4FYNA

Crystal structure of spleen tyrosine kinase complexed with 3-(8-{4-[ethyl-(2-hydroxy-ethyl)-amino]-phenylamino}-imidazo[1,2-a]pyrazin-5-yl)-phenol
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
277
structure length
267
Chain Sequence
VYLDRKLLTLEDKELGSNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Rational design of highly selective spleen tyrosine kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 267
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fynA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fynA01
2XF0A 3R1SA 4OTPA 3ZO4A 3MH3A 1MRUA 4DFBA 4FKVA 3ITZA 4NJDA 3WIGA 3OOGA 3OD6X 4M67A 1U5QA 4MD7E 4NU1A 3LCKA 2YFXA 5TO8A 5EYCA 3RJCA 4BB4A 4OAVB 2V55A 4FVPA 4DHFA 2G2FA 4RIYB 3VUGA 3SA0A 1MRVA 2C6DA 4UN0C 3FLWA 5F94A 2WQNA 5AP0A 3L9MA 2YM7A 5AAFA 1M17A 4FR4A 1H0VA 3GENA 4IAZA 2FSLX 4EH4A 4AX8A 4WUAA 3E8CA 3KRXA 3K5VA 4FSMA 3WYXA 2UW7A 4JOAA 4Y85A 5AIKA 1CKPA 5C01A 3QFVA 1H1RA 4O7NA 1STCE 5GIPE 3FZ1A 4BI0A 3C5IA 3DAEA 4GT4A 4JAIA 2XP2A 3U4WA 4F9CA 4APPA 4F0FA 3HV5A 5K3YA 3MW1A 4F08A 4QYFA 1XBAA 3ZLXA 2B52A 2OU7A 1DAWA 5EFQA 1GZOA 4ANOA 3NUAA 4EOPA 4ALUA 1RQQA 5BVWA 3FPMA 3RVGA 2R64A 4JG7A 4CZUA 2BZIB 2EB3A 3N4VA 2PVNA 3ZFMA 4QPSA 2VU3A 3ZDUA 5L2WA 3CY3A 2YIYA 3GU7A 1YXXA 2GNIA 4GFOA 2YCFA 4YZCA 2PVHA 3MB7A 4LMNA 4V04A 4DG0E 2V0DA 2J90A 2DWBA 3MY5A 1W84A 3ELJA 4DGLC 4IHPA 2XKDA 3RKBA 1BKXA 3VF8A 4CFXA 5L8KA 1BI7A 1LEWA 3FI4A 3QF9A 4ITHA 4YJNA 5EHYA 4FIGA 2DS1A 3TL8A 4AA0A 4DGGA 4KD1A 4HVHA 5F9EA 2W4OA 5K4IA 2XNGA 4F4PA 3O51A 3L9PA 4FTMA 2I1MA 5HBEA 4FV7A 3KU2A 4HVSA 2VNYA 4QP2A 4U42A 1U5RA 3ORPA 3Q5IA 4GK2A 3ULIA 4PL3A 3WILA 4AGDA 1H00A 4YZNA 5EHLA 2WQBA 4F9YA 3QTRA 5K5NA 5CEIA 3W8QA 5HU3A 1CM8A 3R00A 4GU9A 1GAGA 5GZAA 5IISA 3UOJA 4HCTA 3CC6A 3KMWA 4O6LA 4CV8A 2C6OA 3EZRA 2UZNA 3G6GA 2YZAA 3WIKA 5CF5A 2XB7A 4XV3A 3U87A 5BVEA 3LM0A 2BTRA 4WG5A 4GFGA 4GH2A 5HG7A 4ERKA 3KULA 1KE6A 3KL8A 3PTGA 3O8UA 2ZV7A 3PP1A 4YJQA 3VS7A 5IQHA 3RINA 5D9HA 3OF0A 1PHKA 2XJ1A 4ENXA 2A0CX 4L8MA 3W2SA 3HGKA 4RX5A 2NNWB 1PXMA 2IZUA 3NRMA 5KE0A 4AGCA 3QALE 4UZDA 1RJBA 4IWDA 5F1ZA 3Q04A 4IB3A 4CZYB 1M7NA 2GNFA 4X3FB 3OXIA 3OUNB 3L8XA 1JQHA 2C47A 3OCSA 4FICA 4JX3A 4O22A 4ANBA 3N4UA 2CNQA 4TYIA 4ITJA 1WFCA 2XRUA 5JFWA 4XRLA 4ITIA 3IW7A 4U5JA 3AT2A 5HX6A 3CXWA 3F2RA 4PMMA 3LM5A 1JNKA 1XQZA 3FY0A 3LLAA 1NW1A 2ITVA 4AG8A 4U97A 3S0OA 4W4YA 3R9DA 4YJPA 5ETCA 4KBKA 4GS6A 4ZY6A 3RZBA 4AT5A 2WU6A 2XMYA 3W33A 4QNAA 4TYEA 2GQGA 1VR2A 4FBXA 3U54A 3THBA 2NP8A 2YIRA 2PE2A 2O3PA 5JQ8A 3MWUA 5LVNA 3R63A 4FTUA 3ENMA 4IB0A 4MBLA 3E8NA 3RMFA 3BYOA 4E4LA 5HZNA 4KIKB 2BRNA 1UWJA 3K5UA 5HE0A 3VHKA 3CGOA 4GV1A 3W32A 3ZZEA 3D7TA 1H01A 2W7XA 1JKLA 2OGVA 3HKOA 5LXMA 4LMUA 3W2QA 1OIYA 3QCYA 4BCQA 1OIRA 3LCSA 4L01A 2JDRA 2W1CA 3AT3A 4N4SA 2VWXA 3Q4TA 4R7BA 1XKKA 4NL0A 4R1VA 1OKYA 3PP0A 5HE1A 4GYIA 5EHOA 2ETMA 4BDAA 3KXHA 2PMLX 3I4BA 3LCTA 3IOPA 3LFFA 4IB5A 3EQRA 4U41A 5CAQA 3EFLA 4I93A 4MX9A 3Q6UA 3R7EA 1XBBA 4G34A 3ALOA 5L2QA 2YM4A 1Q62A 1WBTA 2C5VA 2X4ZA 3LJ0A 1B38A 2BKKA 2XIRA 1ZY4A 3CSVA 4EH6A 3NIEA 2RFDA 2VTRA 4IAFA 5AFVA 4AOIA 1JSUA 2ZM3A 3KCKA 3PG3A 4RIWB 2PVKA 4CKJA 5IH5A 3OVVA 5AA8A 3VVHA 1KE8A 3W2OA 4EC8A 4H39A 2GHLA 1PF8A 1R0EA 3QD3A 4BC6A 5CI6A 2PZRA 3EN4A 5I9ZA 4EOLA 1ZOHA 3VUIA 4FNYA 3DLSA 3LZBA 3U6HA 4YLLA 5AX3A 4ANLA 2B4SB 3F88A 4RX7A 4AFJA 1H8FA 1JLUE 5AR8A 5HBHA 3OROA 2Z7RA 4QMOA 4O1PA 4L67A 4AS0A 4KS7A 4DH8A 3KN6A 5HIEA 3MFSA 1QPCA 2O63A 2OZOA 3G15A 2ZB0A 4YMJA 5FXRA 1BYGA 4CFNA 3KFAA 3HMIA 2WTIA 4I1ZA 3P23A 2YM5A 4JAJA 4M69A 1J91A 4OT5A 4AACA 4NCTA 3DXPA 5E7RA 3ODZX 4PTCA 1HCLA 3VRYA 4FSWA 3TTJA 3HRCA 3OW4A 4AZWA 4BDJA 1PXLA 2BMCA 5J87A 3LMHA 2ETRA 3H9FA 3MI9A 1H08A 3W16A 3I6WA 3CD8A 1IAJA 2UW6A 4IAKA 3SOCA 4XBRA 4D1XA 1G3NA 1QPJA 4JIKA 5C8MA 2YIWA 4RFZA 4NIFA 5D41A 4QQJA 1W83A 2PVRA 2HCKA 3I81A 2W1FA 4O7WA 4EI4A 5IG1A 3ERKA 1A06A 3JXWA 3OEZA 4WNPA 4ZSLA 4D0WA 2GPHA 2GNHA 3FLZA 3QRIA 4HGSA 4PMPA 3FBVA 4LGDA 4RSSA 3QQGA 5DG5A 5DT0A 3VS3A 3G2FA 4FT7A 4XG4A 4JQ8A 3VBWA 2V5QA 5CALA 3U9CA 2NO3A 3R7UA 1Y6BA 2IZSA 2PE0A 4ANQA 4ZJIA 2WMVA 4QMSA 4QP9A 3UQCA 3MPAA 3IG7A 2F7XE 4GK3A 3PWYA 5KUPA 2WMSA 3PG1A 3RZFA 2W0JA 3WF7A 2F57A 2VX0A 2X7GA 4XMOA 3C4XA 4R6VA 3NUPA 1BI8A 2O5KA 4IJPA 4CRSA 2PSQA 1TKIA 4IAYA 3DBDA 2CHLA 4DA5A 2OJJA 4FL2A 3RCDA 4FEXA 1YOLA 2QOLA 3DA6A 5BUEA 1J1CA 2H34A 2X6DA 4AA4A 1RDQE 4XYFA 2YWPA 4TYHA 4O2ZA 3D5VA 5CU3A 5HNGA 1U54A 3DB8A 1DI8A 2O64A 4FEWA 1LR4A 3AC5A 3K3JA 4QP7A 3BZ3A 5E8SA 4XV1A 3QD2B 2XM9A 3DBQA 3E93A 2CGUA 2J7TA 2R3KA 2Y8OA 4DFXE 2JIVA 2OF2A 1BMKA 3AMBA 3COIA 3QLFA 5EI2A 4C38A 5I9VA 4DTAA 2OICA 4N6ZA 4D4RA 4IX3A 2XUUA 3P7CA 3OFMA 4GFMA 4ZLZA 1XH8A 4RJ3A 5IMXA 2XIYA 3EN5A 3QQUA 4DFZE 4ZY5A 1FBNA 4HZRA 5J1VA 3TV6A 1VEBA 2GS7A 3OXTA 5M07A 3A4PA 2OXYA 5DEYA 2X81A 4ZSGA 2UZEA 3ATSA 3F5UA 2YDIA 3QAME 3F82A 4Z3VA 1W98A 3Q2JA 4IDVA 3PIZA 3EOCA 2VTTA 3BLQA 5BVDA 1WZYA 2HW6A 3R7VA 4B8MA 1WBVA 1ZYDA 4IMYA 2IVUA 1B39A 4OTWA 3DK3A 3NUNA 1CTPE 4D2WA 2XK7A 2ESMA 2C1BA 5KNJA 3E7OA 3QTWA 4IWQA 1QCFA 4HPTE 3GU8A 2WMAA 5I4NA 2PULA 