4FYNA

Crystal structure of spleen tyrosine kinase complexed with 3-(8-{4-[ethyl-(2-hydroxy-ethyl)-amino]-phenylamino}-imidazo[1,2-a]pyrazin-5-yl)-phenol
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
277
structure length
267
Chain Sequence
VYLDRKLLTLEDKELGSNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Rational design of highly selective spleen tyrosine kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 267
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fynA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fynA01
3RM7A 3G6GA 3DZQA 4U79A 2X6DA 2F7ZE 2UW5A 2ZM1A 3R9HA 3AC5A 3F5XA 3NYXA 3OY3A 3LFDA 1CTPE 3DNDA 4IACA 3I4BA 5JQ8A 3PXQA 3TNWA 2R3GA 1Z57A 5HEZA 5AUUA 5IA2A 4R3RA 4R6VA 5H8EA 5H3QA 4C4FA 1IA8A 4AGDA 3NEWA 3P86A 4DG0E 3P23A 3VUMA 3LXNA 4PTGA 3MIAA 3E8DA 5A9UA 4Y95A 4YURA 1BX6A 1JKTA 3QTRA 5HVYA 2XK3A 4F4PA 1JBPE 3D0EA 5JFSA 2PMOX 2WQEA 3COIA 4QYEA 4EC8A 1FBNA 4H36A 5KKRC 2WO6A 5HE2A 3PWDA 3DBFA 4MBIA 4A4XA 3NAXA 1VYZA 1LEZA 2P3GX 1ZARA 3FLSA 3NX8A 4G6LA 2A27A 3V5WA 5E4HA 4EWHA 3RCJA 2YCFA 1YXTA 4XEYA 4W4WA 3OF0A 4J71A 1GIJA 4XLIA 3V8TA 3V5JA 2BRNA 2VTMA 3MBLA 5DOSA 4BZNA 1RQQA 1MRYA 4KINA 4NW5A 2HK5A 4MWIA 2OIBA 4RJ7A 4U80A 2C6LA 4EH5A 3LM5A 2NP8A 3PRFA 1UNHA 3QD4A 1V1KA 2QOKA 3QKKA 5E8WA 3ZDIA 3FI2A 2VTHA 1BKXA 2NO3A 2GNIA 4EZ7A 4LFIA 3EH9A 3QQKA 4JX3A 3VIDA 2RFEA 3G2FA 4IANA 3IW6A 4TWPA 4EZ3A 3RNIA 4QP3A 3TDWA 1NY3A 3TIZA 5EQPA 4AT3A 3DV3A 3ENMA 3Q9XA 3KCFA 3OVVA 3EIDA 3F82A 4YLJA 2WHBA 2CGXA 1OIYA 4A9TA 3TG1A 3TTIA 2BMCA 4PNIA 1Y6AA 5M44A 2QOLA 3R04A 5CEPA 3SGCA 4N0SA 3A2CA 1YI6A 4CFVA 5FEQA 2WIHA 3CY2A 2IG7A 4WO5A 3QALE 5E92A 2Y4PA 2X81A 3SOCA 2CKQA 3AG9A 2XS0A 5G6VA 5CNNA 3ZZWA 2W4KA 5HE0A 5AJQA 3LZBA 3QX2A 4DEHA 3VRZA 2IPXA 5A6NA 3HMPA 1XR1A 3NRMA 4RC2A 4FGBA 4HVDA 4LYNA 1FVTA 3E88A 2GPHA 3DCVA 3OXIA 1PXMA 4D1ZA 4P2KA 3B8RA 3TEIA 2I0HA 3Q53A 4P90A 4QTCA 1VZOA 4TKSA 2GHMA 4ZXTA 2BDFA 3DBQA 3LFBA 5JMSA 5I5ZA 3W2QA 4J96A 4D9UA 3RP9A 4GFMA 4XG7A 2EXCX 3UIMA 3TXOA 4OUCA 5M55A 3HV5A 3U8WA 2W9FB 2QONA 3LLTA 5JSMA 4XNEA 4CYJA 4BYJA 5FUTA 4UMRA 4FZAB 3QA8A 5C8NA 3CY3A 5ACKA 4C2WA 4FT5A 2PE1A 3HEGA 1YRPA 4FV7A 3PWYA 2W96B 3C5UA 2XYUA 4M84A 4HYIA 3BV3A 4LV8A 5H8GA 4B99A 4HGLA 2CGWA 3BE9A 2R64A 4DINA 1YHVA 1RJBA 1BMKA 4AS0A 4F08A 4V01A 3H30A 2UW3A 4BCMA 5D7VA 2J50A 4RJ4A 5AADA 1J1BA 4EI4A 5AAGA 3O96A 3FQSA 3VUGA 2WGJA 5M06A 2V55A 2OG8A 4X2FA 4OAUC 2Q0NA 3D15A 2YM8A 2IZRA 2E9OA 2HZ4A 1H07A 1GAGA 3UG2A 2UVZA 2EXEA 3QTIA 4FIEA 4X2GA 4YP8A 2QNJA 1DM2A 3IECA 3M1SA 4FSWA 4L3JA 1FPUA 4QD6A 4EOMA 2XP2A 3O7LD 4OTGA 4BRXA 5A14A 3DBDA 1OUKA 3GU6A 1WAKA 4FIHA 2OW3A 3FC2A 4JG7A 4LGHA 4L3PA 4QMPA 5GZ8A 1H24A 4EOQA 3H0YA 3FL5A 1PXIA 2XIZA 3UOJA 1KE6A 3QUDA 4GK3A 3DJ7A 3KRJA 4IADA 3DPKA 4GCJA 3R8UA 2C4GA 4B6LA 4O0VA 4DBNA 3DQWA 3RWQA 3AC1A 2BVAA 3DJ5A 4IWPA 5E8SA 3IONA 2FSTX 2JD5A 4QP1A 3CIKA 3ZEWA 2R3PA 2YFXA 2QHMA 4XV2A 3BWJA 5ANGA 1J91A 5AUTA 3R7YA 1YKRA 3HV3A 4NL0A 4GK2A 1FGKA 1L8TA 3LFNA 3RVGA 4IVAA 4KBCA 1LUFA 3KXNA 4KKHA 4W4XA 1YOJA 1HCKA 2CKEA 3QUPA 4NU1A 4G5JA 4M7IA 4FA2A 3RJCA 4EOLA 5BYLA 4GFOA 3TKUA 4TZRA 3W55A 5EM5A 4FNZA 1IG1A 2B9IA 5IH4A 4MD7E 3V04A 2XYNA 2YACA 4GUBA 5EDRA 2YN8A 3CLYA 5EHYA 5A4QA 2V22A 4D4RA 4BTFA 2VTNA 3R02A 3MH2A 4IAYA 3JVSA 2VWUA 4G3GA 4ALUA 3VWAA 4R7IA 1QPJA 1CDKA 2VTTA 2ZYBA 2W7XA 5DR9A 3SG8A 4RIYA 3I79A 5HE1A 4R8QA 3A7HA 4FK6A 4AA5A 1JKKA 2QC6A 3OFMA 5C1QB 2ITQA 2CN5A 2F2UA 5EI8A 5I4NA 5DR6A 5AX3A 4F7SA 4C4EA 4DEIA 4EYJA 3V5TA 1Q8UA 4BWXA 5A3XA 3W18A 3MB6A 5FWKK 2G2IA 4AW0A 4PNKA 5BQ0A 4HYSA 4G3FA 5CAOA 4FSYA 3F5GA 4XS2A 5LXMA 3WI6A 4USDA 2GHLA 1U46A 2R2PA 2X8DA 3GCQA 4YTIA 5HD4A 4G16A 4KIQA 4L45A 4QQJA 4O84A 3U6HA 2IVUA 4MD8E 5FG8A 3K3JA 3MY1A 4LRKA 5BVEA 5FTGA 4F9BA 3O71A 3HAVA 5CSHA 4DH7A 4ENYA 4TXCA 4AWIA 5K5NA 2OSCA 2YAKA 3BHTA 3WF5A 4DE4A 4MX9A 2YCQA 4O7WA 3QRKA 2G01A 4A9YA 1V0BA 2BFXA 1KSWA 5CEKA 1YOLA 3EZRA 3HV6A 4RJ6A 5L4QA 5IKWA 4OTDA 3SOAA 3ORNA 4D2VA 3E93A 5IQEA 4X7QA 5ETCA 3RPOA 3EFJA 4IH8A 3EQCA 4BDAA 4IC8A 3HX4A 4D55A 2V7OA 4IB0A 1REJA 2VTIA 2FO0A 3MH0A 5K0XA 4FGRA 4F99A 4ANLA 2FSLX 4F6UA 4BI0A 5CANA 3U9NA 3NS9A 2Z2WA 4F0GA 3RNYA 4ZMEA 4LGDA 3KN6A 3ORLA 4XP2A 3OCTA 3D5UA 3FMEA 3VW8A 2OZAB 2J9MA 4XRJA 5CS6A 4AZTA 1KE5A 4YJSA 3BYMA 4MNFA 5GZAA 4FTRA 3Q4ZA 4NYEA 3GUBA 1BLXA 2XBAA 4BWPA 3GC8A 4NH1A 3UE4A 4BDGA 4CT1A 2YJRA 2B7AA 1GIIA 4FI1A 3EJ1A 2YA9A 3NSZA 3OUKA 1Q5KA 5I3OA 2XK9A 3F3ZA 3PFQA 3PXZA 3SV0A 4B4LA 4ZMFA 4LOPA 3D7ZA 3ZFMA 3DBEA 1NVSA 3NIEA 5CEQA 3POOA 4ACDA 4ANOA 4D1SA 4O81A 2RG5A 2VX0A 4L7FA 2CJMA 3S00A 2W1DA 2GFCA 4GYGA 4YMJA 2ZMDA 3KULB 3TCPA 5CF4A 4MXAA 4EOSA 3HDNA 5IPJA 3QZGA 3SA0A 4O7LA 4DCAA 2B4SB 4K8AA 2W1IA 5HVJA 4JRNA 5DRBA 2VNYA 3FSKA 4IX3A 4UYAA 2NRUA 4WOVA 2WXVA 4UXQA 1SVGA 5BVKA 3MA3A 2YIWA 4NJDA 5BVFA 3SC1A 4FOBA 4RGJA 4HCUA 4FSTA 4FV4A 4EJNA 3MFTA 2G2FA 5GNKA 4HZRA 4JJRA 2OLCA 3RAIA 5E8YA 2XMYA 4QMXA 5CX9A 4F7NA 2X0GA 5DT0A 3R83A 2XEZA 3RZFA 1PKGA 3TWJA 3POZA 4BTMA 3Q9ZA 3NWWA 2B55A 3AGLA 4RX9A 4EC9A 4U8ZA 5ANJA 4QTDA 1Y8GA 1OKVA 4IW0A 4QMSA 4ZJJA 