8A 3WYXA 2GFCA 5JZNA 2HENA 4TYIA 5KZIA 4D5KA 4UWCA 1U59A 3NYXA 2YZLA 2C6OA 4X3FA 3VUHA 4C37A 5EHOA 4C2VA 2C1BA 4YGAA 4E20A 5KNJA 4FTRA 2OG8A 4CG9A 4NTTA 4NFMA 4B0GA 3HV6A 3MPTA 3D5VA 2XIYA 2X6DA 4JQ8A 3C4EA 3PJ1A 4O83A 3E62A 4QQJA 3I6WA 4FICA 5AP7A 2GQGA 2HZIA 4TKSA 4ZK5A 4EZ7A 4FSTA 3PXZA 4FUYA 2WEIA 4M69A 3T8OA 4AGDA 3HRCA 4FV1A 2J7TA 4FVPA 4KIOA 4LUEA 4KB8A 5EDRA 2Y6OA 4C02A 5IEXA 3CBLA 3E8CA 4YBJA 4O81A 4D58A 2VWVA 1WBTA 3BX5A 5LMBA 4PWNA 2QO2A 5KKRB 4IFCA 4O2PA 4MYGA 2PY3A 4QT1A 3RKBA 3TIZA 5JGBA 4D4YA 4MHAA 2VWYA 4HGSA 4ORKA 1I44A 4A4OA 2WTCA 3R8VA 2BAJA 3AT2A 2DUVA 3EQFA 4G6LA 2VX3A 4BDAA 2XRUA 3VBYA 5AWMA 4JOAA 4IC8A 1REJA 3AD6A 4LRJA 3EB0A 4EH4A 3HYHA 2CNVA 4M12A 4O91A 4NZWB 5IQHA 2QOKA 1TQMA 4EOJA 4ZTRA 3QRTA 3RPRA 2IJMA 2C30A 4QMSA 5A6NA 3GU7A 2ZMDA 4M3QA 2PYWA 3GENA 2VTHA 3K3JA 3KXXA 4BL1A 5IQCA 5AUVA 3R04A 3EQDA 1U54A 1WBVA 3R1SA 3PLAE 4X3JA 4AG8A 4AOJA 3U87A 4OBOA 2WELA 4EC9A 3Q32A 3QUDA 4LL5A 5J7BA 4K11A 1M2RA 4USDA 1I09A 2UW6A 4FKJA 4YLLA 4IB1A 3MJ2A 1H1WA 3GC9A 4I6BA 4DFBA 2JAMA 3GUBA 3PXKA 2JEDA 4QYHA 4B7TA 2QKWB 1F5QA 3M1SA 4H3PA 2OIDA 4PTEA 3SRVB 3VUKA 1VYWA 1ZMWA 3PSDA 2J0LA 2OGVA 1QPCA 3C50A 3MW1A 4M0YA 4IDVA 4N6ZA 4BB4A 4C4EA 2ZB0A 3CXWA 2ZOQA 3FKLA 3E8EA 1KE8A 2B4SB 2YN8A 2CKEA 4OTDA 4EZ3A 4QPMA 2QOHA 3VW6A 4CT1A 5IA5A 3ZFMA 3NYVA 4AW0A 3N4TA 2OLCA 2YDJA 5IUGA 2XA4A 4IW0A 5LCKA 3G90X 3P9JA 3WOWA 5HKMA 4YSJA 2UV2A 3D15A 1M7NA 2Y4IC 3VW8A 3BYSA 5A4LA 5JFWA 2C1AA 4JLCA 1H0VA 5EOLA 4A4XA 2VTLA 3O71A 5JSMA 2XVDA 2VGOA 5AR8A 2X2MA 3BGQA 4N70A 1Q4LA 2XK6A 3EQHA 2JKQA 3UNZA 3L9NA 3HX4A 4RIXA 2C3JA 1SMHA 1O6LA 4DC2A 4LGDA 1ERKA 4JDJA 4G9RA 1Z5MA 4QRCA 5EK7A 5C9CA 4IAIA 4AUAA 4GT3A 1GZ8A 4OW8A 2EXEA 5F94A 1MP8A 3ETAA 1Q3DA 4FOBA 4RQKA 2QG5A 3ZLWA 4KKGA 3PZHA 5JGAA 3KVXA 4U79A 5HO7A 1YOMA 4RVTA 5C03A 3ZC5A 3CTHA 4BVUA 3NW5A 3COKA 4AZFA 3HDMA 2C68A 3R1NA 4OLIA 2WIPA 3HA6A 2WO6A 2J6MA 3F3VA 4OBPA 2LGCA 1NVQA 4LYNA 2R3GA 4J97A 2NO3A 3CR0A 3NUUA 5CWZA 4YO4A 5FXRA 4KBCA 1M7QA 1Q8ZA 5DPVA 5LOHA 4BIBA 3PVUA 5HTCA 4QYYA 2BRBA 4DH1A 5CYIA 3IGGA 5AV4A 2NNWB 3S3IA 3QTRA 2HZNA 3DZOA 3QGWA 4QO9A 3S00A 2UW3A 3LPBA 3WF7A 4A9RA 4FIGA 4MD7E 5A14A 5FM3A 4OTPA 1CKIA 4GKIA 1VEBA 3QTZA 3FQEA 4IACA 2XK9A 2ZM1A 4BHZA 2BROA 2V7AA 4F7NA 4FZDB 3OCTA 2PVRA 5K3YA 4EH8A 5DEWA 4ENXA 3U9CA 5FDPA 4D2PA 4RIYA 1K9AA 4ZTSA 4YUQA 3FXXA 4U81A 4FE2A 4UMPA 1GZKA 5EI2A 1UU3A 5CANA 3DS6A 2B54A 3I5ZA 4BWXA 3EWHA 3Q53A 3CP9A 4PP7A 4BY9E 2PMIA 3ZO4A 4ALUA 1OM1A 4DGGA 4C4HA 3ZDIA 5JQ5A 5CNNA 5CEMA 1PF8A 3FLNC 4L43A 5EYCA 3RPVA 4EK5A 4H3QA 4F08A 3E3BX 5AIKA 2XNPA 2C5NA 4Y5QA 4DITA 1EH4A 1M14A 2RFNA 3C4FA 3RM7A 4WHZA 4LOOA 1FMOE 5EW3A 4YLJA 4PL4A 1O6KA 3CCNA 1XH7A 2J90A 5IDPA 2PVMA 4WG3A 3LCSA 2XIXA 3UMWA 5IPJA 2BHEA 2W06A 3QQUA 2WFYA 2XIZA 4O27B 4ZXTA 3BWFA 3FKOA 3MTLA 3WZEA 2GHLA 4YJTA 3DY7A 4NEUA 2BZIB 3O0GA 3FZPA 4EK4A 3MB6A 3CY3A 4BCJA 2OI4X 2PSQA 3KVWA 4WUAA 3V6SA 4C36A 4FTTA 1J91A 2JIVA 3VNTA 4RLLA 2YLEA 4KSQA 3DGKA 4O0SA 3GU8A 4QP8A 1NT2A 4AT3A 5CSWA 3KGAA 3F3ZA 5M4CA 3ZSIA 2JKMA 3QQHA 4EOIA 2X8DA 1GOLA 5CEPA 3WF6A 3RPSA 3ZU7A 4GH2A 4QP1A 4DTKA 5I0BA 2VWZA 2OXXA 3QRUA 2PE2A 4RJ3A 4RIYB 4BICA 4M14A 4QMTA 2IO6A 4X2JA 3QL8A 3C0GA 3AGMA 2XF0A 1FINA 1A06A 1GZOA 2YM7A 4P90A 4QMMA 3VJNA 4BTMA 3N4VA 4FEQA 4I5CA 5FD2A 5AV3A 3F9NA 3SD0A 2WGJA 1NVRA 1NY3A 4DF3A 4FSQA 2R4BA 5GINE 3DV3A 4PTGA 3WE8A 2WMRA 2CN5A 2OH0E 4G31A 4AW2A 1OUYA 4XP3A 4BRXA 3N51A 1JKTA 2A1AB 3W8LA 4DN5A 3B2TA 2G2HA 4TXCA 4U97A 4ACMA 3EH9A 4RVMA 3BQRA 5J79A 1Q8TA 2UW4A 3QTIA 4XG6A 4PP9A 4UMRA 4ZIMA 4AA4A 1M17A 5D12A 4CV9A 5IA2A 2Z02A 2O3PA 3GCQA 4LUDA 3WF5A 4BWKA 4CGAA 3IS5A 4K33A 4MVFA 4H1JA 4OT5A 2CKPA 4FKSA 5H8GA 2HWOA 2W1HA 