4O0YA

Back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Back Pocket Flexibility Provides Group II p21-Activated Kinase (PAK) Selectivity for Type I 1/2 Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
total genus 96
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o0yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o0yA01
4ANLA 4BIEA 5LQFA 4R1VA 3D4QA 5J9YA 2ZB0A 4ZJIA 3HV3A 4QYYA 4DGNA 3IG7A 2XBJA 4XEYA 3NYVA 4MXOA 3SRVB 4BCPA 4Z16A 4LQMA 2V22A 2XRUA 4O7ZA 2W5AA 3HYHA 4KRCA 4TNBA 2UZVA 4YBKA 3MIYA 4PUZA 5DR2A 2PZ5A 2JD5A 2YM6A 5JGDA 2AYPA 4ZTQA 3E8DA 4DEAA 4RZVA 3ZOSA 4EWHA 2C5NA 5I9UA 1XHAA 5AADA 2F49A 4EC8A 2Y0AA 4BWPA 4I24A 5JKGA 4DGLC 4O0VA 3I81A 1BI7A 3QUEA 4BCIA 2ZDUA 4YZBA 5EYCA 4AA4A 4ZY4A 2C0IA 3EIDA 2XK3A 3BZ3A 3L8SA 4OAUC 3ATTA 5H3QA 3H10A 2O65A 4FKRA 2BHHA 1G3NA 5H8EA 3KVXA 2JBOA 4BN1A 1QPCA 2VAGA 3FLWA 4ZS4A 3DK3A 2UW6A 3NYNA 3PRIA 4E20A 5LXMA 1T46A 2PWLA 4ACGA 2CKOA 2X8DA 4XP0A 3R9HA 4Z7GA 3I6WA 2FSLX 3MESA 5DE2A 5DYJA 3FZOA 4ZMFA 3TM0A 4A7CA 4ITJA 1J1BA 3KXZA 1CKJA 2OZOA 1Y6AA 4I5MA 3O8UA 3V8TA 4FEVA 4XG2A 3PYYA 2VO6A 1X8BA 3GNIB 3QRJA 3IW8A 3PXYA 4CMOA 4EHGA 2GFCA 1MRYA 3I1AA 2CNVA 1MQBA 5LVPA 3TT0A 3RI1A 3DBQA 2Z60A 3UIXA 2XEYA 4GYIA 3ZSHA 5ETIA 5FXSA 3FY2A 3IK3A 3MFUA 2YDJA 1R39A 2YJSA 4MHAA 3N9XA 4GH2A 4N6ZA 3BIZA 1WBOA 1U54B 2X8IA 4FODA 5BPYA 3KRLA 5CS6A 2UZWE 4M84A 4F1MA 4GEOA 4DLIA 4RJ6A 2P55A 3HZTA 4Y73A 3ZS5A 2GS2A 3W2CA 2Z8CA 4K33A 5CX9A 4XLVA 4HW7A 5I9ZA 2QKRA 4ENXA 3KCFA 3QTUA 2W7XA 4A9RA 1ZZLA 3MA3A 4I0RA 3DTWA 4DYMA 5C4KA 3EQFA 3CXWA 2GNJA 2FSMX 2XIYA 3DXQA 3QQHA 3COIA 2QONA 5HE2A 2BVAA 3GQLA 3Q32A 3R04A 5IA4A 4IWDA 4ZTSA 4O96A 2RFEA 1KV2A 3R7GA 3H9RA 2RKUA 4S32A 5CAUA 1BL7A 4I4EA 2PMLX 5M06A 4L3LA 1PMNA 4FSNA 3FE3A 3V5JA 4BB4A 4DEEA 5M51A 3R83A 4O7LA 4EZ3A 3E93A 5J79A 3TIYA 1B38A 3TIZA 4K0YA 5J1VA 2OK1A 1FOTA 3ROCA 3GOKA 4CCUA 5HVKA 4RWLA 1DM2A 4FKPA 4JLCA 2Z2WA 3VS1A 5L8JA 3DXPA 4QMTA 5DT0A 1MP8A 3A99A 5J95A 2J2IB 4AP7A 2PZRA 4JL9A 3IPHA 3EB0A 4MH7A 3ZH8A 4RLKA 3ZONA 4FEXA 3QQKA 2YM7A 2RFDA 4QD6A 5FEDA 3L9PA 1FPUA 4JI9A 4QP7A 5HE1A 3ETAA 2QLQA 3KY2A 4TWPA 4DT8A 3FKNA 1UA2A 5HD4A 3S00A 3PE2A 4L3JA 1ND4A 4ENYA 3I7CA 2FA2A 4GU9A 3Q4UA 2YDIA 4FT5A 4QMYA 3GFEA 4TXCA 5AUXA 5A14A 3G15A 3N4UA 3FQHA 3CD3A 5LARA 3EQGA 4CRSA 5IQHA 3UGCA 3F3VA 4ZSAA 2X7FA 3C4XA 3NAYA 4G2FA 3DAEA 4KD1A 4F99A 4FIHA 4V0GB 1PXMA 4TKSA 1MRVA 3MVMA 3BV3A 4CRLA 1KE8A 3DZQA 3U55A 4M97A 2QO7A 4WBBB 2EXCX 3DB8A 3L9NA 4H1JA 5IUHA 5CU0A 4CKRA 2Z7QA 5EKOA 2XF0A 5HD7A 3BHUA 3HMOA 2JKKA 3E7VA 1GOLA 4ZZNA 4YJVA 3WI6A 4F7JA 3BRBA 5KMLA 3F2RA 4NCTC 2X81A 1OIUA 2V5QA 3KL8A 4M0YA 4RC3A 2Y7JA 5BYYA 4C2VA 4WD5A 4CFXA 3W2OA 5I9XA 2JFMA 3CSVA 1H1PA 4FUXA 2QU6A 4BGGA 3E64A 5HHWA 3ULIA 4ASDA 1WBNA 3WILA 2HZ4A 4YTHA 3FI4A 3FZ1A 5A4EA 4Y72A 5FQDC 3UODA 5A4LA 4CT2A 2CKEA 3C7QA 3MVHA 1Q62A 4MYGA 4AG8A 1CM8A 4D9TA 4NYEA 2W9FB 3OXTA 4FICA 4X7QA 4ACHA 4GK4A 3MPMA 4ZTHA 3SW7A 4IHPA 5HNIX 5CVGA 2WGJA 2QO2A 5AR7A 1IRKA 5HICA 4EC9A 4RFMA 4GUEA 2EXMA 3RK7A 4J1RA 3VQHA 3QQUA 4CLJA 3WZJA 3NUNA 4LGGA 4U97A 3ORTA 5IQIA 4O2PA 5DPVA 3CJGA 1V0OA 2OH4A 5HCYA 2VWVA 3T8OA 1CSNA 3FKLA 5EDQA 4ANOA 1JSUA 3LCSA 1OZ1A 3UZPA 2B9JA 2VX3A 3UO4A 4G31A 4EH4A 3D2KA 5ETCA 2Y4IC 4G16A 4I5CA 3VULA 4IEBA 3LM5A 4UV0A 2ITOA 4ORKA 4QNAA 3DKOA 4NEUA 4BKYA 4FC0A 3MW1A 1OL1A 2XCKA 2UZLA 1OL7A 3BGQA 3PIXA 2XS0A 4FIGA 5KZ0A 5FTQA 3R73A 2F4JA 3KULB 4U0IA 4EYJA 4ZJVA 4TYHB 3VS2A 4RC2A 5AP5A 1GNGA 2VTQA 3DNDA 2OG8A 4O0UA 4QYGA 3SD0A 5KCVA 5TKDA 2XMYA 2HW6A 3C4ZA 4FKWA 4U79A 3P78A 3RM6A 3ENHA 1GY3A 4JIAA 4FKLA 4YO6A 3RTPA 3FMEA 5AR4A 4P90A 5DBXA 4QMNA 3R28A 3EOCA 3VC4A 3DGKA 3KVWA 4ZSLA 2B1PA 4IZYA 4UZHA 5ANEA 4BGHA 4UN0C 1IEPA 4P7EA 4C4JA 4YSJA 4FEQA 4BTKA 2UW5A 2GNGA 3HA8A 2WTCA 2FH9A 2YJRA 4KIQA 1G5SA 3FZSA 5A4CA 2W5BA 4PRJA 3NCZA 5KE0A 1PKGA 4ASEA 3OCGA 4FSUA 5AR3A 1STCE 4L53A 2WTKB 4GG5A 4Y46A 5EDPA 4AZSA 1G8AA 4RJ8A 3RZFA 1JKTA 4AOIA 3UIUA 4X3JA 3OTUA 4K2RA 2XKEA 3HL7A 3P79A 3QL8A 2VTTA 3LFEA 4D5HA 2PE1A 4ZTMA 3FL5A 2PMNX 5HORA 3EQBA 4NSTA 4W4VA 4EKKA 5HLWA 1PMEA 3PJ1A 4XH6A 4IWOA 4CEGA 1JPAA 3FZRA 3IO7A 2VGOA 3ZFYA 4TN6A 3OCBA 3CKWA 4L44A 4KSPA 2WTVA 4M69A 4M67A 3NW7A 3IW4A 4MVFA 4MEDA 1PJKA 4IWPA 5DHJA 2GSFA 5L2WA 2PK9A 5HBEA 5CI7A 1Q8ZA 3P08A 2IW6A 4FEUA 4L43A 5DMZA 3GU4A 3LXPA 3OMVA 2OH0E 2W05A 3ODZX 4F6UA 5TF9A 2O63A 4ANQA 2PL0A 3AT4A 2V62A 3IQ7A 3QTZA 2HZ0A 4EL9A 2HCKA 3KRRA 3PZEA 3H9FA 3QC9A 3VUIA 5A46A 1WVWA 1XBBA 3VUTA 2WXVA 1QPEA 4RQVA 2VWBA 2F7ZE 3HNGA 4UB7A 4ZSGA 3RHXA 2VGPA 4GMYA 3EFWA 2WTDA 3BE9A 5HCZA 4AN9A 4PDYA 4BDAA 3QZFA 1Q8WA 4MNFA 4I1ZA 1UKIA 2QURA 4FT7A 3DJ6A 4FZFB 2B52A 3KXGA 4F7LA 2GQRA 3VRZA 2BDWA 3FXXA 4PX6A 2ZM4A 3Q4CA 4DT9A 3CY3A 3ZHPC 4P5QA 3VS4A 5F9EA 2OJJA 4O84A 2JAVA 4UYAA 4ASXA 4G5PA 3LMIA 4IW0A 4TL0A 5IQEA 4GK3A 5HE0A 4F63A 1XR1A 3MI9A 4NJDA 5HE3A 4EZ5A 2PVHA 3M42A 4FNXA 2PUUA 2W96B 3FY0A 4Z3VA 2C6IA 4I0TA 4BI1A 3CGFA 3PXQA 4C37A 2YISA 3OZ6A 3QQJA 4C33A 1KUTA 4DBXA 2PPQA 2XKFA 3RPRA 4CSVA 4GKHA 3KF4A 2ONLA 4QPSA 3T3UA 3MJ1A 