1O6LA

Crystal structure of an activated akt/protein kinase b (pkb-pif chimera) ternary complex with amp-pnp and gsk3 peptide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Crystal Structure of an Activated Akt/Protein Kinase B Ternary Complex with Gsk-3 Peptide and AMP-Pnp
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1o6lA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1o6lA02
3FI4A 2R9SA 4U80A 2Y8OA 4O0UA 1ATPE 3CKWA 3P7CA 3C4XA 5E91A 2JEDA 4N0SA 4YNOA 4IB0A 3Q5IA 4FSUA 4LUDA 3CC6A 4G2FA 3GCUA 3HMMA 4BB4A 3UOLA 4XCUA 2BZKB 4MX9A 4MD9E 3COKA 2GS2A 2WMRA 2VZ6A 3PVGA 3O2MA 3QGYA 4QQCA 4XLVA 5JKGA 3EZRA 5HCZA 3LQ5A 3E8NA 3TIZA 1A9UA 4MXCA 4DFNA 4IACA 1JSTA 3FZTA 4KBCA 4ZTRA 3RAWA 5CSPA 3UBDA 2XCKA 4LFIA 3FYKX 2VX3A 1J91A 3G51A 2EB3A 3UODA 3D5VA 5ITAA 5HLWA 1R39A 1XH7A 3V8WA 4TZRA 2QU5A 3R01A 4GJ2A 4IBMA 5L2TA 5CAOA 4PDOA 3G90X 4O38A 3ZBXA 3L8VA 4OR5A 4CD0A 3WOWA 3NIEA 4AN2A 2W9FB 3HP5A 4E6QA 3REPA 1IEPA 4U8ZA 4DLJA 2CHLA 2AYPA 2R3MA 4YHJA 3DGKA 3RZBA 4HYUA 4G1WA 3OUKA 4E20A 2HELA 3GU6A 5EQYA 3PIYA 1OIQA 4I0SA 4FV2A 2XNBA 5DRDA 5L8LA 3AD6A 4JDKA 2VWXA 2CGWA 4QMSA 1W0XC 4IZ5A 4FMQA 3PJ3A 2WGJA 2YWVA 1MRUA 2ONLA 3GENA 4L8MA 5J9ZA 3MPAA 3QU0A 2QG5A 4RLKA 2R2PA 3O50A 4FV9A 4ACHA 4BHZA 4H3QA 1W7HA 4IX3A 5B0XA 3RJCA 4EORA 4YC6A 1R3CA 4RJ3A 4RWLA 5EYDA 3ZUTA 4PDYA 4ASZA 5CX9A 4KB8A 4OTWA 1YOJA 3BRBA 5D41A 5AP5A 5IEYA 2EWAA 2JKKA 4HVHA 1UNGA 1H1SA 1T46A 1B38A 4GK2A 4OT5A 4RWKA 5H2UA 3V51A 4F1OA 4ZOGA 4ZTLA 3VNTA 3R7EA 3UDBA 2EU9A 5BX0A 3MH0A 3QC4A 3KC3A 3S0OA 3TJDA 4F9CA 4EOSA 4YJRA 2YIRA 4NM7A 5CEIA 4QP9A 4BDCA 3BQCA 1Q41A 2IWIA 4Y85A 5T3QA 3RCJA 2GCDA 4JJRA 2W4JA 4FSRA 5C8MA 5GIPE 2VTMA 4M15A 1PRYA 2BVAA 5KMJA 3R0TA 1LUFA 5BMSA 5EW3A 4OBOA 5E8TA 2HW6A 4NM0A 4PWNA 2VTSA 4QPAA 4JXFA 2VO0A 2E9VA 2UV2A 2XM8A 4FNWA 4XBUA 5CXHA 1ZOEA 2A4LA 2X2LA 3ALOA 3DS6A 4PTEA 4JBVA 4J7BA 4XS2A 5BPYA 4CKRA 3LMGA 2YAKA 3IG7A 4EOPA 2RL5A 1WBNA 3ZHPC 3QTRA 5C4KA 4C57A 5L2WA 4ZY6A 3BHHA 4Z9LA 4CG8A 4JBQA 4KNBA 4BDDA 3IECA 3V5PA 3QTSA 4NW5A 4AT3A 4DAWA 5D7AA 2FYSA 3EFWA 5CSHA 2YIYA 4GV1A 2W5HA 3PXKA 3ZU7A 3T3UA 2E9UA 5DR6A 4G5PA 4UZHA 3RWQA 3NZ0A 4AOJA 3IDCA 2YEXA 3I0QA 3JXWA 4U81A 4RRVA 4I24A 1DM2A 3O51A 3F3VA 4OTGA 5IF1A 3DQWA 3DV3A 3QX4A 2YACA 4BICA 5BUIA 5EQPA 3VS0A 3OP5A 2HENA 2O8YA 2WO6A 3OC1A 2P0CA 4PY1A 4QQ5A 2ITPA 3ZTXA 2J0LA 4J52A 1YQJA 3R9HA 3MSSA 3P1AA 3GEQA 2CJMA 4LRJA 5AMNA 2XZSA 1F5QA 5LQFA 3UGCA 4PF4A 4RIXA 3FXZA 4CTBA 3VWAA 3C4EA 3VRZA 4B0GA 4MAOA 2OSCA 4I5CA 4FEUA 5JRSA 4O7ZA 3UIMA 4FNZA 2XNNA 2PE1A 2W9ZB 5FTQA 3BBWA 4RWJA 3EMGA 4QQJA 4TWOA 4A4LA 1WBVA 4BIDA 5K5XA 5ANKA 3UZTA 2WMUA 1JQHA 4OGRA 4IHPA 4RFMA 1ZYCA 3VRYA 4BR3A 2WTCA 4QYGA 4M69B 3MPMA 3MWUA 2PMOX 4QQTA 4NYEA 1OIYA 2ZMCA 5J8IA 5TO8A 3TKIA 4MVFA 5TR6A 1GIHA 2OIBA 5JFWA 2WFYA 1ZRZA 1VYWA 4F9AA 2WMSA 4RC2A 3OW3A 2XJ0A 1Q62A 3NX8A 3HAMA 2X8IA 4YO4A 4RJ6A 4GH2A 5EFQA 1A06A 3QKLA 3OOGA 3Q52A 3R9DA 3FI2A 3G9NA 3MH3A 3HRBA 3BLQA 2WTWA 3MPTA 4I23A 2VO6A 5AA8A 3D14A 5H9BA 4FTRA 3QUEA 4BWKA 4MK0A 3AC4A 4OUCA 1B6CB 2O64A 4IAZA 4QMPA 5I3RA 1H8FA 3VHEA 3RHXA 1H4LA 1OMWA 2WMBA 4TN6A 4G6NA 3IO7A 3RK5A 1ZYLA 4QMXA 4EH6A 1O6KA 3DFCB 3Q4CA 4PRJA 1RJBA 2YDKA 2YM3A 4FZ6A 2XRUA 4QP4A 3I6UA 4R1YA 5DR2A 2CPKE 3C0IA 1BI7A 4P4CA 3QAME 4AZTA 4NW6A 4AGWA 3BZ3A 4I0RA 3IGOA 1WBOA 4ACMA 4FV5A 3PG3A 2YERA 4KKHA 4MEDA 4DH7A 2Z02A 3DY7A 2PY3A 3G6HA 3GVUA 3M1SA 3ORKA 3U8WA 2CGUA 3PZEA 3R2BA 2A2AA 4Y5HA 1FINA 4JDHA 4DH1A 2PULA 4IAFA 2XJ2A 2C6DA 4K6ZA 2ITWA 3DZQA 4L42A 3QGWA 4XEYA 3EN5A 5CAQA 2WAJA 3OCSA 3QZIA 5HESA 3AC8A 4MTAA 4RFYA 3EJ1A 2WTKB 3WYYA 4KIKA 4F0GA 4CEGA 3ZOSA 3OXIA 2WMQA 4QMYA 4UMTA 3N9XA 3TNPC 3TDVA 4KUJA 2CSNA 4YSJA 2PVYA 2CN8A 1OZ1A 1E1VA 3DU8A 3NVMB 4UYNA 4I1ZA 3HAVA 1PKGA 4D5HA 2J50A 4EYJA 2YCRA 3GUBA 3DDQA 1VJYA 1GIJA 4FIIA 5E8YA 4PP7A 4FV1A 1H26A 2EB2A 4LUEA 5HBJA 5DN3A 1OBDA 3ZLXA 3VS6A 4CCUA 4TL0A 4FTAA 2Q0BA 3ZH8A 3M42A 4O7YA 3H3CA 2R3KA 4K8AA 5F20A 5LCKA 4FBXA 3H9FA 3EHAA 4AP7A 2X39A 4YZBA 4ZAUA 3UG1A 4NM3A 1CKIA 4RIOA 5AP4A 2G2FA 3AGLA 2WTJA 4WOVA 1W82A 2PE0A 4C36A 4OAVB 2OGVA 2OZAA 4GL9A 5CI7A 3ET7A 1Q8ZA 1KOBA 5AR5A 1Q61A 1FVRA 2HZNA 2V55A 4WG4A 2OLCA 3MDYA 2JDTA 3FZSA 1GZOA 1HCKA 3M11A 4FL2A 5CZHA 5AV2A 5M4IA 3ID6C 2JFLA 2W7XA 3O17A 3PUPA 3T8OA 5DHJA 4NJDA 3R9NA 4F7JA 3H0YA 4CFNA 3LMIA 3ZO3A 4ENYA 2VAGA 1Q8YA 3BYOA 5AEPA 3FDNA 4RJ4A 4Y46A 3WYXA 2H6DA 2X7GA 1FMOE 4YHTA 3NW5A 3R8ZA 5L3AA 3KCFA 5KMKA 4RQKA 4APCA 3BYVA 3BQRA 4ZTNA 4BTJA 4U3ZA 1GNGA 3DBCA 5FTOA 5DNRA 4BCOA 2QI8A 4V0GA 5JN2A 3ZRMA 4O7TA 2C5NA 4BF2A 4LMNA 2QCSA 5T68A 2UZVA 4Z3VA 2XKCA 4C38A 4AGUA 2X2KA 4FF8A 4XHKB 4BKYA 1Q3DA 4FZ7A 1KSWA 3NNWA 4CFWA 4AFJA 5TKDA 3V3VA 1JKSA 4O7LA 5K0XA 1R0PA 2PPQA 2R3RA 4WG3A 4E6DA 4LM5A 5BVWA 5I0BA 4YLKA 4IAYA 3DT1A 4G3FA 4GVAA 5KHXA 4FV7A 1R78A 2PL0A 4FKJA 5IA4A 2BALA 4CV9A 5M44A 4QTDA 3RAKA 4O7VA 4HPTE 5HX6A 1ZARA 3WIGA 5A4TA 3EFLA 5FEEA 3HX4A 4IDTA 4E5WA 2B54A 3C0GA 5FXQA 5AP1A 3CBLA 2WMAA 3MW1A 4JG8A 5FXRA 1SVEA 4IH8A 4C4HA 1ZZLA 4ERWA 4K77A 1T45A 