4O0YA

Back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Back Pocket Flexibility Provides Group II p21-Activated Kinase (PAK) Selectivity for Type I 1/2 Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o0yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o0yA01
2JAMA 5D9HA 5AM6A 1OKZA 4YZ9A 3GFWA 3QRJA 4ZZNA 3ZTXA 3FYJX 5EM7A 4NH1A 4DEIA 3SAYA 5AUUA 4IVBA 4XNEA 3BHUA 2A0CX 4D55A 1IAHA 1T46A 3PWYA 4Y83A 3MTFA 2XCHA 4AE9A 4EUUA 4MXAA 4YP8A 2C3LA 3PYYA 4FSTA 4UALA 3QXOA 3PSBA 3PPJA 2B53A 3Q3BA 4I23A 5AADA 2XUUA 1U54B 3Q4CA 3BEAA 3F3UA 4IM2A 4UBAA 4BBMA 5FUTA 4PP9A 3K3JA 4GYGA 3EQPA 5FLFA 3TL8A 1Q3DA 2HXQA 2IZTA 4TT7A 3VBYA 3QLGA 2F7ZE 1WMKA 1I09A 2F2CB 1RW8A 3P08A 4WA9A 4ZZMA 5CT7A 5CY3A 4D5KA 4O7ZA 4QMTA 4AW2A 4AW0A 4TYHA 4F70A 2OLCA 3R9RA 4I24A 4OW8A 4TRLA 1Y91A 1L8TA 3SRVB 4GFGA 4B6LA 3NAYA 1UV5A 4W4XA 2YM8A 4FTKA 4AX8A 4EOKA 3ZHPC 5HTBA 4R3CA 3P78A 1OECA 5TOZA 5A6OA 2UVXA 4FUXA 1KE6A 4BKYA 3QTIA 5CXZA 2YWVA 3JR1A 3QGWA 2G15A 1R3CA 2QOHA 3CE3A 4GUBA 2WTDA 3Q9YA 4MYGA 4E73A 4F4PA 3EQBA 1F0QA 1ZWSA 4K18A 4XOZA 4G5PA 4DE4A 3DKFA 1KV2A 3NPCA 1EH4A 5EI2A 3NYXA 3S0OA 1PY5A 4GMYA 1UVRA 5J1VA 3P23A 4GJ3A 4MQ1A 4FSYA 1S9JA 3ZO4A 2OXYA 3QQFA 2QLUA 3ZUTA 5KNJA 3EN4A 3LQ3A 4GIHA 1RQQA 2W1EA 2PL0A 2H6DA 4HPTE 3RM7A 3MFRA 1FGIA 1LUFA 3PP0A 3PXYA 3HRBA 4ZSGA 4BVUA 4I0SA 4D0WA 4DGGA 2G9XA 4DN5A 2EXEA 4F6WA 1OL5A 2BKZA 4D0XA 4DFBA 5KBRA 4YO4A 5IEVA 4R3RA 4O7SA 2HZ4A 2QG7A 3QHRA 3MWUA 3T9TA 3ZFYA 1V0BA 4OTRA 3HAMA 1F5QA 4FEXA 1Q5KA 4ZS0A 2C5NA 4LG4A 1GZKA 5JRSA 3GI3A 3O17A 4FSNA 5LCJA 3FHIA 2WELA 2X8EA 3FWQA 3NIEA 4M7IA 4RC4A 1E1XA 3CQWA 1W84A 4MF1A 3PDTA 4HVIA 4YJUA 3D15A 2HENA 3WIGA 2UW6A 1DM2A 4X3FA 4CKRA 1QCFA 4KINA 1JOWB 4FT3A 4IZYA 4KKGA 4AFJA 3DXQA 3UIMA 3D4QA 2I0YA 4YMJA 3LKMA 4L3JA 3QKLA 2HZ0A 3LXPA 3DZQA 3NW7A 5A54A 3CD8A 2B7AA 3BX5A 4TWNA 3LLAA 2QOLA 3TIYA 4UYAA 4IWQA 2OXXA 3W16A 4OAVB 1O9UA 2GMXA 4B7TA 2R5TA 2VO3A 4Z7HA 3FYKX 3HMIA 1Q97A 3QRTA 4UXQA 1NY3A 2IZSA 4FV6A 4G3GA 2VO0A 3P0MA 3BV3A 4XEYA 3WF6A 3FSFA 5B2LA 2WD1A 4JL9A 3ZBFA 4S33A 2Z8CA 4ZOGA 4Z16A 4FEVA 4FC0A 3KRRA 4U42A 2WGJA 3F69A 3GCVA 4KD1A 4JQEA 5J9LA 2DUVA 3TKHA 2ITXA 4G3FA 4O0RA 4BCKA 4Y73A 3DS6A 3VUMA 5BVDA 1FMKA 2BDFA 2JC6A 4AP7A 3H30A 1Y6AA 4CG9A 4PQNA 4BL1A 2VN9A 3ORZA 3S00A 3EZRA 1OL7A 2VTAA 3KRXA 4UMTA 3LM0A 3ATSA 5E91A 3ZZWA 1A06A 1WBVA 3ORNA 4BCMA 4E5BA 4QYYA 4H3PA 4NL0A 4B99A 3TJCA 4UWYA 5EOBA 4KIKA 3PXZA 2PE2A 5AUVA 3JS2A 5CU3A 4E4XA 3Q5ZA 4DF3A 3NNWA 3QQHA 4XYFA 3U9CA 5EFQA 2OBJA 3W2QA 3BYUA 3WZKA 4F9AA 4FGRA 3F66A 4PL4A 3MFSA 1RE8A 4Q2AA 4CT1A 5KMIA 2XK9A 2E9VA 3POOA 4KA3A 4MNEA 4FICA 4HCTA 2XBJA 1JVPP 4HCUA 4WSYA 5JGDA 2XNEA 3MVJA 3PIZA 4FG9A 2EUFB 2YEXA 2ZMDA 3A4OX 3LZBA 4ZTNA 2BALA 5H8EA 3R7VA 4O84A 3DKOA 3CPCA 4QMLA 3UGCA 2OGVA 2VV9A 4I22A 4I6FA 2Z7RA 5CENA 3OEFX 5DI1A 2BRHA 5AUYA 4QQ5A 4ZLYA 1YHWA 2UVYA 4JOAA 5IA3A 3FUPA 2HIWA 3AC1A 2CHLA 4DFLA 5HG9A 5J9ZA 2BAKA 5HZNA 3MY0A 1J7LA 4M12A 1FVVA 5BUEA 4W4WA 3G5DA 1U5RA 2R2PA 2VTPA 4HGLA 1KE5A 3IKAA 4BYJA 4E5WA 4GUEA 1LR4A 4J71A 4OLIA 5IPJA 3GCPA 5DMZA 4ASXA 5B7VA 3KA0A 4QP8A 3CP9A 2WEVA 2YZAA 3HMOA 1FPUA 2JIIA 2VTNA 4K0YA 1O6LA 3FXWA 5M4CA 2BROA 1MQ4A 3DY7A 3IDPA 2H9VA 3CJFA 2WHBA 3L8VA 4I93A 4U7ZA 3QKMA 3SW7A 3CTHA 5CU0A 3TDVA 1PW2A 2QOKA 3P7AA 5G1XA 2CKQA 5F4NA 4EI4A 1BUHA 1OKYA 2B4SB 1OPKA 2BDJA 4FTUA 1KOAA 3FMEA 4L53A 4XP3A 5JGAA 4TWPA 1VEBA 1UNHA 3VS3A 1Y57A 3A99A 2GFCA 4QPMA 2RGPA 4KIPA 5AR4A 4BDBA 5JGBA 2XF0A 2WMQA 1HCKA 4M14A 5ACBC 4U3YA 4OTHA 3ZLYA 5AA9A 2VTQA 3EL8A 3LXLA 4ONAA 4R77A 4IM3A 2XNPA 4O0WA 4CCUA 2W1GA 2WQBA 1PXPA 2R3JA 1M2QA 2VWVA 1MRYA 2GSFA 4CV9A 3AD4A 1Y8GA 3QQKA 3AD6A 3EQGA 4X6RA 4LRJA 2VNYA 4FIIA 5HBHA 5AV4A 4RX8A 3ORPA 4P5ZA 5TR6A 4KB8A 3N4VA 1NVRA 3UTOA 3T3VA 4EH5A 1H07A 2CMWA 2H34A 3DLSA 5EI8A 4BDEA 5HU3A 4BDGA 3PJ1A 3ETAA 3DFCB 3PVGA 3MN3A 2YDKA 4EH7A 5LOHA 2C5XA 4ANBA 3LQ8A 4RIWA 3R04A 4CTBA 1YI3A 3PXRA 3NUNA 3IGGA 2BIYA 3JYAA 3UYSA 1APME 3VBQA 4RX9A 4IANA 5HE1A 5CAPA 2CLQA 2EB2A 4AOTA 1KE9A 4LL5A 4UZDA 5IH4A 3BYVA 4CGAA 3R8ZA 1Q24A 1U59A 5JSMA 1STCE 2XIYA 2R64A 2X6EA 4XG9A 5CVFA 5CVGA 1KUTA 5AMNA 4WO5A 4MK0A 5EDQA 3LFDA 4DH8A 4DTAA 4XRJA 3COKA 4V0GA 1H8FA 2C6KA 4DLIA 5J7HA 3UQFA 3F3TA 2SRCA 2H96A 5AV3A 2JKMA 4OTFA 1UU9A 4FIFA 4I20A 3OOMA 4YBKA 2P2HA 4FK6A 4C3FA 1IA9A 3MI9A 3UO5A 2Z7QA 3FY0A 3G33A 4C7TA 1WBSA 5A4QA 4DH3A 2CJMA 3W1FA 3AGMA 2YISA 4D4YA 2HXLA 4S32A 3HV5A 3OXTA 5TF9A 4BTMA 3M1SA 4ZTMA 3I0OA 4W8EA 4YLLA 5EYCA 3C5UA 3NZ0A 4ITIA 5DOSA 4BWXA 4C57A 5BVEA 5DG5A 4QTAA 2X9EA 5KMKA 5LMAA 3OFMA 4ZY6A 4G3CA 3ZM9A 3U6IA 3WZUA 3UBDA 1ZYLA 3I5NA 4KS8A 5FEEA 4F9BA 3NYVA 4XX9A 3NGAA 5GNKA 3SLSA 4FI1A 4DGMA 3FC1X 3TDWA 3ACJA 3PA4A 4ENXA 4LYNA 5J5SA 2WU6A 3VULA 1Q8ZA 3EJ1A 4RFZA 3GC9A 4V04A 2GNIA 3O71A 2XNNA 5HE0A 3FEGA 1WFCA 2XCKA 5LARA 3DBCA 3ZEWA 3Q2MA 3I7BA 4K11A 1QPDA 2F9GA 4NKAA 5K4JA 4M68A 2ZDUA 3VRYA 2C4GA 3WARA 3ZFMA 3C4XA 3GGFA 3RPSA 4NUSA 5HX8A 2C47A 3FLZA 4ZY4A 2P33A 3DJ7A 5ICPA 5M08A 2CKEA 4TYJA 3KN6A 3PSDA 4QQJA 3Q53A 3DFAA 4PPBA 