1O6LA

Crystal structure of an activated akt/protein kinase b (pkb-pif chimera) ternary complex with amp-pnp and gsk3 peptide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Activated Akt/Protein Kinase B Ternary Complex with Gsk-3 Peptide and AMP-Pnp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
total genus 92
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1o6lA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1o6lA02
5F95A 4GL9A 5H9BA 5IQIA 4OAUC 2Z8CA 3DY7A 2R3FA 3ENHA 3W2CA 1OUKA 4G9CA 4YZ9A 3DGKA 1GAGA 4X3JA 1XH8A 5ACKA 4Q2AA 2YAKA 3FMJA 3NGAA 5CX9A 3SXRA 4K6ZA 4HYUA 2LAVA 2WMBA 3UDBA 3TWJA 2QHNA 3PP0A 3R73A 3UPXA 5J5TA 1BL6A 4I92A 4N0SA 1WVYA 4U0IA 3CLYA 3EQIA 3U9NA 4QTDA 3W32A 4CLJA 2C30A 4BVUA 4MD7E 4CXAA 3RCDA 4FVPA 3KRJA 2JAVA 4YSMA 3CXWA 5HTCA 3SQQA 2JIUA 1PF8A 4O0TA 4ANBA 5DRBA 4DEEA 2C3IB 2GNHA 1H27A 1Q3WA 3PSBA 3W2RA 4L3PA 4QO9A 5A46A 4JXFA 5FTGA 3AD4A 4YJRA 4EZ7A 2E9OA 5CZIA 4IC7A 2R3OA 5E92A 4BWXA 2WMUA 4IE9A 4RX9A 4NL0A 5DT3A 4R1VA 1RDQE 2Y9QA 1XQZA 1JKKA 3VUDA 4FTKA 5FXRA 3BV3A 4XRLA 2GQSA 3UJGA 4ITIA 1NA7A 3QTRA 3REPA 3ZBXA 5CSPA 5KE0A 5L8LA 4GW8A 3OCGA 5CU2A 3ZO2A 5A6NA 1A48A 3TKIA 1YQJA 4ZSLA 3C9WA 3OY1A 2W7XA 4FKSA 4QYEA 4PNIA 2WOUA 3ZRLA 5ANJA 2VGPA 2GSFA 4F65A 3PY1A 4ACDA 2QURA 4DT9A 3UNZA 4V01A 4AW5A 3U9CA 4EKLA 4IB5A 3QLGA 5I9YA 4EZ5A 1J91A 4MWHA 3VW8A 2ZV7A 2XKEA 3PXRA 3D9VA 4KNBA 1J7UA 4GG7A 4E26A 2C3JA 4EHGA 3ZCLA 3UZPA 4AGCA 3CPCA 4LQMA 2WMWA 5HE1A 3I7CA 5CQWA 3WF6A 4O22A 3T3VA 4D0XA 4K0YA 4FKIA 3ROCA 2HXLA 1ZWSA 3V5WA 4YO4A 5CEOA 4FT5A 1XBAA 3ERKA 1H08A 3R1NA 5BUIA 2Z02A 1Q4LA 2X6EA 3AC3A 3RM7A 3VBQA 4E6DA 5L8KA 4IZ5A 5IU2A 4G3CA 2FSMX 2PZYA 2GQGA 4F6UA 1B39A 2QOQA 1ERKA 3KMMA 4V0GB 2V0DA 1PMEA 3HV7A 4KRDA 3COKA 2HW7A 1J7LA 5CNOA 3C4EA 3VS6A 2R3GA 3PA4A 4O0YA 2CJMA 1GZOA 3R01A 3F5XA 5DEWA 4FL2A 5AA8A 1H1QA 3UO5A 5K4IA 2VWXA 2VX0A 5EDQA 3G51A 5IH5A 3BYVA 2QO2A 4G16A 4R7HA 2C6IA 4WG4A 2VWYA 3TUDA 3LCTA 5I9XA 3O7LD 4RVLA 4BCMA 5A54A 4I21A 3EQPA 3KMUA 5AM6A 3LXLA 4EH5A 3FI3A 4JG8A 2RSVA 4KRCA 3GU7A 3V5QA 1PMUA 3G6HA 4U41A 2VTAA 5GJFA 2Z60A 3T9TA 4MXZA 4IEBA 3OS3A 3QQHA 5CAOA 1W84A 4D2PA 4WD5A 3GNIB 2HELA 4IX4A 2Y7JA 3MFSA 1U46A 3OCTA 5D41A 2IVTA 1OGUA 3P0MA 5TR6A 3FYJX 1KV2A 3TZ7A 4C57A 4DC2A 1DS5A 1U4DA 2O0UA 2CGVA 2JFLA 3PXQA 4IAZA 3R7IA 2J0JA 4YJSA 1QL6A 4C38A 4M14A 4S2ZA 1QPDA 5C4LA 3VS7A 3BLHA 5HESA 3V6SA 5DGZA 2W1ZA 1ZXEA 2X4FA 3F2NA 1YDRE 3Q9WA 5L6OA 5M53A 4EOKA 1PJKA 5HICA 4ZP5A 3OBJA 2O64A 5J95A 2WQMA 4AQCA 2JAMA 4QQTA 2HY0A 4FSNA 3FKOA 2EUFB 1HOWA 3AD6A 4MNEB 3HX4A 3OXTA 3BU3A 2BAKA 1H01A 2XNNA 3Q9YA 2OXYA 3UIBA 3KRWA 3UP7A 5EOLA 2BIKB 4PL3A 4AT4A 1SM2A 