4D1XA 1URWA 3GCSA 3I5ZA 2BKZA 4IC8A 1LP4A 4BCKA 2ZOQA 5DH3A 2NRYA 2C6IA 2YWPA 3Q9XA 4NK9A 5E1EA 3H10A 3RBWA 2WB8A 3DJ6A 2J0IA 3DB8A 3LQ8A 2ZV2A 4BBFA 4R5SA 3DJ7A 4CG9A 3MYGA 1XBBA 5IA2A 1BKXA 3KEXA 1ZOGA 5ANIA 4DF3A 4M12A 2F2UA 3KGAA 3CY3A 3FMNA 4G9CA 4U97A 2Z7QA 2R7BA 3HL7A 4D0XA 5CI6A 3G15A 4IAKA 3K5VA 4V01A 2AC5A 5HEZA 2WQEA 4BCPA 3GP0A 5GINE 5AUWA 2WOTA 3QTIA 1UNHA 3HV4A 5TT7A 1OUYA 3SOAA 1XH5A 2ITTA 2RF9A 5J87A 2ITYA 4AW0A 4C4FA 3TEIA 2H9VA 2ITNA 3PIZA 5L8JA 4EONA 4C3FA 4GSBA 2PYWA 2WIPA 4DEAA 4JX3A 4D4YA 5A46A 2OICA 2XBJA 2FUMA 4I4EA 3U6IA 4XJ0A 4Y83A 5HLNA 2VD5A 4P2KA 4AA5A 4DINA 4FEXA 5HG5A 3FC2A 3FQEA 1YWNA 2FB8A 2WKMA 1GZNA 4LG4A 4NKAA 2UZEA 1QPJA 4YZNA 4O0RA 4ASDA 3GNIB 3CXWA 4GK4A 2PZIA 3FY0A 5CXZA 1OVEA 4EWQA 2Z8CA 1TKIA 3BI6A 3MN3A 3D4QA 3OUNB 3TI1A 3UVRA 1Y57A 1OL1A 4IFGA 4L67A 1OPJA 4O21A 4IM0A 1M7NA 4CCBA 2J5EA 4GG7A 4NWMA 3A62A 2G2IA 3TTJA 3BLRA 4Q9ZA 1XH9A 5JZJA 3QKMA 4RIWA 5D10A 2HAKA 4QP1A 4FL1A 4XRJA 3PA3A 3DXQA 5HE3A 2HWOA 5IA1A 3L1SA 3DXPA 3PXFA 2W5BA 4E4XA 3WI6A 3LLAA 3BU3A 2GNIA 3PFQA 2HXQA 1OECA 2HY0A 5BVDA 3DKOA 2VWUA 4YJUA 5M4UA 4O6LA 4O1OA 3QA8A 4GFMA 4U6RA 4NCTA 4QMQA 4IXPA 4B6LA 2J4ZA 5A4QA 2C68A 4PMTA 4JQ7A 5BVFA 4AFEA 3FAAA 3Q4ZA 3ZUVA 3MIAA 3TV6A 3D0EA 3ORMA 5CQUA 1F0QA 5DVRA 5E8UA 2JFMA 3LCDA 5ETCA 2X6DA 2ACXA 5I9VA 4IX6A 4XG3A 1XKKA 4CV8A 3NAYA 4XRLA 2CLQA 2FA2A 4YTHA 4NTSA 4I22A 4DT9A 1OL7A 3A7GA 1SNUA 3PY1A 5HCXA 4HGTA 3KMWA 4WIHA 4E1ZA 2R0IA 3F9NA 3IKAA 4ZEGA 4E7WA 3UPZA 3ZDIA 1NA7A 3ENHA 3NGAA 4I21A 5G1XA 3UC4A 4BDFA 3NNUA 4N57A 4CFUA 4J1RA 4AUAA 2PVHA 3KN6A 3F3WA 4MHAA 5HX8A 4ZMEA 5HO8A 3FY2A 3D5WA 5AX3A 5GZAA 4XOZA 5H8EA 3UQCA 2OK1A 1PXMA 4JOAA 4O0XA 4G6LA 5DI1A 1CDKA 2WTKC 4PPCA 3GU7A 3FHRA 2XEZA 4IVCA 2XIYA 3L8SA 4DFXE 4I92A 5H8GA 2RFSA 2PZYA 4G3GA 4L52A 1YI4A 3P7BA 4CXAA 4ZK5A 1UV5A 2I0YA 2UZWE 3VBXA 1RE8A 4FVQA 4DC2A 3ULZA 3UZRA 3OBGA 4RJ7A 3R7OA 3TJCA 4J97A 2QR7A 3NCGA 2DUVA 4WBOA 5LVMA 4IVBA 3GFEA 4R7BA 4HVSA 4JL9A 4I6FA 3PXZA 2JC6A 2HWPA 3PZHA 4U0IA 3E3BX 4F09A 4X2GA 3LXLA 5FEDA 4EYMA 5I5ZA 2V62A 3HEGA 1OPLA 4M67A 4U3YA 4ANMA 3EN9A 4FEQA 3IK3A 2JGZA 3R8UA 4EJNA 3VS4A 4BCQA 2HOGA 1OKZA 3KF7A 3PRFA 3RCDA 4AGCA 4RX9A 5CEOA 4MF0A 4NSTA 5CANA 4J8MA 4P5QA 5E8XA 4DGGA 1RW8A 3EQRA 4LOPA 2UZDA 4WD5A 2QO9A 4M13A 2VO3A 3KMUA 3ZLYA 4WG5A 4BCHA 5JQ5A 1OIUA 2FSOX 2WMVA 3QC9A 1V1KA 3C4CA 3L9MA 3ZDUA 2IVSA 3FZPA 4UBAA 3CD3A 3OS3A 2JDRA 4TRLA 3A4OX 4QMMA 4GU9A 3LW0A 3V5TA 4CFMA 4F1MA 2ERZE 1O6YA 2XIZA 3R04A 3ORLA 3W32A 4I6HA 3HUCA 4I5HA 4E6CA 3V6SA 2QO2A 3NLBA 4O1PA 4XG8A 4YBKA 1KV2A 5F4NA 4A9UA 2DWBA 4G5JA 4M69A 2I7QA 3SQQA 5CU0A 5CU2A 1JVPP 3B2WA 2YLFA 5A6OA 3MBLA 4R78A 5EM5A 4LGGA 2Q83A 1M2RA 3DPKA 4DG2E 5DIAA 4C2VA 3AMYA 4ACDA 2YAAA 3MTLA 4BDKA 4FV4A 4NM5A 1MRYA 1XO2B 2WOUA 4UB7A 5K0KA 3R8PA 5AUYA 2QKRA 3Q04A 4FKPA 5CU3A 2YZLA 3U55A 1KE6A 3D94A 5AR2A 3PG1A 3LFNA 1U5RA 4IVDA 3TZ8A 1G8SA 3QBNA 4O0VA 5AIKA 2WD1A 1U46A 3DAKA 3U87A 4CKJA 5HD7A 2R3PA 3R00A 1JPAA 2XS0A 3ITZA 4QMNA 2YDIA 2XKEA 4C3PA 5DMZA 4HCTA 2F7ZE 3W1FA 4U41A 4FKVA 1Q99A 1K3AA 3MY5A 4HVIA 2GHGA 5IMEA 4OTIA 2F57A 3LIJA 3VHKA 2EXEA 2BRHA 2XNPA 1JAMA 2UW9A 4D9TA 2Y7JA 5DPVA 4GJ3A 3BU6A 4JNWA 4RZWA 3FZRA 3WE8A 3ZUUA 4E26A 3NS9A 4U44A 1H1RA 3BYMA 4IM3A 3FQSA 5HU3A 2PUPA 3PXYA 4NUSA 2WNTA 5EDQA 4ZIMA 4NFNA 4USEA 5LJJA 1DI9A 4GIHA 3DK6A 5E8VA 3F3TA 2R3GA 3ZZEA 1SZMA 3SA0A 4O27B 4OT6A 3ZSIA 4EKLA 3OCGA 4FKIA 4O0YA 4EK8A 3TTIA 4RVMA 1ZXEA 3DKCA 1TQMA 3SG8A 1ZY5A 4M68A 3QLGA 4JVGA 4XLIA 4CLJA 2XBAA 3F88A 3FYJX 1BUHA 1KUTA 4WNOA 2QHMA 2C6MA 3CPBA 4P90A 3COHA 5FGKA 3NUNA 4FTKA 4L68A 4RVKA 3OHTA 3TKUA 4DHFA 2BRMA 3NW7A 4TKSA 4EOIA 1PXJA 5I9YA 3SXSA 2R3HA 2KTYA 5CU6A 3MGYA 5AIRA 3EYGA 3QL8A 4DTAA 3TDWA 2P4IA 4MXAA 3F7WA 1EH4A 3LVPA 1CSNA 3IW6A 2BTRA 3RINA 3WARA 4EH7A 3QWJA 3QQUA 3FLYA 4C34A 4FKQA 1BL7A 5LMKA 2YM4A 1FOTA 5K9IA 3E63A 1ZZ2A 4Q5EA 5C27A 5J7BA 3DFAA 5KCVA 3KRXA 4LGHA 4UMUA 3A7JA 1TQIA 5HBEA 4CFVA 1YXSA 2ZM4A 4DFLA 5ANJA 3EQBA 4ZMFA 4CGAA 5E92A 2XK8A 4EOQA 2UZUE 2VRXA 1YDRE 3F69A 4KS7A 4C02A 3R6XA 3O7LB 5CNNA 5LMBA 2WQNA 2C5XA 5K3YA 2O2UA 4C4JA 5IH5A 3PVUA 3EKNA 4D2RA 3PVWA 1PKDA 2PSQA 4B99A 3OCBA 2YA9A 3D83A 1CKPA 4WUAA 4UWBA 4R3RA 3TACA 3SVVA 2FH9A 3ZXZA 2VUWA 3GOPA 2FO0A 2C0TA 2OU7A 4J96A 3R7VA 3EL8A 2J0KA 4FV0A 3U6HA 4RC4A 3CEKA 3UQFA 2Z7LA 2IW6A 2XK4A 3PJ8A 3E64A 4ERKA 5HI2A 4C4IA 3EQCA 2C0IA 3H30A 4EEVA 2PUIA 4OAUC 4FV8A 3I7CA 2J9MA 3QXPA 3E5AA 3W2OA 1APME 2YZAA 4EKKA 5E8WA 4IZYA 4L7SA 3HUBA 4H3BA 2I1MA 4OTPA 1VEBA 4PV0A 3R02A 3OXZA 4ZP5A 3BELA 4AOTA 1UKIA 2X6EA 3TG1A 4C8BA 3AD5A 1BLXA 2KULA 4IC7A 3OROA 1JLUE 4KD1A 3UIBA 3ORZA 2PVNA 4DTBA 3H9OA 2R3FA 2C3IB 3NRMA 2UW3A 2W1CA 1OL6A 5HD4A 4I41A 4YR8A 3ATTA 2R3NA 4L45A 4F65A 5IZFA 3QLFA 2RIOA 2WPAA 1OITA 2EUFB 3Q9WA 4X7QA 4BI0A 4X2JA 3FSKA 3EL7A 2IG7A 4RIWB 2CMWA 3GC0A 2PVRA 4H1MA 4YTFA 3VUMA 1GY3A 1XR1A 2CKEA 3E87A 4IJ9A 2WMXA 3ORNA 3CIKA 4ZSJA 5TOZA 3R9OA 3WF7A 1Q5KA 4AZEA 3FLZA 4MCVA 3PA5A 3DKFA 3GGFA 4M8TA 5AAFA 1UU8A 3L8PA 3ODYX 4M0YA 3W33A 3TKHA 