4YU2A 4XV2A 5CALA 2BZJA 3FI3A 3TIZA 4YTHA 3O23A 3PWDA 2BHEA 2PVNA 3W55A 4O81A 3RHKA 4QT1A 2CCIA 4ASDA 5DA3A 4XOYA 2XVDA 4HYHA 2PMOX 3KXNA 3C1XA 2ITVA 4RX7A 4EOQA 3GOKA 4FF8A 3TJDA 2YERA 4GT5A 1H26A 3ENHA 2DQ7X 2AC5A 3E3PA 4U0IA 2ETMA 3KU2A 3VBXA 3ORXA 4IX6A 4R7HA 2WNTA 5L8JA 5KZ0A 2J4ZA 3SXFA 3W33A 2EVAA 1PKDA 1ZYDA 5AR7A 4C62A 4IAAA 2JIVA 5BUJA 3R83A 4DEBA 3BRBA 1ZYSA 1SMHA 5HG7A 4DC2A 3FQEA 4YLKA 1XH5A 4NTTA 4J99A 4C59A 3EQFA 2UW7A 2BRBA 3CGOA 3HV6A 4XG4A 2UW9A 5HD4A 2VTTA 4CMTA 4KBCA 3DQXA 2PTKA 2X4ZA 5CT0A 4AACA 1PYEA 2IW9A 4YTCA 4GV1A 3EWHA 5CU6A 4O21A 3R71A 5AR2A 3KREA 4BDAA 1ATPE 1GAGA 3KULB 4AN3A 4KAOA 5A14A 2OO8X 5AA8A 4KUJA 3LLTA 2XRUA 1Q3WA 2YCFA 1SNUA 3E5AA 3KXMA 3VW8A 4RLLA 4U45A 1XH6A 4RJ4A 4RBLA 3MW1A 3FMNA 5DH3A 4X2KA 4C02A 3I6UA 4NTSA 3HV3A 4IWPA 3S1HA 3SA0A 4X21A 4FTTA 4G3DA 1B6CB 2IVUA 4HNFA 4WUAA 3TZ8A 2OIBA 4P4CA 4GG5A 4TXCA 5JQ5A 4PDOA 4E1ZA 4NSTA 4IX3A 3PSCA 2ITPA 1GIHA 1K2PA 4ID7A 2BMCA 3NNVA 4G2FA 4KRDA 4ACMA 4EKKA 4XLIA 5L6PA 5M51A 3DJ6A 1E9HA 1F3MC 5AIRA 5CZIA 2QU6A 3DLZA 5DT3A 3DTCA 4OTWA 3U9NA 2WOTA 5LMKA 3G6HA 2X4FA 3EN7A 2C6TA 3QF9A 3PJ3A 2CGXA 4W4VA 3DTWA 5CAOA 1ERKA 4PUZA 5FD2A 5CSPA 4II5A 4AQCA 1CDKA 3BIZA 5HEZA 3V8TA 4X3FC 2ERKA 3UZTA 3QRKA 3BEGA 3VJOA 4D2VA 2GCDA 3NUAA 2RFEA 3FZSA 3EKKA 3TV6A 3O50A 3BLHA 3IK3A 1JNKA 2JFLA 3TKIA 3PG1A 2GS7A 4JRVA 4UXLA 3FPQA 5IMEA 1P4OA 4QMMA 4FZDB 3A7HA 4FL2A 5BYLA 1J91A 3UC4A 1H1RA 3SD0A 2FSLX 4IX5A 4LFIA 2A2AA 2OH4A 3LFAA 1BL6A 1H25A 3DCVA 4FMQA 2VO7A 4WKQA 1NW1A 2E9OA 3OBGA 2QR7A 5DR6A 3SXRA 2ZB1A 3JVRA 4G3EA 3VHKA 3JUHA 1M14A 5DHJA 5K5NA 3QA0A 3MDYA 3NUXA 3O8UA 3KRJA 4FYOA 3OG7A 3SDJA 3C7QA 3E64A 4WG4A 3PXFA 1M7NA 5E8YA 3UOLA 4NIFA 4H58A 2PU8A 2C68A 2X8IA 5IA4A 4L9IA 3V8SA 4A4LA 1XH7A 2GS2A 1BI7A 1YI4A 2YIRA 4GW8A 3OT3A 2UZTA 4IC7A 3VNTA 4MX9A 5J9YA 2IZRA 3OOGA 4JX7A 2PULA 3V8WA 3ZONA 4DFUA 5DN3A 1YXSA 2W1IA 2FYSA 5IEYA 3G9LX 4P7EA 2J9MA 3AGLA 3Q04A 4M8TA 4RLKA 2C5OA 3OXIA 5B2KA 4J98A 4ACDA 2B0QA 5I9UA 4ENYA 5FEQA 4IZAA 3O51A 4A4XA 4M0ZA 3G2FA 4JBQA 4M84A 4APPA 5JFVA 3CQUA 4U3ZA 4RZVA 3EMGA 4FVPA 4U43A 4RWKA 4HVSA 4FTOA 4YR8A 3RM6A 3OY1A 5IA5A 4IWOA 3K54A 1Q8YA 4LV8A 1MRUA 2XIXA 3W10A 1BX6A 2JBOA 2RFSA 5KX8A 4F7JA 4FTNA 4FA2A 3F3VA 1GZNA 2HCKA 3U6JA 2FO0A 3ZXZA 2GTMA 3I60A 2BVAA 3QL8A 3WIKA 1G8AA 2JDVA 3QUPA 4AZWA 2R3FA 3T8OA 2P55A 4RSSA 5K5XA 3I1AA 4O0TA 1PXIA 1R1WA 2X7OA 3D5UA 3MVMA 3MY5A 3F7ZA 5CLPA 2ZVAA 3M2WA 3ROYA 2E2BA 4PL3A 3F5GA 3DK7A 4UB7A 4WBBB 4O86A 2WQOA 3OWLA 4CZTA 4L8MA 5E7RA 4FT7A 4TYIA 2XM8A 1YW2A 2B54A 2IVVA 2WMTA 3ZDIA 4BCNA 3DGKA 4WRGA 4Q9ZA 3VUDA 2VWZA 4X3FB 3RVGA 1M7QA 2ETKA 5AUWA 2YA9A 3KB7A 3NUSA 4ITJA 4O22A 4YLJA 5DBXA 4BTKA 3MH2A 2YM6A 3RJCA 4HVHA 4E5AX 5DVRA 2QC6A 4C4FA 2UZEA 2Y9QA 5CF5A 1OIYA 5M44A 1ZAOA 1W0XC 1YDRE 2GDOA 5CVHA 4QP9A 2HZNA 5CYIA 3RTPA 3TNHA 5BYYA 2WAJA 2JD5A 3NCGA 3Q4ZA 3AMBA 3QKKA 4N4SA 1YWVA 5KMJA 3ID6C 4G17A 4BDFA 4RVTA 4MAOA 4FSRA 1MP8A 2ITZA 4KKHA 4WRSA 4BYIA 4Z7GA 3U8WA 2JBPA 4NKSA 3O7LB 4HNIA 5KKRB 2WQNA 5DR9A 3TT0A 3QCQA 3QTWA 4O91A 5M55A 3V51A 4DCAA 2ZM3A 4IW0A 3QQUA 1PMVA 3BHTA 4G6LA 5B2MA 1XBBA 2I40A 5I9ZA 4GKIA 2CPKE 3C4ZA 4EORA 3DT1A 3EKNA 2XKCA 4QMPA 3H9RA 3A7GA 1NVSA 2ZM4A 4MEDA 4ASEA 2Z2WA 3ANRA 3ZO1A 3F2RA 4DGLC 3NCZA 1ZRZA 2WO6A 2XJ1A 4FNZA 2YM4A 3W2SA 2XNBA 5C8KA 4U9AA 1OZ1A 3ULIA 4XG8A 4IWDA 4LV5A 2PUNA 4YC6A 4K9YA 1HCLA 4PTEA 3F61A 2Y4PA 3MA6A 3W8QA 4EL9A 2OFVA 4C38A 4HVGA 4BC6A 3OEZA 4TWOA 4KRCA 2YIXA 4IM0A 2OJGA 2VWYA 4GEOA 4LMNA 3ITZA 3EQHA 4QQTA 5CEPA 4M66A 4F0FA 3PLSA 2X6DA 3IPHA 4RVMA 3RNIA 4MNEB 4PX6A 4CFWA 2GFSA 4IAIA 3MFUA 2C5VA 5AWMA 4IHPA 1V0PA 3A8WA 3ZRLA 4I21A 4O0SA 4XJ0A 1P2AA 3A62A 3CS9A 1SVHA 3L9PA 1W82A 5JT2A 1BMKA 2VX0A 4QP3A 2GNHA 3LCKA 3BBTB 2OW3A 3FJQE 3QZFA 3IW8A 3QWJA 4U81A 5CZHA 4D4RA 2ONLA 2GS6A 2X2KA 3LMGA 4J8MA 4O6EA 2YACA 2ERZE 3PJ8A 3C51A 3COIA 1XKKA 3DOGA 3NW6A 3NYOA 1E1VA 4OT5A 4ANOA 3R00A 4K2RA 4TY1A 2CNVA 4YZDA 4QRCA 3RPRA 3WE8A 3H9OA 5K0KA 3RBWA 3N51A 2ZMCA 2WZJA 4XP0A 4K6ZA 5I9YA 2W7XA 2X81A 2XYNA 3FQHA 4I41A 1FOTA 3OHTA 3ORLA 4L68A 3LW0A 1H08A 1DI8A 4F7SA 3HV7A 2JKOA 2ZAZA 4EHVA 2R3PA 4JI9A 5FXSA 4EC8A 4JXFA 4NCTA 1JSTA 4RWIA 3PJ2A 4BDKA 3SG9A 3G51A 4HGTA 1FQ1B 2PMLX 4D28A 5LVPA 5CSVA 2PVFA 2XB7A 2W5AA 3IECA 4KSQA 3PRFA 4XH6A 5EW8A 3E62A 3R8PA 4D2TA 4BR3A 2PZ5A 1PXNA 1XWSA 4EEVA 4F63A 3CKWA 4RPVA 2W17A 4GJ2A 3ROCA 4I6BA 1BLXA 2R3LA 4CQEA 2Y6OA 3FQSA 4DTBA 3AC2A 2C0TA 4I94A 4DYMA 1MRVA 3D2IA 4O82A 4DFYA 1G5SA 1M17A 4NWMA 2FSOX 5IG1A 4PMTA 1KE7A 2XEZA 5LVNA 4PP7A 5KE0A 2AUHA 3W2PA 4M69A 3ANQA 3PZEA 3U55A 3CD3A 5FTQA 3NUUA 2W9ZB 4MXZA 5FEDA 3UODA 4U79A 4NFMA 4QYGA 4JRNA 3VS7A 4ZJJA 3FI8A 3KQ7A 4ARKA 3HV4A 4UWBA 3V6SA 4AW1A 5H2UA 5E8TA 4AT3A 4DH5A 5DT4A 1REJA 2F7XE 3EIDA 3P1AA 4KSPA 4WT6A 4F7NA 4H36A 2X7GA 3WF7A 4G6NA 3RWQA 1OL1A 3TV4A 1UWHA 1PJKA 3PA5A 5GJFA 4HCVA 3R30A 3DK6A 5IUIA 1UU8A 4QYFA 4NM0A 3R63A 4B0GA 2C30A 4U97A 1ZOGA 2VTOA 2B55A 2GPHA 3TCPA 5HICA 3TEIA 3PY0A 4E6QA 4GH2A 3D7TA 4RA4A 3LJ2A 3TNIA 1OB3A 3ERKA 3HP5A 1URCA 