4IM0A 2ZMCA 3U6JA 4JLCA 3UPXA 5AV4A 4CKRA 2VX1A 5IEYA 4LGGA 4CKIA 4QP3A 3A4OX 2IWIA 1M2RA 3NCZA 4JG8A 3CBLA 5FD2A 3T9TA 2QURA 2WMRA 1XBCA 3H0YA 3QZHA 4O82A 2XK4A 2VTNA 2ZOQA 3TKUA 4FK6A 2YDJA 2C3KA 4ACGA 4FKTA 4DG3E 3NMUF 4GRBA 5C26A 3A99A 4BDIA 3BLHA 3ZRKA 3F3VA 5J7HA 2C30A 3MJ2A 4U79A 1BL6A 4YNOA 3QQHA 5E8UA 4QYGA 4JJRA 3R9HA 4UY9A 3VIDA 4QQ5A 4O0WA 4I6QA 4XJ0A 1U46A 3H30A 3NW7A 3Q9YA 3BPRA 2X8DA 2ITTA 5FEEA 1WBOA 4NEUA 1Z9XA 3TWJA 5CQWA 5IF1A 3CJFA 4O0UA 2LAVA 2UVXA 3E64A 3QKLA 4RA5A 3DGKA 4CQEA 2ZYBA 1AD5A 5AUWA 1O9UA 4FG9A 4JIAA 2AYPA 2R3MA 2W05A 5H8GA 4AT4A 3ZBFA 5HBJA 5DOSA 5H3QA 3BYMA 2WXVA 5FP6A 4FV5A 4J98A 4RGJA 1LEZA 4FT9A 4XNEA 4EH2A 2FSTX 2QC6A 3IW8A 4QNYA 4QPMA 3HLLA 4JDHA 5CSWA 1SM2A 4KINA 3KK9A 3DTWA 2OFUA 4RC4A 4AGUA 1H1QA 3PVGA 1Q61A 4NW6A 4FKOA 3HV3A 4AZEA 2FH9A 3NR9A 3GQLA 4O0RA 4EK6A 3ATTA 2I0VA 4NJ3A 5EQEA 3BBTB 3KK8A 3EFKA 4BHNA 5ITAA 4FIFA 2QOIA 4E7WA 1CMKE 1GZNA 3KY2A 4UMTA 3RHXA 4G31A 3UE4A 3PLSA 2JC6A 3FMNA 4O7VA 3MV5A 4L42A 1URCA 2A27A 4PMSA 3ZSIA 2QKRA 2VTMA 3CTQA 3PXZA 1ZYSA 3HYHA 3VQHA 5E1SA 3I5NA 1CSNA 2IO6A 1PW2A 4ASDA 4HVIA 2BDWA 3TUDA 1FVTA 3NYXA 3KF4A 1YHWA 3Q6WA 3QTUA 2ITZA 2VWIA 4EONA 3F5PA 4ANNA 4EOOA 2WEVA 2OJIA 3CQUA 3VNTA 3UIUA 3I79A 5I0BA 3C9WA 4GG5A 4BDEA 5A14A 3PRIA 2BHEA 4BI2A 5CF6A 1JOWB 3QZGA 2FB8A 2E9NA 5JK3A 3KGAA 3R2BA 4E4XA 4IX5A 2R7BA 1JBPE 4O0YA 4GIHA 5C1QB 4BCNA 1ZWSA 3DKOA 4R7HA 2Z02A 3FMEA 3M1SA 4ZSJA 1TVOA 1MP8A 3Q53A 4HCVA 2BRGA 4ASZA 3VN9A 3FZRA 4NTSA 4ASXA 2B9FA 2G9XA 3E3PA 4F63A 2PUUA 1WAKA 5D7VA 5IH6A 3LFCA 2C6LA 3BQCA 4FV6A 3BI6A 3UZRA 4LG4A 3G5DA 2R2PA 3F5GA 4CV9A 5T6KA 2HXQA 3BV3A 3OWKA 4R3CA 4BCGA 2WMTA 3UIXA 4CYIA 2YJSA 3CPBA 2E9VA 3LOKA 4NM0A 2GTNA 3C4WA 3M42A 5HG8A 4YJRA 3IGGA 5BMMA 1F3MC 2RGPA 2J2IB 3C13A 2QR7A 4FKGA 4MXCA 3VS5A 4ACMA 4O81A 2A2AA 2E2BA 2XNNA 4FIHA 4DEGA 3DAKA 1ZYLA 1ZMWA 3G90X 4B0GA 3MH2A 4A9SA 4PTGA 3PA4A 3O8TA 4MVFA 2AC3A 4RX8A 4XP0A 4EEVA 3RAHA 4AZTA 2VO7A 3VUHA 2BROA 2ZV8A 4FKUA 4DC2A 3LFNA 2OJGA 3F7ZA 3K3IA 4YC6A 3BCEA 4BKZA 4C4EA 1H4LA 4MQ2A 3I7BA 2GU8A 4L3PA 4K0YA 4AW2A 4U8ZA 2BIYA 3PVUA 4X2JA 3C0HA 3NNWA 4DEIA 4E3CA 2ERKA 3KKVA 4M97A 3LJ1A 4MXXA 5JRQA 5CTPA 2VUWA 5IPJA 1PXJA 1UNHA 3F3UA 4P7EA 4XS2A 1ZYCA 5ANEA 4ZS0A 2E9OA 3OEFX 2Y9QA 1R0PA 4LGHA 3UC4A 4BGGA 4YTFA 3P0MA 4EH8A 4X6QC 3PXRA 4WHZA 3MPTA 1WBWA 2CPKE 3MPMA 4Q2AA 3S3IA 4Y5QA 4CNHA 4B99A 4MNEA 2UZLA 4LRMA 4RG0A 3HUBA 2WTDA 3D14A 5CSXA 3OWPA 4S30A 1OPLA 3FSKA 2X9FA 4XG6A 5CEOA 5EW9A 4F7JA 2PZIA 1MRYA 2Z7LA 2H9VA 4PF4A 2NRUA 4BTMA 4TKSA 5M56A 2C5XA 4TNDA 4UMQA 3FMHA 3GC8A 4K33A 3MYGA 2GQSA 5LARA 5IEXA 5HG5A 2XBAA 3ZM4A 2WFYA 5EOLA 4WOVA 4P2KA 2W99B 3R8ZA 4FV0A 4C34A 5J5SA 4QTCA 3R04A 4BBEA 3KXNA 3ZS5A 3FL4A 5FXSA 3RAIA 4C35A 4JG6A 3VO3A 3JY0A 4RBLA 3OHTA 2VGOA 3HV7A 5CVGA 3E87A 4FV2A 4BIDA 4D4VA 4W8DA 5HTCA 1YKRA 2HENA 3PIYA 3Q5ZA 5GJDA 3CE3A 3PY0A 3FEGA 1J7LA 2YEXA 1YW2A 4O7ZA 3MJ1A 5HOAA 2IN6A 3WE4A 4MD8E 4WBOA 4AZSA 3MA3A 4BZOA 3F2AA 2J51A 4BZDA 4FNZA 4I20A 1FGIA 2QI8A 3VJOA 4Z55A 5IQGA 3KRLA 5DYJA 3COMA 3PDTA 5F95A 2WOTA 5ICPA 1UU8A 2C6KA 2QOQA 1OKVA 3BGQA 4YBJA 3U55A 3R22A 4RFMA 1LUFA 5E8ZA 3PE2A 1JPAA 4RJ8A 3LIJA 4W4WA 3OCGA 4XLIA 3AGLA 4RFYA 4FF8A 4MYGA 1K9AA 4X6RA 3UNJA 4DCAA 5BYLA 3CTHA 3ZBXA 4XLVA 3QXOA 2PZPA 4IZAA 3UPZA 2R3GA 3R0TA 4UYNA 3RGFA 3P7BA 3ZFXA 4O7TA 1M2QA 1PXOA 3FHRA 3VUDA 4AFEA 2JKQA 3BBWA 3AOXA 4II5A 4DFLA 4WO5A 1ZMVA 3GOKA 4X2FA 5ANOA 1SNUA 2J6MA 5KO1A 4EQMA 4PNIA 4UYAA 2WZJA 2GTMA 2DUVA 5D10A 4ZZOA 5K9IA 3Q3BA 5CF4A 2WTKB 4EOQA 5KX8A 3HA6A 5ANJA 5AP6A 1IRKA 3WF9A 3MDYA 4RPVA 4BDCA 1DM2A 4QMLA 2YACA 3MS9A 4J99A 4IANA 5JFXA 2C0OA 3FZPA 2XEZA 5ETAA 2WQEA 2W1HA 4D4YA 3RALA 4CCBA 5ETIA 4O7SA 3FY2A 2WQMA 4L45A 3QCSA 3VS4A 2PYWA 5HX8A 1ZOGA 3D0EA 4BICA 3LQ3A 3EQPA 3ZDIA 4CG9A 5ACBC 3OTVA 5DGZA 5A3XA 4GMYA 3FL5A 4U45A 3OW3A 2WTJA 3FLNC 4UALA 4Q9ZA 4FUXA 4G1WA 3R8MA 2YZLA 4G17A 4N57A 4I6FA 2GFSA 2HWPA 2PMNX 3IPHA 3KCFA 3AGMA 2JIUA 4BWPA 2UW4A 2HW7A 3IW4A 4OTIA 4BDDA 1IASA 3D7ZA 1W7HA 4BCHA 1YOJA 4LRKA 4BBMA 2AC5A 2X7OA 5GHVA 3R7YA 3HDNA 4BDKA 3P5KA 5IQBA 4OTFA 4GKIA 3A7FA 2BAKA 3R1NA 3VWAA 1WVWA 1O6KA 2J9MA 4FA2A 2LGCA 2ZMDA 4FV9A 3RAKA 1YRPA 2WMXA 3ORTA 5E4HA 1JKTA 3GVUA 3LVPA 4DEEA 1X8BA 5HORA 3IGOA 5A6OA 3ROCA 3FMLA 4FMQA 4IEBA 4BIEA 4FZAB 1AQ1A 3P9JA 5EK7A 3PY1A 4YPDA 4WUNA 4E4NA 3R8PA 3OWJA 5FEDA 2HIWA 4RRVA 1F5QA 5J8IA 5L8LA 4GU6A 3UOKA 4KUJA 5BMSA 4O7RA 2W1DA 4IX4A 2VRXA 5EM6A 2Z8CA 4FUYA 3UGCA 4EOKA 3SXSA 4DLIA 4KBCA 3UMWA 4FEUA 5JZJA 3FZOA 3UP2A 4JDJA 1V0BA 3HA8A 4HGTA 2GHGA 4IZ7A 3TNHA 4HOKA 2B53A 1I09A 3ET7A 4NTTA 2VTAA 4XRJA 3NZ0A 4BWKA 3FC1X 3GT8A 3UNZA 2YWVA 1ATPE 1PYXA 1ZMUA 2IPXA 4AN3A 1YDSE 4O2PA 1REJA 2HZ0A 3N9XA 2WELA 4I6BA 4ONAA 3LLTA 3QBNA 4HYSA 4TWCA 3PE1A 2XIXA 5FTGA 2W17A 1Q4LA 3NYNA 5C9CA 5DMZA 3L8PA 4JBQA 4OT6A 3S95A 4YC3A 3IK3A 4C7TA 5AV1A 5KMOA 3LQ5A 3I7CA 3SLSA 5CAUA 3ZM9A 1OL6A 3IO7A 3Q4CA 4IE9A 2QLQA 4JNWA 4EYJA 2IVVA 3A8XA 3ORLA 4FEQA 5C03A 3HUCA 4F0GA 2B55A 5IUIA 5HO6A 5BYYA 2X9EA 3RCJA 3WZDA 3U4UA 5AUTA 4NK9A 4QD6A 3ZO1A 4A4OA 4EJNA 