4ZTHA 5HG8A 4XG4A 3KXHA 4HYIA 4R7HA 4BBMA 3Q4UA 2OFUA 3PVBA 3FSFA 5CU4A 2W99B 5EM6A 1CKJA 3PE1A 2BPMA 3DZOA 2OF2A 1H27A 2IVVA 4UWCA 3S1HA 3I60A 3F5UA 3AMAA 3AT2A 2C6TA 3K3IA 2VTJA 3CPCA 4ANNA 2HZ4A 1RQQA 4RMZA 3QZFA 1I44A 3PPKA 4F7LA 1FPUA 4FG8A 1J3HA 3VS1A 1YOMA 4BGQA 3F5XA 3QQFA 4TWCA 3LQ3A 1SVGA 4FZDB 4BGHA 4IQ6A 3EQFA 2XKFA 3FKNA 3DK3A 1OPKA 2NPQA 4W4VA 1WVYA 2IW8A 2XNMA 3UIXA 3UP7A 4HNFA 3UYSA 2JIVA 3BKBA 3C4WA 5EW8A 3ZM4A 4EK4A 4CTCA 4JS8A 3GQLA 4BDGA 1M52A 5ACBC 4IAIA 3BPRA 1J1CA 3VO3A 1H07A 2NNWB 4G3CA 2V22A 4WNPA 3E62A 2I0HA 2VTRA 2VV9A 2XIXA 2YIQA 3EOCA 4PP9A 3D9VA 2PVFA 4ACGA 3LFSA 5M51A 4ARKA 2QC6A 4G3EA 4O81A 4I94A 1P5EA 4AW2A 1KOAA 3C51A 4M7IA 3TV4A 5JFSA 4GKIA 3P0MA 2DQ7X 5DEWA 4GFOA 5HORA 3I5NA 5EW9A 5ANOA 3UO6A 2UZNA 3WF5A 3S3IA 5IISA 2B55A 4FTTA 5HBHA 4EUTA 3H4JA 3NUXA 1JSUA 4O2ZA 4YJSA 4DCAA 4QMVA 4EJ7A 2F4JA 3IW4A 1NXKA 3R7YA 1P14A 4IVAA 5E8ZA 2C6OA 2WQBA 5HTBA 3EQPA 4BTKA 2F7EE 4R3PA 4YNEA 4S34A 5A6NA 1ZMWA 3OTUA 4AF3A 1WMKA 4QTEA 2C6EA 2VTLA 2IO6A 3LM0A 4EQUA 1BI8A 2I0EA 3BV2A 1BL6A 4Y5QA 2JIIA 2PMIA 3MV5A 4N6ZA 5AR4A 1NT2A 1U4DA 4C4GA 3B8QA 1YRPA 4L6QA 3AT4A 3OOMA 1OL5A 3EQIA 4W9XA 4KS8A 2RFDA 2YCSA 3PLAE 4FSQA 2B4SB 4E4LA 3IS5A 1OBGA 2CNUA 5EDPA 4CMTA 1J7LA 2Z7SA 3V5JA 4BCGA 4F99A 3UVPA 4U5JA 2XNEA 5CVHA 4WA9A 3BHYA 4DEEA 1QPEA 3B8RA 3NEWA 5I9UA 4KRCA 3PSDA 4YZ9A 1Q24A 2UW7A 3FE3A 4MD7E 4FEWA 3RTPA 2X1NA 5DFPA 2WIHA 3I0OA 2PVKA 3E92A 1FVVA 2E2BA 3EN4A 4XMOA 3IGGA 1Z5MA 4FTOA 4M0ZA 1H01A 3KK8A 3GC7A 4RFZA 2UVZA 4L3LA 5HG7A 3ZZWA 3ZM9A 4N4SA 4E4NA 4ZY4A 3VUTA 3KVWA 5HICA 1UA2A 2B52A 1DI8A 4KWPA 3LCKA 3DNDA 2QKWB 1QPDA 5FM3A 2QOBA 3O7LD 2ZYBA 5IUIA 3CCNA 3NYOA 4Q5HA 5HVJA 2XRWA 3UOJA 4DFUA 3UNZA 1FBNA 4JG7A 5IQEA 3JY0A 3W16A 5AA9A 5GJGA 3FMDA 2HZ0A 2XYNA 2ZMDA 1IA8A 2UUEA 3AMBA 3VS7A 4EI4A 3DAJA 4WSQA 3QX2A 3OT3A 3KXNA 5CZIA 1IAJA 2Z60A 5IDPA 4IADA 3HV5A 4AS0A 4GK3A 4DEBA 4H3PA 2SRCA 2PVJA 4K1BA 3W2RA 2XKDA 3LFBA 4TYGA 2W06A 3RM7A 4MQ2A 3FZOA 5AUVA 1CM8A 4MXOA 5GZ9A 3QRKA 1QCFA 3HLLA 5IA3A 5FLFA 4DH3A 4HGEA 2P3GX 3A99A 3DAEA 3MFRA 5L2SA 4MYGA 3LCSA 2C1AA 1ZYSA 2XUUA 3HV6A 2WHBA 2WMWA 5DEYA 4BIEA 3Q3BA 3QHRA 1HCLA 3QALE 5L6WL 4J53A 2YN8A 3DBFA 4EBVA 3MJ1A 3G5DA 4C58A 5GZ8A 5AWMA 4ANSA 2J7TA 5CAUA 3RZFA 1STCE 3DLSA 4EL9A 1P4FA 5LWNA 5H8BA 5CVFA 4ZXTA 5HG9A 3CR0A 5K4JA 4FE2A 4EH2A 5BYZA 2XJ1A 3PY3A 4L7FA 3PPZA 1MQBA 4L44A 3TUBA 4ZS4A 5LARA 4OW8A 4Y8DA 5K4IA 3QKKA 4XNEA 5HIDA 1Y6AA 3F5PA 1WVWA 3GB2A 2Y9QA 4QPMA 5HCYA 4C3RA 3VAPA 2JBOA 4BDIA 3QQGA 2C5OA 2UW6A 3ELJA 3UIUA 3OXTA 3R8MA 5E8SA 5L6OA 4BZDA 4U45A 3FHIA 3ZSGA 5BVOA 3EWHA 4YLJA 5KZ0A 4ORKA 2VX0A 4D2SA 3RWPA 3ZONA 4FKSA 1XH6A 3VW6A 1PXPA 3PSBA 3SAYA 2YM6A 3R28A 5HU9A 5C4LA 4LL5A 1UU9A 3HGKA 3QCSA 2X8DA 4F6UA 4JR3A 3EQDA 4CT2A 4A9YA 4UXLA 5EK7A 2OW3A 1B39A 2YM8A 3MFTA 4LV5A 5DBXA 5EM7A 5HKMA 3UNJA 4UMPA 3CJGA 3QYZA 4TW9A 2H8HA 4HNIA 4CYJA 2A0CX 3GOKA 1AGWA 3EYHA 4HZRA 4EOOA 4WNMA 4DFBA 4BY9E 5M57A 4YUQA 4IB3A 3GT8A 2Y4IB 4QPSA 5I3OA 4A4OA 4AE9A 2NO3A 4ASXA 1G5SA 2QOKA 3PIXA 1ZMVA 2BIKB 4HPUE 4DFYA 1Q8TA 5CAVA 4H58A 5HTCA 4NCTC 2XF0A 3ROYA 2YJSA 4FIFA 3HNGA 5GJDA 3OFMA 4QMLA 2W4OA 4ITHA 4WO5A 4NT4A 4EHEA 4F70A 1MP8A 3A2CA 4S31A 2J6MA 3BYSA 4YHFA 2XM9A 4CQEA 3DBEA 1NY3A 3LPBA 4XP3A 4M14A 2GPHA 3JVRA 4FKRA 4O91A 3R83A 5HE2A 3QTZA 3PXQA 4YPDA 5B2KA 4CFXA 4AQCA 2WTIA 3HZTA 2CGXA 4PTCA 3FXXA 2Q0NA 5A4EA 3VJNA 1ZY4A 4EQMA 2XYUA 2RG5A 5IA0A 1PY5A 5FUTA 2IVTA 3U9NA 2CCHA 2VTNA 4V04A 3FMMA 3QHWA 3F7ZA 5EI8A 3TWJA 2BILB 2Y4PA 3WZDA 4FT3A 4DE4A 4X0MA 4RWIA 3UMWA 3GU4A 3LCOA 2VNYA 3OF0A 5EYKA 1RDQE 4FSNA 4WRSA 3GBZA 4IEBA 5AP3A 2QOCA 3G2FA 4EH9A 1P4OA 1UNLA 3K54A 2Y0AA 4RLLA 4ANLA 2DYLA 1PYEA 2C30A 1H0VA 1XWSA 2HZIA 3C9WA 4A07A 4GFGA 4DH5A 4GVJA 4WSYA 3JPVA 2ETKA 3KQ7A 4D2VA 5IH6A 4PMSA 4JDIA 5AM6A 1I09A 3LJ0A 4QYYA 2UVYA 3KB7A 4I93A 4RX8A 4BTMA 4HYHA 2R5TA 3EN6A 5C9CA 4R5YA 5GJFA 2X7FA 5FXSA 3EKKA 3UO4A 1YOLA 5F95A 4C0TA 4O7RA 3MFUA 2VWYA 3OT8A 3II5A 3CTQA 4RX5A 3R63A 5HLPA 1XH4A 4LRMA 4J71A 5BYYA 3HV3A 1WVXA 4AOIA 1YXTA 2Y6MA 4FODA 3PLSA 3SHEA 4W8EA 2BDWA 4L46A 5FEQA 3N4UA 3AOXA 3GC8A 4EHVA 3IOKA 4F9BA 4I20A 2PWLA 2JITA 4YJNA 1Y8GA 2WU6A 1J7IA 3KU2A 3RVGA 5L6PA 5FWKK 3C7QA 3KKVA 1XBCA 3HRCA 3MVLA 3Q6UA 4PL3A 5FDXA 3TV7A 4NKSA 3K2LA 2B9IA 4K18A 4UEUA 1XH8A 1M2PA 1KE9A 1KWPA 2VTAA 2UZOA 4FX3A 4JQ8A 4TNBA 2UZLA 5EI2A 5AR7A 2R3LA 4IWOA 5FTGA 3P7AA 4RC3A 3BWFA 5EG3A 3NIZA 3VUGA 2XCHA 4BC6A 2J0JA 4DBNA 3V8TA 2XB7A 4IDVA 2P2IA 5EDRA 5KUPA 1YXUA 2A1AB 1JKTA 4EOLA 3DOGA 3L9PA 4WT6A 2PUUA 3RK7A 3NPCA 5B2LA 2QHNA 4FL3A 3NCZA 3MA6A 5BVEA 2QLQA 3E93A 3Q60A 1NVQA 1VZOA 4UMQA 2OXXA 2HCKA 2CLXA 4RSSA 4FK6A 3RNYA 5A9UA 5CF4A 2OIQA 5HNBA 2WELA 1Q8WA 4K0YA 4DEHA 4K2RA 3E88A 1E1XA 3F2RA 5AP2A 5F9EA 4IE9A 3M2WA 2BZHB 4AXAA 4PUZA 4ITIA 4MBLA 2YLEA 4PMMA 4ANBA 2GNHA 4FYOA 5J79A 4Y72A 3FXWA 5FG8A 3HA6A 2BUJA 4TXCA 1FGIA 2OJFE 2R3QA 3TZMA 3RPRA 3LFEA 3SXRA 4DEIA 3S00A 1GJOA 2QO7A 2X81A 4M97A 3QCXA 2VWWA 3BGPA 4TYEA 4O7SA 5HTIA 3SRVA 4AW1A 4AN3A 3ORXA 4MXXA 4XG6A 