4MYGA 2YIRA 5H8EA 1CMKE 3ZONA 3SRVB 3UNKA 4BGHA 1ZOHA 3DZOA 4DEIA 5KHXA 2WIHA 5CQUA 3E63A 4F9WA 4X7QA 3IOPA 5B2KA 5HD4A 1KSWA 3GC0A 3ORMA 2X0GA 4YHTA 4B99A 4ARKA 5KBRA 1S9JA 4R77A 4Y85A 1V1KA 4FTAA 3SKCA 4CSVA 4U97A 5D1JA 1Q62A 4JRVA 3R7OA 3EN5A 4EORA 3UGCA 4CFFA 3VF8A 4EQCA 3PVUA 4WG3A 3KU2A 3RJCA 2VTRA 2PSQA 4OBOA 4E3CA 4PQNA 4C4IA 4AT5A 3RZBA 2OF2A 4UMRA 5E4HA 3U6IA 1RE8A 4UALA 5BVFA 3FZOA 3EZVA 2YAAA 4IB3A 5L6WL 3H0YA 5IQBA 4YO6A 3OD6X 2CGUA 3FQEA 4DINA 1OL2A 4PY1A 2VN9A 1UU3A 2IW6A 4M3QA 4CZUA 3TUCA 5LMKA 3PY0A 5CEKA 3MIAA 4PPAA 4IVCA 1IASA 1OIYA 3PWYA 2JDOA 2YJSA 5AM7A 4BTMA 3C50A 4F08A 3Q04A 3TN8A 2GTMA 2X2KA 2BHEA 3OTUA 3COMA 5KMKA 2A19B 2EU9A 4I5PA 4YBKA 3EJ1A 2VWIA 3TCPA 3IS5A 3HV4A 5AEPA 4FVQA 3HA6A 5E1SA 4FT3A 4F0GA 5I9VA 1V0BA 3EQCA 2ITXA 2R3JA 4I6HA 4OTDA 5D7VA 4F1OA 3N4VA 3ZFYA 4EHEA 2C5VA 5CU4A 5DRDA 3ZC6A 4XJ0A 4AW1A 1YHSA 1ZYDA 2ONLA 4QMZA 2AYPA 4HCVA 2J0LA 4J1RA 1XHAA 4PUZA 3V51A 5BPYA 5HVJA 2Q0NA 4NM0A 4C61A 3V3VA 4AFJA 1OKZA 2IVVA 5EW8A 5C26A 1XBCA 3SAYA 2PYWA 3UIUA 4O7NA 1JQHA 2JEDA 4YR8A 5IMEA 4A07A 1H07A 4NYEA 3HRFA 5IA0A 4FK6A 5D12A 1KE5A 2XK6A 5DHJA 3PZHA 5CEIA 4LOPA 3SLSA 3LCKA 3ORKA 3BV2A 3P9JA 4JAJA 4BTJA 1YI6A 5I4NA 2RL5A 4E5BA 2J5FA 3KREA 2ZM1A 4DT8A 3OC1A 3PXZA 3GU4A 3W8QA 4YZBA 5JMSA 1URCA 4ENXA 2BRMA 3MWUA 2YFXA 3OOGA 4GS6A 2WQOA 3MW1A 4QPMA 4MD9E 4WKQA 1E1VA 4GK2A 5AP0A 3Q5IA 4LGGA 1UU8A 5IQHA 1GOLA 4UYNA 2PE0A 2WHBA 2DYLA 4W4XA 4ZJIA 4U6RA 3MA3A 4EQUA 5DI1A 5JFWA 4D1SA 3IPHA 2FGIA 4FIEA 2VO6A 3OFMA 5ANEA 1ZYSA 3O51A 5FM3A 2V55A 3QUEA 4WG5A 5IDNA 2PMNX 2R64A 2WMTA 3QX2A 4YLJA 4BIDA 2IJMA 4WUNA 4CMOA 4J52A 5IF1A 3CC6A 3E8NA 4WNPA 3IDBA 3R8ZA 4AOTA 3A7IA 4ALWA 1CSNA 2PMOX 3E92A 3HZTA 4FG9A 4I20A 5CEQA 3GCQA 5L2SA 2PU8A 2X1NA 2QCSA 4B8MA 5IMXA 5JGBA 2F49A 4PPCA 4U42A 4EEVA 5I5ZA 4GCJA 4A9TA 3M2WA 4DTAA 4R7IA 5J9ZA 4H05A 1WFCA 4IC8A 5A4EA 5KUPA 3AC4A 3RPYA 4IWPA 5EOBA 2YERA 5TE0A 3BKBA 3HP2A 3R1SA 4ASXA 4QMQA 2QOKA 2B54A 3DOGA 4FE2A 1QPCA 2YM8A 4IANA 5HOAA 2R0IA 2I0YA 5LVNA 2B52A 3IECA 5FEQA 3POZA 3IDPA 3ZFXA 3ZLXA 5LWNA 1UKHA 3M11A 3PIZA 4QYFA 4V05A 4GK4A 4XEYA 2WU6A 2QO7A 4XG6A 4L44A 4S32A 4WO5A 1YHVA 5LVMA 5AFVA 3HAMA 2DWBA 2CN8A 3FSFA 4I4EA 3MPMA 1LUFA 1U54B 1APME 4JDJA 1MQ4A 2PUNA 4GEOA 3V04A 5IUGA 1TQIA 3NS9A 3ZRMA 3K3JA 2HXQA 4FZFB 4BDJA 4TNDA 1YWVA 2XH5A 3D5UA 2R3RA 5HBEA 3A8WA 3R8PA 1U59A 3C4CA 2P3GX 4KIPA 1RW8A 4UWYA 3KN6A 3DU8A 1QMZA 2QQ7A 3P86A 1ZY4A 4QMNA 2HYYA 2QD9A 4YMJA 4JBQA 2XJ1A 1YDSE 3R2YA 5DH3A 4QP7A 2W9ZB 1J1BA 4EHVA 4EONA 2GU8A 4PDSA 3NVMB 1UNGA 3TT0A 2BRNA 3DZQA 4I22A 4FTIA 4QQ5A 2B4SB 4W8EA 4G6OA 1NVQA 3F9NA 3KK8A 3TKHA 4M0ZA 3N4TA 1R0EA 3RCJA 3ZUTA 