5BYZA 3A62A 4C36A 4HYSA 4DH5A 2WTKC 3RGFA 3DXNA 3GU8A 2WB8A 4OAVB 5ANKA 4UMPA 5L6WL 2VWUA 3D5XA 4GG7A 3SC1A 1Y57A 2XNMA 2QOIA 5LVMA 5A54A 5T68A 3TNPC 1I09A 5EKNA 3C5IA 2BZHB 2WQBA 5AJQA 4FIIA 4W8DA 4A9SA 5IA2A 3CJFA 3G0EA 5FXQA 3VBVA 3W2RA 4Z7HA 5L2TA 5CSXA 2W1EA 4DITA 1DS5A 4CKJA 3ZBFA 4EH6A 2WKMA 2VD5A 2WMVA 5LVLA 2XUUA 3DKCA 2CN5A 4RFZA 3R9DA 1ZMVA 3ZCLA 5CF6A 2YIQA 4F64A 3FSFA 5JEBA 3M11A 2XNGA 3C4CA 4IB5A 1M17A 1XQZA 1DAYA 1QPDA 2GDOA 5ANJA 5L3AA 3ITZA 5HG8A 4FV9A 3ORNA 4XBUA 2GTNA 2R9SA 3HV5A 3QHWA 3RKBA 5AP2A 3UO5A 2OXXA 3FLYA 2OF4A 4QMQA 3IW5A 3PFQA 4U41A 2O8YA 3P9JA 3D94A 1GIHA 3B8QA 3L9MA 4UALA 1Y8GA 5E91A 4TRLA 4BKZA 4XOZA 3FMJA 1YOLA 4WKQA 3H30A 4AW5A 2PUPA 5AP3A 1OL5A 2QU5A 3I6UA 3Q5IA 3LMHA 2BUJA 3TZMA 2B53A 4Q5EA 2CJMA 4FSWA 4JBPA 3MSSA 4EORA 4JBOA 3OEFX 3PIYA 3ET7A 2JDTA 4ERKA 5JGAA 3NW6A 2Y9QA 2I0YA 4PMMA 5LJJA 2W4OA 4IX3A 2QOKA 1ERKA 3VUDA 2C0OA 4H1MA 2BRMA 3KGAA 5DR9A 5EM8A 4FVRA 4DFYA 4RG0A 1NVSA 3OUNB 3BHYA 3UNJA 3KQ7A 1LUFA 4IJ9A 3RJCA 4GJ2A 4KS7A 4FGRA 2Z02A 2BIKB 4IJPA 4X6RA 3DDPA 5K3YA 3PG3A 4FTMA 3UZTA 3BU6A 5I3OA 1S9JA 5HEZA 3VN9A 3ZXTA 3ERKA 2RL5A 3JPVA 4FT0A 3FPQA 5D1JA 4Y5QA 5AR2A 3SW4A 4EH7A 3FI2A 3MGYA 4C34A 2VTPA 5E8SA 4CFMA 4EJ7A 3R71A 1B39A 3MY5A 1Q61A 2W1HA 5CALA 4OTPA 4XP3A 4AF3A 3W32A 2IWIA 4RA4A 1FBNA 5CSVA 3NEWA 1F3MC 2PVKA 2CDZA 4X6QC 4FSMA 5CSWA 5AUWA 2OI4X 2NO3A 2VUWA 3Q2MA 4AS0A 2UZEA 3BX5A 4FKJA 4H58A 2WTWA 3TV7A 4AE6A 4LV5A 4E3CA 3Q53A 1U59A 3QZIA 2ITZA 3DBEA 4JVGA 4JG8A 2WU7A 1ZXEA 5EYKA 3L8VA 2HENA 4O2ZA 2VNYA 4GT3A 3DZOA 4QMOA 5CSHA 5CEKA 2H96A 5KBQA 2O0UA 4YLJA 5C4LA 3LW0A 2C3KA 5CF5A 3GQIA 4M12A 4YZ9A 1VJYA 4WA9A 3EJ1A 4TYIA 2C6TA 3PSDA 1ATPE 4YHTA 3G0FA 4F0FA 3MYGA 4HVSA 4P5ZA 4M66A 4CFWA 5M4UA 2YCSA 3QZGA 3FZPA 4QQTA 2ZV7A 4ERWA 2XK9A 3QYWA 3PE1A 4RFYA 3ZO2A 5IQCA 3VQUA 1H1SA 4XG4A 2BTRA 5FTGA 3QA0A 1UNGA 2AC5A 3GCVA 3QCSA 3QKKA 3WOWA 2P0CA 5L6OA 2GPHA 4WUAA 4OTQA 2R3KA 3PUPA 4AZEA 3CKXA 2CCHA 1Q8UA 4W4YA 4IZ7A 4RVLA 1YOJA 5DGZA 3U51A 3GCPA 3G6GA 1OMWA 4D2SA 2ZDTA 4ZAUA 1AQ1A 2OSCA 4QP8A 3TWJA 4LYNA 2QOQA 3GVUA 4YZCA 5HG5A 4DEGA 4PMPA 2WEVA 3BQRA 2B0QA 3I0QA 3DA6A 2DS1A 2G2IA 4WBOA 3TNIA 4C4EA 1ZYLA 2YAAA 4IMYA 2PMIA 4ZZOA 1WCCA 3AGMA 2QO9A 4IACA 4MK0A 4Y8DA 5CEIA 4BCMA 3MY1A 4CZTA 4ANNA 4BCQA 5CAVA 1Z5MA 2DWBA 3FL4A 3JYAA 1OIRA 3QXOA 4AXAA 4OBPA 3Q3BA 4U9AA 3QAME 1KOBA 4J98A 3QTSA 4HZRA 1H1WA 3HECA 3F88A 2OJIA 3WF9A 4YU2A 2WQNA 1LEWA 4YJPA 5A4TA 4GVAA 4HGSA 3KMMA 3QU0A 4TWOA 1Q99A 3BWFA 4C62A 4AT3A 4NKAA 4XNEA 2R3LA 4AAAA 4NKSA 4MXYA 4BC6A 4E4MA 3C1XA 2P33A 4WRGA 4QP1A 4BTJA 4KBCA 4APPA 4YGAA 4R7BA 1GIIA 2ERKA 2F57A 3KCKA 5AP0A 4BCOA 4O7TA 2V0DA 3C13A 3FMKA 5DFPA 1YI3A 2XIZA 3OVVA 3ZO3A 5AUTA 5DWRA 2ETRA 5AP6A 2QQ7A 3GFWA 3IS5A 2OF2A 5HG9A 2BCJA 1J7IA 3R2BA 5AAEA 5GINE 1R0EA 2YWVA 4OT6A 4NWMA 4ZSJA 3BU3A 4WSQA 4B6LA 4JDJA 5AUZA 2YM3A 3FQEA 3C0IA 5E8UA 2I7QA 2W99B 3MFSA 2IVVA 2ERZE 5AR8A 4I0SA 1DI9A 4S33A 1FQ1B 4FTUA 3P7AA 1GAGA 5K4IA 3F9NA 3OHTA 5EG3A 2QOBA 2OZAB 3IDPA 4S31A 2FUMA 4C59A 1UU7A 3COHA 3UDBA 4EOPA 4FSYA 4NCTA 4BVUA 4BR3A 4AZWA 4BDKA 5L4QA 2BKZA 1JKLA 1KWPA 4J8MA 4MXAA 1M2PA 4HZSA 4MTAA 3EN7A 4TYJA 4CD0A 4WOVA 5JGBA 4R8QA 4L68A 4IAAA 4JDIA 1ZRZA 1AD5A 3CE3A 3CQEA 4N70A 1OKVA 2XKCA 2VN9A 4MWIA 2HYYA 4WG4A 2CGWA 4W9XA 4XHKB 1WFCA 3PA5A 3N4TA 3T9TA 2YCQA 3GP0A 3W2SA 3E7OA 5A4QA 4IANA 3RCJA 4TNDA 5C8NA 3NNUA 2O3PA 3IOPA 2ITNA 4LFIA 5LMAA 3BHVA 5H8GA 5L2QA 4QTAA 3NPCA 5GJGA 4L3PA 5IQDA 3O8PA 2UW3A 4X3FB 4GFMA 2EU9A 4F0GA 1V0PA 2OZAA 4IX5A 4X2FA 2R3HA 2ZOQA 4MNEB 4AW1A 1O6KA 4CG8A 1NY3A 4AGWA 1M14A 4R6VA 3FLZA 5DEWA 4APCA 4J96A 3OW4A 4TYHA 2GQGA 3RCDA 4CTCA 2R3FA 2OICA 3ZC6A 3BEAA 3FPMA 5TE0A 2CPKE 3LIJA 4EH5A 3G2FA 3CTHA 5H8BA 4D4RA 5FD2A 3ZFMA 1ZOHA 2CKPA 4FG7A 4OTRA 4LL0A 3KXNA 2C5OA 3OC1A 3QX4A 4FBXA 4NTTA 5BVNA 3R7VA 1OBDA 4II5A 3ORMA 5FDPA 5HVJA 1HOWA 3DQWA 3PVWA 3FDNA 3GCQA 3PXFA 3QGWA 4I94A 1CKIA 3UTOA 5BMSA 3NVKI 4E4NA 1H01A 3TNWA 5CY3A 4R5SA 5CWZA 3HMNA 3QLFA 4ZSEA 4IB3A 5HTCA 2W0JA 5D9HA 4B4LA 2C1AA 4DTKA 2BAJA 5M07A 2YCFA 4AZVA 3BLRA 3WZEA 4FEWA 4AU8A 4B8LA 2GTMA 3HLLA 2R3IA 5AX9A 3ZUUA 3QTIA 4FTOA 4CKIA 1JOWB 5KMIA 2J51A 3OXZA 1XJDA 3I4BA 3UG2A 3QKLA 5AM7A 2IW8A 3DB6A 1DI8A 3NIZA 3UIMA 5AX3A 3VUHA 2YDKA 3MDYA 5B7VA 2QOFA 3R8ZA 3DBFA 1O9UA 3E8NA 2CNUA 4C4FA 2W1IA 4JR7A 4JQEA 5E90A 1XBAA 2BILB 3HV4A 1WBTA 4M13A 5AMNA 3F5GA 4IAKA 1ZYCA 3LFNA 3OY3A 2WELA 3OS3A 2P4IA 3OW3A 2JGZA 4FOBA 3ZUTA 2Q83A 4FI1A 1E9HA 3QUDA 5HLPA 2GNHA 4N57A 4D5KA 5IEYA 3Q6WA 2JKQA 4JR3A 1Q4LA 5D7AA 5IG1A 4X3FC 3HP2A 4L00A 4NM7A 3D5VA 4HCVA 3NLBA 5C1QB 3DKFA 3QTRA 4TPTA 4AW2A 3BYOA 1PXLA 2QR7A 3U6IA 5CTPA 5L2IA 3AT3A 2A1AB 2BTSA 1Q8YA 2UW8A 2OFUA 2J90A 4LOQA 1BX6A 4UWBA 5LMKC 3OD6X 3W8LA 4KSQA 3WARA 5DN3A 2CSNA 5K5XA 1H28A 4P4CA 4IDTA 1S9IA 4EHZA 4JAJA 1VEBA 2WPAA 4LI5A 1Y8YA 1YXSA 2X4FA 5HIEA 3LFCA 4MBLA 1ZOGA 3VS0A 3G6HA 2C5XA 3VO3A 5B0XA 1EH4A 4UWYA 5IDNA 3F3WA 4BI0A 3TUCA 3TKIA 4FK6A 3BLQA 5BUIA 3V8SA 3ZSGA 4O7SA 2BRHA 2QI8A 2XM8A 5IQAA 1TQPA 1J1CA 3TACA 1JAMA 4HNIA 