2VWXA 3VJNA 3RPOA 4BICA 4NFNA 3DAJA 2R4BA 5DRDA 3E8DA 4J97A 4TYEA 4EWQA 3F2AA 4DG3E 5IQHA 2XIRA 3OVVA 4FZ6A 4EH4A 4MXXA 5DWRA 3MVLA 5LWNA 1ZOHA 3NDMA 4YURA 3EN6A 4OUCA 5M4UA 4IIRA 3IW6A 3OUNB 3CEKA 4W9XA 1PRYA 3ZCLA 5ETAA 5CNNA 1Q8TA 2IW6A 2RG5A 3BV2A 2YAAA 3MIYA 4QMSA 5L6WL 4C4JA 3VUIA 4TW9A 2XNMA 2V0DA 5EW3A 2JAVA 3PY3A 3QCSA 4IFCA 4E3CA 4GU9A 1LEZA 4RIYA 3T3UA 3RKBA 4GKHA 1CKJA 4H3BA 3GCQA 2JITA 4E4NA 4YJOA 3C5IA 3GC8A 3UVRA 4L00A 2HW6A 2V62A 3GP0A 1TQPA 3U4UA 5E9EA 3KL8A 1Z57A 4IFGA 5BX0A 3TUDA 1PMUA 4ZSAA 2PVYA 2W4KA 5JFXA 4AF3A 2QD9A 4IDTA 5D7AA 4FKPA 3OF0A 5HCYA 3WF8A 3PZHA 4C4HA 4CLIA 2OZAA 2W9FB 4EQCA 2R3MA 4G5JA 3QXPA 1J1CA 4C4GA 1OGUA 4DEAA 4E4MA 3QD2B 4F7LA 3QQLA 5LMKC 4AGWA 4KBAA 1FBNA 2YM3A 1OL2A 3KN5A 3O7LD 4IZ7A 3NMUF 4LQMA 4QMVA 5G6VA 3IO7A 4ANMA 4EOMA 4K33A 5LMBA 3LCSA 3KXHA 4C61A 4EH9A 4ZTLA 1ND4A 4DGOA 2X8DA 3Q2JA 3ELJA 3F5PA 4ZTHA 5C27A 4XBRA 4CRLA 1OUYA 1UU7A 4O7RA 2CKPA 2XJ2A 1PMNA 3OCBA 5C9CA 4ACGA 4FKOA 4C33A 5BVFA 5EW9A 3GU4A 3HUCA 4AE6A 4CYIA 4RJ6A 5HORA 4O7YA 3B8RA 2YAKA 4FOCA 1YXUA 4JDJA 3VO3A 5IH5A 1OPJA 5H8BA 4OTDA 4JNWA 4RA5A 4BY9E 3QC4A 3O2MA 2IPXA 4O0UA 2RFDA 5T6KA 4G16A 4FEWA 2Y0AA 4QP2A 2OG8A 4G6OA 4RWLA 5IUGA 2ZV8A 4FT5A 5F9EA 2VUWA 5CX9A 1YVJA 3OW3A 4RJ8A 3QTQA 4ERWA 4CKJA 4B9DA 5CEMA 3LFBA 2B9JA 3BKBA 3PVUA 5JQ8A 4MTAA 4O7VA 4ANSA 4D9TA 3B2WA 4A7CA 3VRZA 4QYHA 4L6QA 4HGSA 4FTAA 4ZSJA 2IVTA 1OIRA 2YJSA 1VZOA 3R1QA 4BCFA 1GIJA 4FVQA 1XH9A 3CSVA 3MYGA 4DCEA 4IDVA 4BCOA 3NIZA 3LFFA 2A1AB 3NRMA 4N70A 2WTKC 1A9UA 3QRIA 4MNFA 2JDRA 5K0XA 1PXLA 1OL6A 4UMUA 3VQUA 2R0IA 3CBLA 3ORIA 5AIKA 2IJMA 4FV3A 3UP7A 4EBWA 2IO6A 3KMUA 4X0MA 3RINA 4CQGA 4I0RA 2V55A 5A4EA 4JBOA 4FX3A 2VGPA 2OICA 5I9XA 1QMZA 3KVXA 2EXMA 4NZWB 2QOFA 2PE0A 1DS5A 4O1OA 3R1YA 2BAJA 3AC4A 3ZLSA 4AXAA 1YXXA 2Y4IC 1WCCA 4FKJA 5JH6A 4EKLA 4MKCA 3NYNA 2XEYA 4FKSA 2ZB0A 3DK3A 4JG6A 2VTJA 2BZKB 2KULA 2WXVA 4LOQA 4UX9A 4JT3A 1X8BA 1JAMA 3NNXA 4C34A 4BKJA 3QA8A 2WQEA 1WBOA 1XH8A 2J0MB 3E3BX 3CPBA 1JBPE 2ESMA 4J7BA 5F1ZA 2V7OA 5CASA 3VVHA 1OBGA 2OI4X 2G01A 4PWNA 3UE4A 4KABA 4YJVA 2HW7A 5FP6A 4I92A 4PDSA 3HVCA 4WG3A 2VD5A 5GZ9A 3VS2A 3WZDA 2XIZA 3NNUA 1TVOA 1JSVA 1GNGA 1IG1A 4BWKA 2GHGA 3O8TA 3NX8A 4MBIA 2G2HA 5AP3A 2JDOA 2PY3A 4N0SA 1YXVA 3U6HA 4KNBA 2REIA 1NVQA 3QCYA 5BVNA 3FI4A 5A9UA 2B52A 3QGYA 2GU8A 3UO4A 5HD7A 4O38A 3ZSGA 5H3QA 5CTPA 1U54A 3QQGA 3LVPA 4X2FA 4Z3VA 3FL4A 3Q6UA 4O0XA 4BDHA 3BYMA 2I7QA 1Q8UA 1WVXA 2Z7SA 4W9WA 4O83A 1VR2A 5EM8A 4JLCA 4E6DA 2OWBA 3FZTA 4CV8A 3RHXA 4BRXA 5CEKA 3RP9A 3P79A 5HNBA 3NUYA 4GK4A 2Z02A 4AOJA 4FKRA 4WOVA 5KUPA 4FL1A 4FKVA 1Q8WA 4GS6A 2FGIA 4ZY5A 4B8MA 4TN6A 2XM9A 5FTGA 1YHVA 3GEQA 4M97A 4QP1A 2A19B 2FSMX 4YJSA 4EHZA 5KMOA 1R78A 1ZYCA 3E8CA 2VTRA 3IW7A 2YIQA 3ZUVA 2W5BA 1YWRA 3LHJA 5JKGA 3L8XA 4JIAA 4APCA 4B8LA 3S95A 4WD5A 3TV7A 1H1SA 3TUBA 2CLXA 4EQUA 4BZOA 1PHKA 5E1EA 1WBWA 2LGCA 4OR5A 3UQGA 2JEDA 3R21A 5TO8A 1PYXA 3R8LA 1L3RE 2BTSA 3JPVA 3KK8A 5BMMA 5L4QA 1WBTA 4CNHA 2FB8A 3ORKA 3DV3A 4RIXA 4LOOA 1NT2A 2WTKB 4AZTA 5KHXA 2YM5A 3THBA 3QCXA 3F9NA 3EFWA 3CTJA 3FLQA 5CU2A 5AR3A 3W32A 4S30A 4IVAA 5EQPA 5EM5A 4XLVA 1UA2A 1NA7A 1JWHA 1YQJA 4HYIA 4QMXA 3WF9A 4C4IA 2IG7A 2B9HA 2OK1A 4Y85A 5AP6A 5JN2A 1I44A 3B2TA 5K3YA 2ACXA 3OWJA 4D5HA 4RC3A 5CQUA 3KY2A 4HVDA 1U5QA 1ZZLA 5J8IA 1U46A 5GZAA 3PIYA 4TZRA 3OXZA 4M3QA 3GUBA 4JR3A 4X2NA 3K5VA 1QPEA 3U51A 3LMIA 4BHZA 4BDJA 4FIJA 4Z55A 5JZJA 2GQSA 4ALVA 5CNOA 2BHHA 2ONLC 2A27A 2QOQA 3NSZA 1ZXEA 5AP5A 2BAQA 5AX3A 3E92A 4NYEA 2YJRA 2W5HA 2QQ7A 4F9WA 3N4UA 5HE3A 4XV9A 2R3GA 3VHEA 3LCOA 2R3IA 5ANJA 4AA5A 3BU6A 4XG3A 3WYYA 4LUEA 4UMPA 3QC9A 4KWPA 3MJ2A 2HY0A 4OAUC 4MD8E 4AT4A 4YTFA 3VQHA 2ZJWA 2F7EE 3RALA 3D94A 3DBDA 3RK9A 2WTWA 5ANIA 3BLRA 3RPVA 4CXAA 3MH1A 4FSWA 3L9MA 4ALUA 1OIUA 3HL7A 1JLUE 4LL0A 5HGIA 2CNUA 3E93A 1Z5MA 4FNWA 5HO7A 3FLWA 2WOUA 5JK3A 2QONA 3O96A 3Q5IA 4F09A 4PDYA 3FLSA 4L45A 1FVTA 2HOGA 3QX2A 4FKLA 4BN1A 4JR7A 2XYUA 3UZPA 3E7VA 3O0GA 1V0OA 3D5WA 5EDPA 2R0UA 3QYZA 2J7TA 3BWJA 1K9AA 4FV4A 3EB0A 1TQIA 2VTMA 4FSZA 4GYIA 4C36A 3QWKA 4QNAA 4PF4A 3A7JA 4Q9SA 5DGZA 3BU3A 2CNQA 4IB5A 2ZV2A 4L7FA 3ZC5A 5E8XA 4R5SA 4F1MA 5A6NA 3FMHA 3A4PA 3AQVA 5GIOE 4X2JA 4FT0A 2WB8A 2ITYA 5ETIA 4WUNA 3UP2A 4HYSA 2Y8OA 4XV1A 4BDDA 4FV2A 2PMIA 4L01A 4BCQA 2KTYA 4EJNA 3H3CA 3TNQB 3SQQA 3OCTA 1OKWA 3R22A 4P90A 4BCHA 5FDXA 2WMXA 2ZOQA 3CY3A 4G1WA 2J5FA 4J53A 3P7CA 2XBAA 3FZ1A 1JQHA 3KRLA 4WIHA 4BDCA 4U44A 4HJOA 3ZM4A 1Q99A 3S3IA 2OZOA 3UIBA 2WMBA 4IC8A 2BTRA 3V5PA 2BCJA 5A46A 3GFEA 3W2OA 1YDSE 4IMYA 5F94A 1UKHA 4CZYB 4EK3A 3I5ZA 1RDQE 4ZSEA 3F3WA 4ZJVA 3E88A 5DIAA 2O63A 4JDIA 2PZYA 2UW3A 4TTHB 3ACKA 4JBPA 5KMMA 4DT9A 5HX6A 3Q9XA 1R0EA 1PKGA 3IQ7A 4O0VA 1XBCA 4AUAA 4KS7A 2Q83A 4FKTA 2X39A 2WPAA 4Y46A 4IAFA 3WZEA 5IUHA 3SHEA 4QP7A 2XNGA 3VBTA 3HP2A 3MIAA 3AMAA 3I81A 5DT0A 2GNJA 4LGGA 3QX4A 2ITWA 2ITUA 5DRBA 4D2PA 4FVRA 2VZ6A 4J1RA 4OTQA 3DAKA 2XK6A 4FZ7A 1QPCA 3OC1A 4IQ6A 5E92A 4I3ZA 3RWPA 3ZFXA 5KHWA 4RFMA 3R9NA 1XH4A 3TKUA 4YJRA 3EL7A 3DU8A 3RK5A 2YFXA 3AMYA 3UZRA 