3D5XA 3WF9A 2R3IA 3QRIA 5C03A 4OTQA 4AG8A 3K5UA 2X8EA 4ZTMA 4F9YA 3ZFXA 3FMJA 2PVHA 2YEXA 5K0KA 5B2MA 1UKHA 2VTAA 5HTCA 5CAPA 4WSYA 4O83A 2NRYA 2A4LA 2JIUA 3SAYA 3RMFA 1H8FA 2A19B 4FKLA 2QKWB 3RI1A 4YUQA 4Z16A 3LCSA 2UZEA 4RIWA 1OPKA 2IN6A 3HRCA 4G3EA 2VO3A 3KXHA 3KRLA 5IZFA 1BL6A 2A0CX 4IAFA 3F2AA 2WTIA 5AMNA 2YCRA 3MV5A 4BCKA 3FZPA 3QA0A 3QXOA 2J0JA 5BVOA 2OXYA 2Y7JA 4CFUA 2LGCA 4EORA 2XUUA 1PXKA 3DXPA 3E7OA 4J7BA 3R9DA 3CXWA 2I0VA 3E7VA 2Y0AA 3QQUA 4G9CA 4S31A 3VBQA 4EOPA 1JKLA 3R8PA 1TKIA 4FSQA 4I20A 4CTBA 4Q5HA 5AAFA 3U51A 3NR9A 2EUFB 3Q52A 4D4SA 2VRXA 4KRCA 5ANIA 5CZHA 3ORTA 3UZPA 4FEVA 5FD2A 2QOBA 4IX4A 3FWQA 5HTBA 3GCVA 3GC9A 2XCKA 4RVLA 3QKMA 2FYSA 3G0EA 2XIXA 2B54A 2W05A 4YTCA 4BR3A 3LFCA 5AP5A 3QL8A 3V5QA 5LMBA 4ZP5A 2HELA 5DN3A 4HW7A 2EVAA 1OIRA 1AGWA 3FY0A 4I0RA 1ZMWA 2CKOA 5AAEA 3BCEA 4X2NA 1G8SA 2E9UA 4EH8A 3VUIA 4BDJA 3PVGA 4HPTE 3MH3A 4FIGA 4KRDA 5FDXA 2R3MA 3JY0A 3PIYA 1KE9A 4E4MA 5JRQA 1YDSE 2C5OA 4KA3A 5FGKA 3UZRA 4CG8A 4QOXA 4G3DA 2IO6A 4JQEA 4QQTA 3LMIA 1OIUA 3DKFA 3R30A 5L8JA 1Y57A 4R1YA 3G15A 4DGGA 4C2VA 3UPXA 1PY5A 5BYZA 3VF9A 4YJRA 2I40A 4Y5HA 5DVRA 3KXMA 2XZSA 4YC8A 3EB0A 3OWLA 3HZTA 5E90A 4AQCA 2F7XE 1R3CA 2OBJA 3AC2A 2B1PA 3DAEA 5F1ZA 4FEUA 4I21A 2Y6OA 3I60A 4Y85A 2RF9A 5HHWA 3WOWA 4PL5A 1VJYA 2PL0A 3AMAA 4RRVA 5IQAA 4ACCA 3PUPA 5EQEA 1PXNA 5TE0A 5CVHA 5HNBA 5C9CA 4CKRA 5HIBA 4E5WA 3ZLXA 3BHHA 4PX6A 4NM3A 2NPQA 5L3AA 5K5XA 5JFXA 2JBPA 5KMOA 5FQDC 4WRGA 5EI6A 2JAVA 2WTCA 3UG1A 4DFYA 2HZ0A 3LW0A 4F09A 5FTOA 5A4EA 4UALA 4RPVA 3VBTA 3H0ZA 5JEBA 3UOKA 1TQPA 2YIYA 3WF8A 3O8UA 5ANDA 5D9HA 4YJTA 2A1AB 2UW0A 4YC3A 3TJDA 3HL7A 1B6CB 4RIXA 3VJNA 3ALOA 4JIAA 4E6CA 1CKJA 3KF7A 5DRDA 2YABA 5FXQA 2CDZA 2C1AA 4BCPA 2OJJA 3QHWA 4HOKA 4ZK5A 5GHVA 4OTIA 3ZTXA 4WHZA 4WT6A 3C0IA 2C68A 4R78A 5KO1A 4O0UA 4N4SA 4BBFA 2IZTA 4XG9A 2WKMA 2R0UA 4FR4A 1XBCA 4GG7A 1XBBA 1PW2A 1ZY4A 4FTUA 4WNPA 4YPSA 4FG9A 3KRXA 4ZSGA 2W1FA 3QQLA 4OW8A 4AU8A 3G9NA 4JBVA 2XCHA 1J3HA 3D2IA 3KA0A 4BDIA 3IKAA 3G5DA 3ZLYA 2WTJA 5DLSA 2RIOA 3FSFA 1OECA 2GNFA 2ZVAA 3C13A 5F95A 2PZYA 2OH0E 3I5NA 5C01A 5J9LA 3KVWA 1R0PA 3SW4A 3UC3A 3N4UA 4UN0C 2OJGA 3LCOA 2PUPA 5IQFA 3TZ9A 3H9FA 3PLAE 3D2KA 2JDOA 3ACJA 3PTGA 2PVJA 5KZ0A 2PUUA 2XK4A 5LVOA 3ZHPC 4BTKA 1OKYA 4C0TA 2PTKA 2VO0A 2ZV8A 2QQ7A 1W84A 3VHEA 4F1MA 4TY1A 3PSDA 5CYIA 4B9DA 4BC6A 5I9YA 1O6YA 1Y6BA 3W2OA 1JSVA 4AN3A 3MYGA 4JXFA 3REPA 5AEPA 4O27B 4I93A 4QYFA 2UW4A 2DWBA 4IJPA 5HTIA 3TUBA 4WG3A 4AZWA 2YIXA 2W0JA 4WBBB 4ZZNA 1LEWA 2HXLA 2UW9A 4O7NA 3JYAA 4WKQA 3IS5A 2IVSA 3FMNA 1W83A 3ULIA 2UZOA 2PY3A 4UZHA 5J7BA 3COMA 4AN2A 3KVXA 4L9IA 4MHAA 1OI9A 4JOAA 4EHEA 4GK4A 4FTLA 3FJQE 2XNEA 5FTQA 1UU8A 4DLJA 2J7TA 3CJGA 1JQHA 2Q0BA 4CCUA 2J6MA 3SLSA 4YJQA 2GSFA 3OROA 2JITA 1IAHA 1YWNA 4K33A 3RK9A 2W17A 4O7VA 3UVPA 5M53A 3G0FA 4QP7A 2WMWA 3OXZA 3CS9A 1GJOA 4JBQA 1STCE 3VAPA 3FLZA 3DZOA 3UNZA 1M2QA 2P4IA 4QMOA 3K3IA 3OCSA 4IHPA 4JAIA 2YDIA 1PJKA 1GNGA 4AW2A 3ORMA 1YI4A 4I6BA 3NNVA 4ZLYA 4DGMA 4IAAA 3QFVA 5DH3A 2WZJA 3MSSA 3V5LA 3ZYAA 2X7OA 5A4TA 2RG6A 3UMXA 2OXDA 3BLHA 1L3RE 4YJPA 3VC4A 3DT1A 4RIYB 4TL0A 4EHZA 4DT9A 3I6WA 5HLNA 4M14A 5H9BA 5IEXA 2GQRA 4L3LA 2ONLA 2ERKA 4G17A 4QMWA 4I22A 4U81A 3CBLA 3U4WA 4BKJA 5HCXA 1OL7A 4KS8A 5I9WA 4F64A 4KB8A 1OBDA 3IGOA 5EQYA 4G5PA 5CF8A 2QOFA 2OKRA 3ORIA 4G6NA 4KSQA 4F0FA 1X8BA 3IW7A 4PPCA 3Q6WA 4NZWB 4QMZA 2XNPA 3ZRMA 3ZUVA 3CTHA 3PY0A 4E4LA 5IMEA 4O38A 3QQJA 1WFCA 4E6AA 4QPAA 4A4OA 3DJ6A 4B0GA 2R7IA 1PF8A 1YQJA 2C47A 3LXKA 1VYWA 2R3NA 2X9EA 2ZAZA 3ZH8A 2YJSA 3OOGA 3K2LA 5CLPA 3GEQA 3QGYA 3PXYA 4TNBA 4GJ2A 3UNJA 4AT4A 3WYXA 4K1BA 3QZHA 3BBTB 1PMNA 3CCNA 4XMOA 5KMKA 2ESMA 3C5IA 1QPDA 2I0YA 2PYWA 3QQFA 1JSUA 2KTYA 4GYIA 3CEKA 5J1VA 3R9RA 3K5VA 3OTUA 5DHJA 1W7HA 2PMIA 2V0DA 2GU8A 1YHWA 1UNGA 3P7CA 4OT5A 4TW9A 3CD8A 2J4ZA 2OIQA 2H96A 3A60A 3CQUA 4B7TA 2DYLA 5ANKA 3DKOA 3KFAA 4EH2A 3DOGA 4LQMA 3KK9A 1UNLA 1GZNA 5D1JA 4CV9A 2AC5A 3P7BA 3V01A 3UMWA 2QHNA 4JAJA 2QG5A 3BYUA 2WQOA 4FTCA 4I4EA 5CNOA 5HG7A 3NUXA 5LVMA 1JOWB 5FXSA 1ZOGA 3Q5ZA 3FXWA 5M4IA 4O6EA 4C8BA 2UZNA 3D4QA 4ONAA 1ZAOA 2VGOA 3EN7A 2W9ZB 4J8NA 4XG8A 2PPQA 5DR2A 2VAGA 2WIPA 4UYNA 3UDBA 4DH5A 4RWIA 5IQGA 4YLLA 4HVSA 4AZEA 3QRTA 4QO9A 5HQ0A 3I7CA 4L52A 4LL5A 3F3VA 2C3IB 4Z9LA 4AZSA 4FT0A 3BBWA 5ACBC 4YZMA 4NCTA 4I5CA 5D11A 4O1PA 3IQ7A 2BPMA 4CQEA 4M13A 2YWPA 4N6ZA 3NW7A 3QBNA 3L9PA 2QO7A 4FNYA 4Y72A 4M8TA 4U42A 5DBXA 3W2CA 3PPJA 2GS6A 2PSQA 2WOTA 3Q4UA 2W5HA 4G6OA 3ZOSA 4PDSA 4M0YA 3LJ1A 1JPAA 3D5WA 1P2AA 3P79A 3NPCA 4CYIA 4ZSAA 4O1OA 2XNBA 2YM3A 3S4QA 4NIFA 2PZRA 2Z02A 4GW8A 1F0QA 1UU7A 2VWYA 3H9OA 3ZU7A 4LV5A 2E2BA 3FHRA 2WNTA 3W2RA 3TNIA 4IB3A 4BVUA 3QZFA 5CAVA 5IMXA 3LAUA 2VX3A 4PMTA 3UIBA 1Q3WA 4CRLA 3THBA 3FMDA 4R3CA 2VTSA 2R9SA 1Q8ZA 3LCTA 3R7UA 3DAKA 3OD6X 4PP7A 3P1AA 3BHUA 4U40A 4TYGA 3EOCA 3AT2A 4HYUA 4L7SA 2PUNA 2V5QA 5CT7A 4KUJA 3TM0A 4PY1A 4GJ3A 2PZ5A 1UVRA 3M42A 5CQWA 5HE3A 4C61A 2RFDA 2DS1A 3MA6A 4FTOA 3GXLA 3U9CA 4PL3A 2BTSA 3MPMA 3Q9YA 4FKWA 1LPUA 1H27A 4J95A 1M52A 5J8IA 3WZUA 5L6OA 1M7NA 4ID7A 4WBOA 2WMSA 5KKRB 