3ZLWA 5HQ0A 3L9LA 4JI9A 3A8XA 5C26A 1IG1A 4FTJA 1YI6A 2OF4A 4KRDA 3UTOA 2I6LA 3FC1X 5HE0A 5FM2A 5BUJA 3MVJA 4QYEA 4USDA 2GNLA 1LPUA 4FK3A 4YSMA 4E5BA 4RIYA 3VUHA 3NUAA 4FTQA 2RKUA 1PYXA 4AZVA 3I81A 3E7OA 2O65A 4KBKA 3VUDA 2F49A 3UPXA 4X3FB 2J90A 3LZBA 3R21A 4E73A 1BYGA 4H39A 4UN0C 4XUFA 5H3QA 2BRGA 2GTMA 3F2AA 5CSVA 3W18A 4BTFA 3H9RA 5JQ8A 3ANRA 4XYFA 1Q8UA 4XP2A 4A9RA 2A27A 2Z7RA 4FC0A 4MBJA 4FGBA 4QMTA 3NMUF 4XG7A 1U59A 4W4WA 4ALVA 1AD5A 2FGIA 3MI9A 4W8DA 4BI1A 3FZ1A 4EHGA 4HVGA 4Q9SA 1Y91A 4XP0A 4FZFB 4EBWA 4GS6A 3WBLA 3KN5A 2G9XA 2PK9A 4GIIA 2WEVA 2XNGA 3E3PA 2BFYA 5CNOA 5M53A 4BRXA 4JBOA 4KINA 2XK6A 5HZNA 1A48A 1QL6A 4IFCA 3RK9A 4B4LA 3JR1A 4H05A 5JH6A 1O6LA 3RHKA 5JGAA 5KBRA 3FQHA 4U40A 5LMKC 2ZB0A 4D1SA 4MH7A 3DDPA 3JS2A 3QZHA 4FKWA 2B7AA 3D5UA 5HOAA 4IB1A 4KSQA 1SNXA 3GCVA 4KBAA 4D28A 4D4SA 4FR4A 4D2WA 4A9TA 3CGFA 2JIUA 5KMIA 3W2PA 2C3KA 5CLPA 3QUDA 2B9HA 5CF6A 4J8NA 4P5ZA 3FWQA 4N6YA 3KXZA 3IW7A 2OFVA 4FG7A 4YZDA 3Q2JA 1JSVA 2OH4A 2QONA 3O8UA 3K5UA 4NTTA 3LKMA 5CSXA 2HW7A 2QQ7A 5JGDA 2BAJA 3TNWA 3TUDA 3PJCA 4MD8E 4E3CA 3PP1A 2PU8A 1YXXA 4C4EA 4BN1A 2ZB1A 2OO8X 3KULA 5EYMA 3LXPA 4CZUA 4F1TA 3P9JA 4CVAA 1OL2A 2Y4IC 2CKQA 1XJDA 3FUPA 2WEIA 3ORIA 5IUHA 4Y73A 2C1BA 3QQKA 5KZIA 4WHZA 4CZTA 2YCQA 3DQXA 2OXDA 5EOLA 3V5QA 2EXMA 4U9AA 3S95A 2W1EA 3MY0A 5C01A 4EK5A 5K5NA 5GNKA 4FIJA 5LMAA 2BIYA 4JLCA 4B8LA 4CLIA 4QRCA 3MH1A 5LCJA 2HYYA 3LFFA 4IZAA 4XG9A 5D11A 3RKBA 4D1ZA 3FLWA 4AZSA 4F6WA 1OGUA 3DXNA 2C4GA 4L00A 3NNXA 2XA4A 3OY1A 4GYGA 4IWDA 2XP2A 5B7VA 4ITJA 5JZNA 2GNGA 3ETAA 3Q96A 3Q4TA 4BKJA 2CNVA 1K9AA 5AM7A 1UWHA 2WQMA 3WILA 2VNWA 5L8KA 1PMUA 4JIKA 4O0WA 3U51A 4CMOA 4UWYA 5G6VA 5AUUA 3A4PA 4GT3A 2CN5A 4BI2A 3NYVA 3OVVA 3GCQA 4CQGA 3HMNA 1W8CA 5L4QA 2PUNA 3AXWA 4FIGA 5J95A 2NRUA 5JFVA 4RJ5A 4LOQA 2GDOA 2XMYA 2GQRA 3RAHA 3VS5A 4NIFA 4D4VA 3BWJA 5E9EA 2R64A 5KNJA 1Q97A 4O96A 3HMIA 5JEBA 4W4XA 4IANA 3C0HA 2VGPA 4FTMA 3BCEA 3ZFMA 4ZLYA 5C8KA 4NEUA 4ONAA 3LJ2A 2BRNA 3MVMA 4MXZA 3UE4A 4TPTA 3VW8A 3BIZA 2YDJA 3N51A 3Q2MA 3FL5A 4DYMA 2XK3A 4FZAB 3EH9A 5IEVA 2RGPA 2GQGA 5B2MA 2JDSA 3OEFX 4A06A 4BL1A 4JQEA 4LQMA 2R3JA 4ZJVA 4FOCA 4DT8A 4X2KA 4LRKA 4BZOA 3TM0A 4EZ5A 3RALA 2QVSE 5ETFA 3VULA 1W98A 3QD2B 3THBA 3VF9A 1MRVA 2BAKA 3SX9A 2IZSA 5L2IA 4DGNA 3ZEPA 2R3IA 3AQVA 3DBQA 3KCKA 3O71A 4JDJA 4S33A 4F0IA 2HXLA 2I0VA 3FKLA 4BCJA 4FKLA 3G33A 5DRBA 4F64A 1YI3A 3UQGA 3BLHA 2UW0A 4YZMA 3UOKA 4WKQA 2JDOA 2X9EA 4MQ1A 2PVLA 3R1QA 3BHVA 2JDVA 3PPJA 4HCUA 5DA3A 5KMOA 3ATSA 3OCTA 2GNFA 4QD6A 3KMMA 4ZY5A 3C4FA 5IDNA 2JKQA 3DLZA 3RM6A 3TN8A 4ASEA 4D58A 2G2HA 3UYTA 2HY81 3IOPA 4F0FA 3MA3A 3K3JA 4O2PA 3AG9A 2R7IA 4LGDA 2BCJA 4K11A 2UVXA 3KRJA 3ZRKA 1PJKA 4ID7A 4LI5A 5DLSA 3VUKA 3WIKA 2GS7A 2IN6A 3R9RA 2VN9A 4CT1A 3QD4A 2BAQA 4BCFA 4MKCA 4HGSA 1SYKA 2W1FA 3OBJA 4JAIA 4UZDA 4YJOA 3VUIA 5HVKA 4FKGA 1GIIA 3BU5A 5KBQA 5C1QB 4QP6A 3WZUA 5J5SA 4O83A 3CE3A 4FTLA 5EKNA 4S30A 4JBPA 4YGAA 4R7IA 4CNHA 3HECA 4IJPA 2VWBA 4OBPA 4DH8A 2V7OA 5AAEA 4A4XA 4AAAA 3KXMA 5M4CA 2X2MA 1Z57A 4OTQA 3QQHA 4EH8A 3L9NA 5A4LA 5T6KA 3E8CA 4FT9A 3I1AA 3LAUA 4M3QA 4QTAA 4TYHB 4AN9A 4IZ7A 2I40A 2A19B 2VO7A 3KREA 4PQNA 2WTDA 2XIRA 4EC9A 1SVHA 2PTKA 4AX8A 4MBIA 5AV0A 3C50A 3RNIA 2OWBA 5CYIA 2HIWA 3PJ1A 4FICA 4G17A 1OUKA 4O0SA 4X6RA 2W4KA 4Y95A 3FMJA 5L2QA 2BZIB 3VC4A 3R7IA 4EZ3A 1OKVA 2O3PA 2OH0E 3COMA 5ETAA 3RPYA 3CSVA 1H1WA 3EQHA 5AR8A 4B8MA 5LXMA 3QRIA 4HZSA 3ZSHA 3AT3A 4GCJA 4FSWA 3W8LA 4EUUA 3COIA 5A4CA 4YJTA 1F3MC 3PY0A 4M84A 4DLIA 3P79A 4DEDA 1TQPA 5DOSA 4FV3A 3OG7A 2PZRA 5ICPA 3RGFA 2ZV8A 5E7RA 3Q32A 4X3FC 3FLQA 1ZWSA 4I5MA 3TXOA 2BZJA 4ZSGA 3FLNC 1KE8A 4O84A 2GHLA 4KIOA 4FSTA 3FMHA 5HO6A 5EHOA 4DBXA 1OKWA 3EIDA 5J9YA 1JKKA 3LXNA 3NNVA 4FYNA 5KMNA 2ZM3A 4F7SA 2ZV7A 4HOKA 2YHVA 3Q53A 3IW5A 4ZJJA 2VU3A 3DKGA 4O6EA 4APPA 3SRVB 2ETMA 3IONA 3MH2A 5HGIA 3ULIA 3ZBFA 4MF1A 4C7TA 3LMHA 4G31A 4GYIA 4PDSA 4O82A 4PNIA 3DTCA 4RIYB 4J95A 5CAPA 2FSMX 1REJA 1M14A 2C5YA 5IA5A 4QNAA 4HGLA 3R7UA 4YTCA 2C69A 4FVPA 3F3UA 5DGZA 2BROA 4MXYA 5IEXA 3SDJA 3RI1A 1DAYA 4IM2A 2GMXA 2CCIA 4AWIA 3A7HA 4AU8A 3LFCA 3OMVA 3UVQA 4BWPA 4S32A 4LOOA 3PSCA 2UZBA 1UU3A 3HYHA 5HHWA 1YWRA 2C47A 2PZPA 4E6AA 2ITQA 2PMLX 2E9PA 4KIQA 3W2CA 4MNEB 3ZXTA 1PXKA 5IQGA 3DJ5A 3KRWA 1NW1A 4I3ZA 3A8WA 4RBLA 5DG5A 4ZSLA 1WBPA 3V5WA 3WF8A 3TZ7A 3NUYA 4BWXA 3R1YA 4EHZA 3ANQA 4O7WA 2OIDA 4HJOA 3D2IA 4EC8A 1PF8A 2LGCA 3TNQB 3PDTA 5CEQA 3HDNA 4I6BA 3FL4A 1XHAA 4G34A 3IPHA 3QCQA 1H24A 4R8QA 4D0WA 5EQEA 1BX6A 1CMKE 1JBPE 1ZYDA 3KK9A 4GW8A 4YTIA 4ZJIA 4FSZA 4YPSA 5GHVA 2GU8A 1PMNA 4EK6A 4E4MA 3DK7A 4X21A 3GQIA 5CT0A 3HVCA 3HDMA 3MY1A 4ZTQA 2QD9A 4BFMA 1V0BA 3QUPA 5TE0A 1L3RE 4GUBA 4FSMA 4CYIA 3Q9YA 5AFVA 3D5XA 2XK9A 5IMXA 2QURA 1VYZA 2H34A 4RX7A 2O5KA 2YJRA 4YP8A 2YABA 4BZNA 2YM5A 3V01A 3BYUA 4U79A 4XG2A 5IQBA 3NUPA 5HNIX 4W9WA 2XNOA 4EH4A 1LEWA 2ITUA 3ZFXA 3FBVA 2ZJWA 2RFEA 3PTGA 1PHKA 2QOOA 5AV1A 4X2NA 3PJ2A 3LFDA 3W55A 4QTCA 4BDHA 3ENMA 1H0WA 2W17A 3VBQA 3KULB 4IX4A 5HVYA 1R1WA 3ZYAA 3W8QA 3FMEA 2QOLA 3F61A 2NP8A 