5J87A 4RJ4A 4DGMA 4DFZE 3FMHA 4LV8A 2FB8A 3FMKA 4D4VA 3ZUTA 1OZ1A 4BC6A 4FK6A 4BI1A 1P4FA 5JK3A 3QBNA 3ZUVA 4IIRA 4IDTA 2JFMA 4YNOA 1PMUA 4F1TA 2QCSA 1UWHA 1V0OA 1OKZA 2VV9A 3TDWA 3IG7A 3MTFA 3VQUA 2ITVA 1YRPA 4EJNA 3MIYA 2BCJA 5F9EA 3GU5A 2I0YA 4HGTA 4GUEA 3DXQA 4G1WA 2XYNA 3DKFA 3ZBFA 2HY0A 4YTIA 1Y6AA 5B0XA 4FTQA 3Q4CA 4L53A 5K0KA 3ORIA 4DAWA 2YACA 5D9HA 1B6CB 2HW6A 4YURA 4RWIA 5ICPA 2PVHA 5IA3A 2GNIA 2O2UA 4ZSJA 3RWPA 4IX6A 2VTNA 4W4WA 3F2AA 4WSQA 4FF8A 2PZIA 4J53A 3LQ8A 4ANQA 1ZMUA 2W4KA 4ITIA 3UG2A 2WD1A 3HMIA 4YZNA 3OXIA 2GPHA 2VN9A 3DKCA 3Q6UA 5EQEA 4YZDA 3C51A 4KIPA 4BCGA 2QD9A 4EOMA 3MV5A 3MVMA 3UTOA 2UZNA 3OF0A 4IQ6A 4L44A 4PUZA 4EQUA 2RL5A 3QQJA 2PMOX 4FSWA 4J8MA 2VWUA 2X0GA 4YZBA 4CQGA 4EK3A 2R3QA 2B55A 2WMUA 3QKKA 5LVPA 2QU5A 1T46A 1V1KA 5AR2A 3PA4A 3RTPA 1NW1A 2ONLA 3NDMA 3OCGA 3P7CA 5HU3A 1XH8A 5LJJA 1H01A 2YCFA 1H1QA 4UYAA 4BIEA 2Z8CA 3R7VA 5E8VA 2B7AA 4RRVA 2R9SA 1O9UA 5HNBA 4IEBA 1W98A 3ZYAA 3RINA 4PQNA 2J5FA 3HKOA 3UQCA 4IWPA 4JQ7A 4FSUA 5DFPA 5L3AA 2IVSA 3F6XA 5GJDA 1JOWB 1ZYDA 5J8IA 3RHXA 3POOA 5F4NA 5KUPA 4O0RA 4HGEA 5E8UA 4C58A 1PW2A 2C0OA 3EQBA 3KN5A 3AG9A 2J2IB 3WF9A 3SGCA 3IPHA 4UMUA 2YM5A 2HWPA 4A9SA 3BWJA 2I0EA 3A4PA 3EJ1A 3FYJX 2XM9A 3O96A 3E63A 2A2AA 3AMAA 4WG4A 3NEWA 4NM7A 4WRGA 2PWLA 3MPMA 5L6WL 4BDDA 3EYHA 3NYNA 1OBDA 3F7WA 3P7BA 4O7ZA 3BE2A 3QHWA 4PRJA 5FTQA 2WOUA 4G3EA 4FKTA 4KD1A 3W10A 3QA0A 4D4RA 5CI6A 5M4UA 4AAAA 3FI2A 3KB7A 3F82A 5DOSA 4G16A 3Q6WA 1ZZ2A 3VUDA 3W2SA 3NUAA 4U44A 4KA3A 4R6VA 3AD4A 3NW7A 4LMUA 4LL0A 4UMTA 4BGHA 4IB5A 3SG9A 5TR6A 4BGGA 3SOAA 3PJ2A 4YZMA 2W0JA 4EBVA 4ZY4A 3ENMA 2C0TA 2VD5A 3BBTB 3OUKA 1XH6A 4U45A 2E9PA 4FIJA 4FT7A 5EFQA 1YDRE 3LE6A 2JBPA 4MH7A 3JUHA 5GZAA 3FZ1A 5HX6A 4GT5A 4JR3A 2BRMA 3Q9ZA 1V0BA 2DQ7X 1U4DA 2JD5A 2ZMCA 3D14A 4FKOA 4XJ0A 3ZO2A 1MQ4A 2BUJA 2XKEA 4DGLC 1JWHA 2X1NA 4Q5EA 3KA0A 3OOMA 1FVRA 4J95A 5FM2A 4QD6A 3V01A 2VTSA 5HZNA 4YC8A 1H07A 3ZHPC 3EFLA 2VU3A 3V51A 4O7LA 1YWRA 4WKQA 2ZDUA 1S9IA 2O5KA 5CT7A 5DN3A 2IW9A 2XH5A 3ZLXA 2JGZA 4EOKA 2R3PA 3GXLA 4CSVA 1JKKA 1URCA 4LGGA 5HHWA 4BI2A 4L3JA 1FQ1B 4FTAA 4GRBA 3ET7A 4R1YA 4Y8DA 4DFUA 1OIYA 3VN9A 5J1WA 2GS6A 1U46A 5KX8A 3C1XA 3NVMB 4F7LA 4JI9A 2PVFA 3QA8A 2P2HA 3F5GA 3GVUA 2GTMA 4A7CA 5D1JA 4U0IA 3PJCA 2C6LA 5CVFA 3U4UA 3U9NA 2J0KA 3S2PA 5IQFA 1CDKA 1G8SA 5K4JA 3F5PA 4WBOA 3ZFYA 5C1QB 4IC7A 4ZJVA 4TRLA 2GNJA 4IBMA 4UALA 3LXNA 2P33A 2P2IA 5CXZA 2R3KA 3P1AA 5KZ0A 1Q41A 3C4ZA 4FNYA 3VHEA 4FKGA 3VS1A 4CFWA 1SNXA 2AC3A 5AP5A 4G34A 4Z16A 2GNLA 4Q9SA 4L8MA 4U6RA 5EYKA 3R8UA 4EBWA 5LQFA 3IW4A 4R7IA 2QI8A 3HMMA 4II5A 4XP0A 5DT0A 3R71A 3SXRA 2Z7LA 3NUNA 5EM5A 3KU2A 4DHFA 4CMUA 1MQBA 4ZJIA 4F70A 3HMNA 3SRVA 3DK3A 4ALWA 3AC4A 3PG3A 3VF9A 3GU4A 4IX4A 4JG6A 2CLXA 3TNPC 5AP4A 1APME 2P4IA 3I81A 1LUFA 3WBLA 4RX7A 3LMGA 2VUWA 3PPZA 3UZPA 1W0XC 3ZZWA 5J5SA 1T45A 4XUFA 5HO8A 4FKRA 1P5EA 5IQDA 3BU6A 1CTPE 2WTVA 5KBRA 5HBHA 2VTQA 5D7AA 1LPUA 2PULA 1REKA 4U42A 2BFXA 5JFSA 4C8BA 1W7HA 5AUZA 4C61A 3LKMA 4PPBA 5IA0A 3BYUA 2UZEA 4UY9A 4F9AA 1BLXA 4CFXA 2QU6A 3DJ6A 2VX1A 3TV6A 5JKGA 4Y83A 2BZHB 4DFNA 3EQIA 2OW3A 4C4JA 4JIKA 3RHKA 1BMKA 2JIIA 4QMXA 4QMYA 4HYIA 5E8TA 4CVAA 3NUPA 4BDHA 2WZJA 3RMFA 5CSVA 4R78A 4ZZNA 4YHJA 3ZTXA 4DG0E 5HTBA 5AUTA 2W99B 4F0IA 4I93A 5CVGA 2GQRA 3OWPA 5H3QA 3FLYA 5I4NA 3ZM4A 4FT9A 4RWJA 4BZDA 4UBAA 3LJ0A 5HCZA 4DEBA 4DEEA 4EOLA 3UO5A 2JDVA 2RF9A 3WILA 4AGUA 4EQCA 4YTHA 3DK6A 3KFAA 4LM5A 3FXZA 3SX9A 1FGIA 4TZRA 3TL8A 2GS2A 3BEAA 4QPAA 2PVJA 3G9NA 3P78A 4QTBA 3QX2A 2XJ1A 3LFSA 5AR7A 3W2OA 3I7CA 5HU9A 4EH9A 2XEYA 3K54A 4D2TA 4EH7A 4PL3A 4W9XA 5LMAA 4AN9A 4ANBA 4MXAA 1URWA 5C27A 4R77A 2R2PA 1YI3A 2XJ0A 4H1MA 4R8QA 4CRLA 4FV8A 5C8KA 1UKHA 