2FVDA 3F3ZA 3TDVA 4AZFA 3MB6A 2IVTA 3R21A 3OWLA 4QMUA 4A4LA 5M44A 4G3CA 4L44A 4H58A 2ZM4A 4RWJA 3K2LA 2PMIA 4G6NA 3HEGA 4O7YA 3BYSA 3EJ1A 4O38A 4GKHA 4X7QA 4WG3A 2EWAA 5M4CA 4MH7A 4U44A 3MFTA 2I0EA 3QX2A 2QU6A 2O65A 4XG7A 5LVMA 4QT1A 4RIXB 2JGZA 2XKCA 4OUCA 1GIIA 4P90A 5EW3A 4GVAA 1XHAA 3EL8A 3IDBA 4CEGA 4ZLYA 4BZNA 3BU5A 4EH5A 4N70A 2F7EE 2CCHA 1SVGA 3RNIA 2P2IA 3R73A 5JZNA 1QPEA 4CFWA 3HL7A 1JVPP 4RIOA 4L46A 4X3FC 2CKQA 5AUZA 3VUKA 3SKCA 4ZMEA 4A9UA 3TZMA 4CFUA 5JKGA 4KB8A 4G3EA 3V5PA 1SVHA 5DLSA 2BZHB 4XG9A 1OL2A 5HVJA 3UMXA 2XKEA 1PMNA 4Y5HA 4I5HA 3MSSA 4TXCA 5AP5A 1Q41A 5AR4A 3NW5A 4MBJA 5D11A 5BPYA 3FLQA 3GCSA 3BIZA 4OBOA 1P5EA 4FX3A 2B1PA 2GNLA 2QO2A 4R7IA 4EQCA 2C6MA 3NIZA 3ACJA 4IB1A 4OLIA 1L8TA 3SC1A 1ZLTA 4LL0A 3ZU7A 4ZEGA 3QRJA 3FMDA 5B0XA 4AN9A 2UV2A 4X3FA 1GIJA 5LMAA 3PPKA 1UU9A 5CI7A 4C0TA 4XV9A 3RNYA 2QCSA 4BCPA 4HVDA 3QL8A 5FG8A 3VHEA 1GIHA 2C3LA 4BWXA 2QNJA 4TPTA 5HD4A 4F1TA 3NNVA 4UX9A 4KWPA 2PK9A 4AOJA 2X6EA 2R3FA 2XCHA 3DDQA 4V05A 5D7AA 4NT4A 5HE3A 5AEPA 2WTCA 3AC2A 3VULA 4QP6A 4HNFA 1PXIA 2PVMA 4RJ6A 3UOHA 4BKYA 4BCOA 3WARA 4P5QA 5BX0A 3SGCA 2OKRA 3KF7A 4JBPA 2IJMA 4U40A 4E6AA 1IAHA 3NVKI 2VWZA 5FBNC 2YIQA 5DRDA 2Q83A 3A7IA 4E5AX 2HWOA 2Z7QA 2A19B 2JKOA 3ZO2A 1YXVA 2BDFA 2C6EA 4BBFA 1YXUA 3QQKA 1WBSA 4K11A 4DGOA 3NUSA 4OTGA 3EKNA 4RVTA 4BCFA 4CTBA 4ASEA 2EUFB 2WGJA 4F1MA 4Z7GA 3U8WA 2OXDA 4PPCA 4PP7A 3AD5A 4K18A 4ZTSA 4A9YA 5AUUA 1ZRZA 5KMIA 2OF4A 4L7FA 4S2ZA 5K0KA 3AC3A 3LFSA 3MIAA 4DH3A 2EVAA 5CEPA 3BHUA 1IG1A 1PMVA 5KHXA 5FP5A 2ERZE 3QTQA 3H10A 2IZRA 4M14A 4MHAA 4C2WA 3TUCA 2H8HA 3JPVA 3EH9A 1Q8UA 3QUDA 4RVMA 2JBPA 4IH8A 3R7GA 3PRFA 4M13A 3QZFA 3NUUA 1TQPA 2IW9A 2CMWA 3ANRA 4KSQA 1Q24A 3WZKA 3HMPA 1OBDA 4XOZA 4E6QA 1FMKA 5CZHA 1GZKA 3QRUA 4YBKA 4LOOA 5F20A 4DE4A 2ETKA 1ZZLA 2BDJA 3ACKA 3FYKX 3H9RA 4IDTA 4RC3A 4RIWA 4YJUA 3P08A 5H9BA 3R30A 3MY0A 2XKFA 3GU6A 4MBIA 3MH1A 3FQEA 4HGLA 2CKOA 4IADA 3ETAA 4WRGA 5M55A 5L2TA 1TQMA 5FBOA 5HNBA 3HAMA 4QOXA 4C4JA 4LQMA 2R3OA 2VO6A 4ZAUA 4U3YA 3FPQA 2O0UA 4LYNA 4YUQA 2JDOA 3ODYX 3GQIA 5EYMA 2WB8A 3CLYA 2OJ9A 2V7AA 4C58A 4JDKA 3HMNA 4I5MA 3I0OA 2ZB1A 4M69B 3SV0A 3TJCA 4BVUA 3KMMA 3FYJX 2WIPA 1CDKA 3DV3A 4LV5A 5JRSA 3FI8A 4DN5A 5BVFA 3TNIA 3OXZA 4NKAA 3EMGA 3GCVA 1YOMA 1IR3A 4QMPA 4YZMA 3ZC6A 4ALWA 3F9NA 4USDA 3BGPA 3COKA 3PA3A 2C69A 2J0MB 3IONA 4C3FA 1ZAOA 3LE6A 3MN3A 4BY9E 3KB7A 4EHGA 4YGAA 2XYUA 3FZTA 1OZ1A 2QHMA 3A7GA 3PXQA 4D58A 3IKAA 3QA8A 4FC0A 3RK7A 4DBNA 2QR8A 4PNKA 4IXPA 3MH0A 5K4JA 1KSWA 5HE2A 5A54A 1MQ4A 3R8LA 3LFEA 4M7IA 3FXWA 3NDMA 3CQWA 3VBTA 3F2NA 4YO6A 2REIA 1NVRA 1UVRA 2IVSA 2XNMA 3FSFA 3OCTA 3DQWA 2ACXA 1Z57A 4G5JA 3WOWA 3PWDA 4H3BA 3OG7A 4WSQA 5JN2A 2OIDA 3W1FA 1OECA 1YHVA 5EDPA 3QRKA 2VO3A 2WQOA 2YCSA 4G6LA 3V8WA 1J3HA 3LMGA 5AR7A 5KKRB 4BYJA 4TW9A 4E93A 4M12A 2PTKA 4BTJA 3V5QA 4W8EA 1YWRA 3ZUUA 3CGFA 4NKSA 2Q0NA 4WA9A 4QYYA 4A9RA 1PJKA 3P4KA 4F7SA 5HCXA 4PTEA 4RVLA 2YHVA 3H3CA 3QA0A 3C4EA 5A4CA 3GB2A 1I44A 4UV0A 5FTOA 3G0EA 3HP5A 3SRVB 4GT5A 4NM7A 3SOAA 1PKDA 5FDPA 2XK6A 3RI1A 4L00A 4GSBA 5AM6A 2QOHA 5JT2A 3NGAA 2BZJA 3R83A 1U54B 3V6RA 3H9OA 3V51A 3FZSA 5T68A 3V8TA 4ZXTA 5DHJA 4QMQA 3P7AA 2R3JA 3G33A 3SQQA 4OTRA 5CAPA 2KTYA 1BL7A 4D5KA 4O0XA 2I0YA 3LXLA 4MXOA 4EHVA 4FK3A 5AV0A 2BPMA 2R3QA 3E92A 4RWKA 5J95A 2WD1A 4D4SA 4X21A 4RX9A 4TWPA 3QX4A 4BFMA 4BDGA 3KMUA 4BRXA 3FE3A 3LFDA 5J1WA 5KZ0A 4KRDA 3UZPA 1OI9A 4EL9A 3R1QA 4HYHA 2XJ2A 2W9FB 3D2IA 3Q9ZA 3GC0A 4AT3A 4UMUA 5HO7A 2XRWA 3PJ3A 3R01A 5DPVA 1GZ8A 3R1YA 3O7LB 4RQVA 4UB7A 1PRYA 3O8PA 4IVAA 5GIOE 2J4ZA 5E8VA 4M3QA 2ITPA 5DBXA 2XK3A 2W5HA 3T3UA 4J97A 4ZMFA 2QOKA 4ZOGA 5CWZA 4XG8A 4EOSA 5CSHA 4MK0A 2DYLA 5AWMA 4H1JA 2BTSA 2YERA 2VX3A 3PFQA 4IAAA 3ZLYA 3V6SA 2X1NA 4JQEA 5D12A 3TACA 3T9IA 2JIIA 1XH9A 3DDPA 3ZLSA 4CMOA 4CLIA 4QQTA 2V7OA 2BAJA 2F2UA 4EH7A 2RL5A 4M68A 5HLPA 4I23A 2VTOA 5KMKA 1OBGA 4FV1A 4FKLA 2UVYA 1H25A 4K8AA 2ZAZA 4GL9A 3TT0A 4ZSAA 3DT1A 2OG8A 4AQCA 4FL3A 2JBOA 2UW8A 2XYNA 4FSQA 4B7TA 5A9UA 3CP9A 4EJ7A 3DB6A 3B2WA 5M57A 5AP1A 3E8EA 4FG7A 3NYOA 3E7VA 2WOUA 3LFBA 4LV8A 5EI6A 3DXQA 3ROYA 3EN6A 4FKPA 5AP4A 5HKMA 3Q52A 4WG4A 2GCDA 5IQEA 2X4FA 1OB3A 2GS2A 3P1AA 2UW0A 2CGVA 4Q5HA 4O21A 3PSBA 4U0IA 5CF8A 2XNEA 4NM3A 5DR6A 4QTBA 4FTRA 2UZDA 4XHKB 4PP9A 4MXAA 4FSZA 4JI9A 1NT2A 1L3RE 3RPOA 3EYHA 4PRJA 4ANMA 4D55A 1WCCA 4PPAA 5ACKA 5LJJA 5IKWA 3RPYA 3SDJA 2OWBA 1UV5A 3ZUTA 4CYJA 2C0IA 4EC9A 4E6DA 2QODA 1GNGA 5CSVA 4FTNA 5LOHA 3EQCA 2W4JA 2XEYA 3AT4A 3EIDA 4ID7A 4DGMA 3GI3A 2UW9A 3CEKA 3TJDA 2RKUA 2BFYA 5HESA 4I0RA 4QMMA 1XJDA 2ITWA 4BTKA 2XIKA 3C1XA 3UC3A 4FV4A 4IC8A 3VF9A 2X0GA 4FTLA 3UO5A 3EB0A 4JVGA 2VWBA 4AAAA 5DNRA 1UKHA 4Y95A 4RLLA 3TG1A 1R39A 4AUAA 4NM5A 5G6VA 2UZTA 3RPVA 3T8OA 4DT9A 4E26A 2JLDA 2QOCA 2FSMX 2PZYA 4G6OA 4XEYA 4L53A 4E4MA 2YN8A 5IDPA 3F66A 5I9UA 2R3HA 4QTEA 3A62A 1O6LA 1XH7A 3PZHA 2ITNA 2PE1A 5CAOA 2QOFA 1SMHA 1YWNA 2QLUA 4CXAA 1H24A 2JKKA 5AV3A 3W2RA 3HAVA 4O96A 1Y57A 2XS0A 3DJ5A 4F7LA 2IG7A 3Q4ZA 2BRMA 3VW8A 1V0OA 5DT4A 3QGWA 2PPQA 3EQBA 3KC3A 4U80A 1Q97A 4YSMA 3AMYA 3ZHPC 1P4OA 2OJFE 