3QZGA 4X3JA 1ZLTA 4ENXA 3H0ZA 4L43A 1NVRA 2BMCA 3AD4A 3V6RA 3QD3A 1J7UA 4XX9A 4FTCA 5C03A 3FI8A 3EFKA 3Q5ZA 3POZA 4HYSA 5D9HA 3RAIA 4RA5A 3FMKA 5IU2A 2UW4A 3BE9A 4BDEA 5F1ZA 2OG8A 1FQ1B 2R3OA 3KRLA 5BYLA 3DCVA 2FSTX 4ANQA 3AC3A 4X3FA 1S9IA 4RGJA 4FNXA 4V05A 3MB6A 3LOKA 3MTFA 2VTOA 4QNYA 2CKPA 4RQVA 3IDBA 4GEOA 5A14A 4N70A 3NYXA 3QTQA 2OI4X 2VWZA 3GFWA 2X9FA 4F08A 3RPOA 3QXOA 3MB7A 1GOLA 3VBVA 3BX5A 4G9RA 2EXCX 4AT4A 5BQ0A 3RMFA 1UKHA 3OWLA 4IWPA 3AGMA 3R2YA 4AACA 3ORTA 1KV1A 2P55A 3VJOA 4C2WA 2QOFA 3ALNA 2B0QA 4OBQA 5I9WA 3NR9A 3KXGA 4FNYA 4NIFB 5J9LA 3FJQE 4QT1A 5CEKA 5HNGA 3QRJA 4BDAA 3CY2A 5IQHA 2LAVA 3FKOA 2GHMA 4R6VA 2YITA 3W2SA 3BGZA 4R77A 1U54A 4BCNA 5DWRA 1G3NA 4FKTA 5AP0A 3LCTA 3LFQA 2G15A 3IDPA 5FP5A 4QOXA 4YC3A 2O63A 4BBEA 4BCMA 2C5VA 4C35A 2R4BA 2VTIA 2VTPA 3DNEA 4XV2A 3BHUA 3S2PA 5E90A 4DEGA 2JAVA 3VVHA 1DS5A 2WMTA 3OWJA 4F9WA 1L8TA 5BUEA 3O0GA 4U7ZA 2ZV9A 2F7XE 2VX1A 5IQCA 4AGDA 4Q2AA 1NVSA 1S9JA 5BMMA 5CS6A 4PL4A 1OIRA 3U4WA 3NUUA 4KABA 3VS3A 4QP7A 2X7OA 5HIBA 3UOHA 3QWKA 2BKKA 4FUYA 3OEZA 3CTHA 1DAWA 1V0PA 4RT7A 3AC1A 2FSLX 2QOIA 3KFAA 1WCCA 4H36A 5ANGA 3UO5A 5IUGA 2ITVA 3T9TA 1ZYJA 2F9GA 1GAGA 1GZ8A 1O9UA 4ZZMA 3A7FA 2ZDTA 4LMUA 5EI6A 5JGBA 3W2QA 1XBAA 1K2PA 2IVUA 4AW5A 2ERKA 2PE2A 3HMPA 4B9DA 4BGGA 4YJQA 4FIHA 2WXVA 3CQWA 4JR7A 3TCPA 4HCVA 1KE7A 5I9XA 1X8BA 3CS9A 4FT5A 4ACCA 4YJVA 3DBDA 2W96B 3P5KA 5CTPA 5KO1A 3R8VA 1WBSA 4RA4A 5I9ZA 3SOCA 2CDZA 4BCIA 3ZEWA 5CF8A 3B2TA 2C3LA 2YISA 3ACJA 3D7ZA 3QF9A 3RP9A 4F4PA 5JK3A 1JNKA 3ZRLA 5CSWA 4UALA 4CKIA 4K33A 5ACKA 3W10A 3POOA 5I4NA 3MESA 4DN5A 1E9HA 4FV6A 5EHLA 2QNJA 5AUTA 3ORPA 4OTFA 1UVRA 3PA4A 4JG6A 2G1TA 4NH1A 1KE5A 2PVMA 4OTRA 4XV1A 3GCPA 3LM5A 5CENA 3O96A 4FVRA 3HA8A 5IG1A 2XIKA 4PNKA 3O8PA 5AV3A 3ZFYA 4G6OA 4I4FA 3WZEA 2IPXA 4B7TA 5IQIA 2IJMA 4BHNA 4YO6A 1PXNA 4JX7A 4PX6A 3VQUA 3JY9A 3KL8A 3ZO2A 4DG0E 2ZM1A 4CSVA 4NFMA 3KVXA 1YDSE 3D7TA 3NSZA 3P78A 4H1JA 4IMYA 4GU6A 4RZVA 5LVPA 4QYFA 3F82A 2AUHA 1YXVA 2V5QA 3QCYA 4YC8A 3E8DA 1XQZA 3SD0A 4C37A 2AC3A 4U42A 1ZMUA 2PMNX 2RG6A 3ZS5A 4FSYA 5CALA 3I4BA 4UXQA 3OW4A 4ZSEA 3VBWA 2YFXA 3NAXA 1ZOHA 5M55A 3RPVA 4F6SA 3UMXA 3OWKA 5AP7A 4M66A 5LVOA 3A7IA 3EFJA 4ZTMA 1HOWA 3GI3A 1PW2A 3SW7A 2ZVAA 2J51A 5M08A 3BEGA 3E7VA 3NDMA 4KA3A 2FVDA 2OBJA 5FP6A 3ZCLA 2W05A 4PTGA 4FT0A 3UJGA 4CFFA 1FMKA 3AC2A 3QQJA 3NWWA 4WRGA 5EYCA 4D55A 4EZ7A 4Z16A 3LFAA 5LWMA 5M56A 4GKHA 4Z7GA 1ZAOA 3DA6A 3P86A 3VQHA 2PZ5A 4EOKA 2QOQA 4NJ3A 1MUOA 3HRFA 2BDFA 3DB6A 4DCEA 3CKXA 5KMMA 3V5LA 3Q9ZA 4LV8A 2X4FA 4CZYB 3N4TA 5KKRB 4DA5A 1JWHA 5A54A 3G0FA 4DGOA 4BYJA 3U54A 1CTPE 3FPQA 3F66A 3R8LA 3IQ7A 4PPBA 3HV7A 5JSMA 4QYHA 3PRIA 4ZTSA 2WQOA 3HKOA 4BDBA 1PXOA 2JAMA 1WBWA 3I6WA 2VTQA 2OZOA 1PMEA 5DYJA 1H1QA 2E9NA 2ZAZA 1H08A 2VGOA 4GT4A 3JUHA 4TWPA 2WZJA 1ERKA 3HP2A 3VBTA 4KIPA 1H00A 4EOMA 4K9YA 3CQEA 2C0OA 2GFSA 3R73A 3U4UA 2UW8A 3V04A 2QOHA 2JKMA 3LLTA 5DT0A 3SKCA 4RG0A 1URCA 3ROCA 2P2HA 4E8AA 4TT7A 3MS9A 3MJ2A 1W84A 3VS2A 4TYHA 2F2CB 2H96A 2ITZA 2W5AA 3MFSA 5ANEA 5EM8A 1Z9XA 4YMJA 5D7VA 2JBPA 3QD0A 5AP6A 3A60A 4TY1A 1M2QA 3R71A 3GU8A 3ZC5A 4D2TA 5EKOA 1JOWB 4ZLOA 3UC3A 2O0UA 1H1PA 4I0TA 1FVTA 3EB0A 4RJ8A 3V8SA 4AA0A 4HW7A 5AJQA 1YW2A 4O7NA 1YKRA 3KXXA 3C5IA 3F3ZA 3FV8A 2VTHA 4C59A 4CMUA 3TUCA 2GNJA 4FI1A 3G6GA 3SV0A 3CLYA 3TL8A 5AUZA 4BIBA 4Z7HA 2GS6A 1Q4LA 2R0UA 3LHJA 5KMLA 1OM1A 3TNHA 3QYWA 4C33A 4JAJA 4D9UA 3QRTA 4AA4A 4HVDA 5EH0A 4R3CA 3JYAA 1TVOA 2C3JA 3T9IA 2VWVA 3ERKA 4QMOA 3ZC6A 3C1XA 3WE4A 4OTDA 5A3XA 5HIEA 1IR3A 3P4KA 1G8AA 4IB5A 2YIWA 3SXFA 3A61A 4QP2A 2J0MB 2OJIA 4ALWA 4DTKA 2ITXA 3DTWA 2ETRA 4YZCA 4ZLZA 3QTXA 3VF8A 3R1NA 3PE2A 1SMHA 4UMRA 1PXIA 4KSPA 1W83A 2IZTA 4U43A 4UX9A 3R30A 5IQDA 5IQAA 1IASA 1WZYA 4LL0A 2E9OA 1Y8YA 3QFVA 3PWYA 3ZLSA 1AQ1A 4O86A 3FEGA 2W1HA 1YVJA 1OB3A 5AAGA 3BV3A 2XH5A 2UZTA 1SM2A 1FGKA 3O23A 4RIXB 1UWJA 4MWIA 4MNFA 5CY3A 4BDJA 4E93A 3CTJA 2BRBA 3U6JA 1ND4A 4NL0A 3QTUA 2B1PA 4WNKA 4NU1A 4TYIA 2CNQA 2QG7A 4MWHA 4KKEA 3BHTA 4ZSAA 3VIDA 5DR9A 4AZWA 3TT0A 2B9JA 5FDPA 4GMYA 4TYJA 3UP2A 3OTVA 2G01A 3KF4A 2Z2WA 3GXLA 1YHVA 3SC1A 4GG5A 3TNIA 3WF9A 2JLDA 1R0EA 1YDTE 5FQDC 4PMPA 3O8TA 4ZZOA 3MVHA 4PDPA 4EK3A 4FTIA 4I6QA 4MNEA 4S2ZA 3KY2A 4ZZNA 2GFCA 5JMSA 2CKOA 3WZJA 2OJ9A 5KE0A 2RFNA 3QA0A 5CWZA 4C61A 4EH5A 5KX8A 3PWDA 2B9FA 2W1GA 4DITA 5IQFA 4YURA 5DE2A 4UY9A 2Y6OA 4A9SA 4DG3E 3R22A 4J99A 4F7NA 2XK7A 3LJ1A 4QMUA 5FRIA 4D4RA 2GTNA 3I7BA 1U5QA 5AR3A 4AZFA 1U54B 3CJFA 4UV0A 5M07A 3D2KA 1LEZA 4JRVA 3AC5A 2QR8A 4QP3A 4EOJA 4ZS0A 4USFA 3F6XA 1J1BA 4LYNA 3VBYA 5J1WA 3CQUA 5D1JA 3WF6A 1IRKA 1QMZA 4QTBA 5BNJA 2ZDUA 2YIXA 3EN7A 4RVTA 3TZ9A 3JVSA 2UW5A 1MQ4A 1YWVA 4QMWA 1VR2A 2BTSA 4IWQA 5CASA 3ZO4A 4CRLA 1PMVA 1H25A 3KRRA 4FKOA 2OJJA 3SW4A 4W4YA 5CQWA 4D2PA 2IZRA 4QP8A 5DT3A 2W0JA 5J5TA 4EQCA 1V0OA 5CF5A 2C6LA 3OZ6A 4O22A 5M06A 4AT5A 3GC9A 4UYAA 4ALUA 2J2IB 5DT4A 5AV4A 5HO7A 4XH6A 1Q3WA 3MIYA 2XEYA 2P33A 4FG9A 3ODZX 3BBTB 4WBBB 2BHHA 3LE6A 5AADA 3CP9A 5LVNA 4R1VA 5EOBA 3U9CA 4RPVA 4KIKB 5CVGA 4KAOA 1GZKA 2JD5A 