2C1BA 4F7NA 3DA6A 3EL8A 4NW5A 5AUYA 5HU9A 4O7ZA 3QC9A 4F6WA 3DK6A 5JRQA 4RFZA 4E5WA 3ATSA 5IUHA 4U44A 3L1SA 3GFWA 3MH3A 3NAYA 2XEYA 2QR7A 1VZOA 3GU5A 5EM8A 4C3RA 3IO7A 2XBAA 5DBXA 5BVDA 5IEYA 5L6PA 2ETRA 3VUMA 4CZYB 3O71A 4F9BA 5EW9A 5HBJA 1T46A 3G6GA 2H34A 3QD2B 2ZDTA 3QKLA 4HNFA 3UYTA 3VBXA 3I79A 4R5YA 1REJA 5IA2A 3S00A 3MJ1A 2B53A 3WE8A 2ZYBA 4YC3A 4O2ZA 4BCOA 5BX0A 4FVRA 4IMYA 2JDTA 3VVHA 2IO6A 5AP2A 2WNTA 3MGYA 2FSLX 3FWQA 3KXHA 4CQEA 4Y8DA 3O8TA 4OGRA 3ZSIA 3CPBA 4EYJA 3EFLA 1OMWA 2QKWB 4F9CA 4FYOA 2W05A 5CF8A 3OP5A 3TTIA 3FI8A 2ITVA 3EQHA 3GEQA 3FQSA 1ZOEA 1BUHA 1IA8A 4I0RA 4NFMA 4BZNA 4D1ZA 5AAEA 1GIHA 4O7LA 2W4OA 2F7EE 3ORIA 2YZAA 4Y5HA 2NRYA 2UZBA 2WD1A 3PVWA 4BCQA 3AD5A 4DH5A 4E7WA 2R7IA 3SXSA 4ALUA 4ZTMA 1AD5A 1JKSA 4MK0A 1B38A 4QP4A 4MAOA 4XG2A 4J99A 5DPVA 4CKIA 3O7LB 3UQCA 2OJJA 3OTVA 4O96A 4QMYA 2GNIA 4QPSA 2FO0A 3DT1A 5HNIX 2XP2A 1OITA 2CGWA 2W5HA 3KFAA 4G2FA 4N70A 1GY3A 4X0MA 1SYKA 5CSHA 3FZ1A 5FEDA 5FUTA 1ZMVA 4C36A 2QOOA 2PVHA 5HQ0A 1ZZLA 1PXPA 2BPMA 4H3QA 4O27B 4R3CA 5DN3A 4K18A 3GQIA 4QMUA 5M09A 4LRKA 4YP8A 3D2KA 1OBDA 4ZMFA 3O17A 3KC3A 5KMIA 3FL5A 2HWPA 5BMMA 4DGLC 4CCBA 4AW2A 1H8FA 3PJCA 3CGFA 3GB2A 3SXFA 3ZO1A 3R22A 5HORA 5K9IA 2IZUA 3PFQA 5E1EA 3GT8A 3BRBA 4IX6A 5FP5A 4KSPA 3DV3A 4EOOA 3D5VA 4A4LA 2IZSA 3EWHA 4FOBA 4BGQA 1Y91A 4QQJA 4X3FB 1PKDA 5HX8A 2PE1A 2C0OA 4BCKA 4PPBA 4TL0A 2VRXA 4XOYA 2GS7A 3FEGA 3ZM9A 3FY2A 3BYMA 2RG6A 4EWHA 5HKMA 4LGHA 5CF5A 2QG7A 2IN6A 3FQHA 5IA1A 3LHJA 3OOMA 4WNKA 3SX9A 4FSYA 4GH2A 4YZMA 4L00A 4BR3A 4KKGA 4IVAA 4ZJJA 4F70A 4O82A 2FVDA 2O8YA 1IA9A 5ANGA 2J50A 2QOIA 4RVMA 5HGIA 3R63A 4G3DA 5L2QA 5AP3A 4MBLA 3DTWA 5EHYA 4USFA 2RF9A 3F6XA 3Q52A 3HMOA 4AS0A 1JLUE 3RAIA 3EQRA 4DH7A 3KCFA 3I1AA 3NSZA 3RPRA 5CEMA 3WYYA 4DF3A 3MTFA 2WTCA 4NH1A 3LQ3A 3FPMA 5HCXA 4C3FA 2WZJA 3KXMA 2XYNA 4NUSA 1KE6A 4O81A 5KMMA 4XG7A 4FI1A 4BN1A 5CANA 3IGGA 1BYGA 1STCE 5JQ8A 4EH9A 3R21A 4RG0A 1UKIA 2X9FA 1R39A 1DI9A 3F66A 3E93A 2R2PA 5HLNA 2WQEA 2PUUA 4ZAUA 5EYMA 3CBLA 4JS8A 4L42A 2YN8A 3F69A 3V5TA 4EWQA 3TZ8A 4I1ZA 1OL5A 4KIQA 4YJVA 5AX9A 5TKDA 5JGDA 3H10A 5DOSA 3S0OA 5HO6A 4GJ2A 3QC4A 3E3BX 3QHRA 5EDRA 4QQCA 5CXHA 4D5KA 4TN6A 1KE9A 4ACHA 4ORKA 1FINA 2BFXA 4GKHA 3R7EA 4BTKA 2GTNA 2B9HA 3E62A 4FTTA 4BYJA 4JT3A 3TL8A 3ZUVA 1UNHA 4ENYA 3LJ0A 3QL8A 2G9XA 4QMTA 2YACA 2ZM3A 3K54A 2Q0BA 2RFNA 1TQPA 3UMXA 3MH1A 2GQRA 3OWKA 4O84A 2HCKA 5J7BA 4OR5A 1W98A 4XP2A 3I5NA 2E9PA 3SDJA 3ZXTA 2PE2A 3BHTA 1PXNA 3EZRA 2UW4A 3EHAA 3KA0A 2O63A 5IA5A 4WUAA 3BWJA 4L53A 4KAOA 5JZNA 3WZUA 1ZLTA 3GVUA 3Q4ZA 1GJOA 2QODA 4JLCA 1H28A 3POOA 4BKJA 3DAEA 1NVRA 4WRGA 2WMQA 1XH7A 3G90X 4MF0A 4YGAA 2BCJA 4XP3A 5JH6A 3UZTA 