3ZCLA 4IAIA 2B54A 4YLJA 1QL6A 1M2PA 3WZJA 4O91A 4S34A 2NPQA 2JDVA 4FKSA 2Y6OA 1UWHA 2OXXA 2BCJA 3I0QA 4KAOA 5CS6A 2JAVA 4KKGA 4EKLA 4V0GA 2YDKA 4QMTA 5ANDA 4C59A 5CXHA 3NSZA 4XCUA 3ORNA 4CCUA 3R71A 5M4UA 2FO0A 4G16A 2QU5A 3GCUA 1Q8WA 4I22A 5CNOA 2VTQA 5FQDC 3TDWA 2WMUA 2GNJA 1E1XA 4GUBA 3FWQA 3HRFA 3OP5A 4OAUC 3W8LA 3SVVA 3A61A 1W8CA 4M0ZA 3FMJA 4JXFA 5HG9A 2GDOA 4IFCA 4XOYA 4DTBA 4FTOA 1FGKA 4GK4A 4F65A 3VC4A 4FV3A 4EOJA 4E6CA 3QUEA 4C62A 3DLZA 1F0QA 1YVJA 3L9NA 4D2VA 2Y6MA 4O1OA 5HVYA 3VS0A 4O0VA 4RC2A 1OGUA 4YR8A 4UEUA 3WYYA 5A4QA 2PUPA 4EUTA 2J0KA 4WIHA 2C6IA 1Y8GA 4QMZA 1KOAA 3ZUVA 4KRCA 1URWA 4PUZA 2XJ0A 4NUSA 4RJ4A 3W2CA 4GW8A 4H05A 4U7ZA 4K1BA 3OOMA 2FYSA 5GJFA 5AADA 3LAUA 2X2MA 3ZSHA 3PA5A 3NVMB 2W1IA 1YWVA 2VTHA 1OMWA 3SG8A 3GU5A 2BHHA 5BNJA 3DZQA 4FSUA 4HCUA 3ORMA 4RZVA 5HTIA 4UXLA 4Y73A 2J0JA 3BKBA 3QQLA 4ACCA 4KSPA 2PY3A 4FYNA 3RP9A 3V5LA 4O86A 3VBYA 4JRVA 3PXFA 5AP2A 3WBLA 3BLRA 3HP2A 4FOCA 4D2RA 2G01A 2HY0A 3FQHA 5DH3A 4E1ZA 2XK9A 4MNEB 3LQ8A 2BZKB 4TRLA 4X3JA 3ZTXA 4EOMA 2OZAB 5E8XA 4IVCA 1XWSA 3FKNA 4AU8A 4Q5EA 4U9AA 3IDCA 3QQFA 5AR5A 3NNUA 3PUPA 4GJ3A 3R8VA 4RLKA 5AUXA 5CXZA 1W82A 5FUTA 3CS9A 2YABA 3UG1A 2BALA 3OZ6A 4BTFA 4QMWA 4FSYA 2PUNA 1P2AA 3CIKA 3PSDA 4X2NA 3ZO3A 1HCKA 5HLWA 2EB2A 2HELA 3OUKA 4E73A 1NVQA 2JFLA 5CU4A 5KMNA 5HO8A 2B9JA 4UWCA 2XK8A 3BU3A 2WNTA 2HZIA 4K2RA 2R3IA 3POZA 3DBEA 4XG3A 4OBPA 4FE2A 5JMSA 4YPSA 5TOZA 3IW5A 5TR6A 3ZOSA 3ORXA 3A2CA 2R0IA 2C68A 4C37A 5L6OA 2VTLA 1NA7A 2Y4IB 5I5ZA 3BX5A 4Y46A 3KN5A 4FNXA 3BYUA 4HYUA 4I0TA 5AMNA 3PJCA 3HV4A 5A6NA 3ULZA 4J96A 1PYEA 3WZUA 2QQ7A 3S4QA 3E5AA 5ANIA 4YJVA 3EQFA 5H8BA 2BFXA 3QKMA 5AJQA 4ZTQA 3F3TA 1Y6AA 4AXAA 1VZOA 2WAJA 3VBVA 4MQ1A 2JDTA 3CTJA 1IA9A 3FI3A 4R77A 4LOQA 3DJ7A 2VNWA 4PL4A 2WTKC 3VJNA 3BU6A 3DS6A 5TE0A 4I21A 3QWKA 3QKKA 4FZFB 1K3AA 4P4CA 3RAWA 2B0QA 1H27A 3UZTA 2YCQA 2Z60A 2P2HA 3B2TA 5IEVA 4ZTHA 1KE5A 4DH7A 2FSOX 4PPBA 4Y83A 4CTCA 4N0SA 4EHZA 4A06A 2ZJWA 5KHWA 3TZ9A 5I3OA 4EK3A 1U59A 3FMMA 3HV6A 3NEWA 3EHAA 2GFCA 3HECA 4W9WA 4IZ5A 4QMYA 1Y8YA 4YZBA 5K5XA 3Q9WA 2C0TA 2V22A 2CCIA 4FYOA 5J9LA 4K6ZA 3E63A 5DN3A 1G8SA 1ND4A 3I60A 3EZVA 2JEDA 3E8DA 2WO6A 4FEVA 1Q3DA 2UZVA 4IVDA 1SVEA 4TL0A 1RE8A 1M7QA 5LVOA 2VWYA 3LCDA 3I6UA 2RFNA 2ITUA 3HRBA 5E8TA 3WF8A 4A7CA 3DFAA 4MXYA 4NYEA 5AX9A 3FLSA 3KXMA 3UYTA 3BHHA 4WKQA 3QC4A 2O2UA 4TT7A 3R8UA 3SG9A 4YJOA 4BF2A 4BYIA 5L8JA 3JS2A 4GT3A 2B9HA 1A9UA 5FDXA 4GUEA 4JR7A 5HEZA 5AAEA 1OIQA 2F7ZE 1IA8A 4EZ5A 4MD9E 3TZ7A 2VV9A 3A8WA 4USEA 2QG7A 4PDOA 4I94A 2V62A 5FXQA 2ITQA 5HU9A 5DA3A 5GZ8A 3BEGA 3C7QA 1FQ1B 1Z5MA 2XVDA 3I1AA 4E8AA 4YTCA 5LCJA 2P33A 4I6HA 5DE2A 4U3ZA 4FSRA 4DGNA 3O7LD 4WT6A 2CN8A 4L9IA 4C3PA 3D5XA 4CD0A 1ZZ2A 2F9GA 4F99A 5BQ0A 2SRCA 5AAGA 1O6YA 4TN6A 2I7QA 2ZDUA 4YO4A 5LQFA 3NCGA 2X39A 1KOBA 4JT3A 4MNFA 4QRCA 4GVJA 3QD4A 2R0UA 3MGYA 4FVQA 4EWQA 5IQAA 4TZRA 2YLEA 3ALNA 4XP3A 3NPCA 3FI2A 2R3NA 4I0SA 5CANA 3R7IA 3JVSA 1ZY5A 5IQFA 4DEDA 5DIAA 4C4HA 5J79A 3PJ8A 2WPAA 3NLBA 4BDHA 4RIYA 5JFSA 5ANGA 4FTKA 5HCZA 1KV2A 3TM0A 4IWOA 5JGDA 4QTAA 3RBWA 5JFVA 4M15A 4ZJJA 5EG3A 2NRYA 1YXTA 3NW6A 5A4TA 4ANSA 4R3PA 3ZRLA 4WD5A 4DTKA 5CEKA 4EK4A 3M11A 2PVJA 3RK9A 5DVRA 1UNGA 2CNVA 4HNIA 3DBCA 3GNIB 3CY2A 4D2SA 3KXGA 3G0FA 5CAVA 4NZWB 3QTIA 4B4LA 4C3RA 1Q5KA 4V01A 4CT1A 3DY7A 4D9TA 3G9NA 1FMOE 4FTAA 3Q32A 3CJGA 2Y4PA 4K9YA 5BVOA 3MBLA 3P86A 2WMQA 3ZSGA 4QP1A 4RT7A 1OIUA 1S9JA 3QYZA 3QCQA 3V5TA 4XBUA 3EQGA 3TIZA 5I9YA 4WNKA 2W5BA 4RQKA 4C4GA 4F9AA 1OUKA 3G9LX 3N4TA 4LOPA 3CD3A 4EWHA 2OBJA 4ZLOA 4G9RA 2WHBA 3NX8A 5A4LA 2F4JA 1CKJA 4L3JA 3TZ8A 4BL1A 2E9PA 3RHKA 4EZ7A 4MF1A 4E20A 5IMEA 1UU3A 2ZVAA 5EM7A 4Z16A 3PPJA 4Y72A 3ID6C 5A4EA 1M52A 1SNXA 3FQSA 5EI8A 2QONA 3HNGA 5EQYA 3B8QA 4W4XA 1EH4A 4XX9A 4AWIA 4YSJA 4P5ZA 1OL7A 3RM7A 3E62A 3G51A 2W9ZB 3R9NA 3KREA 4WSYA 5M08A 5DRBA 3RPRA 5FWKK 4M8TA 4F09A 4CFMA 1Q99A 4IJ9A 1G5SA 4HYIA 1FVVA 1K2PA 5CVFA 4NFNA 2OFVA 4BDFA 5KBQA 3NYVA 1R1WA 3GFEA 3UQFA 4BI1A 5BUIA 1A48A 3A7HA 1R78A 2KULA 4RIXA 4H3PA 3ANQA 2XH5A 2XZSA 3LKMA 2BIKB 2YIXA 5CQUA 4YURA 4FI1A 4EUUA 2XM8A 4AF3A 5IA0A 3AC4A 3HDMA 2QG5A 3QGYA 4M66A 4CMTA 3VS6A 4F6SA 1KUTA 3KULB 4QP4A 3TV7A 1JAMA 4L52A 4ZSEA 3GC9A 5AR3A 5IQIA 3O17A 4QTDA 4JRNA 4C4IA 1YI4A 3JR1A 3PLAE 3R6XA 2RIOA 3OTUA 1YXSA 4HW7A 4N6YA 5L4QA 3V5WA 2W1ZA 4YTHA 2A1AB 3A7JA 2VTPA 3JVRA 4IWPA 1PXNA 2RF9A 4KA3A 4EKKA 3ZH8A 3QTXA 5HQ0A 5DEWA 3EQHA 3ZZWA 1GY3A 3DQXA 4IZYA 4MWHA 3K54A 4XG2A 2F49A 4IC7A 2ITYA 5DWRA 5FGKA 3ZC5A 3L8SA 4FTQA 4G3FA 4C33A 4W4VA 4EYMA 5DI1A 1ZOEA 2OH0E 4DH5A 1SZMA 2XIZA 2VTIA 4BGHA 2P3GX 4BDBA 4C61A 2UUEA 5M4FA 1XH4A 2XNBA 3F3WA 4DCEA 4ZP5A 2CGWA 2GQRA 3QLGA 4O84A 3QQJA 4BCMA 2Y7JA 4UZHA 3UVPA 5E91A 3OY3A 4I4EA 5DR9A 1APME 3IECA 2PU8A 2YA9A 4AP7A 3PXYA 3CKXA 4I3ZA 4L68A 5ANKA 5EW8A 2HZNA 4S31A 4UWBA 2RG6A 3ZMMA 4DF3A 2WTVA 3D7TB 4FSNA 4J7BA 4DAWA 4OTHA 1UA2A 3NAXA 4KIKA 5C8KA 5M53A 3MY1A 4HPUE 3TNPC 5LWMA 4Z7HA 3GOPA 3IW6A 3FDNA 3PYYA 4FKIA 3MTLA 5DFPA 4BCJA 2PZ5A 4AGWA 3DNEA 4D2TA 2BUJA 1KV1A 1XH6A 3DZOA 4EBWA 5J9YA 4ZS4A 4OTQA 3SAYA 