3N4VA 4GUEA 3UG2A 1WBTA 4E5AX 4TNDA 4Z55A 2WU7A 3C13A 5AUXA 1IAHA 2DS1A 3R1SA 5CEPA 3WZKA 4XV9A 4IAAA 2W1DA 3NUSA 3SG9A 4CRSA 3ZO1A 3BE2A 4F9YA 2PHKA 2IZUA 1WAKA 5C8NA 2BFXA 2VTTA 3FLSA 4YU2A 4OLIA 3C4ZA 3CD8A 2OXYA 1OI9A 4FEVA 2BDJA 3F2NA 2REIA 4FOBA 3P23A 2W1IA 4NZWB 3FI3A 4DGMA 4JIAA 5FD2A 3Q6WA 1UU7A 5BVKA 1REKA 4G3DA 2X4ZA 1P2AA 3OY3A 4GRBA 5AX9A 2C6KA 3VN9A 4FTNA 2V0DA 4BKZA 2OZAB 3OWPA 4FA2A 5ANDA 5EHYA 1Y6BA 1YHSA 3UZPA 4JRNA 4FIEA 4GT5A 5BVNA 3FMLA 1BMKA 1IA9A 4FKUA 2BHEA 1YHWA 3RPSA 3D7TB 4L01A 4PPAA 5TF9A 2RSVA 5LOHA 2J5FA 2ONLC 3HMOA 2VWIA 2ITOA 4P7EA 2GSFA 3QQLA 4I5PA 4RVLA 5HE1A 2BR1A 3T3VA 2HK5A 4IW0A 4IIRA 3SLSA 4L3PA 4XV3A 5IPJA 4L53A 4IX5A 3ZMMA 4YBJA 3GU5A 3KA0A 3NW6A 3LXKA 1WFCA 4TWNA 5KKRC 4O0TA 3OD6X 5KHWA 3PYYA 2OKRA 5GIOE 5E1SA 5FBOA 2CGVA 2YM7A 3SGCA 3C5UA 1LR4A 4V0GB 5CEMA 5M09A 2W1ZA 3D15A 4BVUA 5LVLA 4F63A 2X0GA 4X6QC 2QODA 3G9LX 3E8EA 4DFZE 4DGLC 2YCFA 4C62A 5JRQA 2ESMA 4A7CA 2IW9A 4QMZA 2OJGA 4KKGA 4WUNA 5M4FA 3BEAA 4FUXA 1JKLA 4YLLA 2X8EA 3L8XA 4AG8A 3F5GA 4TTHB 3R7GA 4OTHA 3G0EA 4D5KA 2V7AA 3TIYA 3UNKA 5JFXA 4J98A 2B53A 3FPMA 5J7HA 2GQSA 3QTWA 4FTUA 4PL5A 2EVAA 5CT7A 3IW8A 3PXRA 1OKYA 5ETIA 5IKWA 4EWHA 4EH3A 3ACKA 3BGQA 4ANOA 3P08A 2XVDA 4JT3A 1M17A 3I79A 4L3JA 5FBNC 1H28A 4FGRA 4L9IA 1PXLA 5F94A 5E4HA 3NVKI 2QU6A 4II5A 4XBRA 3S4QA 1QPCA 3CGOA 2WTVA 4X2FA 4QO9A 4G16A 2QLUA 3QRUA 4AE6A 4FT7A 1M7QA 4BYIA 5J1VA 5IH4A 3NYNA 5JT2A 3EZVA 3EQGA 2JKOA 3PP0A 4XOYA 4YJPA 5D12A
chains in the Genus database with same CATH superfamily
3FI4A 2R9SA 4U80A 2Y8OA 4O0UA 1ATPE 3CKWA 3P7CA 3C4XA 5E91A 2JEDA 4N0SA 4YNOA 4IB0A 3Q5IA 4FSUA 4LUDA 3CC6A 4G2FA 3GCUA 3HMMA 4BB4A 3UOLA 4XCUA 2BZKB 4MX9A 4MD9E 3COKA 2GS2A 2WMRA 2VZ6A 3PVGA 3O2MA 3QGYA 4QQCA 4XLVA 5JKGA 3EZRA 5HCZA 3LQ5A 3E8NA 3TIZA 1A9UA 4MXCA 4DFNA 3UDSA 4IACA 1JSTA 3FZTA 4KBCA 4ZTRA 3RAWA 5CSPA 3UBDA 2XCKA 4LFIA 3FYKX 2VX3A 1J91A 3G51A 2EB3A 3UODA 3D5VA 5ITAA 5HLWA 1R39A 1XH7A 3V8WA 4TZRA 2QU5A 3R01A 4GJ2A 4IBMA 5L2TA 5CAOA 4PDOA 3G90X 4O38A 3ZBXA 3L8VA 4OR5A 4CD0A 3WOWA 3NIEA 4AN2A 2W9FB 3HP5A 4E6QA 3REPA 1IEPA 4U8ZA 4DLJA 2CHLA 2AYPA 2R3MA 4YHJA 3DGKA 3RZBA 4HYUA 4G1WA 3OUKA 4E20A 2HELA 3GU6A 5EQYA 3PIYA 1OIQA 4I0SA 4FV2A 2XNBA 5DRDA 5L8LA 3AD6A 4JDKA 2VWXA 2CGWA 4QMSA 1W0XC 4IZ5A 2XARA 4FMQA 3PJ3A 2WGJA 2YWVA 1MRUA 2ONLA 3GENA 4L8MA 5J9ZA 3MPAA 3QU0A 2QG5A 4RLKA 2R2PA 3O50A 4FV9A 4ACHA 4BHZA 4H3QA 1W7HA 4IX3A 5B0XA 3RJCA 4EORA 4YC6A 1R3CA 4RJ3A 4RWLA 5EYDA 3ZUTA 4PDYA 4ASZA 5CX9A 4KB8A 4OTWA 1YOJA 3BRBA 5D41A 5AP5A 5IEYA 2EWAA 2JKKA 4HVHA 1UNGA 1H1SA 1T46A 1B38A 4GK2A 4OT5A 4RWKA 5H2UA 3V51A 4F1OA 4ZOGA 4ZTLA 3VNTA 3R7EA 3UDBA 2EU9A 5BX0A 3MH0A 3QC4A 3KC3A 3S0OA 1XMMA 3TJDA 4F9CA 4EOSA 4YJRA 2YIRA 4NM7A 5CEIA 4QP9A 4BDCA 3BQCA 1Q41A 2IWIA 4Y85A 5T3QA 3RCJA 2GCDA 4JJRA 2W4JA 4FSRA 5C8MA 5GIPE 2VTMA 4M15A 1PRYA 2BVAA 5KMJA 3R0TA 1LUFA 5BMSA 5EW3A 4OBOA 5E8TA 2HW6A 4NM0A 4PWNA 2VTSA 4QPAA 4JXFA 2VO0A 2E9VA 2UV2A 2XM8A 4FNWA 4XBUA 5CXHA 1ZOEA 2A4LA 2X2LA 3ALOA 3DS6A 4PTEA 4JBVA 4J7BA 4XS2A 5BPYA 4CKRA 3LMGA 2YAKA 3IG7A 4EOPA 2RL5A 1WBNA 3ZHPC 3QTRA 5C4KA 4C57A 5L2WA 4ZY6A 3BHHA 4Z9LA 4CG8A 4JBQA 4KNBA 4BDDA 3IECA 3V5PA 3QTSA 4NW5A 4AT3A 4DAWA 5D7AA 2FYSA 3EFWA 5CSHA 2YIYA 4GV1A 2W5HA 3PXKA 3ZU7A 3T3UA 2E9UA 5DR6A 4G5PA 4UZHA 3RWQA 3NZ0A 4AOJA 3IDCA 2YEXA 3I0QA 3JXWA 4U81A 4RRVA 1W2CA 4I24A 1DM2A 3O51A 3F3VA 4OTGA 5IF1A 3DQWA 3DV3A 3QX4A 2YACA 4BICA 5BUIA 5EQPA 3VS0A 3OP5A 2HENA 2O8YA 2WO6A 3OC1A 2P0CA 4PY1A 4QQ5A 2ITPA 3ZTXA 2J0LA 4J52A 1YQJA 3R9HA 3MSSA 3P1AA 3GEQA 2CJMA 4LRJA 5AMNA 2XZSA 1F5QA 5LQFA 3UGCA 4PF4A 4RIXA 3FXZA 4CTBA 3VWAA 3C4EA 3VRZA 4B0GA 4MAOA 2OSCA 4I5CA 4FEUA 5JRSA 4O7ZA 3UIMA 4FNZA 2XNNA 2PE1A 2W9ZB 5FTQA 3BBWA 4RWJA 3EMGA 4QQJA 4TWOA 4A4LA 3BL9A 1WBVA 4BIDA 5K5XA 3BLAA 5ANKA 3UZTA 2WMUA 1JQHA 4OGRA 4IHPA 4RFMA 1ZYCA 3VRYA 4BR3A 2WTCA 4QYGA 4M69B 3MPMA 3MWUA 2PMOX 4QQTA 4NYEA 1OIYA 2ZMCA 5J8IA 5TO8A 3TKIA 4MVFA 5TR6A 1GIHA 2OIBA 5JFWA 2WFYA 1ZRZA 1VYWA 4F9AA 2WMSA 4RC2A 3OW3A 2XJ0A 1Q62A 3NX8A 3HAMA 2X8IA 4YO4A 4RJ6A 4GH2A 5EFQA 1A06A 3QKLA 3OOGA 3Q52A 3R9DA 3FI2A 3G9NA 3MH3A 3HRBA 3BLQA 2WTWA 3MPTA 4I23A 2VO6A 5AA8A 3D14A 5H9BA 4FTRA 3QUEA 4BWKA 4MK0A 3AC4A 4OUCA 1B6CB 2O64A 4IAZA 4QMPA 5I3RA 1H8FA 3VHEA 3RHXA 1H4LA 1OMWA 2WMBA 4TN6A 4G6NA 3IO7A 3RK5A 1ZYLA 4QMXA 4EH6A 1O6KA 3DFCB 1ST4A 3Q4CA 4PRJA 1RJBA 2YDKA 2YM3A 4FZ6A 2XRUA 4QP4A 3I6UA 4R1YA 5DR2A 2CPKE 3C0IA 1BI7A 4P4CA 3QAME 4AZTA 4NW6A 4AGWA 3BZ3A 4I0RA 3IGOA 1WBOA 4ACMA 4FV5A 3PG3A 2YERA 4KKHA 4MEDA 4DH7A 2Z02A 3DY7A 2PY3A 3G6HA 3GVUA 3M1SA 3ORKA 3U8WA 2CGUA 3PZEA 3R2BA 2A2AA 4Y5HA 1FINA 4JDHA 4DH1A 2PULA 4IAFA 2XJ2A 2C6DA 4K6ZA 2ITWA 3DZQA 4L42A 3QGWA 4XEYA 3EN5A 5CAQA 2WAJA 3OCSA 3QZIA 5HESA 3AC8A 4MTAA 4RFYA 3EJ1A 2WTKB 3WYYA 4KIKA 4F0GA 4CEGA 3ZOSA 3OXIA 2WMQA 4QMYA 4UMTA 3N9XA 3TNPC 3TDVA 4KUJA 2CSNA 4YSJA 2PVYA 2CN8A 1OZ1A 1E1VA 3DU8A 3NVMB 4UYNA 4I1ZA 3HAVA 1PKGA 4D5HA 2J50A 4EYJA 2YCRA 3GUBA 4QDVA 3DDQA 1VJYA 1GIJA 4FIIA 5E8YA 4PP7A 4FV1A 1H26A 