5E8WA 3LIJA 4PNKA 5BYZA 4GVJA 4F1OA 4D2SA 4XG7A 1V1KA 1XJDA 4IJPA 1PXMA 4IX4A 2ZV7A 4ZTRA 4AWIA 4R7IA 2GQRA 4KIQA 4DFXE 2QO2A 3AC8A 5AR8A 4MXOA 3DKCA 5KCVA 2VNWA 5I3OA 4ZJIA 4C0TA 3ZZEA 3BQRA 4FODA 3B8QA 4L7SA 2UZWE 1BI8A 3HGKA 5IU2A 3PG3A 4M15A 3ZUUA 5E4HA 5JEBA 3RCJA 2UZUE 1OIQA 1XR1A 3HRFA 3EQCA 5AM7A 4EHEA 5L8LA 3RAWA 3KF4A 3LAUA 3R7IA 4Z9LA 1JKTA 3KCFA 3OP5A 5ANGA 4FV1A 1H0WA 3R28A 5I9VA 3RZBA 3CTQA 3TNPC 5E8VA 2VRXA 5L6OA 1OPLA 3OTVA 2CDZA 2ITOA 4TYHB 5HG8A 4YNEA 4IAZA 3PXKA 4EH8A 5AR5A 3LFNA 4R7BA 4D4VA 3FDNA 5TKDA 4EWHA 3CKXA 2BUJA 4QMZA 4H1JA 3LFCA 5LWMA 3AT4A 4WNPA 3VBWA 2VU3A 3OBJA 3NLBA 4I5HA 5CS6A 4D1XA 2XNOA 4R1VA 2C6MA 3GC0A 3G0EA 2ZM1A 4QOXA 1Q4LA 4DINA 1ZZ2A 3V5JA 5EDRA 2WTVA 4O2ZA 2C6OA 3UVQA 4ANQA 5IA0A 3SOAA 5E90A 1HOWA 2DWBA 4A9TA 1OKVA 3LOKA 3QTUA 5J1WA 1WVWA 2ITTA 3NEWA 5FG8A 4ANLA 3A61A 4EZ5A 4BZDA 4FIHA 4M13A 1J3HA 3FV8A 3QZIA 4WHZA 5EHLA 5HO6A 4DEDA 4S31A 2QCSA 1FVRA 1GJOA 2XK7A 5DNRA 5CF4A 2UUEA 2NNWB 3VBVA 5BUIA 5BVOA 4U41A 4FNXA 4EH2A 5CAQA 2C0IA 4Y5QA 4W4YA 2HY81 5LVMA 1M52A 4XG6A 3CXWA 4BB4A 1YWNA 3IOKA 1MQBA 2XKFA 3F82A 2GTNA 4Q5HA 3LM5A 3SV0A 4D4SA 4DG0E 2JFMA 2YCSA 3KMWA 5AJQA 3SG8A 3C13A 3PPZA 5I0BA 5JFWA 5HG5A 3L8PA 5FDPA 5AX9A 4KIOA 4EH6A 4JS8A 4HPUE 2R7BA 5AUTA 4D9UA 2JKKA 2UVZA 5D41A 4M0YA 2F57A 4WSQA 4XBUA 3TWJA 5J5TA 3R2YA 5EYKA 5DE2A 4CKIA 2PMNX 5EQEA 3GB2A 3I79A 3UMWA 3PLAE 4AU8A 2ETRA 2PVRA 2VWIA 3D83A 4UEUA 2DS1A 3R0TA 3W2RA 1Q41A 2OXDA 1KE8A 3HDNA 3FLNC 1SYKA 4E93A 3ZS5A 4YC3A 2J6MA 2XKDA 3IGOA 2OIDA 3VS4A 1YI6A 1ZYJA 3K5UA 3SW4A 1U4DA 4AW5A 1H1WA 3DJ5A 2PUUA 3VWAA 5IA2A 1IRKA 5C03A 2CSNA 3R7GA 2QO9A 4C3RA 2PE1A 4GG7A 1YXTA 3BPRA 4N6ZA 4FOBA 3PRIA 2O3PA 5J7BA 4A9UA 4JJRA 5J95A 2XK3A 4RQVA 4RX5A 5JFSA 3FMKA 3GU7A 2BIKB 2W06A 2WTIA 5HIEA 1KSWA 4BFMA 1IR3A 3IW4A 4DBNA 4CZUA 3FMLA 2X0GA 4A9RA 3NAXA 2HWPA 4QP6A 4ANNA 3R9OA 2B9IA 4FIEA 2HZIA 3ET7A 4EONA 4FZAB 5EYMA 4CFNA 3S2PA 3MBLA 4L52A 4A07A 4ACHA 3M42A 1JSUA 2RF9A 3R9DA 1ZOEA 5C8MA 3EYGA 3PPKA 2I0EA 3EQIA 3F6XA 3GQLA 3QD3A 4CFUA 2Q0NA 4FV9A 4JIKA 3TACA 4KIKB 2CN8A 3EZVA 1P4FA 5FP5A 4K1BA 2OU7A 2PZPA 5FQDC 4IACA 1VYZA 2W1HA 4MH7A 4BTJA 4EZ7A 5C4LA 1UNGA 3BHHA 1WBNA 4U8ZA 3C0GA 5ACKA 3MSSA 3R6XA 4FSQA 1OBDA 4EJ7A 4BIEA 2EB3A 5D10A 4C4EA 2YITA 3JY0A 2PYWA 4RIOA 1AD5A 3MTLA 4C3PA 3R7YA 4F6UA 4CLJA 4IAKA 4ZMEA 2V5QA 2JLDA 3EH9A 3PVBA 3FMDA 3QZGA 4NU1A 5EQYA 3R7OA 5H9BA 4NT4A 4FV0A 2QURA 4G9RA 4CD0A 4RC2A 2WTJA 3GT8A 5I5ZA 2PVLA 5IA1A 5HCXA 2QU5A 4EQMA 2Y6MA 5M06A 3AC5A 4RJ3A 5CU4A 4F65A 4QQCA 4FUYA 4CFFA 3KULA 5M57A 3PJCA 5D12A 3GCUA 3OROA 4Y5HA 5M09A 4JX3A 5LXMA 4YZCA 1H1QA 1W83A 3AC3A 2C6LA 4YHTA 3NS9A 5BVKA 2WFYA 2EU9A 2YCRA 5CSXA 3ZEPA 4FNYA 4BZNA 4UWCA 4FBXA 4YJTA 4USFA 1A48A 3BE9A 2PK9A 4KBKA 5BNJA 2UZOA 4O7WA 2X2MA 4Q5EA 4E6AA 5H8GA 3DNDA 3QD0A 4YTIA 3HMPA 4FTRA 4AN2A 4QTEA 1P5EA 3D0EA 2P0CA 2F4JA 3E8NA 5D7VA 3Q4TA 3BHYA 5C26A 4H05A 4QTCA 3MPAA 4ZS4A 4FKIA 4ZLZA 3OD6X 3R01A 2VWBA 2Y7JA 4XCUA 3DXPA 3V5QA 2UZBA 2CGUA 4ITHA 4U5JA 3COHA 4D1ZA 3TI1A 3C4EA 4EOIA 4HOKA 4JQ7A 1PMEA 4IADA 4S2ZA 4U80A 3ALNA 5JMSA 3Q9ZA 1CM8A 3FMJA 3PA3A 3FPMA 2JKQA 4X6QC 5JRQA 3HNGA 1KOBA 1JKLA 3PP1A 4V05A 3ULZA 3Q6WA 4ZTSA 2ZDTA 4AZEA 3I0QA 2W96B 3R9HA 4MBJA 2B1PA 3V04A 3PFQA 1REKA 1ZY5A 3TN8A 3QU0A 4JG8A 4RJ5A 4HZRA 5M56A 5EYDA 2IVSA 3ZRMA 1CKIA 3GC7A 4PMSA 4AN9A 4QPAA 2J0JA 5B0XA 4EBVA 5I4NA 5M07A 2VX1A 3HEGA 4YHJA 1LP4A 3TXOA 4CEGA 5IZFA 3GCSA 4R3PA 5IDNA 1ZMWA 4RIWB 3FZOA 3SXSA 3TG1A 5AUZA 2VX3A 4PTCA 1H1PA 4FG7A 1XBAA 3IDCA 4EK4A 3BCEA 4WNKA 4CFMA 5EH0A 3MV5A 4TKSA 5EK7A 4UN0C 4FV5A 3E87A 4R1YA 4YC8A 4C2VA 2YZLA 3NWWA 5HHWA 2F49A 4UZHA 2QOCA 3QHWA 1YKRA 4JDKA 3TZ9A 2VAGA 3MH3A 3OCSA 5LQFA 4WG5A 3DBQA 5IQCA 1W98A 3ALOA 4V0GB 3F7WA 3KXZA 4YZBA 3RGFA 4QMUA 1G3NA 5ANOA 5HIDA 3RK7A 3BBWA 3ZXTA 4EOJA 4BKZA 4GSBA 5AAFA 3QTSA 5A4CA 3NW5A 3FY2A 3KC3A 4H3QA 3T9IA 4DFZE 2UV2A 4ZEGA 4RIXB 4XMOA 1SNXA 2JDSA 3QUDA 5HBJA 3FLYA 1Z9XA 3RNYA 4A9YA 5AP7A 3IONA 4LRMA 4AGDA 4AZFA 3QRUA 4BGQA 3U54A 3FXXA 4X3JA 2BRGA 3PVWA 5F95A 4RGJA 3UYTA 4R8QA 3LCTA 4QYEA 3VW6A 3MVHA 4ZLOA 3AOXA 2VTHA 3ATTA 2I0VA 3JXWA 3A7IA 4I4EA 3RCDA 3PY1A 2O5KA 3II5A 4NW5A 3UNKA 2AC3A 3O8PA 5D11A 5CSWA 3QZHA 1PXJA 4Y8DA 3DQWA 4D2WA 2LAVA 2YLEA 1PXKA 4PMPA 4O7LA 1S9IA 3L8SA 3SOCA 1SVEA 3E7OA 4FT9A 5HQ0A 4TPTA 3UIUA 2AYPA 5I3RA 3HLLA 1WVYA 4PTGA 5GJGA 1XQZA 4G34A 2HAKA 2B9FA 3IW5A 3PXQA 2ITNA 4FEQA 4RJ7A 4AGCA 4L43A 4EH3A 4JG7A 2DYLA 3CGFA 3CY2A 2W1FA 3V01A 3CLYA 3OCGA 5ETCA 2PUIA 3OTUA 3FL5A 4LGHA 1T45A 5IH6A 5BVWA 5IQIA 2OFUA 2J2IB 2PHKA 5K9IA 2VTSA 3FKNA 2CGWA 4OTGA 5EHOA 4A06A 4AG8A 1J7UA 1G8SA 2GQGA 3P9JA 1IASA 4J8NA 2W1ZA 5AP2A 1FGKA 3GU5A 3U87A 1SM2A 2P2IA 3I4BA 3ODYX 4IJ9A 4JBVA 2Z7LA 5ETFA 3ZRKA 4AOIA 2QLQA 4EYJA 3UMXA 2W4JA 4EK6A 1H28A 4QPSA 4RQKA 4ZZOA 4ZTQA 2NPQA 3UNZA 4GL9A 3IG7A 5C01A 3E8EA 3UDBA 3MB7A 3DDPA 1OVEA 3UPZA 4U40A 5AV1A 3MGYA 3N9XA 3CIKA 3HYHA 2J0IA 2NRYA 2C5YA 4R5YA 5TT7A 4I6QA 3RI1A 3JVSA 1FMOE 3MESA 5L2WA 3H10A 2IZUA 4FTCA 4YGAA 4O96A 4QO9A 2CN5A 3A8XA 