4JDKA 2BDJA 2GNGA 4X3FA 4QMMA 5BNJA 3OTVA 3BWFA 2JKOA 2XKDA 5E8TA 1DI9A 5AV1A 5IG1A 4MWHA 3R8MA 3UIUA 4RWJA 5A6OA 3GGFA 3ZM9A 2VTJA 4RIWB 2CGVA 3E62A 2WPAA 5AV2A 3HRFA 2W06A 2JKMA 3R7EA 3F9NA 4P5QA 4W4VA 4DEAA 4E93A 2P2IA 3AT3A 4EQUA 4J99A 2XJ0A 3SQQA 4AOJA 2CNQA 5KMMA 4YNEA 1WVYA 1O9UA 3HV7A 5HGIA 4OBPA 2R7BA 4E7WA 3TACA 5AR7A 2B9JA 3C4XA 5TT7A 2UW8A 1PYEA 2CSNA 2GMXA 4B8LA 4BKZA 2IZSA 3QU0A 2NNWB 3B2WA 3IPHA 4M66A 1EH4A 4O21A 4M67A 4MEDA 1LP4A 3GOKA 2C6OA 3S95A 5JK3A 3OEFX 2JFLA 3GFWA 1JLUE 1KV1A 2XB7A 3EN5A 5LARA 4WSQA 2O8YA 2RSVA 3MB7A 4BF2A 3H10A 3ZUTA 2X8IA 3O0GA 1XKKA 2WMXA 2QKRA 2PVYA 2QOCA 4UZDA 5BVWA 5L2QA 4DEEA 2F4JA 5AUVA 3T8OA 3OOMA 4H1MA 1XH6A 3SXSA 4F9CA 1SNUA 2XRUA 4ZTSA 3EWHA 4L6QA 1IRKA 5KNJA 4L00A 4FKGA 4OTHA 4I4FA 2YWVA 3TI1A 2WB8A 3NMUF 3VJOA 2JFMA 2G9XA 1XH8A 1J1CA 3A4OX 2XKFA 3CPBA 4QP9A 3KCKA 4Y83A 4KD1A 3S2PA 2W4JA 4RWLA 5EW9A 5K9IA 3IDBA 3E92A 3QLGA 4M69A 3UZTA 3MS9A 3RBWA 3LJ2A 5DGZA 1XH5A 2UUEA 5EDQA 2OI4X 2JKQA 2YDKA 4ZJIA 3FC1X 3LCKA 3ZCLA 5M4CA 2ITZA 3LM0A 4BY9E 1YDRE 4U9AA 5HESA 4WNKA 1YVJA 3LIJA 2WAJA 4YSMA 4HVHA 1PRYA 2PU8A 4GEOA 4TWOA 2CCHA 1PMEA 4AW1A 3R6XA 4QYYA 2J2IB 4GU9A 3UGCA 3WF6A 1WZYA 4CFFA 4BBMA 4CFMA 4DFBA 1UU3A 1ATPE 4I5PA 4BCQA 3RWPA 4R77A 2E9PA 2XEYA 4GIIA 2JDRA 3W32A 4U5JA 3DKCA 4C4HA 5LMKC 2IW6A 3D9VA 4X2KA 4FT9A 5AUXA 4IWOA 5L8LA 2BZKB 4HCVA 1RDQE 2J90A 4ITHA 1H1QA 5IUGA 1PXPA 3AC4A 3LMGA 4C34A 4BICA 2CCIA 4TT7A 5CSVA 2R3QA 3B2TA 4MBLA 3U6IA 3ROYA 3BU3A 4RBLA 3EQHA 4OTWA 4RIXB 2ITNA 3OXTA 1TQMA 4MH7A 3VUHA 5M56A 1YXUA 2YISA 3OZ6A 2W4OA 3FMMA 4O7RA 3R2YA 4K11A 5JQ5A 3G90X 3DFAA 5EKOA 3NUPA 3NAYA 5L6WL 4D0WA 4EH7A 5DEYA 4O22A 4XHKB 4XH6A 4ALWA 2HWOA 4O82A 3QTWA 3PA4A 2XJ1A 3A99A 4OT6A 3UQGA 4H3PA 4YSJA 4O86A 2QOIA 3I0QA 4BIBA 1U5QA 2BFYA 2UW6A 3OCBA 3CPCA 3PG1A 1ZZLA 5D12A 4CLJA 3Q04A 5HORA 3O7LB 4TRLA 3TNQB 2H9VA 4ACGA 4DGLC 1A9UA 3T9IA 4V05A 2BCJA 1GY3A 4RLLA 2FSMX 3BEAA 4GSBA 1KV2A 4J98A 4BB4A 4MXOA 1OKZA 4ERWA 4G3CA 4FV6A 4IAKA 3R8LA 5H2UA 3QD0A 4JIKA 1WMKA 1P14A 4IZ7A 4JI9A 3R73A 4YLKA 4IDTA 4A4LA 4EH9A 4H39A 4IIRA 2I1MA 3DB6A 5LVNA 3VBYA 4NTSA 5ANEA 4PF4A 4QMQA 3F2NA 1UU9A 2VWZA 4JQ7A 4EOJA 5ITAA 3R9OA 4PMSA 3NUNA 3ZMMA 4ZY4A 2X4FA 5EM6A 5KBRA 5KMJA 2VV9A 1SYKA 3PJ3A 1ZYLA 2WQNA 1ZWSA 1H1RA 3FBVA 4NJ3A 4I3ZA 4ZZMA 4IX5A 3NCGA 4GU6A 5JFWA 3FZRA 3OS3A 3T3UA 4EK5A 3MGYA 5E8XA 3VN9A 2BZHB 3V6RA 1PKDA 4XRLA 1W0XC 5D7AA 1MUOA 3A4PA 3FZ1A 3BI6A 4WD5A 2VWVA 2VN9A 4FTMA 2R3JA 4AAAA 3BEGA 4BHZA 4PPAA 3PXKA 4BZDA 5E91A 5EKNA 3KXXA 3TDVA 2UZTA 4ZTHA 3W2SA 4IZ5A 5CF5A 3RGFA 4FKIA 2CPKE 3I0OA 3P9JA 5EW8A 1Q4LA 3CTJA 5I3RA 4X3JA 3TV7A 5GZ9A 4YR8A 3ITZA 3ZC5A 4IVBA 1JVPP 4K6ZA 3KMUA 2ACXA 4IMYA 3R9NA 4M12A 4YGAA 4X6QC 3WIGA 4AGUA 4E5AX 2YDJA 4AXAA 4JL9A 3ZEPA 1PXOA 3AT4A 4ASEA 3VS7A 4U3ZA 4MCVA 4YHFA 3UBDA 3EYHA 2OU7A 3PE1A 2JDSA 5BVNA 3FMHA 3GU8A 3C50A 3R28A 5CZIA 4IEBA 2X2LA 4D4VA 4DFUA 2XIRA 4FG7A 3VUKA 4FL2A 2HYYA 5CT0A 5I9ZA 1SZMA 4RFZA 4EJ7A 2QR8A 2ERZE 3EKKA 4OR5A 4QRCA 5EHOA 3TTJA 4BDHA 4BGHA 4CRSA 2YCSA 3VRYA 1YHSA 2XVDA 4QNAA 2XBJA 5AV0A 2C3LA 5M08A 5FM3A 5C27A 4I6QA 4YTHA 2V62A 5AWMA 2X39A 2JDTA 4JRVA 5IH6A 4E73A 4ZOGA 3OW4A 3VO3A 1CM8A 3F6XA 3FQEA 4U6RA 3M11A 1GIHA 2SRCA 4FZFB 2BRGA 4NT4A 1ZOHA 4IFGA 3DU8A 3QYZA 4QMYA 3VQHA 3DS6A 1CSNA 4IVCA 3QXPA 3KGAA 5EFQA 2JDVA 3ZSGA 5AM7A 5IQIA 3MVMA 2XKEA 3NNWA 5CU6A 3W1FA 5IA3A 4XX9A 1PXJA 5IDNA 1S9IA 2Y4IC 3FQHA 2GTNA 5BPYA 5T3QA 3Q96A 3BGQA 4O0YA 5HO8A 2BRBA 3KN5A 5B2LA 2UZBA 2QOHA 4CLIA 5E8ZA 2OXXA 3GBZA 2IVVA 4U44A 5AR2A 3D5VA 4XYFA 1I09A 4D2WA 2UZUE 2JIVA 3MVHA 4EHVA 1R0EA 2W1CA 3RCDA 2BHEA 5BYYA 2X1NA 4LGGA 4C02A 4QMLA 5GJFA 2WMBA 3MI9A 3TUCA 5CSXA 2XM8A 3BV2A 4BCFA 4BGGA 4HYHA 3DK7A 3JPVA 3BYOA 4FTIA 4BL1A 2CHLA 3QTXA 3UOHA 2PVRA 4WNOA 5CVFA 3OT3A 2B0QA 3L9LA 3OBJA 4IB5A 4FIJA 1HCLA 3CGFA 2R3RA 4U0IA 4ZAUA 2I7QA 3GU4A 5C8MA 5KMLA 3R1SA 2QO9A 3Q2MA 4B8MA 1Q41A 1MQBA 3NYNA 4RVKA 5E1EA 1KUTA 4KKEA 3ZSHA 5HX6A 3V3VA 3ANQA 3K54A 3FYKX 2Z7LA 3DLZA 2RGPA 4WG4A 5ETAA 4QQ5A 1IAJA 4WNMA 3FZSA 2G1TA 3F3UA 4C58A 5M51A 3F3WA 2GFSA 1ZYSA 2CLQA 2WQMA 4I5HA 4YO4A 1ZYDA 1R1WA 3QGWA 3BELA 4D58A 4CG9A 5DFPA 3AMYA 4NIFB 5CI7A 4EK4A 5IUHA 3ET7A 5GIPE 4J53A 4HPUE 5HNGA 5LJJA 1YXXA 2V7AA 2BHHA 5J5SA 1V0OA 3COKA 2ITWA 5E9EA 4C38A 1NA7A 2CMWA 3PVUA 2UZVA 3D14A 3MVJA 3PPZA 5GINE 2XNGA 3OBGA 4MBJA 2ZOQA 3ACKA 2IZUA 3R0TA 4IBMA 4XG4A 3ZC6A 5EM8A 3FEGA 3G51A 2ZM4A 3UP7A 3GFEA 4MNEB 5CEOA 2Z7SA 3UVQA 2XH5A 3UIXA 1T46A 3PXRA 2QVSE 3RK7A 3RPYA 2R3KA 4IZYA 4D2SA 2WTKC 5JGBA 1PXLA 3IO7A 3KEXA 4NW6A 2PMNX 5J95A 4FVRA 5HD7A 2HW7A 4F6SA 2ITYA 1PMUA 4I0SA 4NFNA 4AF3A 4ASZA 5CASA 1H08A 4BDKA 5DA3A 3G6HA 4E3CA 4ZTLA 4RT7A 4X3FB 2YAAA 3AC3A 4LRMA 4NKAA 1U4DA 3OG7A 5D41A 3TZ8A 2HOGA 3HGKA 1NVRA 2VTRA 4GS6A 4XP0A 4AGWA 3D7TB 3FDNA 4FV3A 4L44A 3HP2A 4FOCA 3U4UA 4UBAA 4HCTA 4AOIA 4EQMA 5F4NA 2B9HA 4UWYA 5E8UA 4DG2E 4CSVA 4FSRA 2QI8A 1K3AA 2OICA 1ZLTA 1W98A 2ZB0A 3MY0A 4E6QA 4CKJA 4BYIA 4DHFA 3BU5A 1TQIA 3E64A 5A54A 5BX0A 2PVMA 2BR1A 2BKKA 3LQ8A 4FV0A 4AE9A 4ANNA 3SXFA 4K9YA 3GOPA 3BU6A 