4GKIA 3GENA 3FV8A 5EK7A 2ERKA 3LQ5A 1P4FA 2XCHA 2JFMA 4YBJA 3PA5A 1NXKA 3SW7A 4WSYA 2YDKA 3L9LA 4C2WA 2C3LA 1OPLA 1OZ1A 4EUUA 1IAHA 3LKMA 2QG5A 4YJPA 4KKHA 1CKPA 3JY0A 4FNYA 4YNOA 1KV1A 5LWMA 3QZGA 1M7QA 1V0PA 2C5NA 3MI9A 3TTJA 3OY3A 3PSDA 4GIIA 5CS6A 5HIDA 4GT3A 4LL0A 3E7VA 3RINA 4R78A 4NM3A 1KWPA 3Q2JA 3GOPA 3BBWA 4XYFA 3QCSA 4RIWB 2AC5A 4DITA 4IHPA 3CJFA 3Q53A 2JD5A 3VHEA 3QRTA 3CE3A 4GV1A 1E1XA 3SW4A 4BHZA 2CDZA 3VS2A 4O83A 4APCA 4V04A 4ZIMA 2GFSA 3PSCA 3EN6A 4BZDA 4D9TA 5AR4A 4TNBA 4RC2A 2X4ZA 3AMYA 3GCPA 4JBPA 2OICA 5EW3A 5AWMA 3KN5A 2EXCX 2Y4IC 4Y83A 3LFAA 5DMZA 4ZLOA 4EH6A 2ITUA 1OIUA 4LI5A 3MJ2A 2WO6A 3G9LX 2RIOA 3I0QA 4MTAA 4C37A 4Q5EA 3PPKA 4DFNA 4BCHA 2BZHB 4FT7A 3KRLA 4E1ZA 4AG8A 4G6LA 4IACA 4CEGA 3BGPA 1XH4A 2VZ6A 1YXUA 1PY5A 4DBXA 4IM0A 2GNFA 2QOFA 2Y0AA 3EIDA 3O50A 4EOIA 3AMAA 4PNKA 3DXQA 3HAVA 1SMHA 3D5XA 3LE6A 5AUVA 3RPVA 4AF3A 3HECA 4EOJA 2VTPA 1JNKA 3EQGA 2BAQA 4DG0E 5FGKA 2UW7A 4M8TA 1ZRZA 4F6SA 5LVPA 3D0EA 2FSOX 4E6AA 4E4MA 1IG1A 2WFYA 3UO4A 3TG1A 1IAJA 3AOXA 4F7LA 3N51A 3QCQA 3TM0A 1G3NA 2XNOA 2BAJA 4H3BA 4FSUA 4I93A 3FMDA 4NIFA 4TYGA 4LV5A 5AMNA 3RI1A 4EK5A 4RC4A 1NT2A 5B7VA 3FC2A 1UA2A 4O0SA 3FC1X 1YXTA 3G0EA 3OEZA 4FZ7A 4F4PA 4JIKA 4AUAA 4Q9ZA 1OL6A 1H1SA 5FM2A 4NKAA 3WIKA 4UXQA 1UU9A 1UU7A 5CAVA 5KO1A 4BDDA 4F0IA 2YLFA 4DEBA 4DYMA 1FMOE 5IQGA 5CU0A 2ZVAA 4IB1A 4QP9A 3U54A 1QPEA 4GMYA 3GC8A 3ET7A 4AW0A 5LQFA 2B0QA 3LJ1A 3PXYA 4I6QA 5AUUA 2OZAA 5LXMA 5J1VA 4PMSA 2JDVA 5LCKA 1FQ1B 4FT0A 5HBHA 4CFXA 5I9ZA 4ZXTA 3I60A 2PTKA 3FPQA 4IDTA 4ZY4A 2PWLA 3QQUA 4KBKA 3GCVA 4OT5A 1M17A 2E2BA 1HCLA 2PMIA 2QOBA 4HJOA 4S34A 3LMIA 2XA4A 4YTHA 2VWVA 4QD6A 4I24A 2X6DA 3CY3A 4AGUA 5HCYA 2FA2A 3EOCA 4B7TA 4C59A 3R28A 4JR7A 4BWKA 4QYHA 5HE0A 3EYHA 3LFCA 4YHJA 1WZYA 2VTOA 5K3YA 4U9AA 4G3FA 3JVRA 4NSTA 2V22A 4KWPA 3ZZWA 5KBQA 5KMNA 2VO0A 2IW8A 2OIBA 3D15A 3VQHA 3PJ2A 3LOKA 4A4OA 2BROA 2FYSA 3OW4A 4FTCA 1JBPE 1GIIA 4O38A 3AGLA 4QMWA 3OXZA 4FA2A 1KE7A 3FLNC 2JBPA 2NNWB 5HE2A 4M67A 2VX1A 4NJDA 3RKBA 4APPA 3LVPA 4BDKA 3PE1A 4JX7A 3QZHA 3D7ZA 3QGWA 2WMRA 4EQMA 4FGBA 4TPTA 2PUPA 2ZV2A 3ACKA 3AT3A 1PXKA 3EN7A 2UW0A 4U5JA 3R9NA 5M55A 1Q8TA 3ZSHA 3BU6A 3FMMA 3GCSA 3PA3A 4NT4A 3UTOA 1GZ8A 4BCFA 4BCGA 4BDGA 3ZSGA 4S30A 1DI8A 2A27A 3QRIA 3UOKA 3BE9A 3HNGA 3ZXZA 3U6HA 2GCDA 3G0FA 4EC8A 1ZZ2A 1KOBA 5CVGA 3V5PA 4K11A 4L8MA 2DUVA 4XH6A 4Z3VA 5CI7A 3OCSA 5FD2A 3PLAE 4HPTE 5AV4A 5FP6A 2C6KA 5KKRC 3MESA 1L8TA 5ITAA 4BCPA 3ULIA 4MXCA 4O7VA 3THBA 5EQYA 1YWRA 3KXXA 2CHLA 2I6LA 1JSUA 2GHLA 2HAKA 3JS2A 4FTLA 1Z57A 3P08A 2FSTX 3LQ8A 5T68A 2R4BA 1Q8UA 1ZY5A 3DNEA 3MH0A 3RM6A 5EI2A 1DM2A 3DLZA 3P79A 2JBOA 3RPOA 1NVSA 4C0TA 5JFSA 1PXMA 