3ATSA 1XH4A 3WYYA 4LQMA 4NYEA 2PHKA 2C3LA 3EQPA 1IA8A 3CQEA 3UP7A 4C38A 5H2UA 3TEIA 1VYZA 2W1IA 2EWAA 4E6CA 2QKRA 5A6OA 5C8MA 1P4OA 1YKRA 3R7OA 5J9ZA 1WAKA 2P0CA 3OBJA 3EFKA 4O82A 2GNHA 3DA6A 5CF8A 4ZP5A 3UIUA 3CQUA 5JN2A 1R1WA 5L6OA 4M69B 5HX8A 3BYOA 4F64A 2W5AA 1OIQA 2IVTA 3GCPA 4NKAA 4QP9A 2CKOA 2IG7A 1H24A 3UGCA 4F6UA 4NTSA 3V8SA 3UC3A 3GBZA 2RG6A 3L8PA 4YO6A 4K18A 4A9YA 4M7IA 5CAQA 1PKGA 3LFFA 4BFMA 5EKNA 5KHXA 3BHYA 3FZRA 5DRDA 4EL9A 3QTQA 5J9YA 4DFLA 2GMXA 4YMJA 4TT7A 4EWHA 2HK5A 2VNWA 3C0HA 4QYGA 4WNPA 4MD8E 3ACJA 5CSXA 4OUCA 2UZLA 3VF8A 5E9EA 4U7ZA 4ANOA 2H34A 4O2ZA 1ATPE 4L45A 5FP6A 5HG5A 4FEVA 5L2TA 4NL0A 5BVDA 4GMYA 2X7OA 4BCHA 1TVOA 2J0MB 2WHBA 4FEUA 2X39A 4ZMEA 2W4OA 2DS1A 2O0UA 5IQGA 4FTCA 4S33A 2ITOA 5K5XA 1K3AA 1XKKA 3FWQA 1PMVA 2R3HA 3GC0A 3LJ2A 3MH0A 3PVBA 4GYGA 2OZAB 3RK5A 2IZRA 3ITZA 2ITPA 3ZLSA 2YAKA 4HPTE 3F5UA 4DEIA 4EI4A 3R0TA 4H58A 3QTUA 3FI4A 3R28A 4G9CA 4M66A 4BCFA 3SXSA 2E9OA 4PDPA 5EQYA 5CAPA 2R3JA 4FV0A 3JR1A 4K2RA 3W18A 4QP4A 3Q9XA 4EHVA 4QP7A 4CD0A 3VWAA 5A46A 3BE9A 3W33A 1ND4A 3NCGA 2A19B 4RZVA 1Y57A 2ITTA 5DI1A 5D41A 1IAJA 3W2RA 4PPAA 4IVCA 3BZ3A 1GIJA 4ZTNA 3S95A 3MGYA 4YHTA 3MPAA 4I6FA 3F2NA 2X2KA 4AACA 4BBEA 2W96B 4G2FA 3RGFA 3CY2A 4RQVA 4APCA 3KF7A 4XOZA 2X7FA 3QU0A 2JBOA 3FLZA 4C35A 4KRDA 1AGWA 4XYFA 4QOXA 4DGOA 5BYYA 3D94A 3QRJA 1UU9A 2C6MA 2PVYA 5CEOA 3UOLA 3KC3A 4ZY5A 1PXMA 3OY3A 2ITUA 2QVSE 2YHVA 4GIHA 4NW5A 4XG3A 3PIXA 3PXFA 3DNDA 4W4YA 2QO9A 5ANKA 3IK3A 4KNBA 4CLIA 4ZZOA 2IPXA 4FZAB 4FSNA 2H96A 3MA3A 4BDEA 1PXKA 4M15A 2VO7A 2XKCA 4CYJA 3QF9A 3QFVA 5D10A 5L2WA 2YITA 3SW7A 3CIKA 3R9NA 2R64A 3ZZEA 2JDSA 3NIZA 4QTDA 1JPAA 3FJQE 2UZUE 2CHLA 4M8TA 3MS9A 4PL5A 3BLRA 3PWDA 5LVOA 3KRRA 3ZXTA 3QQFA 4AFJA 5J9LA 5A4QA 3KMUA 2UVXA 3UVQA 4MAOA 4M67A 2VO6A 2X8EA 3LLTA 3KXZA 1OB3A 5FP5A 4AF3A 5M4FA 4BR3A 2BDFA 2IVVA 1KE5A 3OY1A 2XUUA 5HBJA 4R7HA 2BMCA 2CGVA 2Y4PA 3MB7A 3FDNA 4IJ9A 2OZAA 5HO6A 3DT1A 4UXQA 3ELJA 4ZAUA 4ZS4A 1OL6A 3QUEA 3ZRLA 2R3MA 3S1HA 3AC2A 5HG7A 2Y9QA 5IKWA 4FL3A 4GG5A 4QYFA 3TZMA 4XOYA 2WQEA 3ZC6A 1KE6A 2FGIA 5T3QA 4HVIA 2PPQA 3EOCA 2BDWA 3PP0A 4IADA 1DS5A 1OIUA 1QPDA 3MA6A 5AX9A 3CGOA 4BHNA 4UWBA 5T6KA 3R1QA 4EKKA 3LFQA 3MYGA 4PMMA 5FTOA 4DE4A 3ZFXA 4KIQA 4E6DA 3KRLA 2IZSA 3W8QA 3S0OA 3LFBA 2CSNA 3JPVA 3LW0A 4O0YA 5L2SA 3BLHA 1KUTA 4XRJA 4X6RA 1FGKA 3KULB 5IZFA 4BDIA 4MNEB 3TKIA 3G2FA 3NRMA 3ZRKA 2ZV2A 4IH8A 4XV9A 3W2CA 4D2SA 4ZSAA 5FDXA 3P23A 3M11A 4HYSA 4MF0A 4IVAA 4B99A 4RC3A 2XEZA 4RX5A 4GFMA 4DH3A 2O8YA 1RQQA 1B39A 2C3IB 5DT3A 2IWIA 4QP2A 4FG8A 4YU2A 3G5DA 3VUMA 4Z55A 5M53A 2X9FA 4RMZA 3NAYA 4YSMA 2XNGA 4AT5A 5B7VA 2X9EA 3R21A 4EQMA 1FOTA 2GSFA 3NMUF 2F2CB 3V3VA 4E4XA 4I3ZA 4JBPA 4F7SA 4H05A 5AR3A 3DDQA 3DCVA 1PXNA 4GCJA 1ZLTA 4Q2AA 1Q24A 1TKIA 3FL5A 3ZSGA 3U6IA 1H8FA 4UEUA 5M08A 3P5KA 4HVGA 4V01A 4ERWA 3Q3BA 3AD5A 2KTYA 5AUUA 2G1TA 3Q52A 4S34A 5M56A 3QKMA 4O21A 4XV3A 4EUUA 3OW3A 4D1SA 4JVGA 4MTAA 4E4MA 5FXQA 2Z60A 3RK9A 2JITA 2QHMA 3BPRA 3Q5IA 3WE4A 4HZSA 3EKKA 3O50A 4AGCA 1UU7A 4D2RA 2FA2A 4J1RA 4P5QA 4X2FA 4F0GA 4F9BA 5D11A 5GNKA 1GIHA 2PZYA 3NX8A 3Q60A 4D2WA 4DLJA 4I24A 4CV8A 2J0IA 4TPTA 4HOKA 3SOCA 4JJRA 1PYXA 3KXNA 4OGRA 1JBPE 3LHJA 5FXSA 3EL7A 3HEGA 4U41A 3KRJA 4MNEA 4GV1A 3R22A 2W1EA 2YIWA 3VBXA 1G5SA 2J51A 4IANA 1KWPA 2UZWE 2BRHA 4AE6A 3BV2A 1MRVA 1G3NA 3ACKA 3EN7A 4NIFB 3I4BA 5EW9A 4FBXA 2C0IA 4RGJA 5CX9A 4EK6A 5E92A 4I21A 3DBQA 4FSYA 3OEFX 3RZBA 5FBOA 4ZLZA 3H0ZA 1IR3A 2ITWA 4YJVA 4Y5HA 4W4XA 1K2PA 5CAUA 3KCKA 3V5LA 1SVHA 2ZJWA 4FV6A 4XMOA 3UC4A 5EI6A 2ETRA 5BPYA 3LXLA 3NR9A 3PE1A 3QZIA 4JAJA 4E1ZA 4Z7GA 5A3XA 3ANRA 4FC0A 3G15A 2AYPA 2B52A 3CKWA 2YIYA 3ERKA 4J7BA 4E5WA 4GUBA 3UBDA 4YC6A 4CZTA 