3CJFA 3KRRA 1G3NA 4IDVA 2WMTA 4QMUA 1XWSA 3BYVA 4UWBA 5TKDA 5DT4A 2C3KA 4L42A 5HU3A 4X6RA 4ALVA 2C0IA 4D2RA 3DTCA 4JLCA 4UXLA 3BX5A 4I23A 4X0MA 3WZKA 1B38A 1KOAA 2VTPA 4A9SA 4BCHA 5KHWA 4IX6A 3TJCA 3LVPA 4ANQA 2O0UA 1SNXA 4PRJA 4GV1A 5AP3A 4N6YA 4Q9SA 5AR5A 2Z7RA 3TKIA 3V51A 2CNVA 4KABA 3S3IA 4ANMA 5HCYA 4MXZA 4APPA 3E5AA 3II5A 2FVDA 1Q61A 4RMZA 5LWMA 2CNUA 4IQ6A 4NM0A 1G5SA 4NK9A 2VGPA 2EB3A 3SX9A 2QR7A 4W9WA 2P2HA 3D94A 2UW7A 3HAMA 4BKYA 4FYOA 2C6DA 4FV2A 1CKIA 4M69B 2WU7A 1Z9XA 2UZWE 3QCSA 4R5SA 3C4CA 2ZV2A 3DDPA 4IAIA 4S32A 4AN9A 4CTCA 5AUZA 4ZS4A 4PMPA 5EG3A 2JIIA 5ANOA 4G1WA 5JFVA 2BRHA 5EDPA 3MESA 4FZDB 2EU9A 5BUEA 1SM2A 1XO2B 3TV4A 3UP2A 3V5PA 3VQUA 2PULA 4MTAA 5FRIA 4QYHA 3OC1A 2IW9A 3ATTA 1OZ1A 3DQXA 3MPTA 4TN6A 4JR7A 3N9XA 3BIZA 3VBVA 3EZVA 2P0CA 3HMOA 3R1NA 4FKUA 2PVFA 5AP4A 5K3YA 3M2WA 3PSBA 2OFVA 2QG7A 1A06A 5HU9A 5LWNA 2GNLA 2VO7A 4EOOA 4DG3E 2J0MB 4H3BA 3PVWA 1Y91A 3MFUA 3FLQA 3L9MA 2R3LA 1U59A 4RVMA 5HBJA 5IUIA 2RFSA 4EK8A 2HAKA 4V04A 4ZEGA 2Q83A 2YIRA 3KRWA 5HOAA 5IQCA 4P5ZA 3EFKA 3ALNA 4D1XA 1A48A 1OBGA 4UMUA 4F9WA 3FI3A 1H26A 2BAJA 3CKWA 1R39A 4DFLA 3IW4A 3AD4A 3CP9A 3UO6A 4AFJA 4C4GA 3O2MA 4ACMA 4RZWA 3A61A 2XK7A 3RKBA 4EONA 4AA4A 5KCVA 3FL4A 3BZ3A 3ORKA 3TL8A 3B8QA 3CQEA 4F70A 4ZTRA 1H01A 2EB2A 4FZ6A 2X9FA 4LUDA 5KHXA 5LVPA 3VBXA 4XV3A 1M2RA 4I94A 4BWKA 3GC7A 2PMLX 4IAZA 4E4XA 3DB8A 3CQWA 4IWDA 4XOZA 3QLFA 3BQCA 5KMIA 2VTLA 2C30A 3Q6UA 4EH4A 5AA8A 3VNTA 5EW3A 3EQGA 3MTFA 4ZZOA 1XQZA 3NDMA 4ZY6A 4Y73A 1CMKE 1W82A 4JNWA 5CSWA 3F66A 3LFFA 3OUNB 4RIOA 2BZJA 5CU0A 3F7WA 3PZHA 4KAOA 4S33A 4CFXA 1GZ8A 3R8VA 1KOBA 3PP0A 3PY1A 4F1TA 1MP8A 4G34A 4LUEA 4RVTA 3PYYA 5H8BA 4EZ5A 4ZTQA 3LLAA 2HXQA 4W8DA 3QZIA 4IVDA 5CU2A 3NVMB 2C0OA 3HYHA 3Q9WA 3O8PA 4W8EA 4N57A 5DI1A 3SHEA 2HY0A 4CEGA 2BILB 4K0YA 4MK0A 4NFMA 4ASDA 3FLWA 4IE9A 4TYEA 4AZVA 4A06A 1WBVA 4MVFA 4PMMA 4A7CA 4RX5A 1VR2A 2WTWA 4FK3A 1OL5A 4CNHA 3DA6A 4DGNA 4S30A 1XH7A 4NEUA 1ZYJA 4DA5A 4NTTA 3AD5A 3O8TA 5DEWA 3KU2A 3QKLA 4OGRA 3HMMA 3COHA 1E9HA 3MVLA 3CKXA 3IG7A 2GTMA 2ITTA 2UV2A 4FTKA 2LAVA 3W16A 5ICPA 3NVKI 5HX8A 1URWA 4IM2A 3FI8A 2X4ZA 3EN9A 4GT3A 4EK3A 5DMZA 2WOUA 3RAWA 4QP4A 3LQ3A 1OPJA 3A7GA 4O96A 2H8HA 1KE7A 3OWJA 4C3RA 4DLIA 2W5BA 1JAMA 5L2SA 3UJGA 4XV9A 4XJ0A 2WMRA 4U45A 4YHTA 4G2FA 4F65A 4H05A 5FDPA 5JH6A 4FSNA 3ZO2A 4ASXA 1IR3A 1ZYCA 3BHYA 3DDQA 3Q3BA 4RQVA 4C35A 3PIXA 3W8QA 2F9GA 4FE2A 4IZAA 3NW5A 1CKPA 3ELJA 2BKZA 2OFUA 3MW1A 5L2TA 2REIA 2OF2A 3CC6A 4FVPA 4NKSA 3UVRA 3VF8A 4RA4A 5E8VA 2OJ9A 2HZNA 4IXPA 3SDJA 4E1ZA 4BCOA 3I1AA 4EH3A 4I6HA 3QD3A 3EQRA 3LPBA 4F0IA 4E4NA 4TWNA 4YBJA 3FXXA 5EOBA 1PMVA 3KQ7A 2C6KA 4AE6A 2R5TA 4EYMA 5EYMA 4FKJA 3ZRKA 3BGPA 5HG5A 1WBSA 1TVOA 4ANBA 4O7ZA 3OW3A 5K4JA 5HO6A 4BDFA 1QL6A 3NYVA 2G2HA 3ZLSA 1Q8TA 5C26A 1FGIA 4UV0A 4EOKA 2B53A 3N4VA 2YHVA 3HNGA 4RWKA 2VTOA 1H1SA 4NM7A 4RFMA 5CY3A 4DITA 4ZLZA 3ZSIA 3UO5A 4DBXA 4W4YA 1H1PA 2GS2A 5CSPA 3OEZA 4O6LA 2W1GA 3EQIA 5L8KA 1JNKA 4WA9A 3U87A 1K2PA 2WFYA 4FVQA 3TZ7A 3MFSA 4FV9A 4PTEA 1AQ1A 3W8LA 4BIDA 5AP2A 3CGOA 1OL1A 4KBKA 4GKIA 5EM7A 5HBEA 4YJOA 5TR6A 4E20A 3QC9A 2GQGA 4U43A 2GS7A 3R7GA 3VS4A 3LCDA 5AM6A 4DH1A 4USEA 3ZLWA 1J7IA 5HICA 1YW2A 3BLQA 4HVGA 3CE3A 1Q24A 3QTZA 4KNBA 4X21A 3UYTA 2B9FA 4AT5A 4EL9A 3UQCA 3BKBA 2WD1A 2YITA 1OM1A 4CV8A 2X2KA 3RAKA 5FBOA 3WBLA 5CEMA 1F3MC 1T45A 5J1WA 4EEVA 4MNEA 4HGSA 5I9UA 4DH8A 5JN2A 1O6LA 4BDEA 4BZOA 4I24A 4FSMA 4BI1A 2RL5A 5C8KA 3OWKA 4C7TA 3MDYA 3ZO4A 4I0TA 1P4FA 3FHIA 4JDJA 4BDDA 4BHNA 2O2UA 3JVRA 2Y9QA 4A9RA 1VEBA 4QYGA 5LMAA 2HCKA 4EBWA 5JKGA 4FSZA 4QMTA 2VWXA 3W33A 3HUCA 3F5PA 4NUSA 4N70A 3D7TA 3DAJA 3RTPA 4FKVA 3H3CA 3PZEA 4TYJA 2J5EA 1OVEA 4CMUA 4KIOA 4D9TA 5AA9A 4MXXA 4MQ1A 1ZZ2A 3SRVB 3QRJA 2J51A 3AXWA 3C0HA 4GFGA 4MF0A 4PUZA 5J7HA 2QCSA 3WZDA 1V0PA 1BI8A 2XIKA 3E87A 4YO6A 3V8WA 1MQ4A 4O0XA 5DE2A 4WIHA 4ORKA 4FG8A 2VNWA 4QP6A 3MY5A 1JSTA 5GJGA 3WE8A 4Z3VA 1SVHA 2C6EA 3PP1A 2I0EA 4U97A 3PJ1A 1E1VA 2JBOA 4FUYA 4ZJVA 2W99B 3AC8A 2IJMA 4DFZE 2VWWA 3WZJA 3KC3A 1H0WA 2GHGA 3F5UA 4UWCA 2A2AA 1Q97A 3PIZA 4KWPA 1QPEA 3HDMA 3PJ2A 4WUNA 2YZLA 5I0BA 5T68A 4FKOA 1PHKA 4R1VA 5BMSA 5DYJA 2C5YA 5GJDA 2O65A 3JR1A 4AW5A 1WVXA 3KMMA 1ZXEA 1ZRZA 3EQFA 5FLFA 3TIYA 3ODYX 3PPKA 4BTJA 3RALA 3DXNA 3VS0A 4RJ3A 4A07A 2H34A 1U5RA 3F7ZA 5AV4A 5J9ZA 4LMUA 2PVLA 5LVLA 2J0KA 2X2MA 4RC3A 5IDPA 5FP6A 3MJ1A 4BIEA 1JWHA 5D10A 4RSSA 1FVRA 4D5KA 1U54B 2C5VA 3DBCA 3DTWA 4AZFA 3FKOA 3OCGA 1ZY5A 5AR3A 4O0TA 2YM7A 4RFYA 3MPAA 1AD5A 1F5QA 4BCGA 4FTJA 4JX7A 3DY7A 4L67A 4QTBA 2OIDA 2F49A 4UB7A 4XOYA 5JZNA 4C62A 2YZAA 3QWKA 3LJ0A 1NT2A 3E8CA 4E8AA 1Q8YA 3AQVA 2C5XA 1GOLA 2ZM3A 3HMNA 3F88A 4G31A 5F20A 5TO8A 3UC4A 3DXQA 2GDOA 4Y8DA 3NZ0A 4EUUA 2ETRA 2AYPA 2W1EA 3PDTA 2I6LA 1WCCA 3VUTA 2HIWA 5BVDA 2QOOA 2UZLA 3KK8A 3ORZA 3MN3A 3KREA 2GNJA 1HOWA 3HECA 3WARA 3C7QA 3CTQA 2X7GA 4QTEA 3NUYA 2C3JA 4MF1A 4X2JA 1UWHA 3R8ZA 4JR3A 3DK3A 4H3QA 4P4CA 4D2TA 2JKKA 2WELA 3GU5A 4CMOA 4QMNA 5IQHA 4CD0A 4JG8A 2BZIB 4C37A 3LHJA 1M14A 3A7JA 4GG5A 4IM3A 1WBNA 4XG2A 4KIKB 2BRMA 3G33A 4K18A 3RHXA 1REKA 