1WCCA 1F5QA 4YNEA 3RWQA 3PLSA 4PMMA 4WRSA 4ZTRA 4BI0A 3OXIA 2ETKA 4YHFA 5GJDA 5BYZA 2YDIA 2OH4A 3Q4CA 4W4VA 3I6UA 3ZLWA 2EXEA 3CTQA 2W1DA 4WOVA 4BZOA 2ITNA 3QUPA 1URWA 4KBAA 3RK5A 4TYIA 3PXFA 3EL7A 3TUBA 4JNWA 2I0HA 3NNVA 5LCJA 3O8PA 4H58A 5AR2A 4Z7GA 3U55A 1KOAA 4C58A 4N4SA 4GFOA 3S95A 4IZ7A 4U81A 2IPXA 1KE8A 2VWBA 3FLZA 4HVIA 3FY0A 4F7SA 3Q6UA 1J1CA 4C4JA 5FXSA 4IH8A 4CZTA 1OKWA 3C7QA 2W17A 3DFAA 2W1FA 4I94A 3R9HA 1SVHA 3QRUA 2FB8A 3VO3A 4LUEA 4BBFA 4CFWA 1XH9A 2WKMA 4FSQA 4I6FA 3D7TB 3WZKA 3B8QA 5BNJA 2WTDA 2VO3A 4BF2A 4B4LA 3R9OA 2QOLA 4FTOA 4O91A 3VUGA 2X7OA 1IR3A 4QMLA 4ALVA 4FKUA 4FSWA 3W33A 3MFRA 3GQLA 4H1MA 5DG5A 3TV4A 5EHLA 3DXPA 4PDPA 2R7BA 2PY3A 4LM5A 3U8WA 3WF7A 4J53A 3N4UA 2XNBA 4RJ5A 1YVJA 5CY3A 4HYSA 2J0KA 4ACMA 1XH5A 1WBSA 2F2UA 3OF0A 2XK3A 3QYWA 4FNXA 1K3AA 1P2AA 2C4GA 3FZPA 4KSQA 4TKSA 2W1CA 1P14A 2BIYA 3GBZA 4E93A 3WOWA 4IAKA 2PZPA 2VNWA 4A7CA 4EK8A 3PVGA 4M69A 4C7TA 5J9YA 3KRRA 1R78A 5BVWA 3UMWA 3QALE 4C8BA 4P4CA 4EH2A 4BDAA 2VTIA 4XV1A 4L46A 4F64A 5A9UA 4R1YA 3HYHA 2YHVA 3DBDA 5D10A 3TNWA 3Q60A 4EH8A 2XRWA 4NTSA 3RHXA 4HVSA 2J6MA 3L8VA 4U79A 1OIRA 5E91A 4B8LA 5DIAA 2C6TA 3BHUA 3EYGA 4CT1A 4E20A 4GUBA 3MDYA 3LFBA 2REIA 5DT4A 5ETIA 2IG7A 5IUIA 1F0QA 5EHOA 3LFQA 4DHFA 3QA8A 3PY3A 4BRXA 5A4TA 5IZFA 4YPSA 5M08A 3Q4UA 4FKRA 4UMQA 4UXLA 3O0GA 4ASEA 2XM8A 2R3HA 3QHWA 2OIDA 3PUPA 3DJ6A 3PPZA 4FTUA 4XBUA 3BGQA 3LJ2A 2C6LA 3CKWA 3CTJA 3L8PA 5CT0A 3MY1A 3TNHA 5C8MA 4M15A 4BCJA 5KNJA 3BU5A 1MP8A 1F3MC 2LGCA 2WIPA 3H9OA 3PTGA 5HG9A 3Q2MA 2WTVA 3PVBA 4DG3E 3DKGA 2UW9A 1T45A 4J98A 5D9HA 1IEPA 3CIKA 4O0RA 3CGOA 5CEPA 3AMBA 4EOQA 2HZ4A 2IZTA 4FKPA 3I4BA 2BTSA 4Y95A 4DFYA 3BHVA 4AZVA 1NY3A 1Q99A 2WTKB 2CNQA 4AXAA 1WVWA 4IAAA 3QD0A 4RJ3A 4A9SA 1Q97A 2XRUA 4Z55A 3DAKA 1OIQA 2XNPA 4TWPA 1XBBA 4XMOA 5JRSA 2G2FA 3BYSA 5LMAA 3RBWA 4CTCA 3MSSA 4GG5A 3O8UA 4DH1A 4YURA 2X39A 5EQEA 5AX3A 3KF4A 4L67A 4DEDA 4BTFA 4F1MA 3AG9A 3UPZA 5HI2A 3DK3A 3E87A 3F5PA 3O96A 3Q9ZA 2A0CX 4GVJA 3PPJA 4L7SA 2C6DA 1PHKA 2CN5A 2WEVA 3NYOA 3CY2A 4G31A 5CT7A 5HCZA 1DAWA 4BKZA 4ZLYA 2C3KA 4FV4A 4OBPA 4XV3A 1OKVA 2ZB0A 2VTLA 3MPAA 4GRBA 4MCVA 3F3TA 2C6MA 3QTIA 4FTQA 4WNMA 5J1WA 5T6KA 3VIDA 2RFDA 4H39A 4CT2A 4WA9A 3R8MA 1PKGA 4GYIA 3UIMA 4C02A 3CD8A 2OBJA 3M1SA 1Y6AA 5CAUA 4R6VA 5HO8A 4AZEA 2ACXA 4FV5A 4YUQA 3G15A 1M2RA 2Z7LA 3NW6A 4G3EA 3ZLYA 3L9MA 5IG1A 2XK4A 2W06A 4ZY6A 4G1WA 1U5QA 2P4IA 1PMVA 3BYUA 2PVYA 4L3JA 2B7AA 2JITA 3A8XA 4AGDA 4MQ2A 3ELJA 3DLSA 3W18A 2HOGA 1VYZA 1Q8WA 2QOHA 2UW3A 4JOAA 2GDOA 4FZ6A 3ODZX 2W1EA 3V8SA 4J95A 4DFLA 3GP0A 4MXOA 2E9VA 3D7TA 4EK3A 3OEFX 5HG8A 5CZHA 3ID6C 3FMHA 2X9EA 2ONLC 1GIJA 4BBMA 2YCRA 1I09A 5HIEA 