4FYOA 4O86A 4DT8A 3ODYX 4JS8A 4FKLA 5AR4A 3GCSA 4FR4A 4EEVA 5KMLA 3O7LD 2PU8A 1CKPA 2BILB 2VO3A 3BHHA 3PVWA 2YIXA 3DJ7A 4G3GA 4ZS0A 4AS0A 4QTCA 5DG5A 4F1MA 4LGHA 3UNKA 3QQLA 1XJDA 4ASXA 5CSPA 4LRMA 2H8HA 3B8RA 2FH9A 2YCSA 4I0RA 2VTOA 4ZZMA 2V22A 3ORTA 3OXTA 3UVRA 4CFMA 4DG2E 4XG7A 3PTGA 4EKLA 5LVMA 5LCJA 1XQZA 2X4ZA 5LVNA 2J4ZA 4GW8A 2ZM4A 3RJCA 3NS9A 4KRCA 2R7BA 3QZGA 4NUSA 5F1ZA 3U6HA 3MFSA 5HG8A 1GAGA 1JQHA 4JBQA 4V0GB 3KREA 3U51A 3O17A 3OMVA 5JRQA 1WZYA 2OU7A 4JBVA 5C01A 5I9WA 4QMNA 1Q8UA 1SZMA 5FGKA 3ZEPA 4CFNA 3DKGA 3NNXA 4F65A 5AFVA 1YHSA 4RWKA 2QOLA 3ORZA 1PXLA 1QL6A 3DBFA 3PY3A 1Y91A 4MX9A 5CQUA 4LV5A 4U43A 4QNYA 1OKWA 5CENA 4BZNA 5EM7A 2QQ7A 4IZ7A 2UVZA 2YABA 5D7VA 4D9UA 5G6VA 4HYUA 2OIBA 4YJQA 3AXWA 3TI1A 3UOJA 2I0HA 3A61A 4C3RA 5CT0A 3VS0A 3PDTA 3H3CA 2B9JA 4X6QC 2VRXA 1WBSA 3ORPA 4X3FB 2XK7A 4ZTMA 2QURA 5JFVA 4XG9A 3PA5A 4AP7A 3TXOA 4EORA 3NIEA 1Q62A 2B1PA 1SVGA 5F20A 2VWXA 5HG9A 4AU8A 3SVVA 5HLPA 3R7YA 3RAKA 3A99A 3I60A 4RZWA 4DH8A 2J9MA 3EN9A 3U4WA 4AXAA 4U3YA 2JIUA 2P55A 3LCTA 4TWCA 3WZJA 3EQCA 2YAAA 4QNAA 4RSSA 4BCOA 4EOQA 2BFYA 2EUFB 3ID6C 3ZH8A 5EDPA 2W1CA 1XH5A 2EB3A 2W9ZB 2E2BA 3L8VA 3R7GA 3R63A 5DMZA 5I9XA 3TTIA 3OP5A 4FTKA 4FK3A 3UJGA 2JAVA 4RT7A 4I20A 1WBNA 4J52A 5IQAA 2PZRA 3ALOA 4MWHA 4JDIA 3UODA 3UYSA 4HNFA 4E8AA 1RW8A 1IASA 2ERZE 3Q4ZA 3PIZA 3L9PA 5EM8A 5FEEA 2GU8A 4QMQA 5K5NA 5GIOE 2BIKB 2XIKA 4FL2A 1OKYA 4L9IA 5IF1A 4I6QA 3FE3A 4IAKA 4CCUA 3ZCLA 5I9ZA 4EUTA 1O6YA 4FZFB 5BVEA 5CU4A 2Q0BA 2QC6A 4TNDA 3GEQA 4GJ3A 3LVPA 4ARKA 5HIDA 3QTXA 4YZCA 2IZTA 2BRGA 3D0EA 4K8AA 4AE9A 4U9AA 5HI2A 2UZVA 4PNKA 5AR5A 4A4LA 2B0QA 4MXZA 5TOZA 2ZDTA 2Z7SA 2YM8A 3ZS5A 2QOFA 4E7WA 3EN4A 4H36A 1YOLA 1GNGA 2WMWA 5HVJA 4C4FA 2VO0A 4HCTA 3VBTA 4RFYA 4PTCA 4N6YA 4C3PA 5LXMA 3GB2A 3GCVA 5KHWA 3WIGA 5ETCA 2OFVA 2PZPA 1Z57A 4FSZA 4GEOA 4I5HA 2XK4A 3BHUA 2C5XA 2W4JA 1W83A 2W5BA 4IM0A 3VS5A 1FPUA 4MQ2A 4D28A 1Q3WA 4R5YA 2BAKA 4IB0A 2GNFA 3BEGA 3NLBA 3ATTA 3FKNA 5BYLA 3ZM9A 3OWJA 1OI9A 4JG7A 4XRLA 4RJ7A 1KV1A 1TQIA 3COMA 4AW5A 4FNZA 2W1DA 5I9UA 4B6LA 2XJ2A 3N9XA 4UZHA 3C9WA 4WO5A 5E90A 4XHKB 5M07A 2J0JA 3FZOA 4IM3A 3C7QA 4MBJA 4CTCA 2FYSA 2OXYA 3MVJA 4OAUC 4U40A 1KV2A 4AN2A 3FEGA 3ZOSA 4I1ZA 2WQMA 4KIKB 1U5RA 2OBJA 3V5TA 2B9HA 3SDJA 4ERKA 4E73A 5HLWA 2B9FA 4O7RA 3R9RA 4XH6A 1PJKA 3H10A 1LEWA 4PNIA 4NW6A 5CF4A 4U3ZA 1P2AA 3KULA 3P08A 4GL9A 2LAVA 4IM2A 3QHRA 5I3RA 3MFRA 4QTAA 1ZY5A 1NVSA 2FSTX 5L8LA 2V7OA 1IEPA 2X7GA 3BYVA 3HNGA 4U8ZA 4YPDA 3SAYA 3TNQB 4R5SA 4RA4A 4DLIA 4I94A 2OJ9A 4RBLA 5FTGA 5HIEA 4BKYA 4FZ7A 4X3FC 2UW0A 5BVNA 4FEXA 2WMAA 5DA3A 4O0XA 3R9OA 3I1AA 3AC1A 4F6SA 3T3VA 2R3FA 4JNWA 3QALE 2PMLX 2BKZA 4DINA 1PYEA 4HGLA 2VTRA 5E8ZA 3KK8A 5CEIA 2C6IA 4AZEA 4G5PA 2C3KA 2XKFA 3DBCA 3GCUA 4FV4A 2VX0A 3A8WA 3MI9A 2HY81 1X8BA 3HMOA 2HAKA 4W4VA 4L68A 3NZ0A 1YQJA 1S9JA 1WVWA 3BQCA 3LFAA 3NCZA 3P86A 4YJNA 2WQOA 4ITJA 2OK1A 4WNMA 3SKCA 4ANMA 2P3GX 3LIJA 3IW6A 3KN6A 5DBXA 4BYIA 4PPCA 5CALA 3K5VA 5CU3A 2E9NA 2BKKA 2BR1A 5F95A 2JLDA 5IQIA 2RKUA 3R00A 3E8NA 4FTOA 3I6UA 3MFTA 5KMNA 2X81A 3IQ7A 3FV8A 4DH5A 1ZYLA 4FIFA 1MUOA 3FZTA 3ULZA 4O1OA 3UO6A 3HECA 2HCKA 3CD8A 1VZOA 3THBA 4F9CA 5EI8A 4UV0A 2QR8A 5LVLA 3QRIA 2WTWA 5GJFA 3DBDA 4MEDA 3UYTA 4EJ7A 4HZRA 3RZFA 4Y73A 5IA1A 4TYEA 3OFMA 2JKKA 4I4FA 4AZTA 2EXCX 3DOGA 3LOKA 3D7TB 2ZVAA 3HL7A 3POZA 4FV9A 4GU6A 4P2KA 5ANGA 4DTAA 3RI1A 3RVGA 1GY3A 2PUNA 1BX6A 4WT6A 5HESA 2YJSA 3IOKA 4IX3A 4YJUA 3HGKA 3VC4A 5C8NA 5LWMA 4DBNA 3LLAA 2WEVA 2IVUA 4I6HA 5CU2A 3CGFA 2XK8A 3DU8A 5HEZA 5IDNA 1YXTA 2XRWA 3A7GA 4MF1A 3SG8A 4ASDA 2BHHA 3LMHA 4OTHA 1YW2A 2WMSA 4JL9A 1RJBA 4TWOA 4FGBA 2PE1A 3QX4A 5JEBA 5E1EA 2UW5A 4EHEA 5HBEA 1LP4A 4WUNA 2W1GA 