3LMHA 3NUAA 4D5HA 5IEYA 3FYJX 4AX8A 4F6WA 3S0OA 5L2WA 4XBUA 3LFEA 1YDTE 4R5YA 4O7SA 5HBHA 3Q2JA 2Y8OA 2ITXA 3ZO3A 4QP2A 1ERKA 3ORPA 4YZBA 5IQDA 2BTRA 2JLDA 2Z8CA 2ZMCA 3DLSA 3UPZA 4Z7GA 3ZO1A 5DWRA 3W2PA 3PA3A 5EYDA 4PDYA 4JDIA 3GQLA 4JG6A 4LM5A 4MKCA 4USFA 4E5BA 2CGUA 3C4ZA 3ODZX 4FICA 4U3YA 1GZOA 4LRJA 4O91A 4RLKA 3AD6A 1DS5A 4XG6A 5A4CA 5AIRA 3ORXA 4S34A 5BMMA 4V0GA 3ZM4A 1H00A 3EHAA 1FQ1B 3P0MA 1YXSA 2QU6A 2ITVA 2OK1A 2EXMA 3R01A 3WF7A 4TYHB 5HIDA 4R7BA 3EQPA 4I92A 3PLSA 2O64A 5BUJA 1ND4A 1YOMA 3EMGA 5CU4A 4HVIA 4CFWA 3TV6A 4AACA 5IA0A 5JT2A 2JGZA 2BAKA 4TYIA 3ZS5A 4AP7A 5IH5A 2W1ZA 3T3VA 1OITA 4CCBA 3HMIA 3PXFA 2W1HA 4IC7A 3BHVA 2WU6A 4DEGA 1ZMVA 2JAMA 4OAVB 4K77A 2WMAA 2XRWA 3T9TA 3ZXZA 4QMVA 4Q9ZA 2C6MA 3EKNA 4HZSA 2BALA 4FKSA 4ZSLA 3QAME 3UNKA 3HKOA 2HWPA 4TTHB 5EHLA 3SKCA 4GT5A 5KBQA 4RQKA 3ID6C 4FTAA 2FUMA 1K9AA 4ZSEA 3RPVA 2ITOA 4HNFA 5FBNC 4DT8A 4DH3A 3FZTA 3GT8A 1Q62A 4D2PA 4Y46A 5LCJA 2X6EA 3JUHA 4IFCA 4LI5A 5HO7A 1YXVA 2WEVA 1Y8YA 2R3OA 1H1WA 3DFCB 4GIHA 3LFAA 3VHKA 3ZUUA 4ARKA 1LR4A 4RX7A 2XNMA 4HNIA 4KS7A 4CZYB 2J0IA 2OZOA 2JEDA 3R00A 5CTPA 4DFXE 3I6UA 5DPVA 4NSTA 5HLWA 4FNXA 3FZOA 2Y6MA 4GL9A 3VBWA 4DGOA 2B52A 3O50A 4C4IA 5FXRA 3I81A 5IA4A 1M7QA 3NIZA 2CKPA 2VWBA 3KMWA 4BN1A 4ZLOA 4DTBA 2ZDTA 2AC3A 1Q99A 3L8VA 4LOQA 1OB3A 3C4FA 4GUEA 3AOXA 4XLVA 3AGMA 3ZBFA 3DGKA 5F94A 3GC0A 5I9XA 2IW8A 3N51A 4UMQA 2OGVA 4NM5A 4F7LA 1BI7A 3ANRA 4Y5QA 3Q4CA 2R4BA 2OJIA 5HI2A 4DF3A 1H0VA 4BGQA 4O2PA 2YM5A 1JKSA 4J52A 4E6DA 3TZMA 4GVAA 2BDWA 3IGGA 4R3PA 4C33A 4FMQA 3KXZA 4J8MA 2HW6A 3JY9A 4BCNA 4QQCA 2O63A 3CR0A 5EH0A 4YJUA 1XBAA 2ONLC 5IQBA 3QQGA 4L46A 4FF8A 3FKLA 4I6FA 3HRBA 4KSPA 1PYXA 4UMPA 4FV5A 3A62A 3EN6A 3KY2A 3NW6A 3IOPA 4PWNA 5AP1A 5FM2A 4O0WA 5TF9A 3W10A 1MRUA 3IK3A 4JDHA 4RJ5A 5EYCA 3V8SA 3EL7A 4L43A 3PG3A 1RW8A 4PPBA 1SMHA 2ETMA 5CENA 4FKPA 5CAQA 5AUYA 2ITPA 5KX8A 3PA5A 2JC6A 3H9RA 3MFRA 3FV8A 4BDCA 2FA2A 1GZKA 4U41A 2HZIA 2IVTA 3LXPA 1M2PA 3FPMA 4XBRA 3GENA 4JVGA 4DTAA 3QCQA 3MTLA 2VO6A 3A8WA 4MD9E 4QPSA 2VD5A 5FEEA 3A7FA 3ZDUA 4YZNA 3FPQA 4D4YA 4HJOA 1ZOEA 2P55A 4TPTA 5M4FA 3FMLA 3ZBXA 3R22A 3NLBA 4JS8A 2PWLA 4C4JA 3TN8A 4YU2A 3R21A 2XNOA 3TNHA 5IA5A 3ROCA 1BYGA 4DTKA 3ATSA 4U7ZA 3E63A 4F7JA 4UEUA 3I7BA 4C57A 1XHAA 3VULA 4OTPA 2YLFA 1OUYA 1I44A 4JBOA 4II5A 1Q3DA 3SD0A 5HIEA 5IF1A 1OGUA 3RHKA 3VS5A 2O3PA 5IEVA 2O5KA 5CI6A 2Y4IB 3F69A 4UX9A 3LFSA 2YM4A 3BQRA 3ZRLA 3WE4A 4J97A 2UVXA 1QCFA 4ANSA 5AP6A 4CKIA 4IJ9A 4QP8A 3QCXA 1RE8A 4KKGA 3MH1A 4I1ZA 1H28A 4EK6A 5AIKA 5CQUA 4I5MA 4DN5A 4F1OA 3UQFA 4BFMA 4CVAA 5AV3A 3AMBA 5A4LA 1DAWA 2AUHA 5G1XA 1KE8A 2F57A 4HGEA 2VWIA 1O6KA 1NW1A 4RC4A 4GVJA 1P5EA 3S1HA 1Q8WA 4KBAA 2F7EE 3SRVA 1WBTA 4MXCA 4PTCA 4QT1A 4NCTC 4C3PA 1G8AA 3HA8A 1FMOE 2VTQA 3L1SA 3OMVA 1IA9A 1S9JA 3PY3A 1OKWA 1YWRA 4FEXA 3ERKA 5I9VA 1OPLA 1FINA 1UWJA 1H25A 3UTOA 3RINA 3O23A 5K4IA 4RZVA 1WVWA 4JT3A 4IWQA 3WZEA 4D0XA 2R3FA 4P7EA 4XV1A 4FT7A 4YNOA 2IWIA 4ZS0A 3DK6A 4YTFA 5EI2A 4E26A 5KUPA 3LXLA 4EUTA 2E9NA 5B7VA 4M97A 3Q5IA 4FODA 4FX3A 3IW8A 4L68A 4EBVA 3QWJA 2ITUA 5HVKA 1KWPA 4YPDA 5J9YA 3SVVA 3QQHA 5B2KA 1Z5MA 4L8MA 5AP0A 5KZIA 3R7OA 3OP5A 1MRVA 4CQGA 3BGZA 3MIYA 2Z60A 1APME 4FL3A 3RPRA 5KE0A 2PK9A 2PZIA 4C59A 3KB7A 4K2RA 2VZ6A 3BE2A 4C3FA 1WBOA 5IA1A 4Q2AA 4CXAA 3C51A 4OTRA 2C1BA 5HKMA 1U54A 2WMQA 2ZV9A 3QTQA 4FKQA 4FT3A 4XCUA 4YBKA 5LCKA 1OMWA 3NUUA 4X3FC 2C5NA 3F61A 2UZDA 3I5ZA 3NUSA 3BRBA 4W9XA 3GQIA 2YIQA 4AGCA 4Z7HA 2WMVA 5JGDA 3QF9A 2WTKB 4MYGA 3C1XA 3CD3A 4OBOA 5AUWA 3VS1A 3ZXTA 3VW6A 5BUIA 2XM9A 4RA5A 5EYKA 4EKKA 4BDBA 5CWZA 2PZPA 2PUIA 3UO4A 4FYNA 3DNEA 3JXWA 4YC6A 3OHTA 5AFVA 3U55A 2F2CB 2YM6A 5ETFA 3RM6A 2PE2A 2QODA 3QD2B 4F9AA 1M17A 4NWMA 3IOKA 5E1SA 3VS2A 4TNDA 2C0TA 2XKCA 4WRSA 3RZBA 4MQ2A 5FP5A 4DEBA 1H4LA 3GVUA 5ETIA 3R7VA 4AA0A 3WIKA 5M57A 3VS6A 3GNIB 3FUPA 1OL2A 4A9UA 3EFWA 3LFQA 3U54A 3KL8A 4CZUA 2C69A 4LMNA 4KIKA 3FI4A 3R1YA 4PQNA 3IDCA 5LMKA 2YERA 3FLYA 3KXGA 5DNRA 3RK5A 1R78A 2CLXA 2QO2A 4J1RA 3E8EA 4LG4A 4R7HA 5B0XA 1J7UA 2E9VA 5LQFA 1URCA 3O51A 4CMTA 1BL7A 3QTUA 4FSUA 3L8PA 2FSOX 3F3TA 3FAAA 4WG5A 4GMYA 4ACHA 5M09A 4C36A 5DIAA 2XK6A 3GCSA 3EL8A 1DAYA 3OWPA 5JZJA 1FMKA 3NNXA 2C6TA 3MWUA 5CXHA 4YZDA 4ITJA 3VUDA 4AOTA 1SVEA 2PHKA 3HVCA 3FY2A 1UV5A 2KULA 3FE3A 5JRSA 5C4KA 3QYWA 4PV0A 2PVNA 4M68A 4YZ9A 2BIKB 3WYYA 4EHGA 3L8XA 5L2IA 4CFNA 3DKGA 1XJDA 5CXZA 4FTTA 4GRBA 1ZMUA 3R71A 2RFNA 3G9LX 1OL6A 5T6KA 3A8XA 2QURA 4TYHA 4EWQA 2DUVA 2FB8A 4EKLA 4O7YA 2BROA 1NVQA 4FV8A 3CSVA 4AFEA 4FKRA 4XP3A 4O7TA 3GI3A 2QOQA 4UMTA 1UA2A 3SG9A 4XUFA 4G9RA 2H6DA 4M3QA 4ZTNA 2J5FA 2QLQA 2Z7QA 3R1QA 4M0ZA 4M15A 3IDPA 3P4KA 3QHRA 3ZFYA 4PP9A 5M4UA 5HZNA 4QPMA 5EK7A 4FIFA 5HLPA 3VS3A 3Q4TA 4FKTA 1W8CA 3RPSA 2G15A 3LKMA 4L53A 3TUDA 3E3BX 4GH2A 2ZJWA 3QC4A 4YJVA 4ERKA 2XIYA 3ETAA 3LE6A 5HCZA 4BBEA 4CZTA 4FIIA 2GCDA 3D83A 1NXKA 4FTQA 2HY81 2EWAA 3FKNA 3VVHA 3EYGA 5EOLA 4L01A 5HG9A 4F63A 5M07A 2ZDUA 3BYSA 3EQDA 4DCEA 2QU5A 5CU3A 3R2BA 3BLRA 2OJFE 2WMUA 3EFLA 3BPRA 3HUBA 1OIQA 2PVKA 4QNYA 4APCA 3JS2A 4EH6A 4O0RA 4AUAA 4FV1A 