4BF2A 3KXXA 2R7IA 4OT6A 2OJJA 4QP4A 5FTOA 3HA6A 5IQFA 4FTJA 2C0OA 5HO8A 1R39A 2XK4A 5LVLA 4V01A 5AAGA 5HBEA 5BQ0A 3SGCA 2PVMA 2Z60A 1AQ1A 3EOCA 3BWFA 4D1SA 2R3NA 5AAEA 3ZLWA 3FXZA 4PPCA 4CG8A 4QMOA 2QOOA 5HE2A 4F9YA 4O7NA 2XRWA 4YSMA 3UC3A 2PVJA 3D9VA 4CSVA 3BGPA 3F2NA 4DH1A 3BGQA 3GXLA 3DDQA 3ZDUA 5ANDA 3OS3A 4IZ5A 5DFPA 3QBNA 1KV1A 5CI6A 3FKLA 5A4TA 3CC6A 2WTCA 3LE6A 4GIIA 4EUTA 4G9CA 4YJQA 4DG2E 3COMA 3KFAA 4W8DA 2OF2A 3IOPA 4C2WA 3DB6A 3AXWA 2QR8A 3NR9A 3NVKI 2BFYA 2I6LA 4GK2A 3M11A 2PWLA 1J7IA 4O7TA 4FG8A 2YLFA 3MPTA 3OZ6A 4C35A 3BZ3A 3FZPA 2UW0A 5DEWA 4USEA 2C69A 4ZK5A 4OGRA 2VO6A 2R3OA 3W8LA 4ZP5A 2WQMA 3VC4A 1GZOA 5IDPA 4DA5A 3TZ7A 2G2IA 2BR1A 3UQCA 3GENA 5ANKA 3UO6A 2XKEA 4CMUA 4PL5A 5L2TA 2RFNA 4QMYA 2C1BA 2OF4A 4I5CA 4IE9A 4YZNA 4AA4A 4ACCA 2XA4A 3F88A 5CI7A 2X1NA 4IVDA 4J52A 2CCHA 4L44A 4LM5A 5CWZA 5AP4A 3FAAA 2RIOA 3L1SA 3LFEA 2QHNA 4LGDA 2JIUA 2OJ9A 2OJIA 4O0YA 5FM3A 2FSTX 2YHVA 3R02A 3WZJA 1VYWA 2J0LA 2J51A 3VAPA 2G1TA 2QOIA 4L3PA 3KF7A 5IKWA 4S34A 5EHYA 1FINA 2NP8A 3SX9A 3WYXA 4ALWA 4DAWA 3BLQA 3V5LA 4DBXA 5EKNA 4UMQA 2FUMA 2XIKA 5L2IA 3V6RA 1H27A 3R7UA 3Q60A 3KK9A 3KMMA 3TNWA 3SRVA 1P14A 5IMXA 3FMMA 2RSVA 3TTJA 3CR0A 2XS0A 2HELA 2BRMA 4F08A 3QTZA 5GINE 1GZ8A 4YNOA 3P86A 5LCKA 3BELA 4IXPA 4NIFB 4GVAA 4EK5A 4FYNA 5FBOA 5GZ8A 2UZDA 3HKOA 2W0JA 4FTLA 4QTBA 4DH7A 4E8AA 4IAYA 2O65A 3H9FA 4B4LA 4CTCA 2QVSE 3EFKA 3R1NA 1B38A 4BGGA 4LI5A 3RAIA 4LOPA 5L2SA 1DAWA 3LFSA 3MB6A 3BE2A 4MCVA 3VIDA 4BBEA 2JDTA 5J79A 3QLFA 5AEPA 3G0FA 1RJBA 4DEGA 4DLJA 4PV0A 5E8ZA 3ORMA 2C3JA 5AP0A 1SZMA 4TL0A 3C4WA 2XH5A 4ASZA 3N4TA 1Q61A 1ZLTA 4ZSLA 2O64A 4D58A 3OMVA 2RG6A 2RKUA 2X9FA 1XO2B 4PRJA 4U6RA 2PUPA 4CFXA 3MPMA 2WKMA 3CCNA 3I7CA 5HLWA 4D2RA 1O6YA 2C3KA 1QL6A 4WNMA 4YZMA 3RAKA 2Y4IB 3BYSA 4HYUA 3EFJA 5CF8A 4FKUA 2P3GX 2NO3A 1BL7A 3PE1A 4K77A 2W4OA 4RRVA 4QMWA 4RG0A 4TNBA 3VUGA 1M2RA 3L9NA 4F0GA 5GJDA 4Y95A 2C6DA 3V5TA 3P4KA 4EOOA 5HVJA 3R2BA 3DA6A 2C3IB 2YDIA 5GHVA 4BIDA 3VF9A 3ZO2A 3KGAA 4K8AA 3LQ5A 5HCZA 2YIWA 1YRPA 2IWIA 2YWPA 3DBEA 3KEXA 2XP2A 4MVFA 4YUQA 2A4LA 4XRLA 1W8CA 4GU6A 3MFTA 2FH9A 4QTDA 4FV8A 4P5QA 3U4WA 4RFYA 5FGKA 3K2LA 3D5XA 3C0HA 3EHAA 4CRSA 5KMNA 4L3LA 3KVWA 3L9LA 5E8SA 1UNLA 5A4LA 3H0YA 3DXNA 2QHMA 3FC2A 4FZFB 4NCTC 5IISA 3DAEA 3OW4A 5HOAA 3GBZA 1WAKA 4GT3A 3WBLA 2PZIA 1KWPA 2V22A 2YCQA 2QOBA 4RWJA 5HIBA 3UJGA 3WILA 4DFNA 4F64A 2VTIA 3D2KA 4OBQA 4F9CA 4RVKA 1IA8A 1DI9A 5EOLA 3UVPA 2QI8A 2GNGA 4JDHA 5EKOA 5ITAA 4CFVA 2UZNA 2QODA 3C0IA 3MA3A 4NM5A 2UW4A 3HX4A 4GFOA 4EZ3A 3UG1A 4FIGA 5FXRA 4JVGA 2V7AA 5CEQA 1YOJA 3TM0A 2OH0E 3A60A 2CGVA 3G90X 3AT2A 4BI0A 4QD6A 5BMSA 4MHAA 3OWPA 3UPXA 2E9UA 3EQDA 4IB0A 3EQRA 4IBMA 3FBVA 5HNGA 1TKIA 4OBPA 5A3XA 5K4IA 3LCDA 5TE0A 2WU7A 3W18A 2R3KA 4GCJA 4O27B 3PUPA 3CJGA 3EYHA 3BHVA 3ZO3A 5HNIX 1CKPA 4J96A 5T3QA 4ZXTA 4QMNA 5HKMA 1OITA 4JAIA 2R3HA 4GRBA 5F20A 3DNEA 4NM3A 5CEOA 3ZMMA 5L2QA 3MS9A 3F5UA 1OM1A 4FKQA 2X2LA 3QTRA 3PTGA 4M67A 4WNOA 4DITA 4JQ8A 1OI9A 2BDWA 4LUDA 4NW6A 4YBJA 4G31A 2E9PA 5I9WA 4OBOA 3LFQA 5DEYA 3F3ZA 5FBNC 3UG2A 1GIIA 3G9NA 3PE2A 4L67A 4ZIMA 4O1PA 3ODZX 4AZSA 5HVKA 2VGOA 3C4CA 4P2KA 2J50A 3DBFA 4AA0A 4OTIA 4C58A 4H39A 5CANA 5C4KA 2GNLA 2ITQA 5J87A 3FE3A 2BKKA 2Q0BA 2BZHB 5DYJA 4FGBA 2W1CA 3DPKA 3FZRA 4EHGA 4AFEA 3BU5A 3C9WA 3ZH8A 3BI6A 4LRKA 5D1JA 5AP1A 5M53A 4USDA 1XHAA 1CMKE 3ORTA 2WMSA 3Q52A 3D7ZA 4FL3A 4TNDA 2J5EA 1MUOA 1WZYA 4C8BA 4BCJA 4MD7E 2IN6A 2PVHA 4UV0A 1JKKA 2OSCA 5CEIA 4R78A 2QKWB 4XUFA 3V5WA 1TQMA 4RZWA 3HMMA 2RL5A 5IQGA 2EXCX 2X7FA 3MH0A 1AGWA 3V3VA 1H4LA 5KZIA 2UW8A 2CKOA 3G15A 3C50A 3BYOA 4KKEA 5JZNA 3SC1A 2XMYA 3ENMA 3NUPA 5EM6A 4CYJA 1URWA 5HTCA 2VWUA 3HECA 3QD4A 4FV7A 1W7HA 1UKIA 2BZIB 2BPMA 1PF8A 1Y6BA 3HMNA 4QNYA 4A9SA 4F6SA 4ORKA 4IVCA 1O6KA 2YN8A 4TWCA 3OUKA 4UMRA 4F1TA 3GOPA 2O8YA 3ZYAA 4PY1A 2QO7A 1QPJA 4E7WA 1LPUA 1J1BA 3AD5A 3UIXA 4NK9A 2P4IA 4ERKA 4GFMA 4NJDA 4BCGA 2VWWA 3WF5A 1IEPA 5HI2A 2W99B 4CVAA 2C6IA 2O0UA 4FR4A 4M69B 4TYGA 2O2UA 3KXGA 4BBFA 3VUHA 4ZAUA 2BFXA 1UWJA 1YOLA 4YPSA 4C37A 5HU9A 3RMFA 3MY1A 2WMVA 3R8UA 3ZBXA 1H01A 3UNJA 4CT2A 1H00A 5AUXA 3RAHA 4YJPA 2PZRA 1GOLA 3JY9A 3KKVA 3ZU7A 4EOSA 3HAVA 2GHMA 3QTXA 3G6GA 3REPA 4RVLA 3LJ0A 1JPAA 3P5KA 5KKRC 4F0IA 5IQBA 5DLSA 3LXKA 4A4OA 4YJNA 3HRCA 2PPQA 2UZLA 1UU3A 3C4FA 4IB1A 3Q32A 4R6VA 4N6YA 3Q9WA 1CTPE 2YIYA 4HGEA 3D7TB 3SKCA 4XS2A 3RZFA 2QG5A 2QNJA 5KO1A 2GNFA 5AFVA 3QUEA 1M2PA 5C8NA 4IEBA 1H24A 5DR2A 2HYYA 3ZC6A 3HA8A 5T68A 5EG3A 3UOHA 1IAJA 3DZOA 3S4QA 3HZTA 2I0HA 2JGZA 2R3QA 3FI2A 3OT8A 2C1AA 2VTLA 4MQ2A 3I6WA 1VJYA 1ZMVA 2C6EA 4FKGA 3GNIB 2G2FA 3P7BA 2OJFE 4DHFA 3DKGA 4IH8A 5HVYA 2WMRA 2IW8A 2J90A 4FK3A 3AT3A 5KMLA 2GHLA 2R9SA 4AS0A 2PSQA 3BGZA 3ZLXA 1R0PA 4FTIA 4RIYB 4I0TA 4H1MA 4XP2A 3H0ZA 2BILB 3QQJA 4GK3A 3R7EA 5HESA 1ZMUA 3OY3A 3VUTA 2OIQA 4BGHA 2HWOA 4UY9A 3ZSHA 4E6CA 4EYMA 2ZV9A 2XK8A 4BHNA 2QKRA 2W05A 1CSNA 4I1ZA 3KRWA 3QALE 4WBOA 3WOWA 5HLNA 3OWKA 4MXCA 5LJJA 3VS1A 5FM2A 2F2UA 3DB8A 4IB3A 3VF8A 1BYGA 5E8UA 1JKSA 3VS6A 3D14A 4DGNA 5FRIA 