2EB2A 4LUEA 5HBJA 5DN3A 1OBDA 3ZLXA 3VS6A 4CCUA 4TL0A 4FTAA 2Q0BA 3ZH8A 3M42A 4O7YA 3H3CA 2R3KA 4K8AA 5F20A 5LCKA 4FBXA 3H9FA 3EHAA 4AP7A 2X39A 4YZBA 4ZAUA 3UG1A 4NM3A 1CKIA 4RIOA 5AP4A 2G2FA 3AGLA 2WTJA 4WOVA 1W82A 2PE0A 4C36A 4OAVB 2OGVA 2OZAA 4GL9A 5CI7A 3ET7A 1Q8ZA 1KOBA 5AR5A 1Q61A 1FVRA 2HZNA 2V55A 4WG4A 2OLCA 3MDYA 2JDTA 3FZSA 1GZOA 1HCKA 3M11A 4FL2A 5CZHA 5AV2A 5M4IA 3ID6C 2JFLA 2W7XA 3O17A 3PUPA 3T8OA 5DHJA 4NJDA 3R9NA 4F7JA 3H0YA 4CFNA 3LMIA 3ZO3A 4ENYA 2VAGA 1Q8YA 3BYOA 5AEPA 3FDNA 4RJ4A 4Y46A 3WYXA 2H6DA 2X7GA 1FMOE 4YHTA 3NW5A 3R8ZA 5L3AA 3KCFA 5KMKA 4RQKA 4APCA 3BYVA 3BQRA 4ZTNA 4BTJA 4U3ZA 1GNGA 3DBCA 5FTOA 5DNRA 4BCOA 2QI8A 4V0GA 5JN2A 3ZRMA 4O7TA 2C5NA 4BF2A 4LMNA 2QCSA 5T68A 2UZVA 4Z3VA 2XKCA 4C38A 4AGUA 2X2KA 4FF8A 4XHKB 4BKYA 1Q3DA 4FZ7A 1KSWA 3NNWA 4CFWA 4AFJA 5TKDA 3V3VA 1JKSA 4O7LA 5K0XA 1R0PA 2PPQA 2R3RA 4O4CA 4WG3A 4LM5A 5BVWA 4E6DA 5I0BA 4YLKA 4IAYA 3DT1A 4G3FA 4GVAA 5KHXA 4FV7A 1R78A 2PL0A 4FKJA 5IA4A 2BALA 4CV9A 5M44A 4QTDA 3RAKA 4O7VA 4HPTE 5HX6A 1ZARA 3WIGA 5A4TA 3EFLA 5FEEA 3HX4A 4IDTA 4E5WA 2B54A 3C0GA 5FXQA 5AP1A 3CBLA 2WMAA 3MW1A 4JG8A 5FXRA 1SVEA 4IH8A 4C4HA 1ZZLA 4ERWA 4K77A 1T45A 4D1XA 1URWA 3GCSA 3I5ZA 2BKZA 4IC8A 1LP4A 4BCKA 2ZOQA 5DH3A 2NRYA 2C6IA 2YWPA 3Q9XA 4NK9A 5E1EA 3H10A 3RBWA 2WB8A 3DJ6A 2J0IA 3DB8A 3LQ8A 2ZV2A 4BBFA 4R5SA 3DJ7A 4CG9A 3MYGA 1XBBA 5IA2A 1BKXA 3KEXA 1ZOGA 5ANIA 4DF3A 4M12A 2F2UA 3KGAA 3CY3A 3FMNA 4G9CA 4U97A 2Z7QA 2R7BA 3HL7A 4D0XA 5CI6A 3G15A 4IAKA 3K5VA 4V01A 2AC5A 5HEZA 2WQEA 4BCPA 3GP0A 5GINE 5AUWA 2WOTA 3QTIA 1UNHA 3HV4A 5TT7A 1OUYA 4QEBA 3SOAA 1XH5A 2ITTA 2RF9A 5J87A 2ITYA 4AW0A 4C4FA 3TEIA 2H9VA 2ITNA 3PIZA 5L8JA 4EONA 4C3FA 4GSBA 2PYWA 2WIPA 4DEAA 4JX3A 4D4YA 5A46A 2OICA 2XBJA 2FUMA 4I4EA 3U6IA 4XJ0A 4Y83A 5HLNA 2VD5A 4P2KA 4AA5A 4DINA 4FEXA 5HG5A 3FC2A 3FQEA 1YWNA 2FB8A 2WKMA 1GZNA 4LG4A 4NKAA 2UZEA 1QPJA 4YZNA 4O0RA 4ASDA 3GNIB 3CXWA 4GK4A 2PZIA 3FY0A 5CXZA 1OVEA 4EWQA 2Z8CA 1TKIA 3BI6A 3MN3A 3D4QA 3OUNB 3TI1A 3UVRA 1Y57A 1OL1A 4IFGA 4L67A 1OPJA 4O21A 4IM0A 1M7NA 4CCBA 2J5EA 4GG7A 4NWMA 3A62A 2G2IA 3TTJA 3BLRA 4Q9ZA 1XH9A 5JZJA 3QKMA 4RIWA 5D10A 2HAKA 4QP1A 4FL1A 4XRJA 3PA3A 3DXQA 5HE3A 2HWOA 5IA1A 3L1SA 3DXPA 3PXFA 2W5BA 4E4XA 3WI6A 3LLAA 3BU3A 2GNIA 3PFQA 2HXQA 1OECA 2HY0A 5BVDA 3DKOA 2VWUA 4YJUA 5M4UA 4O6LA 4O1OA 3QA8A 4GFMA 4U6RA 4NCTA 4QMQA 4IXPA 4B6LA 2J4ZA 5A4QA 2C68A 4PMTA 4JQ7A 5BVFA 4AFEA 3FAAA 3Q4ZA 3ZUVA 3MIAA 3TV6A 3D0EA 3ORMA 5CQUA 1F0QA 5DVRA 5E8UA 2JFMA 3LCDA 5ETCA 2X6DA 2ACXA 5I9VA 4IX6A 4XG3A 1XKKA 4CV8A 3NAYA 4XRLA 2CLQA 2FA2A 4YTHA 4NTSA 4I22A 4DT9A 1OL7A 3A7GA 1SNUA 3PY1A 5HCXA 4HGTA 3KMWA 4WIHA 4E1ZA 2R0IA 3F9NA 3IKAA 4ZEGA 4E7WA 3UPZA 3ZDIA 1NA7A 3ENHA 3NGAA 4I21A 5G1XA 3UC4A 4BDFA 4MUQA 3NNUA 4N57A 4CFUA 4J1RA 4AUAA 2PVHA 3KN6A 3F3WA 4MHAA 5HX8A 3O5AA 4ZMEA 5HO8A 3FY2A 3D5WA 5AX3A 5GZAA 4XOZA 5H8EA 3UQCA 2OK1A 1PXMA 4JOAA 4O0XA 4G6LA 5DI1A 1CDKA 2WTKC 4PPCA 3GU7A 3FHRA 2XEZA 4IVCA 2XIYA 3L8SA 4DFXE 4I92A 5H8GA 2RFSA 2PZYA 4G3GA 4L52A 1YI4A 3P7BA 4CXAA 4ZK5A 1UV5A 2I0YA 2UZWE 3VBXA 1RE8A 4FVQA 4DC2A 3ULZA 3UZRA 4AXDA 3OBGA 4RJ7A 3R7OA 3TJCA 4J97A 4LDTA 2QR7A 3NCGA 2DUVA 4WBOA 5LVMA 4IVBA 3GFEA 4R7BA 4HVSA 4JL9A 4I6FA 3PXZA 3TYKA 4FRFA 2JC6A 2HWPA 3PZHA 4U0IA 3E3BX 4F09A 4X2GA 3LXLA 5FEDA 4EYMA 5I5ZA 2V62A 3HEGA 1OPLA 4M67A 4U3YA 4ANMA 3EN9A 4FEQA 3IK3A 2JGZA 3R8UA 4EJNA 3VS4A 4BCQA 2HOGA 1OKZA 3KF7A 3PRFA 3RCDA 4AGCA 4RX9A 5CEOA 4MF0A 4NSTA 5CANA 4J8MA 4P5QA 5E8XA 4DGGA 1RW8A 3EQRA 4LOPA 2UZDA 4WD5A 2QO9A 4M13A 2VO3A 3KMUA 3ZLYA 4WG5A 4BCHA 5JQ5A 1OIUA 2FSOX 2WMVA 3QC9A 1V1KA 3C4CA 3L9MA 3ZDUA 2IVSA 3FZPA 4UBAA 3CD3A 3OS3A 2JDRA 4TRLA 3A4OX 4JMQA 4QMMA 4GU9A 3LW0A 3V5TA 4CFMA 4F1MA 2ERZE 1O6YA 2XIZA 3R04A 3ORLA 3W32A 4I6HA 3HUCA 4I5HA 4E6CA 3V6SA 2QO2A 3NLBA 4O1PA 4XG8A 4YBKA 1KV2A 5F4NA 4A9UA 2DWBA 4G5JA 4M69A 2I7QA 3SQQA 5CU0A 5CU2A 1JVPP 3B2WA 2YLFA 5A6OA 3MBLA 4R78A 5EM5A 4LGGA 2Q83A 1M2RA 3DPKA 4DG2E 5DIAA 4C2VA 3AMYA 4ACDA 2YAAA 3MTLA 4BDKA 4FV4A 4NM5A 1MRYA 1XO2B 2WOUA 4UB7A 5K0KA 3R8PA 5AUYA 2QKRA 3Q04A 4FKPA 5CU3A 2YZLA 3U55A 1KE6A 3D94A 5AR2A 3PG1A 3LFNA 1U5RA 4IVDA 3TZ8A 1G8SA 3QBNA 4O0VA 5AIKA 2WD1A 1U46A 3DAKA 3U87A 4CKJA 5HD7A 2R3PA 3R00A 1JPAA 2XS0A 3ITZA 4QMNA 2YDIA 2XKEA 4C3PA 5DMZA 4HCTA 2F7ZE 3W1FA 4U41A 4FKVA 1Q99A 1K3AA 3MY5A 4HVIA 2GHGA 5IMEA 4OTIA 2F57A 3LIJA 3VHKA 2EXEA 2BRHA 2XNPA 1JAMA 2UW9A 4D9TA 2Y7JA 5DPVA 4GJ3A 3BU6A 4JNWA 4RZWA 3FZRA 3WE8A 3ZUUA 4E26A 3NS9A 4U44A 1H1RA 3BYMA 4IM3A 3FQSA 5HU3A 2PUPA 3PXYA 4NUSA 2WNTA 5EDQA 4ZIMA 4NFNA 4USEA 5LJJA 1DI9A 4GIHA 3DK6A 5E8VA 3F3TA 2R3GA 3ZZEA 1SZMA 3SA0A 4O27B 4OT6A 3ZSIA 4EKLA 3OCGA 4FKIA 4O0YA 4EK8A 3TTIA 4RVMA 1ZXEA 3DKCA 1TQMA 3SG8A 1ZY5A 4M68A 3QLGA 4JVGA 4XLIA 4CLJA 2XBAA 3F88A 3FYJX 1BUHA 1KUTA 4WNOA 2QHMA 2C6MA 3CPBA 4P90A 3COHA 5FGKA 3W0NA 3NUNA 4FTKA 4L68A 2AEGA 4RVKA 3OHTA 3TKUA 3W0OA 4DHFA 2BRMA 3NW7A 4TKSA 4EOIA 1PXJA 5I9YA 3SXSA 2R3HA 2KTYA 5CU6A 3MGYA 5AIRA 3EYGA 3QL8A 4DTAA 3TDWA 2P4IA 4MXAA 3F7WA 1EH4A 3LVPA 1CSNA 