3L9NA 4UY9A 3PE2A 5KMNA 3O17A 4H58A 3QX4A 3C4EA 3V6SA 3PVBA 2J0LA 1FVVA 2WEIA 2X7FA 3A7IA 1IASA 3QUEA 4LL0A 4TWCA 5CAUA 2CN8A 2GQSA 3R7IA 2XNNA 4V0GB 5CF6A 2PE0A 2R0IA 2ZB1A 2OH4A 4BCJA 1YI3A 3P5KA 4EOIA 4IM0A 1WBPA 2BIYA 3GP0A 2ETKA 3C4WA 1B39A 3OT8A 4FL1A 4YHJA 4EQCA 3N4TA 3Q60A 3R63A 5DT3A 3PRIA 2XK8A 4I41A 2WQBA 4DYMA 4DFNA 5GIOE 3TKHA 2YLEA 2VUWA 5CVGA 4WUAA 4RX8A 4PDPA 1WBWA 5IU2A 3E8NA 2WTVA 4HGTA 4FTNA 3QRUA 5AX9A 4FEWA 4MXYA 2XF0A 2RKUA 2XA4A 5JGAA 2DQ7X 3TT0A 4FBXA 3TNPC 5AR4A 3GB2A 5HNIX 4BCIA 3GCPA 3P78A 5A46A 3F2RA 1UKIA 3HP5A 3LOKA 3KKVA 5TOZA 3OY1A 4YJNA 5C4LA 1BUHA 2OZAA 4JQ8A 4KIPA 3GU7A 4O0SA 5IISA 5LOHA 3U6JA 3H4JA 5CALA 4ENXA 4PL4A 2OF4A 3E3PA 3FMKA 3EN4A 2HENA 4GT4A 2BUJA 1XH9A 4ITIA 2BAQA 3NYOA 3NGAA 5HG8A 2WTDA 4FNWA 4Q5EA 2W5AA 2VU3A 5AR8A 3KF4A 3MJ2A 1QMZA 4RJ8A 3ULZA 4CT2A 3UODA 3UOLA 2VX1A 3LQ5A 5FEDA 4OTFA 3PJCA 3P08A 3HA6A 4FZ7A 4D28A 3SW7A 4OLIA 5L6PA 4O2ZA 3ZZEA 1J7LA 4OBQA 3NNUA 3KULA 4H1JA 2QD9A 4FEQA 4XG3A 3ENHA 3UYSA 1E1XA 3NCZA 2UVYA 3Q32A 4PDOA 4RG0A 3ZONA 5J79A 2GNHA 2C6IA 2OWBA 3HLLA 4MAOA 4ZY5A 2XJ2A 4GKHA 4FUXA 2OO8X 3GCUA 1IEPA 4YZCA 5J87A 5DG5A 3WILA 4Z55A 3QTSA 3FLNC 3L8SA 4S2ZA 3QCYA 2P33A 4BI2A 1XH4A 3IW5A 4CGAA 3P7AA 3PJ8A 1YWVA 2QLUA 3HV4A 5J5TA 4LOOA 3C0GA 1QPCA 4ZSJA 4FC0A 3FXZA 2FGIA 1FOTA 2FH9A 3PSCA 1P4OA 5E7RA 5AP7A 3RAHA 2R3HA 4DC2A 2ZV7A 4ZIMA 4QTAA 3SXRA 5F9EA 4DEDA 4IB1A 3EQBA 3C9WA 4JBPA 4DAWA 1DI8A 5CEIA
chains in the Genus database with same CATH superfamily
3RM7A 3G6GA 3DZQA 4U79A 2X6DA 2F7ZE 2UW5A 2ZM1A 3R9HA 3AC5A 3F5XA 3NYXA 3OY3A 3LFDA 1CTPE 3DNDA 4IACA 3I4BA 5JQ8A 3PXQA 3TNWA 2R3GA 1Z57A 5HEZA 5AUUA 5IA2A 4R3RA 4R6VA 5H8EA 5H3QA 4C4FA 1IA8A 4AGDA 3NEWA 3P86A 4DG0E 3P23A 3VUMA 3LXNA 4PTGA 3MIAA 3E8DA 5A9UA 4Y95A 4YURA 3AKKA 1BX6A 1JKTA 3QTRA 5HVYA 2XK3A 4F4PA 1JBPE 3D0EA 5JFSA 2PMOX 2WQEA 3COIA 4QYEA 4EC8A 1FBNA 4H36A 5KKRC 2WO6A 5HE2A 3PWDA 3DBFA 4MBIA 4A4XA 3NAXA 1VYZA 1LEZA 2P3GX 1ZARA 3FLSA 3NX8A 4G6LA 2A27A 3V5WA 5E4HA 4EWHA 3RCJA 2YCFA 1YXTA 4XEYA 4W4WA 3OF0A 4J71A 1GIJA 4XLIA 3V8TA 3V5JA 2BRNA 2VTMA 3MBLA 5DOSA 4BZNA 1RQQA 1MRYA 4KINA 4NW5A 2HK5A 4MWIA 2OIBA 4RJ7A 4U80A 2C6LA 4EH5A 3LM5A 2NP8A 3PRFA 1UNHA 3QD4A 1V1KA 2QOKA 3QKKA 5E8WA 3ZDIA 3FI2A 2VTHA 1BKXA 2NO3A 2GNIA 4EZ7A 4LFIA 3EH9A 3QQKA 4JX3A 3VIDA 2RFEA 3G2FA 4IANA 3IW6A 4TWPA 4EZ3A 3RNIA 4QP3A 3TDWA 1NY3A 3TIZA 5EQPA 4AT3A 3DV3A 3ENMA 3Q9XA 3KCFA 3OVVA 3EIDA 3F82A 4YLJA 2WHBA 2CGXA 1OIYA 4A9TA 3TG1A 3TTIA 2BMCA 4PNIA 1Y6AA 5M44A 2QOLA 3R04A 5CEPA 3SGCA 4N0SA 3A2CA 1YI6A 4CFVA 5FEQA 2WIHA 3CY2A 2IG7A 4WO5A 3QALE 5E92A 2Y4PA 2X81A 3SOCA 2CKQA 3AG9A 2XS0A 3TMOA 5G6VA 5CNNA 3ZZWA 2W4KA 5HE0A 5AJQA 3LZBA 3QX2A 4DEHA 3VRZA 2IPXA 5A6NA 3HMPA 1XR1A 3NRMA 4RC2A 4FGBA 4HVDA 4LYNA 1FVTA 3E88A 2GPHA 3DCVA 3OXIA 1PXMA 4D1ZA 4P2KA 3B8RA 3TEIA 2I0HA 3Q53A 4P90A 4QTCA 1VZOA 4TKSA 2GHMA 4ZXTA 2BDFA 3DBQA 3LFBA 5JMSA 5I5ZA 3W2QA 4J96A 4D9UA 3RP9A 4GFMA 4XG7A 2EXCX 3UIMA 3TXOA 4OUCA 5M55A 3HV5A 3U8WA 2W9FB 2QONA 3LLTA 5JSMA 4XNEA 4CYJA 4BYJA 5FUTA 4UMRA 4FZAB 3QA8A 5C8NA 3CY3A 5ACKA 4C2WA 4FT5A 2PE1A 3HEGA 1YRPA 4FV7A 3PWYA 2W96B 3C5UA 2XYUA 4M84A 4HYIA 3BV3A 4LV8A 5H8GA 4B99A 3W0OA 4HGLA 2CGWA 3BE9A 2R64A 4DINA 1YHVA 1RJBA 1BMKA 4AS0A 4F08A 4V01A 3H30A 2UW3A 4BCMA 5D7VA 2J50A 4RJ4A 5AADA 1J1BA 4EI4A 5AAGA 3O96A 3FQSA 3VUGA 2WGJA 5M06A 2V55A 2OG8A 4X2FA 4OAUC 2Q0NA 3D15A 2YM8A 2IZRA 2E9OA 2HZ4A 1H07A 1GAGA 3UG2A 2UVZA 2EXEA 3QTIA 4FIEA 4X2GA 4YP8A 2QNJA 1DM2A 3IECA 3M1SA 4FSWA 4L3JA 1FPUA 4QD6A 4EOMA 2XP2A 3O7LD 4OTGA 4BRXA 5A14A 3DBDA 1OUKA 3GU6A 1WAKA 4FIHA 2OW3A 3FC2A 4JG7A 4LGHA 4L3PA 4QMPA 5GZ8A 1H24A 4EOQA 3H0YA 3FL5A 1PXIA 2XIZA 3UOJA 1KE6A 3W0RA 3QUDA 4GK3A 3DJ7A 3KRJA 4IADA 3DPKA 4GCJA 3R8UA 2C4GA 4B6LA 4O0VA 4DBNA 3DQWA 4O4CA 3AC1A 2BVAA 3DJ5A 4IWPA 5E8SA 3IONA 3RWQA 2FSTX 2JD5A 4QP1A 3CIKA 3ZEWA 2R3PA 2YFXA 2QHMA 4XV2A 3BWJA 5ANGA 1J91A 4DHJA 5AUTA 3R7YA 1YKRA 3HV3A 4NL0A 4GK2A 1FGKA 1L8TA 3LFNA 3RVGA 4IVAA 4KBCA 1LUFA 3KXNA 4KKHA 4W4XA 4QEBA 1YOJA 1HCKA 2CKEA 3QUPA 4NU1A 4G5JA 4M7IA 4FA2A 3RJCA 4EOLA 5BYLA 4GFOA 3TKUA 4TZRA 3W55A 5EM5A 4FNZA 1IG1A 2B9IA 5IH4A 4MD7E 3V04A 2XYNA 2YACA 4GUBA 5EDRA 2YN8A 3CLYA 5EHYA 5A4QA 2V22A 4D4RA 4BTFA 2VTNA 3R02A 3MH2A 4IAYA 3JVSA 2VWUA 4G3GA 4ALUA 3VWAA 4R7IA 1QPJA 1CDKA 2VTTA 2ZYBA 2W7XA 5DR9A 3SG8A 4RIYA 3I79A 5HE1A 4R8QA 3A7HA 4FK6A 4AA5A 1JKKA 2QC6A 3OFMA 5C1QB 2ITQA 2CN5A 2F2UA 5EI8A 5I4NA 5DR6A 5AX3A 4F7SA 4C4EA 4DEIA 4EYJA 3V5TA 1Q8UA 4BWXA 5A3XA 3W18A 3MB6A 5FWKK 2G2IA 4AW0A 4PNKA 5BQ0A 4HYSA 4G3FA 3ML1A 5CAOA 4FSYA 3F5GA 4XS2A 5LXMA 3WI6A 4USDA 4AQKA 2GHLA 1U46A 2R2PA 2X8DA 3GCQA 4YTIA 5HD4A 4G16A 4KIQA 4L45A 4QQJA 4O84A 3U6HA 2IVUA 4MD8E 4O4FA 3K3JA 3MY1A 4LRKA 5FG8A 5BVEA 5FTGA 4F9BA 3O71A 3HAVA 5CSHA 4DH7A 4ENYA 4TXCA 4AWIA 5K5NA 2OSCA 2YAKA 3BHTA 3WF5A 4DE4A 4MX9A 2YCQA 4O7WA 3QRKA 2G01A 4A9YA 1V0BA 2BFXA 1KSWA 5CEKA 1YOLA 3EZRA 3HV6A 4RJ6A 5L4QA 5IKWA 4OTDA 3SOAA 3ORNA 4D2VA 3E93A 5IQEA 4X7QA 5ETCA 3RPOA 3EFJA 4IH8A 3EQCA 4BDAA 4IC8A 3HX4A 4D55A 2V7OA 4IB0A 1REJA 