3DDPA 3DQWA 3R00A 4RA5A 2JIIA 1H1RA 5HNBA 4IWDA 4RLKA 3PJ1A 4HNIA 4RJ4A 5ACBC 4NK9A 4Y72A 3BHYA 4A06A 4E4NA 3P5KA 4C33A 4RVKA 3M42A 3SOCA 3DB6A 2R3PA 1JKTA 5KZ0A 2W1IA 4CYIA 5HU3A 3KL8A 2PZRA 5CF6A 4FNZA 2HZNA 3MB7A 5E8ZA 4BYIA 4XHKB 3PXKA 3C0IA 2JDRA 3Q5ZA 4JAIA 4LFIA 4OTFA 3HKOA 2OGVA 3FLYA 3CSVA 4F9YA 1WBNA 1LEWA 2ZMDA 3QWJA 1WBWA 3FJQE 4M69B 4ANQA 4MBJA 2R0UA 3UBDA 4U40A 4CCUA 4F99A 5LMKC 4X6QC 4U8ZA 4YSJA 5GJGA 4R5SA 4FIHA 3QD4A 3MTLA 4MX9A 4NTTA 5AAFA 5A3XA 4EJNA 4RJ8A 3NVKI 3D83A 3ORLA 3FSKA 3UG2A 2YM7A 4RJ7A 2PZ5A 4GJ3A 2YIXA 5HLPA 3LXPA 4MHAA 4CFVA 2EWAA 3VS3A 3ZOSA 4ZS4A 2JKMA 3EQDA 3DCVA 3NWWA 5IPJA 1Z5MA 3ZO3A 2WTKC 3RPSA 1PXLA 4GK3A 3R83A 4M97A 3OCBA 4E5AX 3JR1A 2PHKA 4OT6A 4I5CA 3SC1A 2PL0A 3WZJA 3IQ7A 4BCNA 3FXWA 4FUYA 4XLIA 5LVOA 1KUTA 5DR9A 1P5EA 5M51A 1A9UA 5M4IA 3BLRA 3A4OX 4PL5A 4B9DA 4Z16A 3OT3A 3QTZA 4IWQA 2V62A 3BE2A 2X2LA 3QKKA 3Q4TA 3UO6A 1UV5A 4LMUA 1XJDA 2GNJA 5EI8A 3ZRKA 5F1ZA 3BZ3A 3F5GA 2C69A 1ZOGA 3GCUA 2OJFE 4FIFA 4IB0A 4OTIA 3LMGA 4CKJA 4CKRA 1WMKA 1ZYLA 2W0JA 4UEUA 4I4FA 1W8CA 1Z9XA 3JPVA 2ZV9A 3IDCA 4RFYA 1J3HA 4DN5A 3N9XA 4PMTA 4U80A 4EOLA 1BI8A 4KS8A 3DNDA 3OW3A 4QTEA 1YI4A 1YWNA 5GHVA 4RIYA 3TIZA 2BRBA 2UVYA 5TOZA 3I7BA 3NUUA 3CR0A 5L4QA 2W1GA 4QMOA 4BIEA 3A7HA 4HW7A 2BZKB 3FLQA 5TT7A 4AGWA 3KQ7A 4OLIA 4J8MA 1B6CB 4ZZMA 3MN3A 5AP5A 4AZWA 4P7EA 4RSSA 4HGTA 4XRJA 1CTPE 3R8UA 3KY2A 3NUYA 4RJ6A 2XM9A 4UWBA 2A2AA 4YJNA 1VEBA 1Y8YA 2VTNA 4CQGA 3DS6A 4NEUA 3OWJA 4GU9A 4Q5HA 2BDJA 4RWIA 3R7YA 3UZRA 2R3NA 1TQMA 5C03A 4FKVA 2UZWE 4TW9A 2J0MB 5K5XA 4RIXA 2OZOA 4AP7A 3BLQA 1U5RA 4YTFA 5GIPE 3HV3A 4XNEA 4BDBA 4ERKA 3VW6A 4I23A 3HVCA 2W4JA 3C1XA 3Q32A 4FNWA 3QCYA 3WF9A 2W1HA 4HZRA 4AX8A 5DR2A 3F3WA 4Z9LA 5AUWA 5FEEA 4G9RA 4ZZNA 4EH7A 1ZYJA 5CU3A 4BL1A 2C5XA 2P2IA 4IVDA 4U7ZA 1H00A 3KEXA 4XCUA 4XG3A 3HV6A 4PP9A 2OI4X 3ZFMA 1OVEA 3MS9A 3JYAA 5CVFA 4TXCA 5CI6A 4ZSJA 2XJ2A 1UWJA 1QCFA 2BDWA 2OXXA 1M2QA 4LGDA 3GFEA 1PRYA 1OL7A 2XUUA 3TACA 4D1XA 4OW8A 3RWPA 3I81A 3KVXA 1MRUA 2NO3A 3L9NA 4KUJA 5I9WA 2WTJA 4R8QA 3HMMA 4LMNA 4OBQA 5M44A 5KX8A 3CQEA 4QTAA 4ANSA 2QU6A 3LLAA 5C8NA 2YA9A 4YPDA 4DFZE 4EH4A 3F2AA 1YXSA 4MBIA 4CYJA 4D0WA 4JRNA 4BIBA 2GHGA 3DBFA 4CD0A 5HG5A 5BYLA 3JUHA 5IEVA 4C4FA 4QNAA 4O6LA 4XX9A 4J96A 2WAJA 4FUXA 1K9AA 2XNEA 3V8TA 4R7BA 4IBMA 2JLDA 3LZBA 2BALA 2CPKE 4MKCA 3PWDA 2Z7SA 3G33A 3U4UA 3QRJA 4TY1A 2VD5A 4Q9SA 4TTHB 1ZYCA 3EN4A 2W4KA 4U45A 4ZSAA 1J7IA 1ZMWA 4P90A 5DYJA 2I1MA 2ITTA 4MVFA 2Y6MA 4RT7A 3E3PA 5M4UA 4O7YA 4O1PA 2XB7A 4X3FC 5E8TA 2OXDA 3GC9A 1FVRA 2VTHA 3F82A 3LCSA 4FKQA 4DEHA 4LUDA 3CQUA 4C3PA 3IONA 5D7AA 3C5UA 1SNUA 2WMSA 1BMKA 3DBQA 3QAME 1UWHA 2DS1A 3QTXA 5JK3A 