4BWKA 3BV2A 4XG7A 4EH9A 4OTDA 4GL9A 4GYGA 4GU6A 1QMZA 3EFJA 3F3ZA 3FWQA 2R3RA 3PY3A 4RIXB 4E4XA 5J5SA 4UWCA 1GZNA 4AX8A 4RWJA 5FEQA 3KN5A 3SG8A 3PZHA 4AA5A 4JX3A 5BX0A 2JFLA 4FTJA 4Q9SA 3LZBA 3S1HA 1OKZA 3GOPA 4M69B 1ZMWA 3ELJA 4QMPA 3ZMMA 3BPRA 5IUIA 3K3JA 4EONA 3LJ0A 2R3GA 3NDMA 3GC9A 3KXHA 2PSQA 4HPUE 4OT5A 4HVGA 3P23A 3OROA 4N6YA 2XJ2A 2ZV2A 4KKHA 4C8BA 2J0LA 1TKIA 3OY1A 2VWWA 4I5PA 4ZIMA 1F0QA 3AD4A 2IW9A 5IISA 5LCJA 3KULA 2B9FA 3R9NA 1R3CA 4WUNA 1WBWA 4BKJA 1REJA 4ALWA 1OUKA 3HUBA 3DNEA 4I93A 1PHKA 1XKKA 1PXOA 2WOUA 3F5XA 2W1CA 2FB8A 4F4PA 4IB1A 2R3NA 1J7UA 3QWJA 2WEIA 2XNNA 4PY1A 2PE2A 1NVQA 2YITA 5B2LA 4ZTRA 2VRXA 1ZYSA 4CZUA 4I92A 1JVPP 4BCHA 3PPKA 5LWMA 1UNHA 4EOOA 1YHSA 3NAXA 4NFMA 4ITHA 4CLIA 5FBOA 2GS6A 4O1PA 4JS8A 4IZAA 4RWIA 4XG9A 4QP4A 4PNKA 4P2KA 5F94A 2A4LA 2J5EA 2QHMA 2X0GA 3UMWA 4L7SA 3C9WA 3UZRA 4NL0A 5JRSA 3FMLA 4Z55A 5IQGA 5A3XA 3BBWA 1YDRE 5CYIA 4ANBA 5GJFA 1YKRA 3N51A 4OTHA 4DLJA 2C4GA 2YLEA 2CLXA 2UW7A 3I79A 4D4VA 1Z57A 2OU7A 3CD8A 3DK7A 5EFQA 5CNNA 3NNXA 4O91A 1Q5KA 3OTVA 5HVYA 2QVSE 3A2CA 4O6LA 4QPMA 4TTHB 3W2QA 5KNJA 2YIYA 3FKOA 2UZDA 2YN8A 1Y6BA 2XKDA 3PG1A 4D2TA 4EBVA 4DBNA 2VV9A 3V04A 1M2RA 4G6OA 3K5UA 1WZYA 3PRFA 4GVJA 4M15A 4HVIA 5F1ZA 4D9UA 3H3CA 4R7IA 4FL1A 4YC6A 2WMBA 5G1XA 4QTEA 4YUQA 3BYUA 4C3PA 3QRKA 1G8SA 2WZJA 3OOGA 5BQ0A 3EL7A 5D12A 3MB6A 3MH2A 3LFAA 2JIVA 2QG5A 5CAOA 3G33A 2HZNA 2X8EA 2X1NA 3KU2A 4ACCA 3E87A 3DLSA 4BDGA 3LQ3A 4AUAA 1PXPA 3E3BX 1PW2A 4FOCA 4IE9A 3S0OA 3LOKA 5BVKA 3W8QA 4O0YA 2GHGA 3R22A 3UJGA 3N4VA 2C3IB 4FTLA 1YWRA 4H3BA 3T3VA 4DGOA 5AIKA 3A8XA 2PVRA 3EQIA 4DTBA 5AV3A 4DH1A 2C6KA 4KKGA 1JQHA 5AA9A 3QZHA 2W17A 3EYHA 3KK8A 2WD1A 4FV0A 1H8FA 4ZTLA 5F95A 3KEXA 4FTAA 4EUUA 4H36A 3JUHA 2PE0A 4YC8A 4TWCA 4EK6A 3ALNA 3IKAA 1YOMA 3DQXA 4HYIA 3UYTA 3PVUA 4ALUA 2YWPA 3Q9WA 4I41A 4OGRA 4D0WA 3U6JA 4WNOA 5KMNA 3BE2A 1FVVA 4IVBA 1KSWA 3TI1A 2YHVA 5AM6A 3R9RA 1LEZA 4IVAA 4H3PA 4EOQA 3PXZA 3QCQA 4E5AX 3OUKA 1MUOA 4FV8A 4DFNA 2O64A 1H0VA 1W7HA 4FKQA 4EBWA 2WMSA 1OKYA 2F2UA 1Q3DA 4I5HA 5IH4A 4UXLA 4WNPA 2V55A 3IDCA 5CQWA 3IECA 5DRBA 3ORPA 1LPUA 2R0UA 3WE8A 5KO1A 4JBQA 4L8MA 3DOGA 1QCFA 2ITYA 4IADA 5ICPA 4BZNA 4TYGA 1P2AA 3QKMA 4ZXTA 3W1FA 1RW8A 2WAJA 4F9AA 4DFUA 3RNYA 3ATSA 4EH3A 4FMQA 2W5HA 3I7BA 2ZB1A 5TT7A 3SXFA 3BHTA 3ZRLA 4L45A 3UOJA 4D1SA 3TJCA 1REKA 4L46A 4ARKA 4CV9A 4FL2A 3G5DA 3F3TA 3KC3A 1SZMA 5LWNA 4I23A 4JXFA 1ZY4A 5IA3A 4CVAA 4I20A 2IZTA 3ZO1A 4FNZA 4YHFA 2ITXA 4PMTA 3RAWA 3T9IA 2QCSA 3UOHA 4C38A 1XWSA 3RPVA 2BFYA 2FO0A 2DYLA 3L1SA 5HTBA 4NT4A 2OXYA 4BDHA 2P3GX 1TVOA 3SA0A 2IVSA 3VAPA 4KIPA 4FTCA 3Q4ZA 3A7JA 5C01A 4DC2A 3LFQA 5FM2A 1WVYA 2PUIA 1M7QA 3HAMA 4HYUA 4C35A 4D2VA 4AN3A 4C61A 2C1BA 4HCUA 3A7IA 5HIBA 2X4ZA 2XNBA 3QTWA 3O7LB 5B2MA 2B7AA 2JIIA 3ODYX 5FGKA 4LMNA 4EWQA 4UX9A 1NXKA 2HWPA 2VNWA 1TQIA 2ONLC 3KN6A 5CU2A 4XOYA 4BCNA 3UP2A 4MXZA 1YWVA 3LJ1A 1PYXA 4FKGA 3MIAA 5I4NA 3GU7A 5EQPA 3BKBA 1K9AA 3PWDA 4NTSA 2FYSA 4ZLYA 4R77A 2XBAA 2GU8A 3QQFA 5TR6A 1YW2A 3VW6A 3UPXA 2BAKA 4V01A 2YM4A 4QMLA 4USDA 1OIQA 5K5NA 5KMMA 2UVYA 4BDJA 2B54A 4IAZA 1MQ4A 4IM2A 3UYSA 5BNJA 3S3IA 4ZP5A 1FVRA 3G51A 3AC8A 4IBMA 2QOCA 4RPVA 2CKQA 4QP9A 4QP3A 3F61A 3ZTXA 4A4OA 4IFCA 3RMFA 4BDBA 4L9IA 3TDVA 4MXCA 3KF7A 3QUPA 5B2KA 5EI6A 3UC4A 5LMBA 5CASA 5I9VA 4HGTA 3VUMA 3A61A 4F9CA 5GNKA 3R1YA 5C03A 2OWBA 2WTJA 3DPKA 2VTLA 3ZM9A 5I9WA 4FVQA 4DF3A 3UQGA 3HV7A 3TTIA 3DJ5A 4DEHA 1W84A 4AACA 4XYFA 3POOA 5GIPE 4AGUA 4XG8A 4E4LA 4BY9E 3DK6A 4E6AA 3FXZA 4BRXA 2ACXA 2F7EE 3JS2A 2VTAA 1JKSA 5FP6A 3ID6C 4QNYA 3PDTA 3SLSA 2E9VA 2GQSA 3TV4A 4CNHA 1ZAOA 4LRJA 3C5UA 1J91A 3TNHA 5ACBC 1U4DA 3NGAA 2F2CB 4XLIA 2J5FA 3EKNA 4FV1A 1XH5A 3O23A 5E8ZA 5J8IA 5LCKA 4D4SA 4UBAA 4LMUA 4GW8A 2OJGA 4WHZA 2YM8A 3EH9A 3RNIA 2B9HA 2JBPA 2OIDA 3ACJA 4UYNA 1BLXA 5EW9A 1KV1A 2GFSA 3DBCA 4M0ZA 1PY5A 4CFUA 3RAIA 3Q9YA 4Q9ZA 3KMUA 4HVDA 4QTBA 2EB3A 3TV6A 5CSPA 4BIDA 5BUEA 4IH8A 2J4ZA 5DLSA 1WVXA 2OIQA 2WFYA 1JKKA 4AZTA 2C6OA 3VBYA 4RMZA 4FIEA 1BMKA 2XK4A 2YLFA 5J5TA 2P2IA 4QYHA 3MB7A 3BLHA 4F6SA 2F7XE 3FYJX 3QBNA 3RAKA 3R02A 2XIKA 4RZWA 4IAFA 4YTFA 3Q9XA 2FSTX 4NZWB 3O2MA 1GIJA 1WBSA 2REIA 4RVKA 4ASZA 3RPSA 4E5WA 2PZPA 4JBVA 1DAWA 4IM0A 4C3RA 2PZYA 4QMUA 3VF8A 2B55A 4FZ6A 4LV8A 4KINA 1XBCA 4WG5A 2BKKA 2WMUA 4FTNA 3WIKA 2BDFA 2R2PA 1H27A 3LE6A 3QRTA 4UMTA 4BCJA 4DAWA 3VJNA 2I40A 4OTGA 3QD4A 4W8EA 4J99A 1V0BA 3FC2A 5CENA 2XNOA 3ZXZA 1PXJA 2EB2A 2ZJWA 5AV4A 3RK5A 5HU3A 4KABA 4M7IA 3HX4A 4OW8A 2UZTA 4EOIA 5BVOA 4EOSA 5AEPA 4GV1A 2CCIA 3PVBA 2C3JA 5EK7A 1P4OA 3RZBA 2FGIA 5IEVA 3ROYA 1V1KA 3HDNA 3HRBA 3KK9A 4C4IA 4PP9A 5DRDA 4YJTA 2OFVA 4BTMA 2PVFA 2BPMA 2PMOX 4JG6A 5C8KA 1PYEA 3THBA 4J97A 2G01A 3CPBA 5LVNA 2QODA 2UVZA 4RIYB 1WBVA 2XRWA 5CXHA 3TEIA 5AP4A 3K54A 4K18A 2YIXA 3EQRA 2H9VA 4GK2A 4AGCA 3TUBA 2QHNA 4U81A 4XV9A 4I3ZA 4LOOA 5F4NA 1YDTE 4J8NA 3C50A 3TKHA 5E8XA 4KBAA 3D7TA 4AN2A 2XH5A 3UPZA 2DQ7X 4RVTA 3KB7A 2C5VA 4KS8A 3PLAE 2NNWB 4O27B 2WMAA 2C69A 4ZJJA 5IA0A 4CZYB 1FINA 2R3OA 3MJ2A 3QTQA 4DFXE 4KUJA 3PA4A 3M2WA 4FSZA 