2VTIA 2FO0A 3MH0A 5K0XA 4FGRA 4F99A 4ANLA 2FSLX 4F6UA 4BI0A 3W0PA 5CANA 3U9NA 3NS9A 2Z2WA 4F0GA 3RNYA 4ZMEA 4LGDA 3KN6A 3ORLA 4XP2A 3OCTA 3D5UA 3FMEA 3VW8A 2OZAB 2J9MA 4XRJA 5CS6A 4AZTA 1KE5A 4YJSA 3BYMA 4MNFA 5GZAA 4FTRA 3Q4ZA 4NYEA 3GUBA 1BLXA 2XBAA 4BWPA 3GC8A 4NH1A 3UE4A 4BDGA 4CT1A 2YJRA 2B7AA 1GIIA 4FI1A 3EJ1A 2YA9A 3NSZA 3OUKA 1Q5KA 5I3OA 2XK9A 3F3ZA 3PFQA 3PXZA 3SV0A 4B4LA 4ZMFA 4LOPA 3D7ZA 3ZFMA 3DBEA 1NVSA 3NIEA 5CEQA 3POOA 4ACDA 4ANOA 4D1SA 4O81A 2RG5A 2VX0A 4L7FA 2CJMA 3S00A 2W1DA 2GFCA 4GYGA 4YMJA 2ZMDA 3KULB 3TCPA 5CF4A 4MXAA 4EOSA 3HDNA 5IPJA 3QZGA 3SA0A 4O7LA 4DCAA 2B4SB 4K8AA 2W1IA 5HVJA 4JRNA 5DRBA 2VNYA 3FSKA 4IX3A 4UYAA 2NRUA 4WOVA 2WXVA 4UXQA 1SVGA 5BVKA 3MA3A 2YIWA 4NJDA 5BVFA 3SC1A 4FOBA 4RGJA 4HCUA 4FSTA 4FV4A 4EJNA 3MFTA 2G2FA 5GNKA 4HZRA 4JJRA 2OLCA 3RAIA 5E8YA 2XMYA 4QMXA 5CX9A 4F7NA 2X0GA 5DT0A 3R83A 2XEZA 3RZFA 1PKGA 3TWJA 3POZA 4BTMA 3Q9ZA 3NWWA 2B55A 3AGLA 4RX9A 4EC9A 4U8ZA 5ANJA 4QTDA 1Y8GA 1OKVA 4IW0A 4QMSA 4ZJJA 3D5XA 3WF9A 2R3IA 3QRIA 5C03A 4OTQA 4AG8A 3K5UA 2X8EA 4ZTMA 4F9YA 3ZFXA 3FMJA 2PVHA 2YEXA 5K0KA 5B2MA 1UKHA 2VTAA 5HTCA 5CAPA 4WSYA 4O83A 2NRYA 2A4LA 2JIUA 3SAYA 3RMFA 1H8FA 2A19B 4FKLA 2QKWB 3RI1A 4YUQA 4Z16A 3LCSA 2UZEA 4RIWA 1OPKA 2IN6A 3HRCA 4G3EA 4I6LA 2VO3A 3KXHA 3KRLA 5IZFA 1BL6A 2A0CX 4IAFA 3F2AA 2WTIA 5AMNA 2YCRA 3MV5A 4BCKA 3FZPA 3QA0A 3QXOA 2J0JA 5BVOA 2OXYA 2Y7JA 4CFUA 2LGCA 4EORA 2XUUA 1PXKA 3DXPA 3E7OA 4J7BA 3R9DA 3CXWA 2I0VA 3E7VA 2AQXA 2Y0AA 3QQUA 4G9CA 4S31A 3VBQA 4EOPA 1JKLA 3R8PA 1TKIA 4FSQA 4I20A 4CTBA 4Q5HA 5AAFA 3U51A 3NR9A 2EUFB 3Q52A 4D4SA 2VRXA 4KRCA 5ANIA 5CZHA 3ORTA 3UZPA 4FEVA 5FD2A 2QOBA 4IX4A 3FWQA 5HTBA 3GCVA 3GC9A 2XCKA 4RVLA 3QKMA 2FYSA 3G0EA 1OGYA 2XIXA 2B54A 2W05A 4YTCA 4BR3A 3LFCA 5AP5A 3QL8A 3V5QA 5LMBA 4ZP5A 2HELA 5DN3A 2NYAA 4HW7A 2EVAA 1OIRA 1AGWA 3FY0A 4I0RA 1ZMWA 2CKOA 5AAEA 3BCEA 4X2NA 1G8SA 2E9UA 4EH8A 3VUIA 4BDJA 3PVGA 4HPTE 3MH3A 4FIGA 4KRDA 5FDXA 2R3MA 3JY0A 3PIYA 1KE9A 4E4MA 5JRQA 1YDSE 2C5OA 4KA3A 5FGKA 3UZRA 4CG8A 4QOXA 4G3DA 2IO6A 4JQEA 4QQTA 3LMIA 1OIUA 3DKFA 3R30A 5L8JA 1Y57A 4R1YA 3G15A 4DGGA 4C2VA 3UPXA 1PY5A 5BYZA 3VF9A 4YJRA 2I40A 4Y5HA 5DVRA 3KXMA 2XZSA 4YC8A 3EB0A 3OWLA 3HZTA 5E90A 4AQCA 2F7XE 1R3CA 2OBJA 3AC2A 2B1PA 3DAEA 5F1ZA 4FEUA 4I21A 2Y6OA 3I60A 4Y85A 2RF9A 5HHWA 3WOWA 4PL5A 1VJYA 2PL0A 3AMAA 4RRVA 5IQAA 4ACCA 3PUPA 5EQEA 1PXNA 5TE0A 5CVHA 5HNBA 5C9CA 4CKRA 5HIBA 4E5WA 3ZLXA 3BHHA 4PX6A 4NM3A 2NPQA 5L3AA 5K5XA 5JFXA 2JBPA 5KMOA 5FQDC 4WRGA 5EI6A 2JAVA 2WTCA 3UG1A 4DFYA 2HZ0A 3LW0A 4F09A 5FTOA 5A4EA 4UALA 4RPVA 3VBTA 3H0ZA 5JEBA 3UOKA 1TQPA 2YIYA 3WF8A 3O8UA 5ANDA 5D9HA 4YJTA 2A1AB 2UW0A 4YC3A 3TJDA 3HL7A 1B6CB 4RIXA 3VJNA 3ALOA 4JIAA 4E6CA 1CKJA 3KF7A 5DRDA 4O4EA 2YABA 5FXQA 2CDZA 2C1AA 4BCPA 2OJJA 3QHWA 4HOKA 4ZK5A 5GHVA 4OTIA 3ZTXA 4WHZA 4WT6A 3C0IA 2C68A 4R78A 5KO1A 4O0UA 4N4SA 4BBFA 2IZTA 4XG9A 2WKMA 2R0UA 4FR4A 1XBCA 4GG7A 1XBBA 1PW2A 1ZY4A 4FTUA 4WNPA 4YPSA 4FG9A 3KRXA 4ZSGA 2W1FA 3QQLA 4OW8A 4AU8A 3G9NA 4JBVA 2XCHA 1J3HA 3D2IA 3KA0A 4BDIA 3IKAA 3G5DA 3ZLYA 2WTJA 5DLSA 2RIOA 3FSFA 1OECA 2GNFA 2ZVAA 3C13A 4FRFA 2PZYA 2OH0E 3I5NA 5F95A 5C01A 3KVWA 1R0PA 3SW4A 3UC3A 3N4UA 4UN0C 2OJGA 3LCOA 2PUPA 5IQFA 3TZ9A 3H9FA 3PLAE 3D2KA 2JDOA 3ACJA 3PTGA 2PVJA 5KZ0A 2PUUA 2XK4A 5LVOA 3ZHPC 4BTKA 1OKYA 4C0TA 2PTKA 2VO0A 2ZV8A 2QQ7A 1W84A 3VHEA 4F1MA 4TY1A 3PSDA 5CYIA 4B9DA 4BC6A 5I9YA 1O6YA 1Y6BA 5J9LA 3W2OA 1JSVA 4AN3A 3MYGA 4JXFA 3REPA 5AEPA 4O27B 4I93A 4QYFA 2UW4A 2DWBA 4IJPA 5HTIA 3TUBA 4WG3A 4AZWA 2YIXA 2W0JA 4WBBB 4ZZNA 1LEWA 2HXLA 2UW9A 4O7NA 3JYAA 4WKQA 3TYKA 3IS5A 2IVSA 3FMNA 1W83A 3ULIA 2UZOA 2PY3A 4UZHA 5J7BA 3COMA 4AN2A 3KVXA 4L9IA 4MHAA 1OI9A 4JOAA 4EHEA 4GK4A 4FTLA 3FJQE 2XNEA 5FTQA 1UU8A 4DLJA 2J7TA 3CJGA 1JQHA 2Q0BA 4CCUA 2J6MA 3SLSA 4YJQA 2GSFA 3OROA 2JITA 1IAHA 1YWNA 4K33A 3RK9A 2W17A 4O7VA 3UDZA 3UVPA 5M53A 3G0FA 4QP7A 2WMWA 3OXZA 3CS9A 1GJOA 4JBQA 1STCE 3VAPA 3FLZA 3DZOA 3UNZA 1M2QA 2P4IA 4QMOA 3K3IA 3OCSA 4IHPA 4JAIA 2YDIA 1PJKA 1GNGA 4AW2A 3ORMA 1YI4A 4I6BA 3NNVA 4ZLYA 4DGMA 4IAAA 3QFVA 5DH3A 2WZJA 3MSSA 3V5LA 3ZYAA 2X7OA 5A4TA 2RG6A 3UMXA 2OXDA 3BLHA 1L3RE 4YJPA 3VC4A 3DT1A 4RIYB 4TL0A 4EHZA 4DT9A 3I6WA 5HLNA 4M14A 5H9BA 5IEXA 2GQRA 4L3LA 2ONLA 2ERKA 4G17A 4QMWA 4I22A 4U81A 3CBLA 3U4WA 4BKJA 5HCXA 1OL7A 4KS8A 5I9WA 4F64A 4KB8A 1OBDA 3IGOA 5EQYA 4G5PA 5CF8A 2QOFA 2OKRA 3ORIA 4G6NA 4KSQA 4F0FA 1X8BA 3IW7A 4PPCA 3Q6WA 4NZWB 4QMZA 2XNPA 3ZRMA 3ZUVA 5BV3A 3CTHA 3PY0A 4E4LA 5IMEA 4O38A 3QQJA 1WFCA 4E6AA 4QPAA 4A4OA 3DJ6A 4B0GA 2R7IA 1PF8A 1YQJA 2C47A 3LXKA 1VYWA 2R3NA 2X9EA 2ZAZA 3ZH8A 2YJSA 1G8JA 3OOGA 3K2LA 5CLPA 3GEQA 3QGYA 3PXYA 4TNBA 4GJ2A 3UNJA 4AT4A 3WYXA 4K1BA 3QZHA 3BBTB 2X0QA 1PMNA 3CCNA 4XMOA 5KMKA 2ESMA 3C5IA 1QPDA 2I0YA 2PYWA 3AKLA 3QQFA 1JSUA 2KTYA 4GYIA 3CEKA 5J1VA 3R9RA 3K5VA 3OTUA 5DHJA 1W7HA 2PMIA 2V0DA 2GU8A 1YHWA 1UNGA 3P7CA 4OT5A 4TW9A 3CD8A 2J4ZA 2OIQA 2H96A 3A60A 3CQUA 4B7TA 2DYLA 5ANKA 3DKOA 3KFAA 4EH2A 3DOGA 4LQMA 3KK9A 1UNLA 1GZNA 5D1JA 4CV9A 4AXDA 2AC5A 3P7BA 3V01A 3UMWA 2QHNA 4JAJA 2QG5A 3BYUA 2WQOA 