3PA3A 2F57A 3LFEA 3Q04A 4FTNA 3ULIA 3TM0A 2QLQA 4E4LA 2OZOA 1SYKA 2QNJA 3RK7A 5E7RA 2V55A 4L01A 4X2NA 5J95A 4Y46A 4BTJA 2E9UA 4TW9A 3QCSA 4IFGA 3A7FA 1BI7A 2HXQA 3H9RA 3FLSA 3MSSA 3TUDA 5FUTA 2WPAA 3DTCA 4L42A 4ZY6A 4TWNA 1Q99A 4RIWB 3W55A 2YWVA 2BPMA 4AN3A 2G2FA 4WD5A 4ASZA 4WA9A 5H9BA 4PY1A 5TKDA 4C62A 4LRKA 3MVLA 1PMEA 2JDRA 2ETMA 4ZTQA 4K1BA 4BKZA 4FX3A 4RIXB 3OG7A 5E8WA 4DFXE 3KEXA 1NA7A 4EHZA 3RALA 2PE0A 4U5JA 3UMXA 1YDTE 2NPQA 3E93A 3R8LA 3A60A 5AMNA 3COHA 1BI8A 1U5QA 4W9WA 3TKHA 3HLLA 4TYHA 4AGWA 3PPKA 4BF2A 3VO3A 3DBEA 3VS3A 3MH1A 4XBRA 3E64A 2Q0NA 3IO7A 3QYWA 4YJPA 4D4SA 3FMEA 5CAVA 1H28A 3UNJA 3QZFA 5BVKA 4FKUA 2CCHA 2Y6MA 3TIYA 3RWQA 3HV5A 2XCHA 4G3DA 2IW8A 3BCEA 4GYIA 4IAZA 3GFEA 3R83A 4MD9E 4NKSA 5CF5A 3D7TA 3QWJA 2UZBA 3PPJA 4IJPA 1R3CA 2ITYA 5AM6A 3HV7A 5T68A 4DTBA 4GK3A 5TE0A 3KY2A 2EXMA 2NRUA 4KBKA 3I0QA 4WIHA 5EOBA 1HOWA 3W16A 3IW7A 4XP2A 1UA2A 5CEKA 1OPLA 3L9LA 5CF6A 4CMTA 3ORLA 3OT8A 1BUHA 1OL5A 2PUPA 3NSZA 3IW5A 2YM6A 4TNBA 3SC1A 1F0QA 2XNBA 4FT3A 3F3TA 2XIRA 1W82A
chains in the Genus database with same CATH superfamily
4MBIA 5DT4A 5KCVA 3UZRA 4OTRA 3GGFA 3W0QA 1F3MC 3CSVA 4XEYA 4KBAA 4FOCA 2Z7QA 5AJQA 4G3FA 2PUIA 2QONA 3BI6A 3OCBA 4JXFA 5DWRA 4V04A 4L46A 5FG8A 4OR5A 1UV5A 5L6PA 3FAAA 3HRBA 5EYDA 4NM0A 5JMSA 3EN5A 3FHIA 3D7ZA 2QO7A 4GG7A 3A8XA 4FL1A 5GJGA 5HE1A 4CKRA 2CGWA 2ERKA 1PXOA 3NUSA 4YHFA 3VS7A 3QUPA 4WG5A 3A7IA 4EYMA 5AIRA 5LWNA 4YJSA 3FLQA 4NCTC 1PHKA 4CFFA 4O4EA 3REPA 4XLIA 5IQBA 3FZSA 4GK2A 3B2WA 3BHTA 4Z7HA 2H9VA 3CTJA 3CD3A 3D2KA 2F7EE 5J7HA 2EU9A 1PRYA 1YVJA 3JS2A 2W9FB 2WU7A 3O51A 4BDBA 3GP0A 5KBQA 3W32A 3KMWA 4XV2A 4FEWA 3VRZA 1R39A 5A9UA 5BVFA 4C34A 1XHAA 2RFEA 4G5JA 4XG8A 4BCKA 5AA8A 4KS7A 2W05A 4P7EA 4IMYA 3MESA 4MWIA 5J1VA 3FI3A 4EH2A 5HE2A 3SLSA 4ANNA 2AQXA 4FTUA 4C33A 3N4UA 3TDVA 3SXFA 5DE2A 2CPKE 4DG3E 3WZDA 2EVAA 2WTKC 1HCLA 3FMMA 3IW8A 2XS0A 3OD6X 2PMNX 4HJOA 2YWPA 3SV0A 5ACKA 2YISA 4M97A 4XG2A 2WTJA 4FODA 4PX6A 2YERA 3CKXA 4CEGA 1IA9A 5HVYA 3WZUA 1OECA 2WQNA 5AAFA 5EM6A 2BTRA 4AXFA 5ANJA 3W2PA 3TMOA 2X6EA 4GVJA 4F0FA 1RDQE 3DAKA 4C3FA 4I4EA 2UW7A 4AQCA 3PFYA 5CVHA 1UNLA 2HZ4A 2WKMA 3EYGA 3LCDA 4O0WA 5CXHA 4B4LA 1H1SA 5AADA 4FKPA 3TZ7A 4EYJA 1L8TA 3AMBA 4UXLA 2PVLA 2O64A 4XX9A 4E5BA 1SNUA 4R3CA 4TWPA 3O8PA 3EIDA 3QTWA 5GIPE 5H8EA 2XM8A 4QYEA 4CXAA 3FQSA 3KCFA 4RFMA 3PFQA 1G8AA 3RCJA 4EOPA 2BALA 2GQSA 1R0EA 3GT8A 1KOBA 4O7TA 2ITXA 5ITAA 3EL8A 5KE0A 3QTSA 2BAQA 3PE2A 4FTJA 5DVRA 3U6JA 4O4CA 5EYMA 1PXIA 3QQGA 2VWIA 3EMGA 4YR8A 1FBNA 2FO0A 2OWBA 3E7OA 1BL6A 3OTUA 4NJDA 4UN0C 3QRKA 4FYNA 4IAFA 5E8YA 3KXGA 3FSKA 4HVDA 3RAHA 5IEYA 5DNRA 2RFDA 2GCDA 2QR7A 2WTIA 1GJOA 2Q83A 3ZMMA 4TN6A 3OS3A 4RA5A 2W1ZA 4D0WA 1PXJA 1U54B 4FTMA 4MK0A 3UIBA 4BBMA 5LMKC 1FMKA 3AT3A 4GJ2A 3W0RA 2WIHA 5KMJA 5K4IA 3AC8A 4FA2A 3VQHA 2YLFA 4GT4A 4DEGA 4QMLA 3MWUA 5ETIA 2JDOA 4IZ5A 3F66A 2AUHA 4RJ8A 4AX8A 4RC2A 5J5TA 3D2IA 4XLVA 3L1SA 1QCFA 4O7NA 2OH4A 1H26A 3OUNB 4UWYA 3JY9A 3L8SA 3V6RA 2CGUA 3VS4A 2WMBA 5KMIA 4DBXA 4P5ZA 1DI8A 3UOKA 4USFA 3OHTA 1GIIA 5ANIA 1YXVA 3HMPA 5HVKA 4AXDA 3ANQA 4ACCA 5A4CA 1Q8YA 4RVKA 4ALVA 5DRBA 3AKJA 3G0EA 4I5PA 1XBCA 4QMVA 4E4NA 1CMKE 4TYJA 3FC1X 2C47A 4C57A 1J1BA 4EH6A 5HD4A 1WBPA 3PRIA 2BZJA 3P79A 3E88A 3G9LX 4AFEA 4B8LA 4O7SA 5IISA 2XB7A 2IN6A 5CTPA 4JX3A 2HZ0A 3TUCA 3T9TA 5BVOA 5BMMA 2HELA 1WVXA 4XCUA 2F7ZE 3QC9A 4QMWA 1MRUA 3Q5ZA 4O0TA 4FVRA 4L6QA 4WNOA 5DEYA 2NYAA 4BCIA 5EHLA 5B2KA 1KE9A 3UIMA 3F5XA 3R30A 3TV7A 2XBJA 3E7VA 4IVBA 3GNIB 4ZSEA 5L8JA 1JKLA 2ZB1A 4WOVA 3TNHA 2FSOX 4V0GA 4FV5A 4FMQA 4YTFA 4EH5A 2XAMA 4AZVA 4TYHB 1UVRA 2UZTA 2ZYBA 4BZOA 3BRBA 5LARA 3I7BA 5JFXA 2XKDA 2VTJA 1Y6BA 4JQEA 1OGUA 5M44A 4NCTA 