3AC3A 4FIJA 5C9CA 2A19B 3ZO4A 4YJNA 2G1TA 2R7IA 4ZY5A 4ALVA 3I60A 5KKRB 3PWYA 5KMKA 3M1SA 3HP5A 5AIRA 2PVNA 5CZIA 2XEZA 3H4JA 2OLCA 1O6YA 4ZTNA 2JDVA 4EUTA 3W2PA 4RIYA 1H26A 4QMZA 3U4WA 1OUYA 1NT2A 3ORIA 2RIOA 4F70A 2E9UA 3EL8A 3CY2A 3VS6A 1ZYDA 3B8RA 3JY9A 2HY0A 2WTIA 5EM6A 3FI8A 5CT0A 3RWQA 3V3VA 4IB0A 3MN3A 4DH8A 1P4FA 3I5NA 4AA0A 5KKRC 4BYJA 4L01A 2FVDA 4PTCA 4WRSA 3GC8A 1GZOA 1YDSE 2JEDA 2WQEA 2Y4IB 4MD9E 4Q5HA 3QF9A 4RJ4A 3W33A 5EYDA 3ZLXA 2FSOX 1P14A 5D10A 3OOMA 1PMVA 3PJ3A 3VW8A 3KXXA 4YLKA 3QWKA 4HVHA 5EHLA 4DGGA 4CT1A 4MBIA 2BROA 3CTQA 1FGKA 4R3RA 1E1VA 3UVQA 1Q97A 3Q2JA 1H1QA 4FV7A 5ANDA 4AFJA 4EJNA 3UNKA 3SG9A 4OUCA 4DEBA 2WMRA 4QQCA 4R7HA 3VS7A 3VBWA 3HV6A 5HO8A 1UKHA 2H34A 3E5AA 3E3PA 3HA6A 1CTPE 5JSMA 2VTSA 5GZ8A 1ZOEA 3DT1A 3MA6A 1FGIA 4EZ7A 2OKRA 2LGCA 3QXPA 5HNGA 2BIYA 4DTAA 3EHAA 3LHJA 5ANOA 3FXWA 4KIKA 2KTYA 4HGLA 4NIFA 1H08A 3TKUA 4BCKA 3GT8A 2WMQA 3NMUF 4N0SA 2J9MA 3DTCA 1PXKA 3D83A 4FYNA 4PPCA 5CT7A 3PPZA 2UZUE 4G5JA 4CXAA 3KREA 3KFAA 3EMGA 2ITQA 1UU3A 4IX4A 5ETAA 4G17A 3CQWA 3V5PA 1JNKA 4MD8E 4CYIA 3FMMA 4OTIA 4DCEA 5AFVA 3HUCA 4YHJA 5AV0A 2R0IA 3UQFA 4QYFA 4EQMA 4K77A 4F1TA 2VTOA 3NWWA 2LAVA 3Q5ZA 3ZSIA 2GHLA 4TT7A 2BAQA 1W98A 3PA3A 1GZ8A 5BVFA 1M7NA 2PY3A 5CVHA 5ETFA 4PTEA 3F69A 3KMWA 4GIHA 4XCUA 2WHBA 4QOXA 4RIWB 4RGJA 4U3ZA 4CG9A 2UUEA 3QQGA 4R5YA 4I21A 4LUDA 4EOJA 4EK4A 3V5TA 1XH8A 4FZ7A 4KAOA 5L6PA 4IAIA 3DLZA 4YMJA 4JT3A 4MNEA 3OF0A 3JR1A 1URCA 1Q24A 4O6EA 4B9DA 4XRJA 3WZKA 3FMDA 3IGOA 3DKGA 3VIDA 5FXRA 4BICA 2Y6MA 5CU6A 3P4KA 5E8YA 3D15A 3QCXA 3R1SA 3NUAA 4R3PA 2XA4A 3P7CA 5H9BA 3UG1A 3V8WA 4H05A 3TZ8A 3UO6A 4E6DA 5M53A 5KBRA 4U44A 1KE6A 2JITA 4FYOA 3ZLYA 4M14A 3LFFA 4QPAA 5C26A 1YXXA 3UIBA 4MXXA 3ORXA 3O71A 4U7ZA 2ETKA 1UU8A 3AD5A 4EHVA 5BVDA 3BYVA 4EYMA 3R7UA 4D2PA 4BTFA 2C47A 5AV2A 5DOSA 2WQOA 2IG7A 4BZDA 3F7ZA 1FMOE 3NVMB 3L9LA 4O0TA 4E26A 2WU6A 2I0VA 1H24A 2JKMA 2SRCA 4FNWA 4RJ3A 4V05A 4XRLA 5BMMA 3GC7A 3GENA 4KIOA 3SX9A 4KA3A 4CMTA 4BDFA 5JQ5A 1M52A 2JKOA 3G9NA 3BHHA 1H0WA 3SVVA 4L7FA 4R78A 2QOOA 4YR8A 2R4BA 4A9TA 3VUGA 4LG4A 3C4EA 1XO2B 3GU6A 3ULZA 4HPTE 2EXEA 3VHEA 4WG3A 4Y5HA 4BBMA 4CFVA 2EWAA 4FTRA 1Z9XA 3A8WA 3PIZA 4G3EA 5FDXA 3POZA 4AOJA 4AT5A 1NW1A 3BI6A 4XV3A 3REPA 5IH6A 4QMWA 1WMKA 3HAVA 5DH3A 5E8VA 5HU9A 3NCGA 3FHIA 4O83A 3FV8A 2HIWA 2NP8A 3JY0A 3OFMA 4BDDA 3OWKA 4ID7A 5E1SA 5IUGA 4CFNA 4PV0A 1CDKA 4FGBA 4H39A 4EK8A 1A9UA 1R1WA 3L8XA 3LM0A 1Q8TA 4GS6A 4KNBA 4UEUA 2ZM1A 5DR6A 3KXMA 4K1BA 5GJDA 5GIOE 3EN9A 3U6HA 4MF0A 3F3UA 4MWHA 4IDVA 4PDSA 3QLGA 1JBPE 2UZNA 4DGMA 3EFKA 4RX8A 3VS5A 4FTKA 5M09A 3D14A 2DUVA 2NPQA 3QC4A 4JRVA 1LP4A 2C6MA 3PY0A 4EOMA 3P5KA 3EQCA 2ITWA 4BHNA 5J9ZA 3DFCB 5HNBA 4CGAA 5EYMA 5FUTA 5LVOA 4TYEA 3SXSA 4YJUA 3R8PA 4E93A 2QD9A 3EYGA 3OWPA 3A60A 4FV6A 3BYSA 4FSQA 4D1XA 5TO8A 4I22A 3A7GA 4C7TA 2VWZA 2PHKA 3R63A 4W4XA 5HIDA 4S30A 3C51A 3R7OA 3NZ0A 5BUJA 5E9EA 1SNXA 4YNEA 4G3FA 1OPLA 2R3PA 1YRPA 3DY7A 3O51A 3TJDA 3WIGA 3QHRA 4A9UA 3UMXA 3HRFA 2ZMDA 2X6EA 3FJQE 5IQFA 1K3AA 1PXIA 4FKOA 2OXDA 2WQMA 4U43A 5AAFA 3ZZWA 4J52A 4FIFA 3LQ8A 4O38A 5IPJA 5T6KA 4U5JA 4FL3A 2XP2A 1W0XC 4PMSA 2VTMA 3AC2A 3ZEWA 3IOKA 4EEVA 4XUFA 5J7BA 4OR5A 5E7RA 3VBQA 2XK7A 3TNQB 5L8LA 5IU2A 4EOKA 1XH6A 5AAGA 3DAKA 1XH4A 3EWHA 3PVGA 3QCYA 5JH6A 3NR9A 1IA9A 1KE5A 2PU8A 5BYLA 2YM5A 3AMAA 3DS6A 4QQJA 5DNRA 4W4WA 3KRXA 3V5QA 4X2JA 3II5A 2Q0BA 5AP7A 2W4KA 3LJ2A 4E8AA 3NSZA 4GJ3A 2X9FA 3BQCA 5D41A 5M4CA 1O6LA 3PPJA 3GI3A 2NRUA 3DV3A 5HGIA 2X6DA 4QT1A 4LRMA 3VBXA 4ACMA 4G34A 4G6LA 3JVRA 3HKOA 4FV4A 4WNKA 5J9LA 3ZRKA 4PP7A 5GZAA 4Y83A 3OCSA 4L42A 3QX2A 3EQHA 3Q96A 2QG7A 3HRCA 3NUXA 1ZMUA 5JFSA 4X2NA 2V7OA 5HLNA 5HX8A 2ZV8A 4A06A 2J0JA 3TCPA 3CR0A 3IDBA 1YXUA 3ZUVA 2XIXA 2J0KA 2OO8X 1KOAA 4A07A 5JQ8A 3HEGA 4ACDA 4J95A 1LR4A 4BBEA 1L3RE 2QOHA 3R0TA 3VJOA 2ZM3A 1UWJA 3LKMA 2UZBA 3RPYA 1TQMA 3VHKA 4NW5A 3ENMA 1U54A 3AMBA 4FV2A 3BBTB 5CEOA 4O21A 3F66A 4ONAA 3CBLA 3SAYA 4U3YA 1OPKA 4PDPA 4QTDA 2B4SB 2P2HA 3A4PA 3R00A 4IWQA 4RVMA 3FI3A 4AOTA 2PTKA 4C57A 3LXKA 4RJ7A 3RVGA 1KE7A 2C6LA 3IW7A 5K4JA 4RX9A 2R3QA 4DEIA 3RM7A 2PULA 3VUKA 2YEXA 4LM5A 3LCTA 3ZU7A 2XIRA 2HWOA 2BDJA 3C0GA 4YZDA 2OIBA 4F9WA 4JDHA 3TTJA 4DG0E 4D55A 3BGZA 4NU1A 3DAJA 4PQNA 3WF8A 4YTCA 4LGDA 1A48A 2XK8A 5AWMA 4ANSA 1JSVA 4TZRA 3MV5A 3RALA 3GC0A 3MPAA 4EH2A 4F09A 2ZV9A 1PF8A 3BCEA 2XB7A 2Y8OA 1FVTA 3SV0A 5EI8A 4FNYA 4EKLA 3MVLA 3TZ7A 3K2LA 3D7ZA 3UOKA 3FMHA 4FT3A 4TW9A 4LUEA 4YO4A 2CNQA 5J7HA 4TY1A 4YPSA 3NRMA 4FZAB 1H25A 4F08A 2PVLA 2J50A 4GUBA 2J0MB 1J7LA 1H07A 5E8TA 3LFSA 5FRIA 1SVEA 3WZUA 3U9NA 1OECA 5IA5A 4ZK5A 4AGDA 4H3QA 4FE2A 4I6FA 3R01A 3PY1A 3A7HA 3AXWA 4PPAA 2HOGA 4QMSA 4QP6A 5G6VA 1SMHA 2IO6A 5I5ZA 4DCAA 3E62A 4PWNA 4YNOA 3WBLA 4IQ6A 3NUSA 3CIKA 4QMMA 1ZZ2A 2YZAA 1JWHA 4DA5A 4J7BA 1PXNA 4K9YA 5HTIA 4PF4A 1ZY5A 1QPJA 4DN5A 4CFFA 5AR5A 1W83A 5IF1A 2W1DA 2WOTA 3H9OA 1RQQA 1ZYJA 2HAKA 4NM0A 4JJRA 3AC1A 4LOPA 3JVSA 3OP5A 1B6CB 2C0TA 2W4JA 4BZOA 1OIYA 5JFXA 4R1YA 5AUUA 1ZARA 2ETMA 4FR4A 4GSBA 5AP1A 5EM5A 3FMNA 3NW5A 4EK3A 