4FTCA 4I4EA 5CNOA 5HG7A 3NUXA 5LVMA 2AEGA 1JOWB 5FXSA 1ZOGA 3Q5ZA 3FXWA 5M4IA 4O6EA 4C8BA 2UZNA 3D4QA 4ONAA 1ZAOA 2VGOA 3EN7A 2W9ZB 4J8NA 4XG8A 2PPQA 5DR2A 2VAGA 2WIPA 4UYNA 3UDBA 4DH5A 4RWIA 5IQGA 4YLLA 4HVSA 4AZEA 3QRTA 4QO9A 5HQ0A 3I7CA 4L52A 4LL5A 3F3VA 2C3IB 4Z9LA 4AZSA 4FT0A 1TZDA 3BBWA 5ACBC 4YZMA 4NCTA 4I5CA 5D11A 4O1PA 3IQ7A 2BPMA 4CQEA 4M13A 2YWPA 4N6ZA 3NW7A 3QBNA 3L9PA 2QO7A 4FNYA 4Y72A 4M8TA 4U42A 5DBXA 3W2CA 3PPJA 2GS6A 2PSQA 2WOTA 3Q4UA 2W5HA 4G6OA 3ZOSA 4PDSA 4M0YA 3LJ1A 1JPAA 3D5WA 1P2AA 3P79A 3NPCA 4CYIA 4ZSAA 4O1OA 2XNBA 2YM3A 3S4QA 4NIFA 2PZRA 2Z02A 4GW8A 1F0QA 1UU7A 2VWYA 3H9OA 3ZU7A 4LV5A 2E2BA 3FHRA 2WNTA 3W2RA 3TNIA 4IB3A 4BVUA 3QZFA 5CAVA 5IMXA 3LAUA 2VX3A 4PMTA 2IEWA 3UIBA 1Q3WA 4CRLA 3THBA 3FMDA 4R3CA 2VTSA 2R9SA 1Q8ZA 3LCTA 3R7UA 3DAKA 3OD6X 4PP7A 4BJJA 3P1AA 3BHUA 4U40A 4TYGA 3EOCA 3AT2A 4HYUA 4L7SA 2PUNA 2V5QA 5CT7A 4KUJA 3TM0A 4PY1A 4GJ3A 2PZ5A 1UVRA 3M42A 5CQWA 5HE3A 4C61A 2RFDA 2DS1A 3MA6A 4FTOA 3GXLA 3U9CA 4PL3A 2BTSA 3MPMA 3Q9YA 4FKWA 1LPUA 1H27A 4J95A 1M52A 5J8IA 3WZUA 5L6OA 1M7NA 4ID7A 4WBOA 2WMSA 5KKRB 4JDKA 2BDJA 2GNGA 4X3FA 4QMMA 5BNJA 3OTVA 3BWFA 2JKOA 2XKDA 5E8TA 1DI9A 5AV1A 5IG1A 4MWHA 3R8MA 3UIUA 4RWJA 5A6OA 3GGFA 3ZM9A 2VTJA 4RIWB 2CGVA 3E62A 2WPAA 5AV2A 3HRFA 2W06A 2JKMA 3R7EA 3F9NA 4P5QA 4W4VA 4DEAA 4E93A 2P2IA 3AT3A 4EQUA 4J99A 2XJ0A 3SQQA 4AOJA 2CNQA 5KMMA 4YNEA 1WVYA 1O9UA 3HV7A 5HGIA 4OBPA 2R7BA 4E7WA 3TACA 3PFYA 5AR7A 2B9JA 3C4XA 5TT7A 2UW8A 1PYEA 2CSNA 2GMXA 4B8LA 4BKZA 2IZSA 3QU0A 2NNWB 3B2WA 3IPHA 4M66A 1EH4A 4O21A 4M67A 4MEDA 1LP4A 3GOKA 2C6OA 3S95A 5JK3A 3OEFX 2JFLA 3GFWA 1JLUE 1KV1A 2XB7A 3EN5A 5LARA 4WSQA 2O8YA 2RSVA 3MB7A 4BF2A 3H10A 3ZUTA 2X8IA 3O0GA 1XKKA 2WMXA 2QKRA 2PVYA 2QOCA 4UZDA 5BVWA 5L2QA 4DEEA 2F4JA 5AUVA 3T8OA 3OOMA 4H1MA 1XH6A 3SXSA 4F9CA 1SNUA 2XRUA 4ZTSA 3EWHA 4L6QA 1IRKA 5KNJA 4L00A 4FKGA 4OTHA 4I4FA 2YWVA 3TI1A 2WB8A 3NMUF 3VJOA 2JFMA 2G9XA 1XH8A 1J1CA 3A4OX 3W0QA 2XKFA 3CPBA 4QP9A 3KCKA 4Y83A 4KD1A 3S2PA 2W4JA 4RWLA 5EW9A 5K9IA 3IDBA 3E92A 3QLGA 4M69A 3UZTA 3MS9A 3RBWA 3LJ2A 5DGZA 1XH5A 2UUEA 5EDQA 2OI4X 2JKQA 2YDKA 4ZJIA 3FC1X 3LCKA 3ZCLA 5M4CA 2ITZA 3LM0A 4BY9E 1YDRE 4U9AA 5HESA 4WNKA 1YVJA 3LIJA 2WAJA 4YSMA 4HVHA 1PRYA 2PU8A 4GEOA 4TWOA 2CCHA 1PMEA 4AW1A 3R6XA 4QYYA 2J2IB 4GU9A 3UGCA 3WF6A 1WZYA 4CFFA 4BBMA 4CFMA 4DFBA 1UU3A 1ATPE 4I5PA 4BCQA 3RWPA 4R77A 2E9PA 2XEYA 4GIIA 2JDRA 3W32A 4U5JA 3DKCA 4C4HA 1VLRA 5LMKC 2IW6A 3D9VA 4X2KA 4FT9A 5AUXA 4IWOA 5L8LA 2BZKB 4HCVA 1RDQE 2J90A 4ITHA 1H1QA 5IUGA 1PXPA 3AC4A 3LMGA 4C34A 4BICA 2CCIA 4TT7A 5CSVA 2R3QA 3B2TA 4MBLA 3U6IA 3ROYA 3BU3A 4RBLA 3EQHA 4OTWA 4RIXB 2ITNA 3OXTA 1TQMA 4MH7A 3VUHA 5M56A 1YXUA 2YISA 3OZ6A 2W4OA 3FMMA 4O7RA 3R2YA 4K11A 5JQ5A 3G90X 3DFAA 5EKOA 3NUPA 3NAYA 5L6WL 4D0WA 4EH7A 5DEYA 4O22A 4XHKB 4XH6A 4ALWA 2HWOA 4O82A 3QTWA 3PA4A 2XJ1A 3A99A 4OT6A 3UQGA 4H3PA 4YSJA 4O86A 2QOIA 3I0QA 4BIBA 1U5QA 2BFYA 2UW6A 3OCBA 3CPCA 3PG1A 1ZZLA 5D12A 4CLJA 3Q04A 5HORA 3O7LB 4TRLA 3TNQB 2H9VA 4ACGA 4DGLC 1A9UA 3T9IA 4V05A 2BCJA 1GY3A 4RLLA 2FSMX 3BEAA 4GSBA 1KV2A 4J98A 4BB4A 4MXOA 1OKZA 4ERWA 4G3CA 4FV6A 4IAKA 3R8LA 5H2UA 3QD0A 4JIKA 1WMKA 1P14A 4IZ7A 4JI9A 2A98A 3R73A 4YLKA 4IDTA 4A4LA 4EH9A 4H39A 4IIRA 2I1MA 3DB6A 5LVNA 3VBYA 4NTSA 5ANEA 4PF4A 4QMQA 3F2NA 1UU9A 2VWZA 4JQ7A 4EOJA 5ITAA 3R9OA 4PMSA 3NUNA 3ZMMA 4ZY4A 2X4FA 5EM6A 5KBRA 5KMJA 2VV9A 1SYKA 3PJ3A 1ZYLA 2WQNA 1ZWSA 1H1RA 3FBVA 4NJ3A 4I3ZA 4ZZMA 4IX5A 3NCGA 4GU6A 5JFWA 3FZRA 3OS3A 3T3UA 4EK5A 3MGYA 5E8XA 3VN9A 2BZHB 3V6RA 1PKDA 4XRLA 1W0XC 5D7AA 1MUOA 3A4PA 3FZ1A 3BI6A 4WD5A 2VWVA 2VN9A 4FTMA 2R3JA 4AAAA 3BEGA 4BHZA 4PPAA 3PXKA 4BZDA 5E91A 5EKNA 3KXXA 3TDVA 2UZTA 4ZTHA 3W2SA 4IZ5A 5CF5A 3RGFA 4FKIA 2CPKE 3I0OA 3P9JA 5EW8A 1Q4LA 3CTJA 5I3RA 4X3JA 3TV7A 5GZ9A 4YR8A 3ITZA 3ZC5A 4IVBA 1JVPP 4K6ZA 3KMUA 2ACXA 4IMYA 3R9NA 4M12A 4YGAA 4X6QC 3WIGA 4AGUA 4E5AX 2YDJA 4AXAA 4JL9A 3ZEPA 1PXOA 3AT4A 4ASEA 3VS7A 4U3ZA 4MCVA 4YHFA 3UBDA 3EYHA 2OU7A 3PE1A 2JDSA 5BVNA 3FMHA 3GU8A 3C50A 3R28A 5CZIA 4IEBA 2X2LA 4D4VA 4DFUA 2XIRA 4FG7A 3VUKA 4FL2A 2HYYA 5CT0A 5I9ZA 1SZMA 4RFZA 4EJ7A 2QR8A 2ERZE 3EKKA 4OR5A 4QRCA 5EHOA 3TTJA 4BDHA 4BGHA 4CRSA 2YCSA 3VRYA 1YHSA 2XVDA 4QNAA 2XBJA 5AV0A 3UDTA 2C3LA 5M08A 5FM3A 5C27A 4I6QA 4YTHA 2V62A 5AWMA 2X39A 2JDTA 4JRVA 5IH6A 4E73A 4ZOGA 3OW4A 3VO3A 1CM8A 3F6XA 3FQEA 4U6RA 3M11A 1GIHA 2SRCA 4FZFB 2BRGA 4NT4A 1ZOHA 4IFGA 3DU8A 3QYZA 4QMYA 3VQHA 3DS6A 1CSNA 4IVCA 3QXPA 3KGAA 5EFQA 2JDVA 3ZSGA 5AM7A 5IQIA 3MVMA 2XKEA 3NNWA 5CU6A 3W1FA 5IA3A 4XX9A 1PXJA 5IDNA 1S9IA 2Y4IC 3FQHA 2GTNA 5BPYA 5T3QA 3Q96A 3BGQA 4O0YA 5HO8A 2BRBA 3KN5A 5B2LA 2UZBA 2QOHA 4CLIA 5E8ZA 2OXXA 3GBZA 2IVVA 4U44A 5AR2A 3D5VA 4XYFA 1I09A 4D2WA 2UZUE 2JIVA 3MVHA 4EHVA 1R0EA 2W1CA 3RCDA 2BHEA 5BYYA 2X1NA 4LGGA 4C02A 4QMLA 5GJFA 2WMBA 3MI9A 3TUCA 5CSXA 2XM8A 3BV2A 4BCFA 4BGGA 4HYHA 3DK7A 3JPVA 3BYOA 4FTIA 4BL1A 2CHLA 3QTXA 3UOHA 2PVRA 4WNOA 5CVFA 3OT3A 2B0QA 3L9LA 3OBJA 4IB5A 4FIJA 1HCLA 3CGFA 2R3RA 4U0IA 4ZAUA 2I7QA 3GU4A 5C8MA 5KMLA 3R1SA 2QO9A 3Q2MA 4B8MA 1Q41A 1MQBA 3NYNA