4E6AA 2UVYA 3NUXA 2OO8X 4I23A 4O6LA 5AP3A 3FMJA 1KOAA 3FHRA 2WXVA 4DDGA 1MRYA 4D9TA 5AM7A 4E3CA 3HP2A 4NIFA 5KMKA 3HP5A 1R78A 3Q2MA 4CZYB 2I6LA 5BUEA 1RE8A 3MY0A 3GQLA 2OKRA 2ESMA 2UUEA 3PWYA 2QG7A 3KMMA 4TTHB 2R3RA 4KKHA 4GFGA 3ROYA 2C5YA 4APPA 2G01A 1ZOGA 4O1PA 3R1YA 4CNHA 5BUJA 2Y8OA 1DM2A 4R3RA 5M06A 4HYHA 4WNKA 3ZSHA 4C2WA 3K5UA 2WMQA 2C6DA 4AOIA 4IAAA 5HORA 3D83A 4FVQA 3KRXA 4XNEA 5CQWA 3HA8A 3LXPA 5BNJA 4X21A 1JKSA 3Q4UA 3QZHA 3V5PA 3TCPA 4FKIA 3A4OX 4PDSA 3LXKA 4RLKA 1Z9XA 3GFWA 3PIYA 4G6NA 4GVAA 4NM5A 4G6OA 4BDCA 5I9YA 3HUBA 3A62A 3GI3A 4J71A 3G51A 4X2GA 2ITNA 3QWKA 3MFUA 3LM0A 4Y95A 5H8BA 3RBWA 5ETAA 1YXXA 4NSTA 5L8KA 5C4KA 1ZYCA 4I92A 3NPCA 3VULA 5CI7A 2V5QA 1PXPA 3C4XA 3OEZA 4QTEA 2ACXA 2JDTA 4L00A 4S32A 5AUWA 3E5AA 3VBVA 2QLUA 3EZVA 4BDKA 2VTTA 2WAJA 4GS6A 2BVAA 3IDBA 3UG1A 3QD3A 4GU9A 4CFUA 5C4LA 2BRNA 4MCVA 3QD0A 4TYGA 1JVPP 3O8UA 2YEXA 5FBNC 3MDYA 3Q9YA 5IMXA 3HDNA 3COIA 1H08A 3TZ9A 1SM2A 3NVKI 3V8WA 3VJOA 3TNIA 3DDPA 1DI9A 3LM5A 3QGYA 3O23A 3KXMA 4L52A 5EH0A 4L7SA 4DCEA 2PTKA 3R73A 4CZUA 2CKQA 1A9UA 5IEVA 2I40A 4ANLA 3DJ5A 5AX3A 2OXDA 4PMPA 3ORNA 2YCRA 4LG4A 1ZWSA 4BTKA 2GNGA 2OJJA 3OW4A 3FI8A 4YTCA 3R01A 2HYYA 2WTDA 3TUBA 3R2YA 2GHMA 4IVDA 4L3LA 5AV0A 4HVSA 2OJFE 3AOXA 3C4WA 3OTVA 4YNEA 3RNIA 2VAGA 4NT4A 4E93A 4AZWA 2F9GA 3OOGA 1LR4A 1L3RE 3QYZA 4GFOA 3PYYA 2VNYA 3DQWA 1JSVA 3OZ6A 4IAYA 5AV2A 3ZBXA 5E1SA 4B8MA 1BYGA 3PJ8A 4ID7A 3SHEA 3OBGA 3Q2JA 1QPJA 3DQXA 2XALA 4L3PA 4MKCA 5ANDA 1YWNA 3P4KA 3SW4A 4DYMA 2XK3A 2R3NA 2XZSA 3KRWA 5ANEA 4YP8A 4WBBB 3GQIA 3SQQA 4N57A 4MXOA 4USEA 2VTPA 3HRFA 2X0OA 4OBQA 4ACHA 5CSHA 2WMXA 4OTFA 4OTGA 3TWJA 1STCE 3AC5A 3G6HA 4RFZA 3WIKA 4I41A 5AEPA 3QKLA 4A06A 4EZ5A 1AD5A 5HE0A 3ORKA 4S2ZA 3RM6A 5BX0A 3MY1A 4FKQA 4LDTA 3MVHA 4O7WA 2REIA 1BL7A 2ETKA 4GSBA 4AA0A 2KULA 3D9VA 5DH3A 4FGRA 3TV4A 3BU3A 2R3OA 4J96A 3NYOA 3ALNA 5IUIA 1W2DA 3WF8A 4X0MA 2XBAA 3A7HA 3DKOA 4Y72A 4KIKA 4BCPA 3DXPA 4M13A 2QOOA 4KS8A 3AMYA 4NM3A 3MN3A 2YCQA 5AV1A 3BKBA 5HD7A 3BL7A 1YWVA 2NP8A 3F3WA 3W1FA 3IOPA 4B9DA 4LOPA 2CN8A 3RAIA 2F2UA 3FPQA 1YHVA 4UMQA 3VHKA 4BYJA 3OWKA 5L2IA 3HV4A 3HAMA 1ZMVA 3TG1A 4QPSA 5TO8A 5JGDA 4YJRA 4CMOA 3C5UA 4FG9A 4Q9ZA 1XH9A 4FT5A 4ZTHA 5I9VA 1WBOA 3V5QA 3UE4A 3FMNA 3IONA 4IHPA 4KAOA 3RPYA 3BIZA 3VAPA 2PVKA 4CQEA 5C26A 4PDOA 5DLSA 3H9OA 3IECA 1UNHA 3JVRA 4FG7A 5CEQA 3R7EA 5BVWA 3P0MA 3C5IA 2WTKB 4O6EA 5EW8A 1E1XA 5A54A 3MY5A 1OPKA 4F09A 3B8QA 3KF4A 3FSFA 3AC3A 5HGIA 3G6GA 2CNQA 1WBWA 1R0PA 3DB6A 3V5WA 3HV3A 4CYIA 2ZV8A 4BCQA 3HVCA 3PRFA 1W8CA 1OKVA 3EQRA 3GC8A 4AOTA 4Z9LA 3BYMA 4C4GA 3U55A 3R9HA 3PUPA 2HOGA 4RX9A 4O7VA 3R7IA 4ASEA 3FYKX 3D5UA 1LEZA 1Y8YA 3F69A 2WMTA 4D55A 4ONAA 1M52A 3MJ1A 4W8EA 4E6QA 2JKOA 3TTJA 5IH6A 4YZ9A 4LMNA 3II5A 4KKEA 2CLQA 5IMEA 4L7FA 4BDGA 5JH6A 2JFLA 1IRKA 4RIWA 1FVTA 2C6TA 3VRYA 4PV0A 2YIQA 5CLPA 3KL8A 3IKAA 2O63A 5FEQA 1XR1A 1M2QA 5EHYA 4BTFA 2OFUA 5BYZA 1KSWA 3CPBA 2F7XE 4UYNA 2UZDA 4FSRA 4O38A 4R1VA 3UVPA 3WARA 4E26A 3SA0A 4R7BA 2BDJA 1YDSE 4I22A 2XNNA 2GDOA 2VWWA 2YIRA 3ORXA 1PMNA 3TJCA 2CDZA 4KINA 3CC6A 4QQ5A 5I3OA 3ROCA 3CTQA 5BMSA 3QXPA 3HAVA 5BUIA 1JLUE 5KMMA 3PSCA 4JT3A 2CMWA 4A07A 2YJRA 4D5HA 2QOIA 4I0SA 3TNWA 3FMLA 4BN1A 4MXYA 4QMUA 3OWLA 4LFIA 3PY1A 4QP6A 2OJIA 3E87A 3H9FA 1J1CA 4ACGA 2Z7RA 3ZUUA 5E8SA 4BKJA 5K9IA 4ENYA 2HXLA 3G33A 3TN8A 5AP6A 3I79A 1QPEA 4RX8A 5FQDC 1OBGA 3KQ7A 3PG1A 2WNTA 3VBWA 1H1PA 3CS9A 1J3HA 3CEKA 3EQGA 3QQKA 5TT7A 5LMKA 1B38A 3EHAA 3VVHA 3ZDUA 2I7QA 2NRYA 3NNWA 4FZ6A 3NNVA 3U8WA 3ZXZA 5KMOA 5HTIA 3LQ3A 2YA9A 3EN6A 5ANOA 5JRSA 3D5XA 2V0DA 4DHIB 5AUXA 1H00A 1OL1A 2GTNA 2OSCA 1XBAA 2XMYA 3V04A 2OIQA 4IB3A 4UX9A 1OIRA 3EFWA 5L4QA 3R8PA 4F78A 2A27A 5DR9A 4NU1A 