4F65A 3SDJA 3V6SA 5JK3A 3AD6A 3ZM4A 4G9RA 4DEDA 5JRQA 3GCSA 5EHOA 5DEYA 1OL2A 5CF8A 2PYWA 2HXQA 2W1FA 4IC7A 4YJQA 4O86A 3BEGA 3LFDA 2WMTA 4O0SA 3ZBXA 2VX0A 3P0MA 4DH3A 2XNEA 5AUYA 2CN8A 1H1RA 1RE8A 2A0CX 3JXWA 4DE4A 3QALE 2ZAZA 1YHVA 3R9OA 3MTFA 4BF2A 4EK5A 1VYZA 4QYEA 3OWJA 5I9YA 3ALOA 3EN5A 3OXIA 3F2AA 4UY9A 3W55A 4BI2A 4AZFA 4C3FA 4LRKA 4B8MA 2VX1A 3BELA 2J0IA 3A4OX 3MWUA 4NK9A 3COMA 3LCKA 4BDEA 1W8CA 4DFZE 5FTOA 5M57A 3GXLA 2R5TA 3V5LA 4FKIA 3FLNC 3NNVA 3V5WA 5M44A 3R21A 5HBJA 4HCTA 4PL5A 3TL8A 4RX5A 3QYZA 2H6DA 5CXZA 4NFNA 5JFVA 2HY81 4KWPA 5EOLA 3K3IA 5FG8A 3FUPA 4UZDA 3QFVA 3SGCA 2VO0A 3GGFA 1YXVA 3WF5A 3CPCA 3ZDIA 4AT4A 4U6RA 3COKA 3RBWA 4J53A 1BL6A 2W1ZA 3KRJA 5FM3A 2BRBA 3VWAA 3Q4TA 3LLAA 2B9IA 5FP5A 1OL6A 3RHKA 3GEQA 2YIWA 4MBJA 3OBJA 5JN2A 3UE4A 3UP7A 4X2KA 2QC6A 3BU5A 4G3DA 3UNZA 1CMKE 3VBTA 3SOCA 4F0IA 4XG6A 3ZLWA 2F9GA 4YJRA 2EVAA 3ACKA 2IVUA 5IQBA 2J6MA 2JDSA 2RG5A 4UXQA 4NJ3A 4ZLOA 2WMXA 4M8TA 4KBKA 3B2WA 2IVTA 3AMYA 5HCXA 1W82A 4IVDA 2HELA 3OCTA 2Y4PA 5T3QA 4RA5A 1L8TA 4K6ZA 3NUUA 4RC4A 3DJ7A 4IC8A 4FTTA 1YI4A 4C58A 2VTNA 3NUPA 1RDQE 1U5RA 3LVPA 4YSMA 3O96A 3R7IA 3U54A 3EQPA 4BFMA 3WYYA 1FMKA 5DI1A 1YXTA 2AC3A 2J7TA 1URWA 4RWKA 2C30A 4IX6A 2UW0A 4D58A 2YCRA 4GIIA 1OI9A 2ITPA 3H0YA 4DHFA 5E8WA 4ZLZA 3TN8A 4B0GA 4D0XA 4PDOA 2IZRA 3PTGA 2C5YA 4ZY6A 2JDOA 3G90X 3DDQA 3H0ZA 3Q52A 3RWPA 5HO7A 1IAJA 2GCDA 4BIBA 1WAKA 2ESMA 3QQLA 1Q3WA 2BRNA 2PVMA 3A7FA 4FTIA 3UBDA 2OW3A 4I6HA 4V0GA 2WO6A 3NIEA 3EFLA 2GHMA 2JDRA 4QP2A 3SQQA 1K2PA 1IA8A 5CI6A 4FSRA 5ANIA 2YA9A 4IZ5A 3C0HA 4WNMA 4JX7A 5A6NA 2QOLA 2RSVA 2G2FA 2BR1A 4HYHA 1IASA 4RX7A 1QL6A 3FC1X 2BRGA 3ZYAA 4U42A 3KRWA 4X21A 5D7VA 2ITTA 3UQCA 1GJOA 2YFXA 3ORLA 3E8CA 3B2TA 4USEA 5HG7A 5HZNA 4NM3A 4MKCA 2PVYA 3PXKA 5C27A 4AFEA 5JFWA 2BZIB 3PP1A 2ZVAA 5EQYA 4ZS0A 3O7LD 1J3HA 2G15A 5EM7A 4X3FA 3WF7A 2X2MA 4C02A 3DBDA 4JIKA 3GU5A 5C8MA 2RFSA 3GCUA 3QD2B 3CEKA 3U4UA 1R78A 2IJMA 2YERA 4A4LA 2IN6A 1SNUA 2WNTA 4KIKB 4MAOA 3R8VA 2GNLA 1NVRA 5LOHA 5HESA 4BHZA 5LMKA 1JSTA 2W1GA 2X7OA 2I6LA 3PXRA 4IIRA 3FLQA 2ITUA 3CQUA 5DG5A 3R7EA 4BCFA 4USFA 4L67A 2V7AA 4HJOA 4KRDA 4GCJA 4QO9A 3R8UA 4BYIA 3R1NA 4FKSA 4JOAA 1IR3A 1VR2A 5E4HA 4V04A 4FUYA 5A6OA 2I1MA 2XJ1A 2C6DA 3R30A 2C3LA 3ORKA 2W06A 4O7VA 3AC4A 4RSSA 4WO5A 4TWNA 4X0MA 2VWXA 3ZZEA 4C4GA 5CAQA 4PPBA 3O0GA 1U5QA 3RP9A 3R6XA 5HX6A 2XZSA 4G6NA 4QMVA 1XH7A 5AUVA 1AGWA 3WZDA 4ZMEA 3HVCA 5IEXA 2JIUA 5KMJA 3IGGA 2OBJA 2BHEA 1BI8A 4YJOA 3ZDUA 2IZSA 3AQVA 3PJCA 4E73A 4AW0A 3S95A 2YZLA 3ORZA 4LL5A 3LFBA 3UC3A 3R7YA 4U80A 4X2GA 4F7NA 2QNJA 2RF9A 3E63A 5DT4A 4AWIA 4O7WA 3UVRA 5E1EA 2X2KA 4PNIA 4XG3A 4F1OA 4CCBA 3SOAA 3EKKA 4JQ8A 3GUBA 3FZTA 3MH1A 2ZMCA 4IFGA 2JC6A 4RJ5A 5J87A 4FT9A 3P86A 3BWJA 2BZJA 3QGYA 1Q41A 5K0KA 3TDWA 3ZRMA 4FF8A 4ANMA 4BGQA 4EHEA 3CC6A 2EUFB 2VTHA 3MH3A 5M55A 2RFNA 5K9IA 4C2WA 5KX8A 2IPXA 2VTIA 2UW4A 3OEZA 4D2WA 3FBVA 3KA0A 3OG7A 3HMIA 1MRUA 3EQDA 3MY0A 3DCVA 4Y95A 3UVPA 4D2RA 4E6QA 4UMRA 3PJ8A 3D7TB 2VTJA 2VWYA 1U46A 5FEEA 4C0TA 4NIFB 3FQSA 2YACA 2A27A 4MX9A 4M3QA 2PZIA 3DU8A 4RBLA 4YPDA 1BYGA 2WIPA 4FV5A 3VNTA 4G3GA 4KKEA 2X2LA 3P1AA 4D1ZA 1OITA 2X7GA 3E8EA 3QD0A 3LCOA 3TZ9A 3LLTA 2I0HA 3DFAA 4FSTA 4BCGA 2VWIA 3F5UA 3VRYA 4U40A 4Y85A 4FG9A 2HXLA 3SKCA 4HNFA 3SRVA 4G3CA 3E88A 1UWHA 3MFTA 3F7WA 5KMOA 1RJBA 2XVDA 2XNPA 3C4WA 5GHVA 5I3RA 1UNLA 3R8LA 4CYJA 4CQGA 1H00A 3QA8A 3NYXA 5EW3A 3R2YA 2KULA 3EN6A 3V01A 3OWLA 2UW9A 1A06A 4HGEA 1SVGA 3UOLA 3RK9A 3D9VA 4YBJA 1SM2A 4BDCA 4F7SA 3ZEPA 4R3CA 3VVHA 5GZ9A 2C68A 2RGPA 4G1WA 3VS3A 2ZYBA 4MQ2A 1M2QA 3KKVA 5KHWA 2CMWA 3F5PA 1ZLTA 3G9LX 4QRCA 3RPOA 4XJ0A 3GB2A 5HOAA 5IMEA 3PJ2A 2GS7A 2O2UA 3RINA 4HOKA 1UV5A 2HZIA 3TUDA 5CAPA 3V6RA 4F9YA 2BMCA 2R64A 2Y6OA 3Q6UA 3CGOA 1H4LA 5M4IA 4OTWA 3O50A 2YIRA 4M68A 1KE9A 4B99A 4ZOGA 5JMSA 5K0XA 2CGXA 1VZOA 2I0EA 2AUHA 1WBPA 4IAYA 2VTRA 4K11A 4O7RA 2CHLA 1YVJA 4GT5A 3RAHA 3LCDA 1YQJA 3HMPA 4A9YA 5CVFA 4CV8A 3ANRA 4L52A 4YP8A 4CMUA 3TXOA 3U87A 3EZRA 4F9BA 2QLUA 3R1QA 1VYWA 3FYKX 2GNIA 4FKTA 2WMWA 5ACKA 3LPBA 2RG6A 3QRUA 4BBFA 1UU9A 4S2ZA 5HI2A 3CP9A 5FWKK 2NRYA 5CEMA 1PMUA 3WE4A 4FK3A 4QQ5A 5DT3A 3F2NA 5L2SA 4RIWA 1F5QA 2PVJA 1SYKA 2XCHA 5KUPA 3MS9A 3LAUA 3SXRA 1OB3A 3MPTA 5CEPA 5CF4A 4AQCA 4I6BA 4YZNA 2E9OA 4O1OA 4L6QA 2O5KA 1OBGA 5FBNC 4O0WA 5EHYA 3PSBA 5AV1A 1YWNA 3ZFXA 5FLFA 4Q2AA 2GNFA 4N4SA 5DVRA 4IM3A 5D11A 4NH1A 3OBGA 5JZJA 3AGLA 4NUSA 4DG2E 2H8HA 3NUYA 2UV2A 2QR8A 3LXLA 2VU3A 1YHWA 3D5UA 4ITIA 4DFBA 2VZ6A 3L8PA 2JAMA 3EZVA 4GRBA 5CEQA 4D28A 2XYUA 2Z7RA 4QTCA 4FA2A 3PP0A 2R3MA 3FLSA 5DA3A 4OBOA 3O8TA 5CQUA 1OVEA 5IKWA 5E92A 4JAIA 3OT3A 4RLLA 3I0OA 4OLIA 3QTXA 4IVCA 4XBRA 4DH7A 1YI6A 2OGVA 3FHRA 1PKDA 3FEGA 3GBZA 3NS9A 5HKMA 3HMMA 3R8MA 1OGUA 3U9CA 3P7BA 5HQ0A 2QKWB 2VO3A 2VO7A 5EH0A 2E2BA 4MCVA 2PUNA 4I4FA 2C6EA 3QRIA 2YABA 5EOBA 5KZIA 1OPJA 3E92A 1Y91A 2YAKA 4DINA 5IDPA 2XK6A 1SVHA 4J71A 3Q9ZA 4NW6A 2A2AA 3CS9A 4O22A 4EQUA 4XP2A 4BWXA 4W9WA 4FV3A 3K5VA 4AE9A 2E9NA 3PLSA 3SHEA 4O81A 2X39A 2W9ZB 2BFXA 4IXPA 3WYXA 4DG3E 3LMGA 