4ZSEA 2UV2A 4XG8A 3TNIA 3OROA 3NLBA 2VTMA 4MNEA 4XOZA 5BVNA 4FG8A 4D9UA 3Q9XA 2EXMA 3P7AA 2WOTA 3NPCA 4HVHA 4MQ1A 5EH0A 3Q96A 4AA4A 5EYDA 4FEXA 3AGMA 3NAXA 4FZAB 4Y5QA 3BCEA 4H1JA 2O5KA 5ETCA 1EH4A 3SRVA 2YLEA 4AOIA 3PZEA 1H0WA 4S33A 3RAWA 2J7TA 3VAPA 5BVOA 1E9HA 1TVOA 1ATPE 3FI2A 5C27A 3DDQA 1P4OA 4RWLA 1W82A 4UV0A 5DE2A 4AN9A 3SD0A 4YTCA 1M7NA 4PTEA 1PYEA 2UZOA 3DAJA 4FTRA 4GYGA 2F57A 3LIJA 1MRYA 1YOLA 5D11A 4CFNA 4ITHA 1NW1A 3SG8A 4DA5A 3QX4A 4O1OA 3KKVA 5F4NA 5G1XA 3KK9A 4DEGA 5JKGA 5IQAA 2UZEA 5C9CA 1CM8A 2C68A 5LVLA 5FLFA 4A9RA 5JGAA 3DBEA 5EM6A 4MXYA 3K3IA 1R0PA 4KIOA 4BY9E 2ZOQA 1YXXA 2QVSE 3SGCA 3VBVA 3ZC5A 3H30A 2YM4A 4NCTA 5KMLA 2EB3A 3G2FA 3LMHA 5L2IA 4C4EA 3UC4A 4Y46A 3E5AA 5E8XA 4AAAA 2XK8A 4BDIA 3QQGA 3PIXA 4L68A 4RC3A 3OHTA 3VJOA 4F1TA 5A4LA 2UZLA 4Y73A 5AP4A 1BLXA 4KD1A 3RMFA 3S4QA 5C8KA 4CG9A 4QT1A 5I3OA 5M07A 4M7IA 2PVJA 4PP7A 3UQGA 5IH6A 3PJ8A 4LOQA 5AADA 3ANRA 4DTKA 4JBVA 5I3RA 3LXKA 5HD7A 1Q3DA 3LLTA 1VR2A 5FTOA 2IW9A 2C5YA 4IZAA 5K5NA 3ULZA 4L43A 4KS7A 3F88A 2X8DA 5AV2A 3FMKA 2WTWA 4ZEGA 5HHWA 5HE3A 2Y4IB 4QTBA 4HZSA 2OJGA 1MQBA 4BCIA 2XZSA 4DFBA 3NNUA 4EBWA 2JKOA 1JWHA 4QP3A 4XUFA 3VS1A 2QI8A 4HOKA 2YABA 4ACGA 1WBTA 1FOTA 3MV5A 2WEIA 4F7JA 2ERZE 3DPKA 5M56A 3AQVA 4HGEA 4AA5A 4JG6A 4MH7A 3UVQA 2J9MA 3OWLA 4QNYA 2B55A 3BQCA 4NWMA 4AZTA 4DH8A 4UY9A 5AR5A 5HG7A 4AZSA 4EJ7A 5CLPA 3ACJA 4GFGA 4JDKA 3SOAA 3R04A 3VRZA 1GNGA 2QLQA 3L9PA 3R8VA 2BR1A 1FVTA 4EI4A 3IW6A 5HIBA 2YISA 4M13A 4D4VA 4X3FA 2XKDA 2C6OA 3ETAA 3HLLA 4YU2A 3G9NA 1LEZA 5AR8A 2IVUA 4JQEA 4X2FA 3KCKA 5EQPA 4MXXA 2QONA 1W83A 2VUWA 3W2PA 2XK7A 4O0VA 4AE9A 1FVVA 3L8SA 5CAPA 3CJGA 4WHZA 4WIHA 5L8JA 3RP9A 3SV0A 1YDTE 2A4LA 3FHIA 5GIOE 3P1AA 5CU6A 5TF9A 4E8AA 3ZS5A 3KRXA 3NUNA 3UOLA 4UMUA 1XH6A 2R3QA 4NFNA 3R7VA 4X2NA 4I0SA 3C51A 2PZIA 1OPJA 4IJPA 1QPJA 4UZHA 1M52A 4II5A 5AR3A 4F09A 2ESMA 4F0FA 1G5SA 4FSZA 3B2TA 3T8OA 3HV5A 2J0IA 2KULA 4LOOA 3MYGA 5CWZA 4IWOA 1MUOA 1YRPA 4TZRA 4I3ZA 4LRJA 4X2KA 2F9GA 1O9UA 4H36A 2XMYA 1Q41A 3QF9A 5K0XA 1Q61A 3OWPA 3QU0A 4FV0A 4IDVA 5GZAA 3RHKA 2CMWA 3IKAA 3ORPA 1DAYA 4LV8A 2F7ZE 5L2TA 2IZRA 4OAVB 1JSTA 5E9EA 5KKRB 3RAKA 4NU1A 3NYNA 3HL7A 2BDFA 4OUCA 2BKKA 2QKRA 2XYUA 1BX6A 2J90A 2OJIA 1FMKA 2X8EA 3IK3A 3P4KA 4G3GA 2VAGA 4QYGA 2OFUA 4IXPA 5JSMA 1H1PA 2F7XE 3ODYX 2Z7RA 4D4RA 2V7OA 4J8NA 2OK1A 2XVDA 4HVDA 3RZFA 4S31A 4CGAA 2UZTA 2QR8A 4QP6A 3AC1A 2W5AA 5E8SA 2PVNA 5IQCA 4LL5A 4D2RA 3S1HA 1YI3A 4FIGA 4IX3A 3VWAA 3TZMA 3WE4A 5M57A 1U54A 4IAIA 3K5VA 3RALA 4IJ9A 5M4FA 4TRLA 4FK3A 1FBNA 2BTRA 4FV9A 3IOKA 3VS4A 3BX5A 4O0WA 3QD3A 1LR4A 4BHNA 4JI9A 4D2TA 5IH4A 5L3AA 4XV2A 3OMVA 2WU7A 2J5EA 4ZZOA 4PF4A 4AWIA 3R1QA 