4J52A 3UVRA 2QHNA 3TNWA 4KABA 3QU0A 5CASA 3KA0A 1YDTE 3R9RA 2CKEA 1UU7A 4R3RA 2HOGA 3ZONA 3UDBA 5CEMA 2W1GA 3UTOA 2W4KA 2JKMA 3D94A 4FG8A 3QUPA 3PZEA 3R9OA 3HVCA 4PV0A 4RMZA 4DITA 2H6DA 4D0XA 5CX9A 2W1EA 4KS8A 4PWNA 4RWIA 5B7VA 3W2PA 4C02A 4UWYA 2C1AA 4EQUA 3NS9A 3HX4A 3KRRA 3VUMA 2JD5A 4MF0A 2ITXA 3LFQA 4MXZA 3VRZA 3BHTA 3OCBA 3KVXA 3O2MA 2CGXA 2J5EA 3BE9A 4YC8A 2H96A 3FJQE 1H1SA 4LRJA 4ZTNA 5FLFA 1DI9A 3EN7A 3BQRA 3GP0A 4G3DA 2JITA 4F6UA 5IA4A 5IA3A 2HZ4A 4D5HA 3AD6A 3ZEWA 5CVHA 2CN5A 5HI2A 4H36A 5JQ5A 1R3CA 3O0GA 4NCTC 1QPDA 2IZTA 3WF5A 4FL1A 5HNIX 4KIPA 2P0CA 2BRHA 3DKFA 2A4LA 3OT8A 3SW7A 3JYAA 2P4IA 3KXXA 3FKLA 3CCNA 4LI5A 4EBVA 3EFWA 3ZEPA 4UBAA 2CLQA 2YJRA 1FOTA 4JL9A 5EOBA 4DEAA 3EL7A 4AZVA 2RG5A 3ZFYA 1S9IA 5IH4A 4X2GA 5BYZA 5JSMA 3PPZA 4YJSA 2P55A 4FV8A 3L8VA 3QC9A 4BR3A 5M09A 2J0LA 1NVSA 2VN9A 5AV2A 5FM2A 2R5TA 3ORIA 4PDSA 4WNOA 5LVLA 5EQPA 3NWWA 4FGBA 4NIFB 4O0SA 5E8WA 1DS5A 4L43A 4C4FA 4PDYA 4PL5A 3BWJA 3DCVA 3PSCA 5HICA 3KEXA 4FTCA 3DFCB 5KKRC 4QMXA 4BHZA 4E5BA 2ZV9A 4ZK5A 4IW0A 1H1PA 3DK7A 2C6TA 3QD0A 1KE9A 1WMKA 4FNWA 4BCKA 4DFUA 3FHIA 3LW0A 1YI3A 2YAAA 2ZV2A 2EXEA 5EDQA 5EM8A 4AW0A 4DLJA 3MVMA 3TEIA 5KBRA 2Z7SA 5CU6A 1NY3A 4MCVA 4EH3A 3UP7A 2WMWA 5E1EA 4IFGA 4MKCA 3VS1A 5AR2A 2X8EA 4AE6A 2G1TA 2PVLA 3FV8A 3ORZA 3UG2A 3Q9XA 2YITA 5HGIA 4DEBA 2I40A 4GJ2A 4ZTMA 2X7FA 4EORA 1OL1A 5IQDA 4IM2A 2J5FA 2YISA 4I24A 1Y91A 4F70A 4JR3A 1XO2B 3R02A 5FRIA 4F9BA 5F4NA 2GS6A 3C0GA 3ZLWA 4F9WA 2QOBA 4JBVA 2OO8X 5CY3A 2C5NA 4TYHB 4UMRA 2OK1A 5B2KA 4CG8A 5FEQA 3W18A 2QO7A 4B6LA 4Y8DA 1OKWA 3UQGA 5EH0A 2HXLA 1Q8TA 4OTDA 1BX6A 1VJYA 3NUXA 3SRVA 4AW5A 5BUJA 4DFYA 1UKIA 3BYVA 3DK6A 5JEBA 1PMUA 4IACA 5BVKA 4DT8A 2OI4X 3EYGA 2ZM1A 3DKGA 4CLJA 5M51A 5HIDA 1PXKA 1WBPA 4EK8A 3F5XA 2WIHA 4O27B 3REPA 3D5UA 4ZZNA 3BRBA 4R78A 2HK5A 3L9LA 4FT0A 4QMVA 3Q2MA 4FGRA 3IQ7A 1B6CB 2ONLC 2R3LA 3CQEA 3GFWA 4NH1A 3ZXZA 3CKWA 3V5JA 5C4LA 4ALVA 2XNOA 3H0ZA 1Q8ZA 3II5A 2UZBA 2VO0A 3UIBA 4KIOA 5J7BA 3E3BX 3DNDA 3UIMA 1IEPA 4D2PA 4U81A 4PQNA 3N51A 3NAYA 1HOWA 3PXKA 4YP8A 4JX7A 3D9VA 4YNEA 4FT3A 5CT0A 3HMOA 2WMBA 5IQCA 4KIQA 3OS3A 4RWLA 4EOIA 3OT3A 1NXKA 4H3QA 2OW3A 4XV2A 5LVPA 5CU0A 3G6HA 5EM5A 3ZRMA 3O71A 3FUPA 3HMMA 4TWNA 2FA2A 4YLKA 3VBXA 4OR5A 5M06A 2I0HA 3C51A 3PJ2A 3S1HA 4FZ6A 4BN1A 4CRLA 3WZEA 1ZXEA 2ONLA 2C5OA 4Z9LA 3VAPA 1QMZA 3UODA 1ZARA 4ORKA 5AUVA 5LMBA 1P14A 2VZ6A 2CKPA 4A07A 3MFRA 3QHRA 5AIRA 3GGFA 1H0WA 3M2WA 4U6RA 5JGBA 3A60A 3MVLA 4MTAA 3MTFA 2G15A 3EQIA 4WRSA 3F6XA 1VYWA 2Y0AA 5HIBA 2IW6A 3GCQA 1T46A 4D1ZA 5L3AA 1G8AA 5C4KA 3RPSA 4KBAA 4J8NA 3UYSA 3DJ6A 2VTJA 3HZTA 2VWWA 4MAOA 3I5ZA 3F61A 3CR0A 3V3VA 4HVGA 2I6LA 3V04A 3GCPA 5AP3A 4MEDA 2RFSA 2XA4A 4FKQA 4W9XA 2XBJA 4J71A 3GC7A 5L6WL 5A46A 1Q8YA 3Q96A 4KKHA 2X2KA 2C3JA 3Q60A 5CEQA 2X2LA 1J7IA 3OY1A 4ARKA 4AW1A 4JBOA 3DTCA 1OKZA 4NW5A 1JWHA 3C4ZA 5C8NA 1H07A 2C3IB 1YQJA 4QQCA 2XCKA 5IUGA 4ACHA 4BGQA 2G2HA 3F69A 4LUEA 5H2UA 3EN9A 4IIRA 4PMTA 3F7WA 3E88A 3QXPA 3QCXA 3AG9A 3CPCA 4K77A 3U9NA 2EU9A 5EKOA 5EYDA 2CDZA 1DAYA 3IDPA 3PVWA 2UW3A 4L3LA 4NFMA 5KZIA 2C5YA 3R7OA 3GBZA 2W96B 4DFNA 4IX6A 1OPJA 4F7NA 1KE7A 4C36A 4O83A 2GMXA 4TYJA 3UJGA 3NUYA 4ACDA 1YI6A 3DPKA 3WE8A 3SXRA 2R3PA 2WU7A 4C57A 2UZWE 2YM3A 4HZSA 3AC1A 1YDRE 5EDRA 4D28A 4D1SA 3BEAA 3DKCA 1E1VA 2FUMA 2YM8A 1WBNA 3TI1A 4FZDB 3BELA 3MA6A 3AC8A 4FOBA 3PVBA 3SD0A 5L6PA 3QTZA 3C5UA 4CGAA 5KMJA 4TTHB 1JSTA 1RW8A 2C4GA 3ORKA 4FODA 2WKMA 5IU2A 3POOA 4XP2A 4F1OA 3VUTA 3C4CA 4LFIA 4LM5A 2OSCA 3S2PA 2WTWA 1REKA 3OC1A 3W10A 4USFA 2E9UA 3COHA 1WVYA 2YCRA 5JH6A 3LCOA 3JY9A 4NSTA 2QD9A 2W5AA 1U4DA 1LP4A 3D5WA 2PVFA 2VD5A 2X8IA 4FTTA 2EXCX 1TQIA 4PY1A 5T3QA 4F6WA 3TIYA 4CFVA 1H1WA 3GXLA 5L2IA 4U43A 1E9HA 2HY81 4ZJVA 3DU8A 3UBDA 4PX6A 2ITOA 4A9TA 5G1XA 5LMKC 4RVKA 2YM6A 1OL5A 4IBMA 3GUBA 3MFUA 4V0GB 2RFEA 1WVXA 3FXXA 1OUYA 3UOLA 3U6IA 3Q4UA 4DINA 2OLCA 4FVRA 4IVBA 4EHEA 4JQ7A 1CKIA 4A4XA 2W06A 3DOGA 3L1SA 4ZTRA 4EH9A 5HTBA 2OH4A 2PMOX 4AA5A 5J9ZA 3EFJA 3C0IA 4JS8A 4CSVA 2PL0A 4YJTA 2AUHA 2JFMA 5CSPA 3BWFA 5HLNA 4ZIMA 4I4FA 1T45A 3V8SA 2J50A 3LJ2A 1KWPA 3MIYA 4X2KA 4EK5A 5CZIA 2B9IA 3B8RA 3O23A 5CNNA 1LPUA 5LMKA 4FT5A 2R7IA 3FLYA 3AXWA 1FVRA 2GSFA 5DT3A 2VAGA 4B9DA 5IDNA 2UW5A 3KRJA 3D2KA 4J8MA 1VYZA 3MVJA 2OIQA 3TKHA 2B7AA 3IS5A 3LXNA 2VTSA 3T3VA 2QO9A 3UVQA 4FTIA 5E92A 4H1MA 3LHJA 3QHWA 4YHJA 2OIBA 2Z2WA 3FKOA 3SHEA 2IW8A 4X0MA 4R5YA 4G9CA 1MUOA 2GHMA 4LUDA 3MVHA 4G3GA 4I92A 1AGWA 4I41A 2GNGA 4UXQA 4DYMA 5AA9A 2UZUE 3FMKA 4ERWA 5L2SA 3AD4A 5CT7A 2PWLA 1J1BA 3TTIA 3AMAA 4R8QA 4RJ5A 5HHWA 3TNQB 3P78A 3RWPA 4HGEA 4TY1A 5IA5A 4BKJA 1OITA 3FXZA 4PDPA 3H4JA 2BR1A 4IM3A 4J1RA 1BLXA 3RWQA 1BUHA 3S00A 4O0TA 5I9WA 3VQUA 5AUYA 5IA2A 4MWIA 3TUBA 1PKGA 2CJMA 4BCIA 3OBJA 5GJGA 4FKJA 5LWNA 3KRWA 1YHSA 3O50A 2BRBA 2R3RA 2Y4IC 4CT2A 3C50A 2OZAA 1OM1A 3PY3A 4YHFA 4FSTA 2R4BA 3TCPA 3VS2A 3W55A 4AN2A 4QP8A 4J95A 5TT7A 3MESA 2R9SA 5BVNA 2VWVA 3PJ1A 4C2VA 4YHTA 5DR2A 3DBFA 3AQVA 3O96A 3QWJA 4OW8A 5J5TA 4DG2E 3ZYAA 4CFFA 4F0IA 4YTIA 5H8EA 1J7UA 3FAAA 4DBXA 4JDIA 3UNKA 5IA1A 4R5SA 