2CLQA 4XV2A 4CTBA 2Z7LA 1BUHA 4O7NA 4G9CA 4OBQA 3S2PA 1GZKA 3I5ZA 4WT6A 3CCNA 4E7WA 2UZOA 2IZUA 2XYNA 5HBHA 4ZEGA 4A4XA 5I0BA 4YC3A 5CU3A 5H2UA 1CKPA 1PRYA 2JLDA 3S4QA 4O82A 4FTQA 3F82A 3BGPA 4LGHA 4GFGA 4BDIA 3CTJA 3MVJA 2R7BA 5TOZA 4DFLA 2HW7A 4MD7E 1ZWSA 2G9XA 3NYOA 3D0EA 5F20A 4YLLA 5KHXA 3MBLA 1I44A 3ZLSA 5M4FA 4PL4A 4I6QA 3MH0A 3U8WA 2XM9A 4Z9LA 3HDMA 3W18A 4YZMA 5BVEA 5CZHA 5EQEA 2CGUA 5IMXA 1APME 2BZKB 5HO6A 5IZFA 3VF9A 4JQ7A 3WF6A 3ANQA 4WIHA 5JT2A 1HCLA 4O0RA 3ZC5A 3V51A 3BYMA 4OTFA 3IW6A 5AA8A 3TG1A 4C4HA 1BKXA 2Q0NA 4XV1A 5EDRA 2WIHA 3FSKA 5CANA 5JZNA 4K8AA 4KB8A 4GKIA 3MFRA 3NNWA 3QD3A 4D4YA 3AC5A 2OJ9A 3D2IA 4E1ZA 3NX8A 1IAHA 4FKUA 3Q60A 3OT8A 4EQCA 2OJFE 3AOXA 2ITVA 4NM5A 4E5BA 4GT4A 4MQ1A 5L8KA 5BVWA 3LXNA 4E6CA 2E9PA 1OKWA 2GMXA 4JDKA 4RT7A 3EN4A 4F6WA 1HCKA 2CGVA 4FZDB 5CU4A 4FVPA 4JNWA 5J1WA 3FAAA 3HGKA 2Z7SA 3MTLA 3IONA 4U8ZA 5A9UA 3CLYA 2HK5A 4QMXA 1T45A 5ANGA 3W16A 4EH8A 3PSCA 4JRNA 2X9EA 4GFOA 3C4FA 4U45A 1UVRA 1XH9A 4PTGA 4XS2A 2XJ0A 3W10A 3F6XA 4CQEA 4YURA 5M56A 5IH5A 4XX9A 1R0PA 2UVXA 4RIOA 5M08A 4JG7A 4PL3A 5EI2A 5CNOA 3Q04A 4FX3A 5CLPA 4EI4A 4UMUA 4RRVA 2R3JA 4S34A 4FKVA 3AG9A 4UMQA 4FG8A 4WSYA 5DIAA 5ITAA 4O7YA 3O17A 4BL1A 1NA7A 4MF1A 5EW8A 4ZZMA 4O0XA 5IA1A 4XMOA 3AT2A 1P5EA 1E1XA 1OM1A 1IG1A 2G2HA 4YJSA 4YTIA 4RIXA 4B7TA 4EOLA 1JLUE 4RQKA 2BALA 3D5WA 3LQ5A
chains in the Genus database with same CATH superfamily
4ANLA 4BIEA 5LQFA 4R1VA 3D4QA 5J9YA 2ZB0A 4ZJIA 3HV3A 4QYYA 4DGNA 3IG7A 2XBJA 4XEYA 3NYVA 4MXOA 3SRVB 4BCPA 4Z16A 4LQMA 2V22A 2XRUA 4O7ZA 2W5AA 3HYHA 4KRCA 4TNBA 2UZVA 4YBKA 3MIYA 4PUZA 5DR2A 2PZ5A 2JD5A 2YM6A 5JGDA 2AYPA 4ZTQA 3E8DA 4DEAA 4RZVA 3ZOSA 4EWHA 2C5NA 5I9UA 1XHAA 5AADA 2F49A 4EC8A 2Y0AA 4BWPA 4I24A 5JKGA 4DGLC 4O0VA 3I81A 1BI7A 3QUEA 4BCIA 2ZDUA 4YZBA 5EYCA 4AA4A 4ZY4A 2C0IA 3EIDA 2XK3A 3BZ3A 3L8SA 4OAUC 3ATTA 5H3QA 3H10A 2O65A 4FKRA 2BHHA 1G3NA 5H8EA 3KVXA 2JBOA 4BN1A 1QPCA 2VAGA 3FLWA 4ZS4A 3DK3A 2UW6A 3NYNA 3PRIA 4E20A 5LXMA 1T46A 2PWLA 4ACGA 2CKOA 2X8DA 4XP0A 3R9HA 4Z7GA 3I6WA 2FSLX 3MESA 5DE2A 5DYJA 3FZOA 4ZMFA 3TM0A 4A7CA 4ITJA 1J1BA 3KXZA 1CKJA 2OZOA 1Y6AA 4I5MA 3O8UA 3V8TA 4FEVA 4XG2A 3PYYA 2VO6A 1X8BA 3GNIB 3QRJA 3IW8A 3PXYA 4CMOA 4EHGA 2GFCA 1MRYA 3I1AA 2CNVA 1MQBA 5LVPA 3TT0A 3RI1A 3DBQA 2Z60A 3UIXA 2XEYA 4GYIA 3ZSHA 5ETIA 5FXSA 3FY2A 3IK3A 3MFUA 2YDJA 1R39A 2YJSA 4MHAA 3N9XA 4GH2A 4N6ZA 3BIZA 1WBOA 1U54B 2X8IA 4FODA 5BPYA 3KRLA 5CS6A 2UZWE 4M84A 4F1MA 4GEOA 4DLIA 4O4EA 4RJ6A 2P55A 3HZTA 4Y73A 3ZS5A 2GS2A 3W2CA 2Z8CA 4K33A 5CX9A 4XLVA 4HW7A 5I9ZA 2QKRA 4ENXA 3KCFA 3QTUA 2W7XA 4A9RA 1ZZLA 3MA3A 4I0RA 3DTWA 4DYMA 5C4KA 3EQFA 3CXWA 2GNJA 2FSMX 2XIYA 3DXQA 3QQHA 3COIA 2QONA 5HE2A 2BVAA 3GQLA 3Q32A 3R04A 5IA4A 4IWDA 4ZTSA 4O96A 2RFEA 1KV2A 3R7GA 3H9RA 2RKUA 4S32A 5CAUA 1BL7A 4I4EA 2PMLX 5M06A 4L3LA 1PMNA 4FSNA 3FE3A 3V5JA 4BB4A 4DEEA 5M51A 3R83A 4O7LA 4EZ3A 3E93A 5J79A 3TIYA 1B38A 3TIZA 4K0YA 5J1VA 2OK1A 1FOTA 3ROCA 3GOKA 4CCUA 5HVKA 4RWLA 1DM2A 4FKPA 4JLCA 2Z2WA 3VS1A 5L8JA 3DXPA 4QMTA 5DT0A 1MP8A 3A99A 5J95A 2J2IB 4AP7A 2PZRA 4JL9A 3IPHA 3EB0A 4MH7A 3ZH8A 4RLKA 3ZONA 4FEXA 3QQKA 2YM7A 2RFDA 4QD6A 5FEDA 3L9PA 1FPUA 4JI9A 4QP7A 5HE1A 3ETAA 2QLQA 3KY2A 4TWPA 4DT8A 3FKNA 1UA2A 5HD4A 3S00A 3PE2A 4L3JA 1ND4A 4ENYA 3I7CA 1W2CA 2FA2A 4GU9A 3Q4UA 2YDIA 4FT5A 4QMYA 3GFEA 4TXCA 5AUXA 5A14A 3G15A 3N4UA 3FQHA 3CD3A 5LARA 3EQGA 4CRSA 5IQHA 3UGCA 3F3VA 4ZSAA 2X7FA 3C4XA 3NAYA 4G2FA 3DAEA 4KD1A 4F99A 4FIHA 4V0GB 1PXMA 4TKSA 1MRVA 3MVMA 3BV3A 4CRLA 1KE8A 3DZQA 3U55A 4M97A 2QO7A 4WBBB 2EXCX 3DB8A 3L9NA 4H1JA 5IUHA 5CU0A 4CKRA 2Z7QA 5EKOA 2XF0A 5HD7A 3BHUA 3HMOA 2JKKA 3E7VA 1GOLA 4ZZNA 4YJVA 3WI6A 4F7JA 3BRBA 5KMLA 3F2RA 4NCTC 2X81A 1OIUA 2V5QA 3KL8A 4M0YA 4FJVA 4RC3A 3BL9A 2Y7JA 5BYYA 4C2VA 4WD5A 4CFXA 3W2OA 5I9XA 2JFMA 3CSVA 1H1PA 4FUXA 2QU6A 4BGGA 3E64A 5HHWA 3ULIA 4ASDA 1WBNA 3WILA 2AQXA 2HZ4A 3FI4A 4YTHA 3FZ1A 5A4EA 4Y72A 5FQDC 3UODA 5A4LA 4CT2A 2CKEA 3C7QA 3MVHA 1Q62A 4MYGA 4AG8A 1CM8A 4D9TA 4NYEA 2W9FB 3OXTA 4FICA 4X7QA 4ACHA 4GK4A 3MPMA 4ZTHA 3SW7A 4IHPA 5HNIX 5CVGA 2WGJA 2QO2A 5AR7A 1IRKA 5HICA 4EC9A 4RFMA 4GUEA 2EXMA 3RK7A 4J1RA 3VQHA 3QQUA 4CLJA 3WZJA 3NUNA 4LGGA 4U97A 3ORTA 5IQIA 4O2PA 5DPVA 3CJGA 1V0OA 2OH4A 5HCYA 2VWVA 3T8OA 1CSNA 3FKLA 5EDQA 4ANOA 1JSUA 3LCSA 1OZ1A 3UZPA 2B9JA 2VX3A 4DHZA 3UO4A 4G31A 4EH4A 3D2KA 5ETCA 2Y4IC 4G16A 2AEGA 1VLRA 4I5CA 3VULA 4IEBA 3LM5A 4UV0A 2ITOA 4ORKA 4QNAA 3DKOA 4NEUA 4BKYA 4FC0A 3MW1A 1OL1A 2XCKA 2UZLA 1OL7A 3BGQA 3PIXA 2XS0A 4FIGA 5KZ0A 5FTQA 3R73A 2F4JA 3KULB 4U0IA 4EYJA 4ZJVA 4TYHB 3VS2A 4RC2A 5AP5A 1GNGA 2VTQA 3DNDA 2OG8A 4O0UA 4QYGA 3SD0A 5KCVA 5TKDA 2XMYA 2HW6A 3C4ZA 4FKWA 4U79A 3P78A 3RM6A 3ENHA 1GY3A 4JIAA 4FKLA 4YO6A 3RTPA 3FMEA 5AR4A 4P90A 5DBXA 4QMNA 3R28A 3EOCA 3VC4A 3DGKA 3KVWA 4ZSLA 2B1PA 4IZYA 4UZHA 5ANEA 4BGHA 4UN0C 1IEPA 4P7EA 4C4JA 4YSJA 4FEQA 4BTKA 2UW5A 2GNGA 3HA8A 2WTCA 2FH9A 2YJRA 4KIQA 1G5SA 3FZSA 4O4BB 5A4CA 2W5BA 4PRJA 3NCZA 5KE0A 1PKGA 4ASEA 3OCGA 4FSUA 5AR3A 1STCE 4L53A 2WTKB 4GG5A 4Y46A 5EDPA 4AZSA 