3IW6A 2BTRA 3RINA 3WARA 4EH7A 3QWJA 3QQUA 3FLYA 4C34A 4FKQA 1BL7A 5LMKA 2YM4A 1FOTA 5K9IA 3E63A 1ZZ2A 4Q5EA 5C27A 5J7BA 3DFAA 5KCVA 3KRXA 4LGHA 4UMUA 3A7JA 1TQIA 5HBEA 4CFVA 1YXSA 2ZM4A 4DFLA 5ANJA 3EQBA 4ZMFA 4CGAA 5E92A 2XK8A 4EOQA 2UZUE 2VRXA 1YDRE 3F69A 4KS7A 4C02A 3R6XA 3O7LB 5CNNA 5LMBA 2WQNA 2C5XA 5K3YA 2O2UA 4C4JA 5IH5A 3PVUA 3EKNA 4D2RA 3PVWA 1PKDA 2PSQA 4B99A 3OCBA 2YA9A 3D83A 1CKPA 4WUAA 4UWBA 4R3RA 3TACA 3SVVA 2FH9A 3ZXZA 2VUWA 3GOPA 2FO0A 2C0TA 2OU7A 4J96A 3R7VA 4BJJB 3EL8A 2J0KA 4FV0A 3U6HA 4RC4A 3CEKA 3UQFA 2Z7LA 2IW6A 4DDIA 2XK4A 3PJ8A 3E64A 4ERKA 5HI2A 4C4IA 3EQCA 2C0IA 3H30A 4EEVA 2PUIA 2AQXA 4OAUC 4FV8A 3I7CA 2J9MA 3QXPA 3E5AA 3W2OA 1APME 2YZAA 4EKKA 5E8WA 4IZYA 4L7SA 3HUBA 4H3BA 2I1MA 4OTPA 1VEBA 4PV0A 3R02A 3OXZA 4ZP5A 3BELA 4AOTA 1UKIA 2X6EA 3TG1A 4C8BA 3AD5A 1BLXA 2KULA 4IC7A 3OROA 1JLUE 4KD1A 3UIBA 3ORZA 2PVNA 4DTBA 3H9OA 2R3FA 2C3IB 3NRMA 2UW3A 2W1CA 1OL6A 5HD4A 4I41A 4YR8A 3ATTA 2R3NA 4L45A 4F65A 5IZFA 3QLFA 2RIOA 2WPAA 1OITA 2EUFB 3Q9WA 4X7QA 4BI0A 4X2JA 3FSKA 3EL7A 2IG7A 4RIWB 2CMWA 3GC0A 2PVRA 4H1MA 4YTFA 3VUMA 1GY3A 1XR1A 2CKEA 3E87A 4IJ9A 2WMXA 3ORNA 3CIKA 4ZSJA 5TOZA 3R9OA 3WF7A 1Q5KA 4AZEA 3FLZA 4MCVA 3PA5A 3DKFA 3GGFA 4M8TA 5AAFA 1UU8A 3L8PA 3ODYX 4M0YA 3W33A 3TKHA 4ZTHA 5HG8A 4XG4A 3KXHA 4HYIA 4R7HA 4BBMA 3Q4UA 2OFUA 3PVBA 3FSFA 5CU4A 2W99B 5EM6A 1CKJA 3PE1A 2BPMA 3DZOA 2OF2A 1H27A 2IVVA 4UWCA 3S1HA 3I60A 3F5UA 3AMAA 3AT2A 2C6TA 3K3IA 2VTJA 3CPCA 4ANNA 2HZ4A 1RQQA 4RMZA 3QZFA 1I44A 3PPKA 4F7LA 1FPUA 4FG8A 1J3HA 3VS1A 1YOMA 4BGQA 3F5XA 3QQFA 4TWCA 3LQ3A 1SVGA 4FZDB 4BGHA 4IQ6A 3EQFA 2XKFA 3FKNA 3DK3A 1OPKA 2NPQA 4W4VA 1WVYA 2IW8A 2XNMA 3UIXA 3UP7A 4HNFA 3UYSA 2JIVA 3BKBA 3C4WA 5EW8A 3ZM4A 4EK4A 4CTCA 4JS8A 3GQLA 3UDZA 4BDGA 1M52A 5ACBC 4IAIA 3BPRA 1J1CA 3VO3A 1H07A 2NNWB 4G3CA 2V22A 4WNPA 3E62A 2I0HA 2VTRA 2VV9A 2XIXA 2YIQA 3EOCA 4PP9A 3D9VA 2PVFA 4ACGA 3LFSA 5M51A 4ARKA 2QC6A 2XANA 4G3EA 4O81A 4I94A 1P5EA 4AW2A 1KOAA 3C51A 4M7IA 3TV4A 5JFSA 4GKIA 3P0MA 2DQ7X 5DEWA 4GFOA 5HORA 3I5NA 2XALA 5EW9A 5ANOA 3UO6A 2UZNA 3WF5A 3S3IA 5IISA 2B55A 4FTTA 5HBHA 4EUTA 3H4JA 3NUXA 1JSUA 4O2ZA 4YJSA 4DCAA 4QMVA 4EJ7A 2F4JA 3IW4A 1NXKA 3R7YA 1P14A 4IVAA 5E8ZA 2C6OA 2WQBA 5HTBA 3EQPA 4BTKA 2F7EE 4R3PA 4YNEA 4S34A 5A6NA 1ZMWA 3OTUA 4AF3A 1WMKA 4QTEA 4AAYA 2C6EA 2VTLA 2IO6A 3LM0A 4EQUA 1BI8A 2I0EA 3BV2A 1BL6A 4Y5QA 2JIIA 2PMIA 3MV5A 4N6ZA 5AR4A 1NT2A 1U4DA 4C4GA 3B8QA 1YRPA 4L6QA 3AT4A 3OOMA 1OL5A 3EQIA 4W9XA 4KS8A 2RFDA 2YCSA 3PLAE 4FSQA 2B4SB 4E4LA 3IS5A 3PFYA 1OBGA 2CNUA 5EDPA 4CMTA 1J7LA 2Z7SA 3V5JA 4BCGA 4F99A 3UVPA 4U5JA 2XNEA 5CVHA 4WA9A 3BHYA 4DEEA 1QPEA 3B8RA 3NEWA 5I9UA 3W0RA 4KRCA 3PSDA 4YZ9A 1Q24A 2UW7A 3FE3A 4MD7E 4FEWA 3RTPA 2X1NA 5DFPA 2WIHA 3I0OA 2PVKA 3E92A 1FVVA 2E2BA 3EN4A 4XMOA 3IGGA 1Z5MA 4FTOA 4M0ZA 1H01A 3KK8A 3GC7A 4RFZA 2UVZA 4L3LA 5HG7A 3ZZWA 3ZM9A 4N4SA 4E4NA 4ZY4A 3VUTA 3KVWA 5HICA 1UA2A 2B52A 1DI8A 4KWPA 3LCKA 3DNDA 2QKWB 1QPDA 5FM3A 2QOBA 3O7LD 2ZYBA 5IUIA 3CCNA 3NYOA 4Q5HA 5HVJA 2XRWA 3UOJA 4DFUA 3UNZA 1FBNA 4JG7A 5IQEA 3JY0A 3W16A 5AA9A 5GJGA 3FMDA 2HZ0A 2XYNA 2ZMDA 1IA8A 2UUEA 3AMBA 3VS7A 4EI4A 3DAJA 4WSQA 3QX2A 3OT3A 3KXNA 5CZIA 1IAJA 2Z60A 5IDPA 4IADA 3HV5A 4AS0A 4GK3A 4O4BB 4DEBA 4H3PA 2SRCA 2PVJA 4K1BA 3W2RA 2XKDA 3LFBA 4TYGA 2W06A 3RM7A 4MQ2A 3FZOA 5AUVA 1CM8A 4MXOA 5GZ9A 3QRKA 1QCFA 3HLLA 5IA3A 5FLFA 4DH3A 4HGEA 3AKKA 2P3GX 3A99A 3DAEA 3MFRA 2A98A 5L2SA 4MYGA 3LCSA 2C1AA 1ZYSA 2XUUA 3HV6A 2WHBA 2WMWA 5DEYA 3ML1A 4BIEA 4AXFA 3Q3BA 3QHRA 1HCLA 3QALE 5L6WL 4J53A 2YN8A 3DBFA 4EBVA 3MJ1A 3G5DA 4C58A 5GZ8A 5AWMA 4ANSA 2J7TA 5CAUA 3RZFA 1STCE 3DLSA 4EL9A 1P4FA 5LWNA 5H8BA 5CVFA 4ZXTA 5HG9A 3CR0A 5K4JA 4FE2A 4EH2A 5BYZA 2XJ1A 3PY3A 4L7FA 3PPZA 1MQBA 4L44A 3TUBA 4ZS4A 5LARA 4OW8A 4Y8DA 5K4IA 3QKKA 4XNEA 5HIDA 1Y6AA 3F5PA 1WVWA 3GB2A 2Y9QA 4QPMA 5HCYA 4C3RA 3VAPA 2JBOA 4BDIA 3QQGA 2C5OA 2UW6A 3ELJA 3UIUA 3OXTA 3R8MA 5E8SA 5L6OA 4BZDA 4U45A 4DHZA 3FHIA 3ZSGA 5BVOA 3EWHA 4YLJA 5KZ0A 4ORKA 2VX0A 4D2SA 3RWPA 3ZONA 4FKSA 1XH6A 3VW6A 1PXPA 3PSBA 3SAYA 2YM6A 3R28A 5HU9A 5C4LA 4LL5A 1UU9A 3HGKA 3QCSA 2X8DA 4F6UA 4JR3A 3EQDA 4CT2A 4A9YA 4UXLA 5EK7A 2OW3A 1B39A 2YM8A 3MFTA 4LV5A 5DBXA 5EM7A 5HKMA 3UNJA 4UMPA 3CJGA 3QYZA 4TW9A 2H8HA 4HNIA 4CYJA 2A0CX 3GOKA 1AGWA 3EYHA 4HZRA 4EOOA 4WNMA 4DFBA 4BY9E 5M57A 4YUQA 4IB3A 3KIOC 3GT8A 2Y4IB 4QPSA 5I3OA 4A4OA 4AE9A 2NO3A 4ASXA 1G5SA 2QOKA 3PIXA 1ZMVA 2BIKB 4HPUE 4DFYA 1Q8TA 5CAVA 1ST0A 4H58A 5HTCA 4NCTC 2XF0A 3ROYA 2YJSA 4FIFA 3HNGA 5GJDA 3OFMA 4QMLA 2W4OA 4ITHA 4WO5A 4NT4A 4EHEA 4F70A 1MP8A 3A2CA 4S31A 2J6MA 3BYSA 4YHFA 2XM9A 4CQEA 3DBEA 1NY3A 3LPBA 4XP3A 4M14A 2GPHA 3JVRA 4FKRA 4O91A 3R83A 5HE2A 3QTZA 3PXQA 4YPDA 5B2KA 4CFXA 2ZFYA 4AQCA 2WTIA 2IEWA 3HZTA 2CGXA 4PTCA 4AQKA 3FXXA 2Q0NA 5A4EA 3VJNA 1ZY4A 4EQMA 2XYUA 2RG5A 5IA0A 1PY5A 5FUTA 2IVTA 3U9NA 2CCHA 2VTNA 4V04A 3FMMA 3QHWA 3F7ZA 5EI8A 3TWJA 2BILB 2Y4PA 3WZDA 4FT3A 4DE4A 4X0MA 4RWIA 3UMWA 3GU4A 3LCOA 2VNYA 3OF0A 5EYKA 1RDQE 4FSNA 4WRSA 3GBZA 4IEBA 5AP3A 2QOCA 3G2FA 4EH9A