2QOOA 3D4QA 2UVZA 4GG7A 5TKDA 2YAKA 4M0YA 5GNKA 3UO6A 4IQ6A 4WNMA 5TF9A 2RSVA 3BE2A 3QTSA 4AE9A 3P79A 2Q0BA 1V1KA 4RZWA 3TN8A 5CU2A 5D1JA 2YLFA 3SW4A 4S33A 4APCA 4GEOA 1H28A 4FTJA 4ENYA 3KQ7A 4OGRA 5AM7A 4I5PA 4DEHA 4FIIA 4HJOA 5K0XA 1GOLA 3PIXA 5EYKA 2PUIA 2HYYA 1V0PA 5KCVA 1M14A 4FKRA 1JKKA 3BHYA 3EWHA 4G5PA 4R1YA 3R2YA 1ERKA 3SXFA 3TV4A 2UZOA 4I5CA 1Q3WA 2VWUA 3OMVA 3DAJA 4L7SA 4WBBB 1P4FA 4RJ7A 3EKKA 5E9EA 5GINE 2G2IA 1JKSA 4BIBA 5HD7A 5E8YA 4YZDA 5ETFA 4QMNA 4KNBA 2CSNA 2EXMA 3LXPA 4EZ3A 4E5WA 5C27A 1FPUA 1OVEA 2XNPA 3LPBA 3KVWA 4UMPA 5I3RA 5AP7A 2JAMA 1XR1A 3EQDA 4TNBA 1MQBA 2BKZA 1H26A 1ZYJA 3QRTA 2WEIA 4FZ7A 4XUFA 4QPAA 1W0XC 1PXPA 3GEQA 4OBQA 4LL5A 4S32A 5CLPA 5HCYA 5B2LA 3WI6A 4NWMA 5LCKA 2BVAA 3ENHA 3DXNA 5GZ9A 3RTPA 1PY5A 3LXKA 1JSVA 4M84A 2VGPA 4FIJA 4C8BA 4QO9A 3U51A 4ZY4A 4RA4A 3KXZA 2CNUA 4Q9SA 4GIIA 1UNLA 5JGAA 3WF6A 3LFAA 1SYKA 5FM3A 1GJOA 2HAKA 2PHKA 4O6EA 4ZZMA 4F64A 3LMIA 4XH6A 5FTQA 2F2CB 4FIEA 5IZFA 3NNXA 3BV2A 4KKEA 4TWOA 5E90A 2O8YA 2QKWB 3UO4A 1FINA 3FC2A 4GYGA 3VBQA 4D9UA 4QYEA 2QVSE 3QYWA 4CQGA 2PVYA 4YU2A 4J53A 4G2FA 2BILB 3V01A 5KMMA 2CLXA 3BHVA 5IUHA 4ZTLA 3C4FA 4TYGA 3GU4A 3ZXTA 5EKNA 4FKWA 4CVAA 2ZDTA 3JUHA 3RK5A 4L6QA 3BGZA 3TXOA 5CYIA 3VW6A 3D83A 4O7LA 1XH5A 2BAQA 1OPKA 2J0IA 4QYHA 4DH1A 5I9XA 4CMUA 2JDSA 4GCJA 2DQ7X 3OBGA 3RM6A 3QZIA 1PMEA 4YZ9A 5CENA 2FGIA 3SX9A 3TKIA 4B8LA 3IOKA 3R28A 4AOTA 4CZTA 5HVKA 5M4IA 5B2MA 3D15A 5KMLA
chains in the Genus database with same CATH superfamily
2XF0A 3R1SA 4OTPA 3ZO4A 3AKLA 3MH3A 1MRUA 1G8KA 4DFBA 4FKVA 3ITZA 4NJDA 3WIGA 3OOGA 3OD6X 4M67A 1U5QA 4MD7E 4NU1A 3LCKA 2YFXA 5TO8A 5EYCA 3RJCA 4BB4A 4OAVB 2V55A 4FVPA 4DHFA 2G2FA 4RIYB 3VUGA 3SA0A 1MRVA 2C6DA 4UN0C 3FLWA 5F94A 2WQNA 5AP0A 3L9MA 2YM7A 5AAFA 1M17A 4FR4A 1H0VA 3GENA 4IAZA 2FSLX 4EH4A 4AX8A 4WUAA 3E8CA 3KRXA 3K5VA 4FSMA 3WYXA 2UW7A 4JOAA 4Y85A 5AIKA 1CKPA 5C01A 3QFVA 1H1RA 4O7NA 1STCE 5GIPE 3FZ1A 4BI0A 3C5IA 3DAEA 4GT4A 4JAIA 2XAMA 2XP2A 3U4WA 4F9CA 4APPA 4F0FA 3HV5A 5K3YA 3MW1A 4F08A 4QYFA 1XBAA 3ZLXA 2B52A 2OU7A 1DAWA 5EFQA 1GZOA 4ANOA 3NUAA 4EOPA 4ALUA 1RQQA 5BVWA 3FPMA 3RVGA 2R64A 4JG7A 4CZUA 2BZIB 2EB3A 3N4VA 2PVNA 3ZFMA 4QPSA 2VU3A 3ZDUA 5L2WA 3CY3A 2YIYA 3GU7A 1YXXA 2GNIA 4GFOA 4AQKA 2YCFA 4YZCA 2PVHA 3MB7A 4LMNA 4V04A 4DG0E 2V0DA 2J90A 2DWBA 3MY5A 1W84A 3ELJA 4DGLC 4IHPA 2XKDA 3RKBA 1BKXA 3VF8A 4CFXA 5L8KA 1BI7A 1LEWA 3FI4A 3QF9A 4ITHA 4YJNA 5EHYA 4FIGA 2DS1A 3TL8A 4AA0A 4DGGA 4KD1A 4HVHA 5F9EA 2W4OA 5K4IA 2XNGA 4F4PA 3O51A 3L9PA 4FTMA 2I1MA 5HBEA 4FV7A 3KU2A 4HVSA 2VNYA 2X0QA 4QP2A 4U42A 1U5RA 3ORPA 3Q5IA 4GK2A 3ULIA 4PL3A 3WILA 4AGDA 1H00A 4YZNA 5EHLA 2WQBA 4F9YA 3QTRA 5K5NA 5CEIA 3W8QA 5HU3A 1CM8A 3R00A 2XARA 4GU9A 1GAGA 5GZAA 5IISA 3UOJA 4HCTA 3CC6A 3KMWA 4O6LA 4CV8A 2C6OA 3EZRA 2UZNA 3G6GA 2YZAA 3WIKA 5CF5A 2XB7A 4XV3A 3U87A 2XALA 5BVEA 3LM0A 2BTRA 4WG5A 4GFGA 4GH2A 5HG7A 4ERKA 3KULA 1KE6A 3KL8A 3PTGA 3O8UA 2ZV7A 3PP1A 4YJQA 3VS7A 5IQHA 3RINA 5D9HA 3OF0A 1PHKA 2XJ1A 4ENXA 2A0CX 4L8MA 3W2SA 3HGKA 4RX5A 2NNWB 1PXMA 2IZUA 3NRMA 5KE0A 4AGCA 3QALE 4UZDA 1RJBA 4IWDA 5F1ZA 3Q04A 4IB3A 4CZYB 1M7NA 2GNFA 4X3FB 3OXIA 3OUNB 3L8XA 1JQHA 2C47A 3OCSA 4FICA 4JX3A 4O22A 4ANBA 3N4UA 2CNQA 4TYIA 4ITJA 1WFCA 2XRUA 5JFWA 4XRLA 4ITIA 3IW7A 4U5JA 3AT2A 5HX6A 3CXWA 3F2RA 4PMMA 3LM5A 1JNKA 1XQZA 3FY0A 3LLAA 1NW1A 2ITVA 4AG8A 4U97A 3S0OA 4W4YA 3R9DA 4YJPA 5ETCA 4KBKA 4GS6A 4ZY6A 3RZBA 4AT5A 2WU6A 2XMYA 3W33A 4QNAA 4TYEA 2GQGA 1VR2A 4FBXA 3U54A 3THBA 2NP8A 2YIRA 4FRFA 2PE2A 2O3PA 5JQ8A 3MWUA 5LVNA 3R63A 4FTUA 3ENMA 4IB0A 4MBLA 3E8NA 3RMFA 3BYOA 4E4LA 5HZNA 4KIKB 2BRNA 1UWJA 3K5UA 5HE0A 3VHKA 3CGOA 4GV1A 3W32A 3ZZEA 3D7TA 1H01A 2W7XA 1JKLA 2OGVA 3HKOA 5LXMA 4LMUA 1W2DA 3W2QA 4O4DA 1OIYA 3QCYA 4BCQA 1OIRA 3LCSA 4L01A 2JDRA 2W1CA 3AT3A 4N4SA 2VWXA 3Q4TA 4R7BA 1XKKA 4NL0A 4R1VA 1OKYA 3PP0A 5HE1A 4GYIA 5EHOA 2ETMA 4BDAA 3KXHA 2PMLX 3I4BA 3LCTA 3IOPA 3LFFA 4IB5A 3EQRA 4U41A 5CAQA 3EFLA 4I93A 4MX9A 3Q6UA 3R7EA 1XBBA 4G34A 3ALOA 5L2QA 2YM4A 1Q62A 1WBTA 2C5VA 2X4ZA 3LJ0A 1B38A 2BKKA 2XIRA 1ZY4A 3CSVA 4EH6A 3NIEA 2RFDA 2VTRA 4IAFA 3UDTA 5AFVA 4AOIA 1JSUA 2ZM3A 3KCKA 3PG3A 4RIWB 2PVKA 4CKJA 5IH5A 3OVVA 5AA8A 3VVHA 1KE8A 3W2OA 4EC8A 4H39A 2GHLA 1PF8A 1R0EA 3QD3A 4BC6A 5CI6A 2PZRA 3EN4A 5I9ZA 4EOLA 1ZOHA 3VUIA 4FNYA 3DLSA 3LZBA 3U6HA 4YLLA 5AX3A 4ANLA 2B4SB 3F88A 4RX7A 4AFJA 1H8FA 1JLUE 5AR8A 5HBHA 3OROA 2Z7RA 4QMOA 4O1PA 4L67A 4AS0A 4KS7A 4DH8A 3KN6A 5HIEA 3MFSA 1QPCA 2O63A 2OZOA 3G15A 2ZB0A 4YMJA 5FXRA 1BYGA 4CFNA 3KFAA 3HMIA 2WTIA 4I1ZA 3P23A 2YM5A 4JAJA 4M69A 1J91A 4OT5A 4AACA 4NCTA 3DXPA 5E7RA 3ODZX 4PTCA 1HCLA 3VRYA 4FSWA 3TTJA 3HRCA 3OW4A 4AZWA 4BDJA 1PXLA 2BMCA 5J87A 3LMHA 2ETRA 3H9FA 3MI9A 1H08A 3W16A 3I6WA 3CD8A 1IAJA 2UW6A 4IAKA 3SOCA 4XBRA 2X0OA 4D1XA 1G3NA 1QPJA 4JIKA 5C8MA 2YIWA 4RFZA 4NIFA 5D41A 4QQJA 1W83A 2PVRA 2HCKA 3I81A 2W1FA 4O7WA 4EI4A 5IG1A 3ERKA 1A06A 3JXWA 3OEZA 4WNPA 4ZSLA 4D0WA 2GPHA 2GNHA 3FLZA 3QRIA 4HGSA 4PMPA 3FBVA 4LGDA 4RSSA 3QQGA 5DG5A 5DT0A 3VS3A 3G2FA 4FT7A 4XG4A 4JQ8A 3VBWA 2V5QA 5CALA 3U9CA 2NO3A 