1G8AA 4AQKA 4RJ8A 3RZFA 1JKTA 4AOIA 3UIUA 4X3JA 3OTUA 4K2RA 2XKEA 3HL7A 3P79A 3QL8A 2VTTA 3LFEA 4D5HA 2PE1A 4ZTMA 3FL5A 2PMNX 5HORA 3EQBA 4NSTA 4W4VA 4EKKA 5HLWA 1PMEA 3PJ1A 4XH6A 4IWOA 4CEGA 1JPAA 3FZRA 3IO7A 2VGOA 3ZFYA 4TN6A 3OCBA 3CKWA 4L44A 4KSPA 2WTVA 4M69A 4M67A 3NW7A 3IW4A 4MVFA 4MEDA 1PJKA 4IWPA 5DHJA 2GSFA 5L2WA 2PK9A 5HBEA 5CI7A 1Q8ZA 3P08A 2IW6A 4FEUA 4L43A 5DMZA 3GU4A 3LXPA 3OMVA 2OH0E 2W05A 3ODZX 4F6UA 5TF9A 2O63A 4ANQA 2PL0A 3AT4A 2V62A 3IQ7A 3QTZA 2HZ0A 4EL9A 4DHIB 2HCKA 3KRRA 3PZEA 3H9FA 3QC9A 3VUIA 5A46A 1WVWA 1XBBA 3VUTA 2WXVA 1QPEA 4RQVA 2VWBA 2F7ZE 3HNGA 4UB7A 4ZSGA 3RHXA 2VGPA 4GMYA 3EFWA 2WTDA 3BE9A 5HCZA 4AN9A 4PDYA 4BDAA 3QZFA 1Q8WA 4MNFA 4I1ZA 1UKIA 4O4DA 2QURA 4FT7A 3DJ6A 4FZFB 2B52A 3KXGA 4F7LA 2GQRA 3VRZA 2BDWA 3FXXA 4PX6A 2ZM4A 3Q4CA 4DT9A 3CY3A 3ZHPC 4P5QA 3VS4A 5F9EA 2OJJA 4O84A 2JAVA 4UYAA 4ASXA 4G5PA 3LMIA 4IW0A 4TL0A 5IQEA 4GK3A 5HE0A 4F63A 1XR1A 3MI9A 4NJDA 5HE3A 4EZ5A 2PVHA 3M42A 4FNXA 2PUUA 2W96B 3FY0A 4Z3VA 2C6IA 4I0TA 4BI1A 3CGFA 3PXQA 4C37A 2YISA 3OZ6A 3QQJA 4C33A 1KUTA 4DBXA 2PPQA 2XKFA 3RPRA 4CSVA 4GKHA 3KF4A 2ONLA 4QPSA 3T3UA 3MJ1A 5BYZA 3A62A 4C36A 2ZFYA 4HYSA 4DH5A 2WTKC 3RGFA 3DXNA 3GU8A 2WB8A 4OAVB 5ANKA 4UMPA 5L6WL 2VWUA 3D5XA 4GG7A 3SC1A 1Y57A 2XNMA 2QOIA 5LVMA 5A54A 5T68A 3TNPC 1I09A 5EKNA 3C5IA 2BZHB 2WQBA 5AJQA 4FIIA 4W8DA 4A9SA 5IA2A 3CJFA 3G0EA 5FXQA 3VBVA 3W2RA 4Z7HA 5L2TA 5CSXA 2W1EA 4DITA 1DS5A 4CKJA 3ZBFA 4EH6A 2WKMA 2VD5A 2WMVA 5LVLA 2XUUA 3DKCA 2CN5A 4RFZA 3R9DA 1ZMVA 3ZCLA 5CF6A 2YIQA 4F64A 3FSFA 5JEBA 3M11A 2XALA 2XNGA 3C4CA 4IB5A 1M17A 1XQZA 1DAYA 1QPDA 2GDOA 5ANJA 5L3AA 3ITZA 5HG8A 4FV9A 3ORNA 4XBUA 2GTNA 2R9SA 3HV5A 3QHWA 3RKBA 5AP2A 3UO5A 2OXXA 3FLYA 2OF4A 3W0QA 4QMQA 3IW5A 3PFQA 4U41A 2O8YA 3P9JA 3D94A 1GIHA 3B8QA 3L9MA 4UALA 1Y8GA 5E91A 4TRLA 4BKZA 4XOZA 3FMJA 1YOLA 4WKQA 3H30A 4AW5A 2PUPA 5AP3A 1OL5A 2QU5A 3I6UA 3Q5IA 3LMHA 2BUJA 3TZMA 2B53A 4Q5EA 2CJMA 4FSWA 4JBPA 3MSSA 4EORA 4JBOA 4DHJA 3OEFX 3PIYA 3ET7A 2JDTA 4ERKA 5JGAA 3NW6A 2Y9QA 2I0YA 4PMMA 5LJJA 2W4OA 4IX3A 2QOKA 1ERKA 3VUDA 2C0OA 4H1MA 2BRMA 3KGAA 5DR9A 5EM8A 4FVRA 4DFYA 4RG0A 1NVSA 3OUNB 3BHYA 3UNJA 3KQ7A 1LUFA 4IJ9A 3RJCA 4GJ2A 4KS7A 3ML1A 2Z02A 2BIKB 4FGRA 4IJPA 4X6RA 3DDPA 5K3YA 3PG3A 4FTMA 3UZTA 3BU6A 5I3OA 1S9JA 5HEZA 3VN9A 3ZXTA 3ERKA 2RL5A 3JPVA 4FT0A 3FPQA 5D1JA 4Y5QA 5AR2A 3SW4A 4EH7A 3FI2A 3MGYA 4C34A 2VTPA 5E8SA 4CFMA 4EJ7A 3R71A 1B39A 3MY5A 1Q61A 2W1HA 5CALA 4OTPA 4XP3A 4AF3A 3W32A 2IWIA 4RA4A 1FBNA 5CSVA 3NEWA 1F3MC 2PVKA 2CDZA 4X6QC 4FSMA 5CSWA 5AUWA 2OI4X 2NO3A 2VUWA 3Q2MA 4AS0A 2UZEA 3BX5A 4FKJA 4H58A 2WTWA 3TV7A 4AE6A 4LV5A 4E3CA 3Q53A 4LV7A 1U59A 3QZIA 2ITZA 3DBEA 4JVGA 4JG8A 2WU7A 1ZXEA 5EYKA 3L8VA 2HENA 4O2ZA 2VNYA 4GT3A 3DZOA 4QMOA 5CSHA 5CEKA 2H96A 5KBQA 2O0UA 4YLJA 5C4LA 3LW0A 2C3KA 5BV3A 5CF5A 3P5JC 3GQIA 4M12A 4YZ9A 1VJYA 4WA9A 3EJ1A 4TYIA 2C6TA 3PSDA 1ATPE 4YHTA 3G0FA 4F0FA 3MYGA 4HVSA 4P5ZA 4M66A 4CFWA 5M4UA 2YCSA 3QZGA 3FZPA 4QQTA 2ZV7A 4ERWA 2XK9A 3QYWA 3PE1A 4RFYA 3ZO2A 5IQCA 3VQUA 1H1SA 4XG4A 2BTRA 5FTGA 3QA0A 1UNGA 2AC5A 3GCVA 3QCSA 3QKKA 3WOWA 2P0CA 5L6OA 2GPHA 4WUAA 4OTQA 2R3KA 3PUPA 4AZEA 3CKXA 2CCHA 1Q8UA 4W4YA 4IZ7A 4RVLA 1YOJA 5DGZA 3U51A 3GCPA 3G6GA 1OMWA 4D2SA 2ZDTA 4ZAUA 1AQ1A 2OSCA 4QP8A 3TWJA 4LYNA 2QOQA 3GVUA 4YZCA 5HG5A 4DEGA 4PMPA 2WEVA 3BQRA 2B0QA 3I0QA 3DA6A 2DS1A 2G2IA 4WBOA 3TNIA 4C4EA 1ZYLA 2YAAA 4IMYA 2PMIA 4ZZOA 1WCCA 3AGMA 2QO9A 4IACA 4MK0A 4Y8DA 5CEIA 4BCMA 3MY1A 4CZTA 4ANNA 4BCQA 5CAVA 1Z5MA 2DWBA 3FL4A 3JYAA 1OIRA 3QXOA 4AXAA 4OBPA 3Q3BA 4U9AA 1G8JA 3QAME 1KOBA 4J98A 3QTSA 4HZRA 1H1WA 3HECA 3F88A 2OJIA 3WF9A 4YU2A 2WQNA 1LEWA 4YJPA 5A4TA 4GVAA 4HGSA 3KMMA 3QU0A 4TWOA 1Q99A 3BWFA 4C62A 4AT3A 4NKAA 4XNEA 2R3LA 4AAAA 4NKSA 4MXYA 4BC6A 4E4MA 3C1XA 2P33A 2A98A 4WRGA 4QP1A 4BTJA 4KBCA 4APPA 4YGAA 4R7BA 1GIIA 2ERKA 4BJJB 2F57A 3KCKA 5AP0A 4BCOA 3UDZA 4O7TA 2V0DA 3C13A 3FMKA 5DFPA 1YI3A 2XIZA 3OVVA 3ZO3A 5AUTA 5DWRA 2ETRA 5AP6A 2QQ7A 3GFWA 3IS5A 2OF2A 5HG9A 2BCJA 1J7IA 3R2BA 5AAEA 5GINE 1R0EA 2YWVA 4OT6A 4NWMA 4ZSJA 3BU3A 4WSQA 4B6LA 4JDJA 5AUZA 2NYAA 2YM3A 3FQEA 3C0IA 5E8UA 2I7QA 2W99B 3MFSA 2IVVA 2ERZE 5AR8A 4I0SA 1DI9A 4S33A 1FQ1B 4FTUA 3P7AA 1GAGA 5K4IA 3F9NA 3OHTA 5EG3A 2QOBA 2OZAB 3IDPA 4S31A 2FUMA 4C59A 1UU7A 3COHA 3UDBA 4EOPA 4FSYA 4NCTA 4BVUA 4BR3A 4AZWA 4BDKA 5L4QA 2BKZA 1JKLA 1KWPA 4J8MA 4MXAA 3W0SA 1M2PA 4HZSA 4MTAA 3EN7A 4TYJA 4CD0A 4WOVA 5JGBA 4R8QA 4L68A 4IAAA 4JDIA 1ZRZA 1AD5A 3CE3A 3CQEA 4N70A 1OKVA 2XKCA 2VN9A 4MWIA 2HYYA 4WG4A 2CGWA 4W9XA 4XHKB 1WFCA 3PA5A 3N4TA 3T9TA 2YCQA 3GP0A 3W2SA 3E7OA 5A4QA 4IANA 3RCJA 4TNDA 5C8NA 3NNUA 2O3PA 3IOPA 2ITNA 4LFIA 5LMAA 3BHVA 5H8GA 5L2QA 4QTAA 3NPCA 5GJGA 4L3PA 5IQDA 3O8PA 2UW3A 4X3FB 3KIOC 4GFMA 2EU9A 4F0GA 1V0PA 2OZAA 4IX5A 4X2FA 2R3HA 2ZOQA 4MNEB 4AW1A 1O6KA 4CG8A 1NY3A 4AGWA 1M14A 4R6VA 3FLZA 5DEWA 4APCA 4J96A 3OW4A 4TYHA 2GQGA 3RCDA 4CTCA 2R3FA 2OICA 3ZC6A 3BEAA 3FPMA 5TE0A 2CPKE 3LIJA 4EH5A 3G2FA 3CTHA 5H8BA 4D4RA 5FD2A 3ZFMA 1ZOHA 2CKPA 4FG7A 4OTRA 4LL0A 3KXNA 2C5OA 3OC1A 