4I4FA 4X7QA 3QFVA 5FWKK 2FVDA 2OZAB 4O2PA 2YDJA 4CCBA 4HW7A 3LJ1A 4ZMFA 4Y72A 4O6LA 2H8HA 3EFLA 1PXOA 4QMQA 4L42A 3HDMA 3EN9A 1YHSA 2YM7A 4FEUA 4DT8A 4NEUA 4YO6A 3GVUA 4EC9A 2EWAA 4BWPA 5CF6A 2YABA 2OKRA 5CAUA 5FXQA 4MXYA 3D5VA 4NJ3A 3UOKA 2ZYBA 3ZOSA 3TUCA 4BCIA 1Y8YA 2XZSA 4BI1A 1NXKA 3POZA 2HK5A 3K3IA 4I5MA 3A2CA 4RT7A 4FE2A 4FSUA 3R1SA 2J0KA 5HLPA 5IF1A 4E4LA 5GIPE 1LEWA 2I1MA 4FTMA 2W1DA 2WMAA 3BQCA 4EK8A 4OTPA 3R73A 4F99A 3FSKA 5KBQA 5EI6A 3F5XA 3KCKA 1DAYA 5L3AA 4MWHA 4RMZA 3VS0A 5IQEA 2R3RA 2WIPA 3Q96A 4FTQA 4X2GA 1YDTE 3VS5A 5AV2A 4J95A 2NRUA 4UYNA 4I6HA 4MD9E 5CSHA 3SVVA 1B39A 3Q4UA 4BDIA 4EOPA 4AGUA 3NVMB 3IDBA 4AAAA 4MWIA 4PDPA 3CQEA 5C1QB 3GU6A 5ANEA 4DEHA 3TTIA 1ZY4A 4FSMA 4MBLA 1Q62A 5CQWA 1SVGA 3PIXA 1OUKA 4N57A 4EOLA 4NM7A 1GY3A 1K3AA 5E1SA 2PVKA 3TZMA 3QAME 3AG9A 4PNIA 2WEIA 4PMMA 3WE4A 5IQAA 4GT4A 3R8VA 3A7FA 4MF0A 3R8MA 4AZVA 3HUBA 3VN9A 4FKWA 3W2CA 1WBPA 2UZVA 5CXHA 3LXNA 2E9NA 4BI2A 2BRNA 2FA2A 4YSJA 1BKXA 3H4JA 5IQDA 3EN5A 5IEXA 4XV3A 4BIBA 4CMOA 3FKOA 3LMHA 5AV0A 3WI6A 4AT5A 2UW5A 4PPAA 4I5PA 4DTKA 1YOMA 4XG2A 1H0VA 4LMUA 4E20A 4DEEA 4JAJA 1ZARA 4L46A 5M4FA 2WMWA 3RPYA 3E63A 3GU8A 4BCPA 2WIHA 3GQIA 2XJ0A 4YPDA 5DPVA 3MJ1A 3LPBA 5BPYA 3QYWA 4BTFA 3IS5A 5M4IA 4HZSA 4E26A 3ZSIA 5L8KA 1OMWA 2WMUA 4YHFA 3VUKA 5HTIA 3UOJA 5CAVA 3FHRA 4XHKB 5LVOA
chains in the Genus database with same CATH superfamily
2JAMA 5D9HA 5AM6A 1OKZA 4YZ9A 4MUQA 3GFWA 3QRJA 4ZZNA 3ZTXA 3FYJX 5EM7A 4NH1A 4DEIA 3SAYA 5AUUA 4IVBA 4XNEA 3BHUA 2A0CX 4D55A 1IAHA 1T46A 3PWYA 4Y83A 3MTFA 2XCHA 4AE9A 4EUUA 4MXAA 4YP8A 2C3LA 3PYYA 4FSTA 4UALA 3QXOA 3PSBA 3PPJA 2B53A 3Q3BA 4I23A 5AADA 2XUUA 1U54B 3Q4CA 3BEAA 3F3UA 4IM2A 4UBAA 4BBMA 5FUTA 4PP9A 3K3JA 4GYGA 3EQPA 5FLFA 3TL8A 1Q3DA 2HXQA 2IZTA 4TT7A 3VBYA 3QLGA 2F7ZE 1WMKA 1I09A 2F2CB 1RW8A 3P08A 4WA9A 4ZZMA 5CT7A 5CY3A 4D5KA 4O7ZA 4QMTA 4AW2A 4AW0A 4TYHA 4F70A 2OLCA 3R9RA 4I24A 4OW8A 4TRLA 1Y91A 1L8TA 3SRVB 4GFGA 4B6LA 3NAYA 1UV5A 4W4XA 2YM8A 4FTKA 4AX8A 3O5AA 4EOKA 3ZHPC 5HTBA 4R3CA 3P78A 1OECA 5TOZA 5A6OA 2UVXA 4FUXA 1KE6A 4BKYA 3QTIA 4O4DA 5CXZA 2YWVA 3JR1A 3QGWA 2G15A 1R3CA 2QOHA 3CE3A 4GUBA 2WTDA 3Q9YA 4MYGA 4E73A 4F4PA 3EQBA 1F0QA 1ZWSA 4K18A 4XOZA 4G5PA 4DE4A 3DKFA 1KV2A 3NPCA 1EH4A 4F78A 5EI2A 3NYXA 3S0OA 1PY5A 4GMYA 1UVRA 5J1VA 4LV7A 3P23A 4GJ3A 4MQ1A 4FSYA 1S9JA 3ZO4A 2OXYA 3QQFA 2QLUA 3ZUTA 5KNJA 3EN4A 3LQ3A 4GIHA 1RQQA 2W1EA 2PL0A 2H6DA 4HPTE 3RM7A 3MFRA 1FGIA 1LUFA 3PP0A 3PXYA 3HRBA 4ZSGA 4BVUA 4I0SA 4D0WA 4DGGA 2G9XA 4DN5A 2EXEA 4F6WA 1OL5A 2BKZA 4D0XA 4DFBA 5KBRA 4YO4A 5IEVA 4R3RA 4O7SA 2HZ4A 2QG7A 3QHRA 3MWUA 3T9TA 3ZFYA 1V0BA 4OTRA 3HAMA 1F5QA 4FEXA 1Q5KA 4ZS0A 2C5NA 4LG4A 1GZKA 5JRSA 3GI3A 3O17A 4FSNA 5LCJA 3FHIA 2WELA 2X8EA 3FWQA 3NIEA 4M7IA 4RC4A 1E1XA 3CQWA 1W84A 4MF1A 3PDTA 4HVIA 4YJUA 3D15A 2HENA 3WIGA 2UW6A 1DM2A 4X3FA 4CKRA 1QCFA 4KINA 1JOWB 4FT3A 4IZYA 4KKGA 4AFJA 3DXQA 3UIMA 3D4QA 2I0YA 4YMJA 3LKMA 4L3JA 3QKLA 2HZ0A 3LXPA 3DZQA 3NW7A 5A54A 3CD8A 2B7AA 3BX5A 4TWNA 3LLAA 2QOLA 3TIYA 4UYAA 4IWQA 2OXXA 3W16A 4OAVB 2IF8A 1O9UA 2GMXA 4B7TA 2R5TA 2VO3A 4Z7HA 3FYKX 3HMIA 1Q97A 3QRTA 4UXQA 1NY3A 2IZSA 4FV6A 4G3GA 2VO0A 3P0MA 3BV3A 4XEYA 3WF6A 3FSFA 5B2LA 2WD1A 4JL9A 3VONA 4FRFA 3ZBFA 4S33A 2Z8CA 4ZOGA 4Z16A 4FEVA 4FC0A 3KRRA 4U42A 2WGJA 3F69A 3GCVA 4KD1A 4JQEA 5J9LA 2DUVA 3TKHA 2ITXA 4G3FA 4O0RA 4BCKA 4Y73A 3DS6A 3VUMA 4O4BB 5BVDA 1FMKA 2BDFA 2JC6A 4AP7A 3H30A 1Y6AA 4CG9A 4PQNA 4BL1A 2VN9A 3ORZA 3S00A 3EZRA 1OL7A 2VTAA 3KRXA 4UMTA 3LM0A 3ATSA 5E91A 3ZZWA 1A06A 1WBVA 3ORNA 4BCMA 4E5BA 4QYYA 4H3PA 4NL0A 4B99A 3TJCA 4UWYA 5EOBA 4KIKA 3PXZA 2PE2A 5AUVA 3JS2A 5CU3A 4E4XA 3Q5ZA 4DF3A 3NNWA 3QQHA 4XYFA 3U9CA 5EFQA 2OBJA 3W2QA 3BYUA 3WZKA 4F9AA 4FGRA 3F66A 4PL4A 3MFSA 1RE8A 4Q2AA 4CT1A 5KMIA 2XK9A 2E9VA 3POOA 4KA3A 4MNEA 4FICA 4HCTA 2XBJA 1JVPP 4HCUA 4WSYA 5JGDA 2XNEA 3MVJA 3PIZA 4FG9A 2EUFB 2YEXA 2ZMDA 3A4OX 3LZBA 4ZTNA 2BALA 5H8EA 3R7VA 4O84A 3DKOA 3CPCA 4QMLA 3UGCA 2OGVA 2VV9A 4I22A 4I6FA 2Z7RA 5CENA 3OEFX 5DI1A 2BRHA 5AUYA 4QQ5A 4ZLYA 1YHWA 2UVYA 4JOAA 5IA3A 3FUPA 2HIWA 3AC1A 2CHLA 4DFLA 5HG9A 3AKKA 5J9ZA 2BAKA 5HZNA 3MY0A 1J7LA 4M12A 1FVVA 5BUEA 4W4WA 3G5DA 1U5RA 2R2PA 2VTPA 4HGLA 1KE5A 3IKAA 4BYJA 4E5WA 4GUEA 3BL7A 1LR4A 4J71A 4OLIA 5IPJA 3GCPA 5DMZA 4ASXA 5B7VA 3KA0A 4QP8A 3CP9A 2WEVA 2YZAA 3HMOA 1FPUA 2JIIA 2VTNA 4K0YA 1O6LA 3FXWA 5M4CA 2BROA 1MQ4A 3DY7A 3IDPA 2H9VA 3CJFA 2WHBA 3L8VA 4I93A 4U7ZA 3QKMA 3SW7A 3CTHA 5CU0A 3TDVA 1PW2A 2QOKA 3P7AA 5G1XA 2CKQA 5F4NA 4EI4A 1BUHA 1OKYA 2B4SB 1OPKA 2BDJA 4FTUA 1KOAA 3FMEA 4L53A 4XP3A 5JGAA 4TWPA 1VEBA 1UNHA 3VS3A 1Y57A 3A99A 2GFCA 4QPMA 2RGPA 4KIPA 5AR4A 4BDBA 5JGBA 2XF0A 2WMQA 1HCKA 4M14A 5ACBC 4U3YA 4OTHA 3ZLYA 5AA9A 2VTQA 3EL8A 3LXLA 4ONAA 4R77A 4IM3A 2XNPA 4O0WA 4CCUA 2W1GA 2WQBA 1PXPA 2R3JA 1M2QA 2VWVA 1MRYA 2GSFA 4CV9A 3AD4A 1Y8GA 3QQKA 3AD6A 3EQGA 4X6RA 4LRJA 2VNYA 4FIIA 5HBHA 5AV4A 4RX8A 3ORPA 4P5ZA 5TR6A 4KB8A 3N4VA 1NVRA 3UTOA 3T3VA 4EH5A 1H07A 2CMWA 2H34A 3DLSA 5EI8A 4BDEA 5HU3A 4BDGA 1XMMA 3PJ1A 3ETAA 3DFCB 