3R7UA 1Y6BA 2IZSA 2PE0A 4ANQA 4ZJIA 2WMVA 4QMSA 4QP9A 3UQCA 3MPAA 3IG7A 2F7XE 4GK3A 3PWYA 5KUPA 2WMSA 3PG1A 3RZFA 2W0JA 3WF7A 2F57A 2VX0A 2X7GA 4XMOA 3C4XA 4R6VA 3NUPA 1BI8A 2O5KA 4IJPA 4CRSA 2PSQA 1TKIA 4IAYA 1G8JA 3DBDA 2CHLA 4DA5A 2OJJA 4FL2A 3RCDA 4FEXA 1YOLA 2QOLA 3DA6A 5BUEA 1J1CA 2H34A 2X6DA 4AA4A 1RDQE 4XYFA 2YWPA 4TYHA 4O2ZA 3D5VA 5CU3A 5HNGA 1U54A 3DB8A 1DI8A 2O64A 4FEWA 4QDEA 1LR4A 3AC5A 3K3JA 4QP7A 3BZ3A 5E8SA 4XV1A 3QD2B 2XM9A 3DBQA 3E93A 2CGUA 2J7TA 2R3KA 2Y8OA 4DFXE 2JIVA 2OF2A 1BMKA 3AMBA 3COIA 3QLFA 5EI2A 4C38A 5I9VA 4DTAA 2OICA 4N6ZA 4D4RA 4IX3A 2XUUA 3P7CA 3OFMA 4GFMA 4ZLZA 1XH8A 4RJ3A 5IMXA 2XIYA 3EN5A 3QQUA 4DFZE 4ZY5A 1FBNA 4HZRA 5J1VA 3TV6A 1VEBA 2GS7A 3OXTA 5M07A 3A4PA 1XMMA 2OXYA 5DEYA 2X81A 4ZSGA 2UZEA 3ATSA 3F5UA 2YDIA 3QAME 3F82A 4Z3VA 1W98A 3Q2JA 4IDVA 3PIZA 3EOCA 2VTTA 3BLQA 5BVDA 1WZYA 2HW6A 3R7VA 4B8MA 1WBVA 1ZYDA 4IMYA 2IVUA 1B39A 4OTWA 3DK3A 3NUNA 1CTPE 4D2WA 2XK7A 2ESMA 2C1BA 5KNJA 3E7OA 3QTWA 4IWQA 1QCFA 4HPTE 3GU8A 2WMAA 5I4NA 2PULA 4IM0A 2ZMCA 3U6JA 4JLCA 3UPXA 5AV4A 4CKRA 2VX1A 5IEYA 4LGGA 4CKIA 4QP3A 3A4OX 2IWIA 1M2RA 3NCZA 4JG8A 3CBLA 5FD2A 3T9TA 2QURA 2WMRA 1XBCA 3H0YA 3QZHA 4O82A 2XK4A 2VTNA 2ZOQA 3TKUA 4FK6A 2YDJA 2C3KA 4ACGA 4FKTA 4DG3E 3NMUF 4GRBA 5C26A 3PFYA 3A99A 4BDIA 3BLHA 3ZRKA 3F3VA 5J7HA 2C30A 3MJ2A 4U79A 1BL6A 4YNOA 3QQHA 5E8UA 4QYGA 4JJRA 3R9HA 4UY9A 3VIDA 4QQ5A 4O0WA 4I6QA 4XJ0A 1U46A 3H30A 3NW7A 3Q9YA 3BPRA 2X8DA 2ITTA 5FEEA 1WBOA 4NEUA 1Z9XA 3TWJA 5CQWA 5IF1A 3CJFA 4O0UA 2LAVA 2UVXA 3E64A 3QKLA 4RA5A 3DGKA 4CQEA 2ZYBA 1AD5A 5AUWA 1O9UA 4FG9A 4JIAA 2AYPA 2R3MA 2W05A 5H8GA 4AT4A 3ZBFA 5HBJA 5DOSA 5H3QA 3BYMA 2WXVA 5FP6A 4FV5A 4J98A 4RGJA 1LEZA 4FT9A 4XNEA 4EH2A 2FSTX 2QC6A 3IW8A 4QNYA 4QPMA 3HLLA 4JDHA 5CSWA 1SM2A 4KINA 3KK9A 3DTWA 2OFUA 4RC4A 4AGUA 1H1QA 3PVGA 1Q61A 4NW6A 4FKOA 3HV3A 4AZEA 2FH9A 3NR9A 3GQLA 4O0RA 4EK6A 3ATTA 2I0VA 4NJ3A 5EQEA 3BBTB 3KK8A 3EFKA 4BHNA 5ITAA 4FIFA 2QOIA 4E7WA 1CMKE 1GZNA 3KY2A 4UMTA 3RHXA 4G31A 3UE4A 3PLSA 2JC6A 3FMNA 4O7VA 3MV5A 4L42A 1URCA 2A27A 4PMSA 3ZSIA 2QKRA 2VTMA 3CTQA 3PXZA 1ZYSA 3HYHA 3VQHA 5E1SA 3I5NA 1CSNA 2IO6A 1PW2A 4ASDA 4HVIA 2BDWA 3TUDA 1FVTA 2IEWA 3KF4A 3NYXA 1YHWA 3Q6WA 3QTUA 2ITZA 2VWIA 4EONA 3F5PA 4ANNA 4EOOA 2WEVA 2OJIA 3CQUA 3VNTA 3UIUA 3I79A 4AXEA 5I0BA 3C9WA 4GG5A 4BDEA 5A14A 3PRIA 2BHEA 4BI2A 5CF6A 1JOWB 3QZGA 2FB8A 2E9NA 5JK3A 3KGAA 3R2BA 4E4XA 4IX5A 2R7BA 1JBPE 4O0YA 4GIHA 5C1QB 4BCNA 1ZWSA 3DKOA 4R7HA 2Z02A 3FMEA 3M1SA 4ZSJA 1TVOA 1MP8A 3Q53A 4HCVA 2BRGA 4ASZA 3VN9A 3FZRA 4NTSA 4ASXA 2B9FA 2G9XA 3E3PA 4F63A 2PUUA 1WAKA 5D7VA 5IH6A 3LFCA 2C6LA 3BQCA 4FV6A 3BI6A 3UZRA 4LG4A 3G5DA 2R2PA 2XAOA 3F5GA 4CV9A 5T6KA 2HXQA 3BV3A 3OWKA 4R3CA 4BCGA 2WMTA 3UIXA 4CYIA 2YJSA 3CPBA 2E9VA 3LOKA 4NM0A 1W2CA 2GTNA 3C4WA 3M42A 5HG8A 4YJRA 3IGGA 5BMMA 1F3MC 2RGPA 2J2IB 3C13A 2QR7A 4FKGA 4MXCA 3VS5A 4ACMA 4O81A 2A2AA 2E2BA 2XNNA 4FIHA 4DEGA 3DAKA 1ZYLA 1ZMWA 3G90X 4B0GA 3MH2A 4A9SA 4PTGA 3PA4A 3O8TA 4MVFA 2AC3A 4RX8A 4XP0A 4EEVA 3RAHA 4AZTA 2VO7A 3VUHA 2BROA 2ZV8A 4FKUA 4DC2A 3LFNA 2OJGA 3F7ZA 3K3IA 4YC6A 3BCEA 4BKZA 4C4EA 1H4LA 4MQ2A 3I7BA 2GU8A 4L3PA 4K0YA 4AW2A 4U8ZA 2BIYA 3PVUA 4X2JA 3C0HA 3NNWA 4DEIA 4E3CA 2ERKA 3KKVA 4M97A 3LJ1A 4MXXA 2ZFYA 5JRQA 5CTPA 2VUWA 5IPJA 4AXCA 1PXJA 1UNHA 3F3UA 4P7EA 4XS2A 1ZYCA 5ANEA 4ZS0A 2E9OA 3OEFX 2Y9QA 1R0PA 4LGHA 3UC4A 4BGGA 4YTFA 3P0MA 4EH8A 4X6QC 3PXRA 4WHZA 3MPTA 1WBWA 2CPKE 3MPMA 4Q2AA 3S3IA 4Y5QA 4CNHA 4B99A 4MNEA 2UZLA 4LRMA 4RG0A 3HUBA 2WTDA 3D14A 5CSXA 3OWPA 4S30A 1OPLA 3FSKA 2X9FA 4XG6A 5CEOA 5EW9A 4F7JA 2PZIA 1MRYA 2Z7LA 2H9VA 4PF4A 2NRUA 4BTMA 4TKSA 5M56A 2C5XA 4TNDA 4UMQA 3FMHA 3GC8A 1OGYA 4K33A 3MYGA 2GQSA 5LARA 5IEXA 5HG5A 2XBAA 3ZM4A 2WFYA 5EOLA 4WOVA 4P2KA 2W99B 3R8ZA 4FV0A 4C34A 5J5SA 4QTCA 3R04A 4BBEA 3KXNA 3ZS5A 3FL4A 5FXSA 3RAIA 4C35A 4JG6A 3VO3A 3JY0A 4RBLA 3OHTA 2VGOA 3HV7A 5CVGA 3E87A 4FV2A 4BIDA 4D4VA 4W8DA 5HTCA 1YKRA 2HENA 3PIYA 3Q5ZA 5GJDA 3CE3A 3PY0A 3FEGA 1J7LA 2YEXA 1YW2A 4O7ZA 3MJ1A 5HOAA 2IN6A 3WE4A 4MD8E 4WBOA 4AZSA 3MA3A 4BZOA 3F2AA 2J51A 4BZDA 4FNZA 4I20A 1FGIA 2QI8A 3VJOA 4Z55A 5IQGA 3KRLA 5DYJA 3COMA 3PDTA 5F95A 2WOTA 5ICPA 1UU8A 2C6KA 2QOQA 1OKVA 3BGQA 4YBJA 3U55A 3R22A 4RFMA 1LUFA 5E8ZA 3PE2A 1JPAA 4RJ8A 3LIJA 4W4WA 3OCGA 4XLIA 3AGLA 4RFYA 4FF8A 4MYGA 1K9AA 4X6RA 3UNJA 4DCAA 5BYLA 3CTHA 3ZBXA 4XLVA 3QXOA 2PZPA 4IZAA 3UPZA 2R3GA 3R0TA 4UYNA 3RGFA 3P7BA 3ZFXA 4O7TA 1M2QA 1PXOA 3FHRA 3VUDA 4AFEA 2JKQA 3BBWA 3AOXA 4II5A 4DFLA 4WO5A 1ZMVA 3GOKA 4X2FA 5ANOA 1SNUA 2J6MA 5KO1A 4EQMA 4PNIA 4UYAA 2WZJA 2GTMA 2DUVA 5D10A 4ZZOA 5K9IA 3Q3BA 5CF4A 2WTKB 4EOQA 5KX8A 3HA6A 5ANJA 5AP6A 1IRKA 3WF9A 3MDYA 4RPVA 4BDCA 1DM2A 4QMLA 2YACA 3MS9A 4J99A 4IANA 5JFXA 2C0OA 3FZPA 2XEZA 5ETAA 2WQEA 2W1HA 4D4YA 3RALA 4CCBA 5ETIA 4O7SA 3FY2A 2WQMA 4L45A 3QCSA 3VS4A 2PYWA 5HX8A 1ZOGA 3D0EA 4BICA 3LQ3A 3EQPA 3ZDIA 4CG9A 5ACBC 3OTVA 5DGZA 5A3XA 4GMYA 3FL5A 4U45A 3OW3A 4QDVA 2WTJA 3FLNC 4UALA 4Q9ZA 4FUXA 4G1WA 3R8MA 2YZLA 4DHJA 4G17A 4N57A 4I6FA 2GFSA 2HWPA 2PMNX 3IPHA 3KCFA 3KIOC 2AQXA 2JIUA 3AGMA 2UW4A 