3QX4A 4FBXA 4NTTA 5BVNA 3R7VA 1OBDA 4II5A 3ORMA 5FDPA 5HVJA 1HOWA 3DQWA 3PVWA 3FDNA 3GCQA 3PXFA 3QGWA 4I94A 1CKIA 3UTOA 5BMSA 3NVKI 4E4NA 1H01A 3TNWA 5CY3A 4R5SA 5CWZA 3HMNA 3QLFA 4ZSEA 4IB3A 5HTCA 2W0JA 5D9HA 4B4LA 2C1AA 4DTKA 2BAJA 5M07A 2YCFA 4AZVA 3BLRA 3WZEA 4FEWA 4AU8A 4B8LA 2GTMA 3HLLA 2R3IA 5AX9A 3ZUUA 3QTIA 4FTOA 4CKIA 1JOWB 5KMIA 2J51A 3OXZA 1XJDA 3I4BA 3UG2A 3QKLA 5AM7A 2IW8A 3DB6A 1DI8A 3NIZA 3UIMA 5AX3A 3VUHA 2YDKA 3MDYA 5B7VA 2X0PA 2QOFA 3R8ZA 3DBFA 1O9UA 3E8NA 2CNUA 4C4FA 2W1IA 4JR7A 4JQEA 5E90A 1XBAA 2BILB 3HV4A 1WBTA 4M13A 5AMNA 3F5GA 4IAKA 1ZYCA 3LFNA 3OY3A 2WELA 3OS3A 2P4IA 3OW3A 2JGZA 4FOBA 3ZUTA 2Q83A 4FI1A 1E9HA 3QUDA 5HLPA 2GNHA 4N57A 4D5KA 5IEYA 3Q6WA 2JKQA 4JR3A 1Q4LA 5D7AA 5IG1A 4X3FC 4O4CA 3HP2A 4L00A 4NM7A 3D5VA 4HCVA 3NLBA 5C1QB 3DKFA 3QTRA 4TPTA 4AW2A 3BYOA 1PXLA 2QR7A 3U6IA 5CTPA 5L2IA 3AT3A 2A1AB 2BTSA 1Q8YA 2UW8A 2OFUA 2J90A 4LOQA 1BX6A 4UWBA 5LMKC 3OD6X 3W8LA 4KSQA 3WARA 5DN3A 2CSNA 5K5XA 1H28A 4P4CA 4IDTA 1S9IA 4EHZA 4JAJA 1VEBA 2WPAA 4LI5A 1Y8YA 1YXSA 2X4FA 5HIEA 3LFCA 4MBLA 1ZOGA 3VS0A 3G6HA 2C5XA 3VO3A 5B0XA 1EH4A 4UWYA 5IDNA 3F3WA 4BI0A 3TUCA 3TKIA 4FK6A 3BLQA 5BUIA 3V8SA 3ZSGA 4O7SA 2BRHA 2QI8A 2XM8A 5IQAA 1TQPA 1J1CA 3TACA 1JAMA 4HNIA 4BWKA 3BV2A 4XG7A 4EH9A 4OTDA 4GL9A 4GYGA 4GU6A 1QMZA 3EFJA 3F3ZA 3FWQA 2R3RA 3PY3A 4RIXB 4E4XA 5J5SA 4UWCA 1GZNA 4AX8A 4RWJA 5FEQA 3KN5A 3SG8A 3PZHA 4AA5A 4JX3A 5BX0A 2JFLA 4FTJA 4Q9SA 3LZBA 3S1HA 1OKZA 3GOPA 4M69B 1ZMWA 3ELJA 4QMPA 3ZMMA 3BPRA 5IUIA 3K3JA 4EONA 3VONA 3LJ0A 4AXDA 2R3GA 3NDMA 3GC9A 3KXHA 2PSQA 4HPUE 4OT5A 4HVGA 3P23A 3OROA 4N6YA 2XJ2A 2ZV2A 4KKHA 4C8BA 2J0LA 1XMMA 1TKIA 3OY1A 2VWWA 4I5PA 4ZIMA 1F0QA 3AD4A 2IW9A 5IISA 5LCJA 3KULA 2B9FA 3R9NA 1R3CA 4WUNA 1WBWA 4BKJA 1REJA 4ALWA 4DDGA 1OUKA 3HUBA 3DNEA 4I93A 1PHKA 4AAYA 1XKKA 1PXOA 2WOUA 3F5XA 2W1CA 2FB8A 4F4PA 4IB1A 2R3NA 1J7UA 3QWJA 2WEIA 2XNNA 4PY1A 2PE2A 1NVQA 2YITA 5B2LA 4ZTRA 2VRXA 1ZYSA 4BJJA 4CZUA 4I92A 1JVPP 4BCHA 3PPKA 5LWMA 1UNHA 4EOOA 1YHSA 3NAXA 4NFMA 4ITHA 4CLIA 5FBOA 2GS6A 4O1PA 4JS8A 4IZAA 4RWIA 4XG9A 4QP4A 4PNKA 4P2KA 5F94A 2A4LA 2J5EA 2QHMA 2X0GA 3UMWA 4L7SA 3C9WA 3UZRA 4NL0A 5JRSA 3FMLA 4Z55A 5IQGA 5A3XA 3BBWA 1YDRE 5CYIA 4ANBA 5GJFA 1YKRA 3N51A 4OTHA 4DLJA 2C4GA 2YLEA 2CLXA 2UW7A 3I79A 4D4VA 1Z57A 2OU7A 3CD8A 3DK7A 5EFQA 5CNNA 3NNXA 4O91A 1Q5KA 3OTVA 5HVYA 2QVSE 3A2CA 4O6LA 4QPMA 4TTHB 3W2QA 5KNJA 2YIYA 3FKOA 2UZDA 2YN8A 1Y6BA 2XKDA 3PG1A 4D2TA 4EBVA 4DBNA 2VV9A 3V04A 1M2RA 4G6OA 3K5UA 1WZYA 3PRFA 4GVJA 4M15A 4HVIA 5F1ZA 4D9UA 3H3CA 4R7IA 4FL1A 4YC6A 2WMBA 5G1XA 4QTEA 4YUQA 3BYUA 4C3PA 3QRKA 1G8SA 2WZJA 3OOGA 5BQ0A 3EL7A 5D12A 3MB6A 3MH2A 3LFAA 2JIVA 2QG5A 5CAOA 3G33A 2HZNA 2X8EA 2X1NA 3KU2A 4ACCA 3E87A 3DLSA 4BDGA 3LQ3A 4AUAA 1PXPA 3E3BX 1PW2A 4FOCA 4IE9A 3S0OA 3LOKA 5BVKA 3W8QA 4O0YA 2GHGA 3R22A 3UJGA 3N4VA 2C3IB 4FTLA 1YWRA 4H3BA 3T3VA 4DGOA 5AIKA 3A8XA 2PVRA 3EQIA 4DTBA 5AV3A 4DH1A 2C6KA 4KKGA 1JQHA 5AA9A 3QZHA 2W17A 3EYHA 3KK8A 2WD1A 4FV0A 1H8FA 4ZTLA 5F95A 3KEXA 4FTAA 4EUUA 4H36A 3JUHA 4F78A 2PE0A 4YC8A 4TWCA 4EK6A 3ALNA 3IKAA 1YOMA 3DQXA 4HYIA 3UYTA 3PVUA 4ALUA 2YWPA 1W2DA 3Q9WA 4I41A 4OGRA 4D0WA 3U6JA 4WNOA 5KMNA 3BE2A 1FVVA 4IVBA 1KSWA 3TI1A 2YHVA 5AM6A 3R9RA 1LEZA 4IVAA 4H3PA 4EOQA 3PXZA 3QCQA 4E5AX 3OUKA 1MUOA 4FV8A 4DFNA 2O64A 1H0VA 1W7HA 4FKQA 4EBWA 2WMSA 1OKYA 2F2UA 1Q3DA 4I5HA 5IH4A 4UXLA 4WNPA 2V55A 3IDCA 5CQWA 3IECA 5DRBA 3ORPA 1LPUA 2R0UA 3WE8A 5KO1A 4JBQA 4L8MA 3DOGA 1QCFA 2ITYA 4IADA 5ICPA 4BZNA 4TYGA 1P2AA 3QKMA 4ZXTA 3W1FA 1RW8A 2WAJA 4F9AA 4DFUA 3RNYA 3ATSA 4EH3A 4FMQA 2W5HA 3I7BA 2ZB1A 5TT7A 3SXFA 3BHTA 3ZRLA 4L45A 3UOJA 4D1SA 3TJCA 1REKA 4L46A 4ARKA 1W2FA 4CV9A 4FL2A 3G5DA 3F3TA 3KC3A 1SZMA 5LWNA 4I23A 4JXFA 1ZY4A 5IA3A 4CVAA 4I20A 2IZTA 3ZO1A 4FNZA 4YHFA 2ITXA 4PMTA 3RAWA 3T9IA 2QCSA 3UOHA 4C38A 1XWSA 3RPVA 2BFYA 2FO0A 2DYLA 3L1SA 5HTBA 4NT4A 2OXYA 4BDHA 2P3GX 1TVOA 3SA0A 2IVSA 3VAPA 4KIPA 4FTCA 3Q4ZA 3A7JA 5C01A 4DC2A 3LFQA 5FM2A 1WVYA 2PUIA 1M7QA 3HAMA 4HYUA 4C35A 4D2VA 4AN3A 4C61A 2C1BA 4HCUA 3A7IA 5HIBA 2X4ZA 2XNBA 3QTWA 3O7LB 5B2MA 2B7AA 2JIIA 3ODYX 5FGKA 4LMNA 4EWQA 4UX9A 1NXKA 2HWPA 2VNWA 1TQIA 2ONLC 3KN6A 5CU2A 4XOYA 4BCNA 3UP2A 4MXZA 1YWVA 3LJ1A 1PYXA 4FKGA 3MIAA 5I4NA 3GU7A 5EQPA 3BKBA 1K9AA 3PWDA 4NTSA 2FYSA 4ZLYA 4R77A 2XBAA 2GU8A 3QQFA 5TR6A 1YW2A 3VW6A 3UPXA 2BAKA 4V01A 2YM4A 4QMLA 4USDA 1OIQA 5K5NA 5KMMA 2UVYA 4BDJA 2B54A 4IAZA 1MQ4A 4IM2A 3UYSA 5BNJA 3S3IA 4ZP5A 1FVRA 3G51A 3AC8A 4IBMA 2QOCA 4RPVA 2CKQA 4QP9A 4QP3A 3F61A 3ZTXA 4A4OA 4IFCA 3RMFA 4BDBA 4L9IA 3TDVA 4MXCA 3KF7A 3QUPA 5B2KA 5EI6A 3UC4A 5LMBA 5CASA 5I9VA 4HGTA 3VUMA 3A61A 4F9CA 5GNKA 3R1YA 5C03A 2OWBA 2WTJA 3DPKA 2VTLA 3ZM9A 5I9WA 4FVQA 4DF3A 3UQGA 3HV7A 3AKJA 3TTIA 3DJ5A 4DEHA 1W84A 4AACA 4XYFA 3POOA 5GIPE 4AGUA 4XG8A 4E4LA 4BY9E 3DK6A 4E6AA 3FXZA 4BRXA 2ACXA 2F7EE 3JS2A 2VTAA 1JKSA 5FP6A 2XAMA 3ID6C 4QNYA 3PDTA 3SLSA 2E9VA 2GQSA 3TV4A 4CNHA 1ZAOA 4LRJA 3C5UA 1J91A 3TNHA 5ACBC 1U4DA 3NGAA 2F2CB 4XLIA 2J5FA 3EKNA 4FV1A 1XH5A 3O23A 5E8ZA 5J8IA 5LCKA 4D4SA <