3RP9A 4F7JA 4HW7A 3OXZA 1WVYA 3A7JA 4JX7A 4YBKA 4AWIA 3DK7A 4DDIA 3F3UA 1H1RA 1XWSA 3BV3A 4QQTA 3DXNA 1ZXEA 4XBUA 2EB2A 1H0WA 3GC7A 3VUIA 2F4JA 4O0UA 5M57A 4M84A 4J98A 4ACDA 1FVVA 3W2QA 2CGXA 1VJYA 3I0OA 4JDHA 4A9TA 3PXRA 4TY1A 3T3UA 4F63A 3WZKA 3QXOA 5B2MA 3JYAA 3TT0A 3H0YA 3VIDA 5B2LA 3V5JA 3NAXA 5L2QA 4R3PA 2R0IA 4RJ5A 4AZSA 3DZQA 4DT9A 4O4FA 5IUHA 4IZYA 2PL0A 5CZHA 2QHNA 1ZOHA 3F61A 4FTLA 3VUGA 5E4HA 5FLFA 4RJ6A 5FWKK 5IQEA 2JC6A 5JT2A 4BIDA 5CASA 3DB8A 2ZM3A 1IG1A 5AP0A 2X2LA 5CZIA 3ZEWA 3VBQA 5BQ0A 4RVLA 4HCVA 1ZARA 1Q8WA 3NUYA 1ZYSA 5ACBC 5HQ0A 2OF2A 3BGZA 3OC1A 2A4LA 3R8MA 4BGQA 3FC2A 2DWBA 4TL0A 4CG8A 2QOBA 3CE3A 2WQBA 4HCUA 3IDPA 4OT6A 4FKWA 3UQFA 3AQVA 3OVVA 3F2RA 2PZ5A 2XNEA 3LQ5A 3ODZX 3QCQA 4XG4A 5CU0A 2YZAA 2CCIA 5E91A 1OPJA 5FEDA 4ZJJA 5AP1A 4ZEGA 2B53A 2ITZA 3LZBA 3CLYA 3R02A 3BELA 4FV3A 3JVSA 3R9DA 3UIXA 5A4EA 2I0VA 2VWBA 1JAMA 4IE9A 1OVEA 1Q97A 3MBLA 2X4FA 3RAWA 3FPMA 2VGPA 4JBOA 3PXYA 3QD2B 4FUXA 4Y85A 5HIBA 1JSUA 2E9VA 3UPZA 2ZAZA 4DEDA 2C4GA 4UB7A 2VTAA 3CPCA 2WOTA 3H30A 3OROA 5GZ9A 3VUTA 1WMKA 3G0FA 1W84A 1YI6A 1E1VA 4G17A 4PMSA 4F1OA 4ZMFA 4Z3VA 3VS2A 2DYLA 2QOQA 3QD4A 5CAOA 5DR2A 3RPOA 1UNGA 4LI5A 3ZO3A 4X7QA 3EFJA 1ZY4A 4CRSA 5AAEA 3VS6A 1ZZLA 3BHVA 3GOKA 2Y0AA 4O7YA 4GIIA 5EQPA 3UOHA 2IW6A 4JIAA 2G2IA 5DR6A 2Z2WA 3K3IA 2RFSA 3Q96A 4O0VA 5HCYA 4JAIA 4AA5A 3PP1A 1OUKA 4D2VA 1OL7A 2ZV9A 5GHVA 4D0XA 2A0CX 4H39A 4EOOA 1OMWA 1YHWA 3MH2A 2WU6A 4IZAA 4P4CA 5HLNA 5AP2A 4QMZA 1WCCA 3FL4A 4BBFA 5AAGA 4AXEA 4U80A 4FKVA 5HCXA 4RG0A 2FSMX 3C0IA 1PKDA 4FNXA 2RGPA 5DHJA 3UQGA 4X2KA 4YC3A 4EOSA 4HPUE 4JRNA 2CJMA 3FUPA 3UPXA 3NWWA 4QMPA 5IH4A 3JY0A 4FV2A 2WMVA 4CLJA 4FIIA 5FRIA 5EG3A 3JXWA 4HNIA 4AXCA 2C6KA 2W17A 2YDIA 1ZOEA 5JZJA 2PVNA 2R7IA 2XNMA 3LAUA 2R0UA 3ZO1A 1J7UA 1CKJA 4CKJA 3DFAA 4DH7A 1H4LA 1CSNA 3FXWA 1GZNA 2FUMA 3DAJA 3O2MA 4GK4A 4UZDA 4BI0A 5TF9A 3V8TA 4C0TA 4N0SA 2F49A 5M09A 3L8XA 5CS6A 4I0TA 1AQ1A 3DAEA 4LOQA 3D5WA 3QC4A 2C5VA 4K77A 2V62A 4CKIA 5EDQA 4K6ZA 1ZRZA 4RWLA 4S31A 4NWMA 1UKIA 3R6XA 2BZKB 3PY0A 4OTWA 4V05A 2I1MA 2QODA 5CY3A 5ETFA 4DFYA 2R5TA 2RIOA 2OICA 3DNEA 3PZEA 1DAYA 2XP2A 4NH1A 3UO4A 3ORMA 4K9YA 4BCMA 5HNGA 3HZTA 5M4IA 3UZTA 3CJGA 3O7LB 2W1FA 5K0XA 1A48A 2SRCA 3AGLA 3IDCA 3QCXA 3UDTA 1ZYJA 3S4QA 3A2CA 4ZLYA 3MIAA 3W0MA 4QP3A 1ZAOA 3FLWA 3C4CA 4FIHA 3FBVA 3I5NA 4AW1A 3CJFA 1SVEA 4D1ZA 4O84A 1BKXA 3LFCA 1H27A 1Q5KA 2G9XA 1YXUA 3LFNA 3H4JA 2YM3A 4QQCA 4XS2A 3UDBA 4EH3A 1PY5A 2WB8A 2XYUA 3BLQA 3TZ8A 2YM4A 3EKNA 2QOCA 2R3IA 4JRVA 3EZRA 1XBBA 1OITA 1QMZA 4G3CA 5EKOA 2ITQA 4OAVB 4RIOA 3QAME 2H6DA 3Q4TA 4BWPA 3F7ZA 4NK9A 2OJGA 5A4TA 3RCDA 4WRSA 4AT4A 1CM8A 1JSTA 4WSYA 4JG8A 2UW9A 3DLSA 2GHGA 3QCYA 3ML1A 2IZUA 2GS7A 3BBWA 3LJ1A 3BU5A 4OTIA 2W5HA 3P7AA 3E92A 1YOJA 4J99A 3ZLYA 4DEAA 1M2PA 4H3BA 1TQPA 4S30A 5GZ8A 3DLZA 4O96A 3LMIA 1P14A 5DGZA 4DA5A 3UDSA 4MBLA 4N4SA 5IU2A 5KKRC 3BGPA 2CNUA 4FV7A 1NXKA 3NNUA 1Q61A 3DFCB 2GFSA 2AC5A 3LCOA 5AUYA 4CT2A 4E5AX 5M55A 1WFCA 4IWQA 4KABA 2OF4A 3NW6A 4YPSA 2YDKA 2ZV7A 1OL2A 3CQWA 4C7TA 4D1XA 3WZJA 2B9IA 2BTSA 4EC8A 4W8DA 2VZ6A 4NFNA 2C5OA 3FY0A 4FIEA 5M51A 5IA4A 3PXQA 5HOAA 3QLGA 3ZONA 3DPKA 3DTWA 2HIWA 4M68A 1YXSA 1E9HA 2YFXA 4J8NA 4MQ1A 4YLKA 3T9IA 3TJDA 3LCKA 3QLFA 4CTBA 4ZOGA 2VTMA 4L67A 1YI4A 3OT3A 3TKUA 3WI6A 1JNKA 2RG5A 2UZOA 3D4QA 4F6WA 4PMTA 4Q5HA 4RC4A 4BCNA 4PDYA 2VTIA 4RPVA 2UW8A 2Y4IB 3F88A 4O22A 4EONA 3U54A 5HICA 3MH3A 1DAWA 3NGAA 2G15A 2R3LA 1KE7A 2X8IA 4M0ZA 5IH5A 2FSLX 2W7XA 5DIAA 5DYJA 3KKVA 1HCKA 1XO2B 3HUCA 2J5EA 3M2WA 4IX5A 3K2LA 4MXCA 3KXHA 4IWDA 4QMOA 4FTIA 4EHGA 4DCAA 4JDKA 3FQHA 4NJ3A 2RSVA 3R8ZA 3PJ3A 4ZTLA 5AA9A 2IEWA 4IWOA 4F9YA 3UDZA 5CNOA 2PUUA 2C6EA 3E8DA 3L9MA 