2HW7A 4BWPA 3IW4A 4OTIA 4BDDA 1IASA 3D7ZA 1W7HA 4BCHA 1YOJA 4LRKA 4BBMA 2AC5A 2X7OA 5GHVA 3R7YA 3HDNA 4BDKA 3P5KA 5IQBA 4OTFA 4GKIA 3A7FA 2BAKA 3R1NA 3VWAA 1WVWA 1O6KA 2J9MA 4FA2A 2LGCA 2ZMDA 4FV9A 3RAKA 1YRPA 2WMXA 3ORTA 5E4HA 1JKTA 3GVUA 3LVPA 4DEEA 1X8BA 5HORA 3IGOA 5A6OA 3ROCA 3FMLA 4FMQA 4IEBA 4BIEA 4FZAB 1AQ1A 3P9JA 5EK7A 3PY1A 4YPDA 4WUNA 4E4NA 3R8PA 3OWJA 5FEDA 2HIWA 4RRVA 1F5QA 5J8IA 5L8LA 4GU6A 3UOKA 4KUJA 5BMSA 4O7RA 2W1DA 4IX4A 2VRXA 5EM6A 2Z8CA 4FUYA 3UGCA 4EOKA 3SXSA 4DLIA 4KBCA 3UMWA 4FEUA 5JZJA 3FZOA 3UP2A 4JDJA 1V0BA 3HA8A 4HGTA 2GHGA 4IZ7A 3TNHA 4HOKA 2B53A 1I09A 3ET7A 4NTTA 2VTAA 4XRJA 3NZ0A 4BWKA 3FC1X 3GT8A 3UNZA 2YWVA 1ATPE 1PYXA 1ZMUA 2IPXA 4AN3A 4LV7A 1YDSE 4O2PA 1REJA 2HZ0A 3N9XA 2WELA 4I6BA 4ONAA 3LLTA 3QBNA 4HYSA 4TWCA 3PE1A 2XIXA 5FTGA 2W17A 1Q4LA 3NYNA 5C9CA 3W0QA 5DMZA 3L8PA 4JBQA 4OT6A 3S95A 4YC3A 3IK3A 4C7TA 5AV1A 5KMOA 3LQ5A 3I7CA 3SLSA 5CAUA 3ZM9A 1OL6A 3IO7A 3Q4CA 4IE9A 2QLQA 4JNWA 4EYJA 2IVVA 3A8XA 3ORLA 4FEQA 5C03A 3HUCA 4F0GA 2B55A 5IUIA 5HO6A 5BYYA 2X9EA 3RCJA 3WZDA 3U4UA 5AUTA 4NK9A 4QD6A 3ZO1A 4A4OA 4EJNA 2FVDA 3F3ZA 3TDVA 4AZFA 3MB6A 2IVTA 3R21A 3OWLA 4QMUA 4A4LA 5M44A 4G3CA 4L44A 4H58A 2ZM4A 4RWJA 3K2LA 2PMIA 4G6NA 3HEGA 4O7YA 3BYSA 3EJ1A 4O38A 4GKHA 4X7QA 4WG3A 2EWAA 5M4CA 4MH7A 4U44A 3MFTA 2I0EA 3QX2A 2QU6A 2O65A 4XG7A 5LVMA 4QT1A 4RIXB 2JGZA 2XKCA 4OUCA 1GIIA 4P90A 5EW3A 4GVAA 1XHAA 3EL8A 3IDBA 4CEGA 4ZLYA 4BZNA 3BU5A 4EH5A 4N70A 2F7EE 2CCHA 1SVGA 3RNIA 2P2IA 3R73A 5JZNA 1QPEA 4CFWA 3HL7A 1JVPP 4RIOA 4L46A 4X3FC 2CKQA 5AUZA 3VUKA 3SKCA 4ZMEA 4A9UA 3TZMA 4CFUA 5JKGA 4KB8A 4G3EA 3V5PA 1SVHA 5DLSA 2BZHB 4XG9A 1OL2A 5HVJA 3UMXA 2XKEA 1PMNA 4Y5HA 4I5HA 3MSSA 4TXCA 5AP5A 1Q41A 5AR4A 3NW5A 4MBJA 5D11A 5BPYA 3FLQA 3GCSA 3BIZA 4OBOA 1P5EA 4FX3A 2B1PA 2GNLA 2QO2A 4R7IA 4EQCA 2C6MA 3NIZA 3ACJA 4IB1A 4OLIA 1L8TA 3SC1A 1ZLTA 4LL0A 3ZU7A 4ZEGA 3QRJA 3FMDA 5B0XA 4AN9A 2UV2A 4X3FA 1GIJA 5LMAA 3PPKA 1UU9A 5CI7A 4C0TA 4XV9A 3RNYA 2QCSA 4BCPA 4HVDA 3QL8A 5FG8A 3VHEA 4AAYA 1GIHA 2C3LA 4BWXA 2QNJA 4TPTA 5HD4A 4F1TA 3NNVA 2NYAA 4UX9A 4KWPA 2AEGA 2PK9A 4AOJA 2X6EA 2R3FA 2XCHA 3DDQA 4V05A 5D7AA 4NT4A 5HE3A 5AEPA 2WTCA 3AC2A 3VULA 4QP6A 4HNFA 1PXIA 2PVMA 4RJ6A 3UOHA 4BKYA 4BCOA 3WARA 4P5QA 5BX0A 3SGCA 2OKRA 3KF7A 4JBPA 2IJMA 4U40A 4E6AA 1IAHA 3NVKI 2VWZA 5FBNC 2YIQA 5DRDA 2Q83A 3A7IA 4E5AX 2HWOA 2Z7QA 2A19B 2JKOA 3ZO2A 1YXVA 2BDFA 2C6EA 4BBFA 1YXUA 3QQKA 1WBSA 4K11A 4DGOA 3NUSA 4OTGA 3EKNA 4RVTA 4BCFA 4CTBA 4ASEA 2EUFB 2WGJA 4F1MA 4Z7GA 3U8WA 2OXDA 4PPCA 4PP7A 3AD5A 4K18A 4ZTSA 4A9YA 5AUUA 1ZRZA 5KMIA 2OF4A 4L7FA 4S2ZA 5K0KA 3AC3A 3LFSA 3MIAA 4DH3A 2EVAA 5CEPA 3BHUA 1IG1A 1PMVA 5KHXA 5FP5A 2ERZE 3QTQA 3H10A 2IZRA 4M14A 4MHAA 4C2WA 3TUCA 2H8HA 3JPVA 3EH9A 1Q8UA 3QUDA 4RVMA 2JBPA 4IH8A 3R7GA 3PRFA 4M13A 3QZFA 3NUUA 1TQPA 2IW9A 2CMWA 3ANRA 4KSQA 1Q24A 3WZKA 3HMPA 1OBDA 4XOZA 4E6QA 1FMKA 5CZHA 1GZKA 3QRUA 4YBKA 4LOOA 5F20A 4DE4A 3BLAA 2ETKA 1ZZLA 2BDJA 3ACKA 3FYKX 3H9RA 4IDTA 4RC3A 4RIWA 4YJUA 3P08A 5H9BA 3R30A 3MY0A 2XKFA 3GU6A 4MBIA 3MH1A 3FQEA 4HGLA 2CKOA 4IADA 3ETAA 4WRGA 5M55A 5L2TA 1TQMA 4O4EA 5FBOA 5HNBA 3HAMA 4QOXA 4C4JA 4LQMA 2R3OA 2VO6A 4ZAUA 4U3YA 3FPQA 2O0UA 4LYNA 4YUQA 2JDOA 3ODYX 3GQIA 5EYMA 2WB8A 3CLYA 2OJ9A 2V7AA 4C58A 4JDKA 3HMNA 4I5MA 3I0OA 2ZB1A 4M69B 3SV0A 3TJCA 4BVUA 3KMMA 3FYJX 2WIPA 1CDKA 3DV3A 4LV5A 5JRSA 3FI8A 4DN5A 5BVFA 3TNIA 3OXZA 4NKAA 3EMGA 3GCVA 1YOMA 1IR3A 4QMPA 4YZMA 3ZC6A 4ALWA 3F9NA 4USDA 3BGPA 3COKA 3PA3A 2C69A 2J0MB 3IONA 4C3FA 3AKJA 1ZAOA 3LE6A 4DHIB 3MN3A 4BY9E 3KB7A 4EHGA 4YGAA 2XYUA 3FZTA 1OZ1A 2QHMA 3A7GA 3PXQA 4D58A 3IKAA 3QA8A 4FC0A 3RK7A 4DBNA 2QR8A 4PNKA 4IXPA 3MH0A 5K4JA 1KSWA 5HE2A 5A54A 1MQ4A 3R8LA 3LFEA 4M7IA 3FXWA 3NDMA 3CQWA 3VBTA 3F2NA 4YO6A 2REIA 1NVRA 1UVRA 2IVSA 2XNMA 3FSFA 3OCTA 3DQWA 2ACXA 1Z57A 4G5JA 3WOWA 3PWDA 4H3BA 3OG7A 4WSQA 5JN2A 2OIDA 3W1FA 1OECA 1YHVA 5EDPA 3NFGB 3QRKA 2VO3A 2WQOA 2YCSA 4G6LA 3V8WA 1J3HA 3LMGA 5AR7A 5KKRB 4BYJA 4TW9A 4E93A 4M12A 2PTKA 4BTJA 3V5QA 4W8EA 1YWRA 3ZUUA 3CGFA 4NKSA 2Q0NA 4WA9A 4QYYA 4A9RA 1PJKA 3P4KA 4F7SA 5HCXA 4PTEA 4RVLA 2YHVA 3H3CA 3QA0A 3C4EA 5A4CA 3GB2A 1I44A 4UV0A 5FTOA 3G0EA 3HP5A 3SRVB 4GT5A 4NM7A 3SOAA 1PKDA 5FDPA 2XK6A 3RI1A 4L00A 4GSBA 5AM6A 2QOHA 5JT2A 3NGAA 2BZJA 3R83A 1U54B 3V6RA 3H9OA 3V51A 3FZSA 5T68A 3V8TA 4ZXTA 5DHJA 4QMQA 3W0PA 3P7AA 2R3JA 3G33A 3SQQA 4OTRA 5CAPA 2KTYA 1BL7A 4D5KA 4O0XA 2I0YA 3LXLA 4MXOA 4EHVA 4FK3A 5AV0A 2BPMA 2R3QA 3E92A 4RWKA 5J95A 2WD1A 4D4SA 4X21A 4RX9A 4TWPA 3QX4A 4BFMA 4BDGA 3KMUA 4BRXA 3FE3A 3LFDA 5J1WA 5KZ0A 4KRDA 3UZPA 1OI9A 4EL9A 3R1QA 4HYHA 2XJ2A 2W9FB 3D2IA 3Q9ZA 3GC0A 4AT3A 4UMUA 5HO7A 2XRWA 3PJ3A 3R01A 5DPVA 1GZ8A 3R1YA 3O7LB 4RQVA 2A98A 4UB7A 3O8PA 1PRYA 4IVAA 1XMLA 2J4ZA 5GIOE 5E8VA 4M3QA 2ITPA 5DBXA 2XK3A 2W5HA 3T3UA 4J97A 4ZMFA 2QOKA 4ZOGA 5CWZA 4XG8A 4EOSA 5CSHA 4MK0A 2DYLA 5AWMA 4H1JA 2BTSA 2YERA 2VX3A 3PFQA 4IAAA 3ZLYA 1TFFA 3V6SA 2X1NA 4JQEA 5D12A 3TACA 3T9IA 2JIIA 1XH9A 3DDPA 3ZLSA 4CMOA 4CLIA 4QQTA 2V7OA 2BAJA 2F2UA 4EH7A 2RL5A 4M68A 5HLPA 4I23A 2VTOA 5KMKA 1OBGA