3PVGA 3MN3A 2YDKA 4EH7A 5LOHA 2C5XA 4ANBA 3LQ8A 4RIWA 3R04A 4CTBA 1YI3A 3PXRA 3NUNA 3IGGA 2BIYA 3JYAA 3UYSA 1APME 3VBQA 4RX9A 4IANA 5HE1A 5CAPA 2CLQA 2EB2A 4AOTA 1KE9A 4LL5A 4UZDA 5IH4A 3BYVA 4CGAA 3R8ZA 1Q24A 1U59A 5JSMA 1STCE 2XIYA 2R64A 2X6EA 4XG9A 5CVFA 5CVGA 1KUTA 5AMNA 4WO5A 4MK0A 5EDQA 3LFDA 4DH8A 4DTAA 4XRJA 3COKA 4V0GA 1H8FA 2C6KA 4DLIA 5J7HA 3UQFA 3F3TA 2SRCA 2H96A 5AV3A 2JKMA 4OTFA 1UU9A 4FIFA 4I20A 3OOMA 4YBKA 2P2HA 4FK6A 4C3FA 1IA9A 3MI9A 3UO5A 2Z7QA 3FY0A 3G33A 4C7TA 1WBSA 5A4QA 4DH3A 2CJMA 3W1FA 3AGMA 2YISA 4D4YA 2HXLA 4S32A 3HV5A 3OXTA 5TF9A 4BTMA 3M1SA 4ZTMA 3I0OA 4W8EA 4YLLA 5EYCA 3C5UA 3NZ0A 4ITIA 5DOSA 4BWXA 4C57A 5BVEA 5DG5A 4QTAA 2X9EA 5KMKA 5LMAA 3OFMA 4ZY6A 3W0PA 4G3CA 3ZM9A 3U6IA 3WZUA 3UBDA 1ZYLA 3I5NA 4KS8A 5FEEA 4F9BA 3NYVA 4XX9A 3NGAA 5GNKA 3SLSA 4FI1A 4DGMA 3FC1X 3TDWA 3ACJA 3PA4A 4ENXA 4LYNA 5J5SA 2WU6A 3VULA 1Q8ZA 3EJ1A 4RFZA 3GC9A 4V04A 2GNIA 3O71A 2XNNA 5HE0A 3FEGA 1WFCA 2XCKA 5LARA 3DBCA 3ZEWA 3Q2MA 3I7BA 4K11A 1QPDA 2F9GA 4NKAA 5K4JA 4M68A 2ZDUA 3VRYA 2C4GA 3WARA 3ZFMA 3C4XA 3GGFA 3RPSA 4NUSA 5HX8A 2C47A 3FLZA 4ZY4A 2P33A 3W0NA 3W0RA 3DJ7A 5ICPA 2IEWA 5M08A 2CKEA 4TYJA 3KN6A 3PSDA 4QQJA 3Q53A 3DFAA 4PPBA 4YU2A 4XV2A 5CALA 2BZJA 3FI3A 3TIZA 4YTHA 3O23A 1XMLA 3PWDA 2BHEA 2PVNA 3W55A 4O81A 3RHKA 4QT1A 2CCIA 4ASDA 5DA3A 4XOYA 2XVDA 4HYHA 2PMOX 3KXNA 3C1XA 2ITVA 4RX7A 4EOQA 3GOKA 4FF8A 3TJDA 2YERA 4GT5A 1H26A 3ENHA 2DQ7X 2AC5A 3E3PA 4U0IA 2ETMA 3KU2A 3VBXA 3ORXA 4IX6A 4R7HA 2WNTA 5L8JA 5KZ0A 2J4ZA 3SXFA 3W33A 2EVAA 1PKDA 1ZYDA 5AR7A 4C62A 4IAAA 2JIVA 5BUJA 3R83A 4DEBA 3BRBA 1ZYSA 1SMHA 5HG7A 4DC2A 3FQEA 4YLKA 1XH5A 4NTTA 4J99A 4C59A 2ZFYA 3EQFA 2UW7A 2BRBA 3CGOA 3HV6A 4XG4A 2UW9A 5HD4A 2VTTA 4CMTA 4KBCA 3DQXA 2PTKA 2X4ZA 5CT0A 4AACA 1PYEA 2IW9A 4YTCA 4GV1A 3EWHA 5CU6A 4O21A 3R71A 5AR2A 3KREA 3AKLA 4BDAA 1ATPE 1GAGA 3KULB 4AN3A 4KAOA 5A14A 2OO8X 4AXCA 5AA8A 4KUJA 3LLTA 2XRUA 1Q3WA 2YCFA 1SNUA 3E5AA 3KXMA 3VW8A 4RLLA 4U45A 1XH6A 4RJ4A 4RBLA 3MW1A 3FMNA 5DH3A 4X2KA 4C02A 3I6UA 1ST4A 4NTSA 3HV3A 4IWPA 3S1HA 3SA0A 4X21A 4FTTA 4G3DA 1B6CB 2IVUA 4HNFA 4WUAA 3TZ8A 2OIBA 4P4CA 4GG5A 4TXCA 5JQ5A 4PDOA 4E1ZA 4NSTA 4IX3A 3PSCA 2ITPA 1GIHA 1K2PA 4ID7A 2BMCA 3NNVA 4G2FA 4KRDA 4ACMA 4EKKA 4XLIA 5L6PA 5M51A 3DJ6A 1E9HA 1F3MC 5AIRA 5CZIA 2QU6A 3DLZA 5DT3A 3DTCA 4OTWA 3U9NA 2WOTA 5LMKA 3G6HA 2X4FA 3EN7A 2C6TA 3QF9A 3PJ3A 2CGXA 4W4VA 3DTWA 5CAOA 1ERKA 4PUZA 5FD2A 5CSPA 4II5A 4AQCA 1CDKA 3BIZA 5HEZA 3V8TA 4X3FC 2ERKA 3UZTA 3QRKA 3BEGA 3VJOA 4D2VA 2GCDA 3NUAA 2RFEA 3FZSA 3EKKA 3TV6A 3O50A 3BLHA 3IK3A 1JNKA 2JFLA 3TKIA 3PG1A 2GS7A 4JRVA 4UXLA 3FPQA 5IMEA 1P4OA 4QMMA 4FZDB 3A7HA 4FL2A 5BYLA 1J91A 3UC4A 1H1RA 3SD0A 2FSLX 4IX5A 4LFIA 2A2AA 2OH4A 3LFAA 1BL6A 1H25A 3DCVA 4AXEA 4FMQA 2VO7A 4WKQA 1NW1A 2E9OA 3OBGA 2QR7A 5DR6A 3SXRA 2ZB1A 3JVRA 4G3EA 3VHKA 3JUHA 1M14A 5DHJA 5K5NA 3QA0A 3MDYA 3NUXA 3O8UA 3KRJA 4FYOA 3OG7A 3SDJA 3C7QA 3E64A 4WG4A 3PXFA 1M7NA 5E8YA 3UOLA 4NIFA 4H58A 2PU8A 2C68A 2X8IA 5IA4A 4L9IA 3V8SA 4A4LA 1XH7A 2GS2A 1BI7A 1YI4A 2YIRA 4GW8A 3OT3A 2UZTA 4IC7A 3VNTA 4MX9A 5J9YA 2IZRA 3OOGA 4JX7A 2PULA 3V8WA 3ZONA 4DFUA 5DN3A 1YXSA 2W1IA 2FYSA 5IEYA 3G9LX 4P7EA 2J9MA 3AGLA 3Q04A 4M8TA 4RLKA 2C5OA 3OXIA 5B2KA 4J98A 4ACDA 2B0QA 5I9UA 4ENYA 5FEQA 4IZAA 3O51A 4A4XA 4M0ZA 3G2FA 4JBQA 4M84A 4APPA 5JFVA 3CQUA 4U3ZA 4RZVA 3EMGA 4FVPA 4U43A 4RWKA 4HVSA 4FTOA 4YR8A 3RM6A 3OY1A 5IA5A 4IWOA 3K54A 1Q8YA 4LV8A 1MRUA 2XIXA 3W10A 1BX6A 2JBOA 2RFSA 5KX8A 4F7JA 4FTNA 4FA2A 3F3VA 1GZNA 2HCKA 3U6JA 2FO0A 3ZXZA 2GTMA 3I60A 2BVAA 3QL8A 3WIKA 1G8AA 2JDVA 4DDGA 3QUPA 4AZWA 2R3FA 3T8OA 2P55A 4RSSA 5K5XA 3BLAA 3I1AA 4O0TA 1PXIA 1R1WA 2X7OA 3D5UA 3MVMA 3MY5A 3F7ZA 5CLPA 2ZVAA 3M2WA 3ROYA 2E2BA 4PL3A 3F5GA 3DK7A 4UB7A 4WBBB 4O86A 2WQOA 3OWLA 4CZTA 4L8MA 5E7RA 4FT7A 4TYIA 2XM8A 1YW2A 2B54A 2IVVA 2WMTA 3ZDIA 4BCNA 3DGKA 4WRGA 4Q9ZA 3VUDA 2VWZA 4X3FB 3RVGA 1M7QA 2ETKA 5AUWA 2YA9A 3KB7A 3NUSA 4ITJA 4O22A 4YLJA 5DBXA 4BTKA 3MH2A 2YM6A 3RJCA 4HVHA 4E5AX 5DVRA 2QC6A 4C4FA 2UZEA 2Y9QA 5CF5A 1OIYA 5M44A 1ZAOA 1W0XC 1YDRE 2GDOA 5CVHA 4QP9A 2HZNA 5CYIA 3RTPA 3TNHA 5BYYA 2WAJA 2JD5A 3NCGA 3Q4ZA 3AMBA 3QKKA 4N4SA 1YWVA 5KMJA 3ID6C 4G17A 4BDFA 4RVTA 4MAOA 4FSRA 1MP8A 2ITZA 4KKHA 4WRSA 4BYIA 4Z7GA 3U8WA 2JBPA 4NKSA 3O7LB 4HNIA 5KKRB 2WQNA 5DR9A 3TT0A 3QCQA 3QTWA 4O91A 5M55A 3V51A 4DCAA 2ZM3A 4IW0A 3QQUA 1PMVA 3BHTA 4G6LA 5B2MA 1XBBA 2I40A 5I9ZA 4GKIA 2CPKE 3C4ZA 4EORA 3DT1A 3EKNA 2XKCA 4QMPA 3H9RA 3A7GA 1NVSA 2ZM4A 4MEDA 4ASEA 2Z2WA 3ANRA 3ZO1A 3F2RA 4DGLC 3NCZA 1ZRZA 2WO6A 2XJ1A 4FNZA 2YM4A 3W2SA 2XNBA 5C8KA 4U9AA 1OZ1A 3ULIA 4XG8A 4IWDA 4LV5A 2PUNA 4YC6A 4K9YA 1HCLA 4PTEA 3F61A 2Y4PA 3MA6A 3W8QA 4EL9A 2OFVA 4C38A 4HVGA 4BC6A 3OEZA 4TWOA 4KRCA 2YIXA 4IM0A 2OJGA 2VWYA 4GEOA 4LMNA 3ITZA 3EQHA 4QQTA 5CEPA 4M66A 4F0FA 3PLSA 2X6DA 3IPHA 4RVMA 3RNIA 4MNEB 4PX6A 4CFWA 2GFSA 4IAIA 3MFUA 2C5VA 5AWMA 4IHPA 1V0PA 3A8WA 3ZRLA 4I21A 4O0SA 4XJ0A 1P2AA 3A62A 3CS9A 1SVHA 3L9PA 1W82A 5JT2A 1BMKA 2VX0A 4QP3A 2GNHA 3LCKA 3BBTB 2OW3A 3FJQE 3QZFA 