5G1XA 1J7IA 1IAHA 3IGOA 1UU8A 2PK9A 3FMDA 4ZSGA 4OTQA 3PVGA 5HE3A 3FY2A 4KWPA 4MNFA 4A9UA 4F9WA 3M42A 4BDJA 3PLSA 3C13A 3OCSA 1Y8GA 3R2BA 3E3PA 4FNWA 4I5MA 3O8TA 2HW7A 3AT4A 4ITHA 2FVDA 4MXXA 3RNYA 4F4PA 5I5ZA 5IG1A 5CU6A 4K0YA 3ZRMA 5KO1A 3LFDA 3Q9WA 2O65A 2C69A 5JQ8A 4KUJA 1UWJA 3ENHA 4CFVA 3UP2A 4ANSA 4XV1A 1VR2A 2J50A 1H25A 4FT0A 4FSMA 3PSBA 4DEHA 3GOPA 1ST0A 4ZSLA 4PF4A 5E8XA 2BIYA 2Y7JA 4CCBA 4C4IA 4YJOA 1V0PA 4FI1A 4DGNA 4BDFA 2ONLC 4EWQA 3R7UA 4IXPA 4HVHA 4KSPA 2XCKA 3TACA 2XNOA 4C59A 5HNIX 1J7LA 3GU6A 4ZLOA 4GKHA 3KK9A 4F99A 4JR7A 4EK8A 3WYXA 2GFCA 5JZNA 2HENA 4TYIA 5KZIA 4D5KA 4UWCA 1U59A 3NYXA 2YZLA 2C6OA 4X3FA 3VUHA 4C37A 5EHOA 4C2VA 2C1BA 4YGAA 4E20A 5KNJA 4FTRA 2OG8A 4CG9A 4NTTA 4NFMA 4B0GA 3HV6A 1TFFA 3MPTA 3D5VA 2XIYA 2X6DA 4JQ8A 3C4EA 3PJ1A 4O83A 3E62A 4QQJA 3I6WA 4FICA 5AP7A 2GQGA 2HZIA 4TKSA 4ZK5A 4EZ7A 4FSTA 3PXZA 4FUYA 2WEIA 4M69A 3T8OA 4AGDA 3HRCA 4FV1A 2J7TA 1W2FA 4FVPA 2XARA 4KIOA 4LUEA 4KB8A 5EDRA 2Y6OA 4C02A 5IEXA 3CBLA 3E8CA 4YBJA 4O81A 4D58A 2VWVA 1WBTA 3BX5A 5LMBA 4PWNA 2QO2A 5KKRB 4IFCA 4O2PA 4MYGA 2PY3A 4QT1A 3RKBA 3TIZA 5JGBA 4D4YA 4MHAA 2VWYA 4HGSA 4ORKA 1I44A 4A4OA 2WTCA 3R8VA 2BAJA 3AT2A 2DUVA 3EQFA 4G6LA 2VX3A 4BDAA 2XRUA 3VBYA 5AWMA 4JOAA 3W0PA 4IC8A 1REJA 3AD6A 4LRJA 3EB0A 4EH4A 3HYHA 2CNVA 4M12A 4O91A 4NZWB 5IQHA 2QOKA 1TQMA 4EOJA 2A98A 4ZTRA 3QRTA 3RPRA 2IJMA 2C30A 4QMSA 5A6NA 3GU7A 2ZMDA 4M3QA 3AKLA 2PYWA 3GENA 2VTHA 3K3JA 3KXXA 4BL1A 5IQCA 5AUVA 3R04A 3EQDA 1U54A 1WBVA 3R1SA 3PLAE 4X3JA 4AG8A 4AOJA 3U87A 4OBOA 2WELA 4EC9A 3Q32A 3QUDA 4LL5A 5J7BA 4K11A 1M2RA 4USDA 1I09A 2UW6A 4FKJA 4YLLA 4IB1A 3MJ2A 1H1WA 3GC9A 4I6BA 4DFBA 2JAMA 3GUBA 3PXKA 2JEDA 4QYHA 4B7TA 2QKWB 1F5QA 3M1SA 4H3PA 2OIDA 4PTEA 3SRVB 3VUKA 1VYWA 1ZMWA 3PSDA 2J0LA 2OGVA 1QPCA 3C50A 3MW1A 4M0YA 4IDVA 4N6ZA 4BB4A 4C4EA 2ZB0A 3CXWA 2ZOQA 3FKLA 3E8EA 1KE8A 2B4SB 2YN8A 3KIOC 2CKEA 4OTDA 4EZ3A 4QPMA 2QOHA 3VW6A 4CT1A 5IA5A 3ZFMA 3NYVA 4AW0A 3N4TA 2OLCA 2YDJA 5IUGA 2XA4A 4IW0A 5LCKA 3G90X 3P9JA 3WOWA 5HKMA 4YSJA 2UV2A 3D15A 1M7NA 2Y4IC 3VW8A 3BYSA 5A4LA 5JFWA 2C1AA 1VLRA 3P5JC 4JLCA 1H0VA 5EOLA 4A4XA 2VTLA 3O71A 5JSMA 2XVDA 2VGOA 5AR8A 2X2MA 3BGQA 4N70A 1Q4LA 2XK6A 3EQHA 2JKQA 3UNZA 3L9NA 3HX4A 4RIXA 2C3JA 1SMHA 1O6LA 4DC2A 4LGDA 1ERKA 4JDJA 4G9RA 1Z5MA 4QRCA 5EK7A 5C9CA 4IAIA 4AUAA 4GT3A 1GZ8A 4OW8A 2EXEA 5F94A 1MP8A 3ETAA 1Q3DA 4FOBA 4RQKA 2QG5A 3ZLWA 4KKGA 3PZHA 5JGAA 3KVXA 4U79A 5HO7A 1YOMA 4RVTA 5C03A 3ZC5A 3CTHA 4BVUA 3NW5A 3COKA 4AZFA 3HDMA 2C68A 3R1NA 4OLIA 2WIPA 3HA6A 2WO6A 2J6MA 3F3VA 4OBPA 2LGCA 1NVQA 4LYNA 2R3GA 4J97A 2NO3A 3CR0A 3NUUA 5CWZA 4YO4A 5FXRA 4KBCA 1M7QA 1Q8ZA 5DPVA 5LOHA 4BIBA 3PVUA 5HTCA 4QYYA 2BRBA 4DH1A 4JMQA 5CYIA 3IGGA 5AV4A 2NNWB 3S3IA 3QTRA 2HZNA 3DZOA 3QGWA 4QO9A 3S00A 2UW3A 3LPBA 3WF7A 4A9RA 4FIGA 4MD7E 5A14A 3AKKA 4DHZA 5FM3A 4OTPA 1CKIA 4GKIA 1VEBA 3QTZA 3FQEA 4IACA 2XK9A 2ZM1A 4BHZA 2BROA 2V7AA 4F7NA 4FZDB 3OCTA 2PVRA 5K3YA 4EH8A 5DEWA 4ENXA 3U9CA 5FDPA 4D2PA 4RIYA 1K9AA 4ZTSA 4YUQA 3FXXA 4U81A 4FE2A 4UMPA 1GZKA 1ST4A 5EI2A 1UU3A 5CANA 3DS6A 2B54A 3I5ZA 4BWXA 3EWHA 3Q53A 3CP9A 4PP7A 4BY9E 2PMIA 3ZO4A 4ALUA 1OM1A 4DGGA 4C4HA 3ZDIA 5JQ5A 5CNNA 5CEMA 1PF8A 3FLNC 4L43A 5EYCA 3RPVA 4EK5A 4H3QA 4F08A 3E3BX 5AIKA 2XNPA 2C5NA 4Y5QA 4DITA 1EH4A 1M14A 2RFNA 3C4FA 3RM7A 4WHZA 4LOOA 1FMOE 5EW3A 4YLJA 4PL4A 1O6KA 3CCNA 1XH7A 2J90A 5IDPA 2PVMA 4WG3A 3LCSA 2XIXA 3UMWA 5IPJA 2AEGA 2BHEA 2W06A 3QQUA 2WFYA 2XIZA 4O27B 4ZXTA 3BWFA 3FKOA 3MTLA 3WZEA 2GHLA 4YJTA 3DY7A 4NEUA 2BZIB 3O0GA 3FZPA 4EK4A 3MB6A 3CY3A 4BCJA 2OI4X 2PSQA 3KVWA 4WUAA 3V6SA 4C36A 4FTTA 1J91A 2JIVA 3VNTA 4RLLA 2YLEA 4KSQA 3DGKA 4O0SA 3GU8A 4QP8A 1NT2A 4AT3A 5CSWA 3KGAA 3F3ZA <