3IW8A 3QWJA 4U81A 5CZHA 4D4RA 2ONLA 2GS6A 2X2KA 3LMGA 4J8MA 4O6EA 2YACA 2ERZE 3PJ8A 3C51A 3COIA 1XKKA 3DOGA 3NW6A 3NYOA 1E1VA 4OT5A 4ANOA 3R00A 4K2RA 4TY1A 2CNVA 4YZDA 4QRCA 3RPRA 3WE8A 3H9OA 5K0KA 3RBWA 3N51A 2ZMCA 2WZJA 4XP0A 4K6ZA 5I9YA 2W7XA 2X81A 2XYNA 3FQHA 4I41A 1FOTA 3OHTA 3ORLA 4L68A 3LW0A 1H08A 1DI8A 4F7SA 3HV7A 2JKOA 2ZAZA 4EHVA 2R3PA 4JI9A 5FXSA 4EC8A 4JXFA 4NCTA 1JSTA 4RWIA 3PJ2A 4BDKA 3SG9A 3G51A 4HGTA 1FQ1B 2PMLX 4D28A 5LVPA 5CSVA 2PVFA 2XB7A 2W5AA 3IECA 4KSQA 3PRFA 4XH6A 5EW8A 3E62A 3R8PA 4D2TA 4I6LA 4BR3A 2PZ5A 1PXNA 1XWSA 4EEVA 4F63A 3CKWA 4RPVA 2W17A 4GJ2A 3ROCA 4I6BA 1BLXA 2R3LA 4CQEA 2Y6OA 3FQSA 4DTBA 3AC2A 2C0TA 4I94A 4DYMA 1MRVA 3D2IA 4O82A 4DFYA 1G5SA 1M17A 4NWMA 2FSOX 5IG1A 4PMTA 1KE7A 2XEZA 5LVNA 4PP7A 5KE0A 2AUHA 3W2PA 4M69A 3ANQA 3PZEA 3U55A 3CD3A 4DHZA 5FTQA 3NUUA 2W9ZB 4MXZA 5FEDA 3UODA 4U79A 4NFMA 4QYGA 4JRNA 3VS7A 4ZJJA 3FI8A 3KQ7A 4ARKA 3HV4A 4UWBA 3V6SA 4AW1A 5H2UA 5E8TA 4AT3A 4DH5A 2XALA 5DT4A 1REJA 2F7XE 3EIDA 3P1AA 4KSPA 4WT6A 4F7NA 4H36A 2X7GA 3WF7A 4G6NA 3RWQA 1OL1A 3TV4A 1UWHA 1PJKA 3PA5A 5GJFA 4HCVA 3R30A 3DK6A 5IUIA 1UU8A 4QYFA 4NM0A 3R63A 4B0GA 2C30A 4U97A 1ZOGA 2VTOA 3ML1A 2B55A 2GPHA 3TCPA 5HICA 3TEIA 3PY0A 4E6QA 4GH2A 3D7TA 4RA4A 3LJ2A 3TNIA 1OB3A 3ERKA 3HP5A 1URCA 2VWXA 3VJNA 3RPOA 4BICA 4AAYA 4NFNA 3DAJA 2R4BA 5DRDA 3E8DA 4J97A 4TYEA 4EWQA 3F2AA 4DG3E 5IQHA 2XIRA 3OVVA 4FZ6A 4EH4A 4MXXA 5DWRA 3MVLA 5LWNA 1ZOHA 3NDMA 1W2FA 3EN6A 4YURA 4OUCA 5M4UA 4IIRA 3IW6A 3OUNB 3CEKA 4W9XA 1PRYA 3ZCLA 5ETAA 5CNNA 1Q8TA 2IW6A 2RG5A 3BV2A 2YAAA 3MIYA 4QMSA 5L6WL 4C4JA 3VUIA 4TW9A 2XNMA 2V0DA 5EW3A 2JAVA 3PY3A 3QCSA 4IFCA 4E3CA 4GU9A 1LEZA 4RIYA 3T3UA 3RKBA 4GKHA 1CKJA 4H3BA 3GCQA 2JITA 4E4NA 4YJOA 3C5IA 3GC8A 3UVRA 4L00A 2HW6A 2V62A 3GP0A 1TQPA 3U4UA 5E9EA 3KL8A 1Z57A 4IFGA 5BX0A 3TUDA 1PMUA 4ZSAA 2PVYA 2W4KA 5JFXA 4AF3A 2QD9A 4IDTA 5D7AA 4FKPA 3OF0A 5HCYA 3WF8A 3PZHA 4C4HA 4CLIA 2OZAA 2W9FB 4EQCA 2R3MA 4G5JA 3QXPA 1J1CA 4C4GA 1OGUA 4DEAA 4E4MA 3QD2B 4F7LA 3QQLA 5LMKC 4AGWA 4KBAA 1FBNA 2YM3A 1OL2A 3KN5A 3O7LD 4IZ7A 3NMUF 4LQMA 4QMVA 5G6VA 3IO7A 4ANMA 4EOMA 4K33A 5LMBA 3LCSA 3KXHA 4C61A 4EH9A 4ZTLA 1ND4A 4DGOA 2X8DA 4O4EA 3Q2JA 3ELJA 3F5PA 4ZTHA 5C27A 4XBRA 4CRLA 1OUYA 1UU7A 4O7RA 2CKPA 2XJ2A 1PMNA 3OCBA 5C9CA 4ACGA 4FKOA 4C33A 5BVFA 5EW9A 1TZDA 1G8JA 3GU4A 3HUCA 4AE6A 4CYIA 4RJ6A 5HORA 4O7YA 3B8RA 2YAKA 4FOCA 1YXUA 4JDJA 3VO3A 5IH5A 1OPJA 5H8BA 4OTDA 4JNWA 4RA5A 4BY9E 3QC4A 3O2MA 2IPXA 4O0UA 2RFDA 5T6KA 4G16A 4FEWA 2Y0AA 4QP2A 2OG8A 4G6OA 4RWLA 5IUGA 2ZV8A 4FT5A 5F9EA 2VUWA 5CX9A 1YVJA 3OW3A 4RJ8A 3QTQA 4ERWA 4CKJA 4B9DA 5CEMA 3LFBA 2B9JA 3BKBA 3PVUA 5JQ8A 4MTAA 4O7VA 4ANSA 4D9TA 3B2WA 4A7CA 3VRZA 4QYHA 4L6QA 4HGSA 4FTAA 4ZSJA 2IVTA 1OIRA 2YJSA 1VZOA 3R1QA 4BCFA 1GIJA 4FVQA 1XH9A 3CSVA 3MYGA 4DCEA 4IDVA 4BCOA 3NIZA 3LFFA 2A1AB 3NRMA 4N70A 2WTKC 1A9UA 3QRIA 4MNFA 2JDRA 5K0XA 1PXLA 1OL6A 4UMUA 3VQUA 2R0IA 3CBLA 3ORIA 5AIKA 2IJMA 4FV3A 3UP7A 4EBWA 2IO6A 3KMUA 4X0MA 3RINA 4CQGA 4I0RA 2V55A 5A4EA 4JBOA 4FX3A 2VGPA 2OICA 5I9XA 3BL9A 1QMZA 3KVXA 2EXMA 4NZWB 2QOFA 2PE0A 1DS5A 4O1OA 3R1YA 2BAJA 3AC4A 3ZLSA 4AXAA 1YXXA 2Y4IC 1WCCA 4FKJA 5JH6A 4EKLA 2AQXA 4MKCA 3NYNA 2XEYA 4FKSA 2ZB0A 3DK3A 4JG6A 2VTJA 4LDTA 2BZKB 2KULA 2WXVA 4LOQA 4UX9A 4JT3A 1X8BA 1JAMA 3NNXA 4C34A 4O4FA 4BKJA 3QA8A 2WQEA 1WBOA 1XH8A 2J0MB 3E3BX 3CPBA 1JBPE 2ESMA 4J7BA 5F1ZA 2V7OA 5CASA 3VVHA 1OBGA 2OI4X 2G01A 4PWNA 3UE4A 4KABA 4YJVA 2HW7A 5FP6A 4I92A 4PDSA 3HVCA 4WG3A 2VD5A 5GZ9A 3VS2A 3WZDA 2XIZA 3NNUA 1TVOA 1JSVA 1GNGA 1IG1A 4BWKA 2GHGA 3O8TA 3NX8A 4MBIA 2G2HA 5AP3A 2JDOA 2PY3A 4N0SA 1YXVA 3U6HA 4KNBA 2REIA 1NVQA 3QCYA 5BVNA 3FI4A 5A9UA 2B52A 3QGYA 2GU8A 3UO4A 5HD7A 4O38A 3ZSGA 5H3QA 5CTPA 1U54A 3QQGA 3LVPA 4X2FA 4Z3VA 3FL4A 3Q6UA 4O0XA 4BDHA 3BYMA 2I7QA 1Q8UA 1WVXA 2Z7SA 4W9WA 4O83A 1VR2A 5EM8A 4JLCA 4E6DA 2OWBA 3FZTA 4CV8A 3RHXA 4BRXA 5CEKA 3RP9A 3P79A 5HNBA 3NUYA 4GK4A 2Z02A 4AOJA 4FKRA 4WOVA 5KUPA 4FL1A 4FKVA 1Q8WA 4GS6A 2FGIA 4ZY5A 4B8MA 4TN6A 2XM9A 5FTGA 1YHVA 3GEQA 4M97A 4QP1A 2A19B 2FSMX 4YJSA 4EHZA 5KMOA 1R78A 1ZYCA 3E8CA 2VTRA 3IW7A 2YIQA 3ZUVA 2W5BA 1YWRA 3LHJA 5JKGA 3L8XA 4JIAA 4APCA 4B8LA 3S95A 4WD5A 3TV7A 1H1SA 3TUBA 2CLXA 4EQUA 4BZOA 1PHKA 5E1EA 1WBWA 2LGCA 4OR5A 3UQGA 2JEDA 3R21A 5TO8A 1PYXA 3R8LA 1L3RE 2BTSA 3JPVA 3KK8A 5BMMA 5L4QA 1WBTA 4CNHA 2FB8A 3ORKA 3DV3A 4RIXA 4LOOA 1NT2A 2WTKB 4AZTA 5KHXA 2YM5A 3THBA 3QCXA 3F9NA 3EFWA 3CTJA 3FLQA 5CU2A 5AR3A 3W32A 4S30A 4IVAA 5EQPA 5EM5A 4XLVA 1UA2A 1NA7A 1JWHA 1YQJA 4HYIA 4QMXA 3WF9A 4C4IA 2IG7A 2B9HA 2OK1A 4Y85A 5AP6A 5JN2A 1I44A 3B2TA 5K3YA 2ACXA 3OWJA 4D5HA 4RC3A 5CQUA 3KY2A 4HVDA 1U5QA 1ZZLA 5J8IA 1U46A 5GZAA 3PIYA 4TZRA 3OXZA 4M3QA 3GUBA 4JR3A 4X2NA 3K5VA 1QPEA 3U51A 3LMIA 4BHZA 4BDJA 4FIJA 4Z55A 5JZJA 2GQSA 4ALVA 5CNOA 2BHHA 2ONLC 2A27A 2QOQA 3NSZA 1ZXEA 5AP5A 2BAQA 5AX3A 3E92A 4NYEA 2YJRA 2W5HA 2QQ7A 4F9WA 3N4UA 5HE3A 4XV9A 2R3GA 3VHEA 3LCOA 2R3IA 5ANJA 4AA5A 3BU6A 4XG3A 3WYYA 4LUEA 4UMPA 3QC9A 4KWPA 3MJ2A 2HY0A 4OAUC 4MD8E 4AT4A 4YTFA 3VQHA 2ZJWA