5CVHA 4BWPA 3D4QA 4FV1A 5EM5A 3ALNA 3UYSA 2PVRA 2YZLA 2BMCA 3RNYA 2VTJA 4FEUA 2QO9A 3MY0A 3VN9A 4RWKA 3UC3A 2CNUA 3VS5A 1PYXA 4IQ6A 4N6ZA 1YW2A 2RFSA 4KBCA 4QRCA 3K2LA 4FIIA 4YJQA 4RZWA 4TYHB 5HNGA 3H9FA 2OZAB 3KVWA 4E4XA 5IA4A 4IFCA 3NDMA 2ZV8A 3NW7A 4L9IA 4B0GA 2GHMA 4M68A 2BILB 2CKQA 5CASA 4JJRA 5EI6A 2VWWA 4ITJA 1Q5KA 4MD8E 2XBJA 4IZYA 3QGYA 3HRCA 4D58A 2XNGA 3MPTA 3W2OA 2JKKA 3I6WA 4FODA 3A61A 1M2PA 3JVSA 3HDNA 4DLIA 4UMPA 4DCAA 3LFEA 4D55A 5A14A 3ITZA 2C1AA 4FKOA 2VTQA 2F2CB 3NUSA 2XKFA 1REKA 4L6QA 5GZ9A 3V6RA 4YJOA 4NW6A 3WBLA 2VTTA 3AT2A 1YHWA 4L52A 5I0BA 2ZM4A 4W9XA 4FMQA 3L8XA 4A4XA 4AFEA 5J79A 4PL4A 3RK9A 3MFUA 5K0KA 3VULA 2Q83A 4CRLA 3LFSA 3A62A 4FYNA 2YCSA 3TI1A 3OBGA 3EMGA 2G01A 3ENMA 3LM0A 3B8RA 3LXNA 2ETMA 3PYYA 3EFKA 5HTBA 1XKKA 1AGWA 4IM3A 4PWNA 3BEGA 4N57A 5DFPA 4FL1A 3TJCA 2E9UA 4W4WA 2X7FA 4OTQA 3ZYAA 2ITZA 1L3RE 5AIRA 5AV3A 4U3YA 1A06A 2J51A 4R3RA 3VUHA 4D2WA 4E6QA 2HW6A 2VU3A 3WZEA 3RVGA 3NW5A 1SVEA 1V0OA 2R3MA 3AT4A 3NNWA 4AA0A 4USEA 2HWOA 1CKJA 4QMPA 4G5PA 5AR7A 4DTBA 4PDOA 3DKCA 3ZZEA 2ZAZA 2OJ9A 4KA3A 2UUEA 1WBOA 3DQXA 3TNQB 4V0GA 5ANKA 4FTJA 4UN0C 3F61A 4ZMEA 3C4WA 3VBTA 3VQUA 5LARA 2CNVA 3AC2A 4NM7A 4W8DA 3E7OA 4JBOA 4KINA 4PV0A 2X8IA 4D4SA 3TV7A 2YJRA 5CSVA 5TO8A 4XG4A 4FICA 3COIA 3FZSA 4FV3A 4CG8A 4KB8A 2A1AB 2KTYA 2C47A 2W5BA 4QPAA 5HVYA 4BB4A 2C6EA 5ANDA 3RAHA 3A60A 4RPVA 3P78A 5AP6A 3PRIA 3T3UA 1LPUA 3EQFA 2AUHA 5IQEA 3ZDUA 4J97A 4JL9A 4A9UA 5CALA 2PPQA 3VNTA 2X2MA 5C1QB 4GT4A 3VUTA 4RIYB 2UVZA 5DEYA 3ZDIA 4FV2A 4QTCA 1PXOA 3UNJA 3U87A 3PP1A 3UE4A 1W0XC 4QMMA 4FKTA 3NUXA 3P23A 5IISA 4FKWA 4J7BA 5J9LA 3EH9A 3NMUF 4EK4A 1OB3A 5BYYA 3FLWA 4GT5A 3V5LA 3UODA 3QXPA 5JFVA 2YDJA 4LYNA 3RGFA 4EOMA 3VBYA 4QMXA 2OO8X 1YOJA 3EKNA 3ZEPA 1FPUA 5J8IA 3KMWA 4DGOA 4EH3A 5FDPA 2I7QA 4AACA 2R9SA 4NJ3A 3BHHA 3F2RA 3R7UA 5T3QA 3TZ9A 1R3CA 3W1FA 2HZ0A 5LOHA 2VGOA 4OTWA 4UBAA 5FG8A 2O65A 3PRFA 5CSXA 4MEDA 3FYKX 2UVXA 5JN2A 3P7BA 3OZ6A 4MF1A 4PRJA 2C0TA 4YZNA 4OTGA 4DBNA 4ZTSA 2HY81 3EB0A 3GU6A 5GINE 3B2WA 4ZLZA 4EYMA 5EKNA 5E8VA 2XF0A 3Q3BA 4DFUA 2CCIA 2UW8A 3ROYA 5G6VA 2OG8A 4IAFA 3DJ5A 3QA0A 1SZMA 3QYZA 1JAMA 4K9YA 1ZAOA 4X2GA 3VJNA 5ANIA 2XIRA 5HX6A 4YLKA 4HCUA 3PJ3A 1YXVA 4FL3A 2RGPA 3K5UA 5IKWA 1ND4A 4BI1A 4RIOA 5J5SA 2NRUA 2HK5A 3GC7A 3QFVA 3SHEA 4EOSA 4M0YA 3PG3A 4UYAA 5AAGA 1H25A 3WIGA 3BWFA 3MVLA 4QP8A 2YWPA 1LP4A 3EN9A 3FZRA 4CLIA 4DFXE 4ASZA 3QQJA 4O86A 3D5WA 4DE4A 4XP0A 3QQFA 3W16A 3BQRA 1AQ1A 2H9VA 3MBLA 4HVGA 3QZIA 4PX6A 3HUBA 2W9FB 4ZTHA 4UZDA 5CSWA 4DGNA 3UVPA 4HYHA 5E90A 3QRKA 5JEBA 3U6JA 2Z7QA 2H6DA 4X2JA 4CRSA 2JDSA 4EBVA 3R9RA 2ITPA 4YZCA 5AUZA 3DTCA 4P5QA 1XWSA 2WQBA 3WF8A 4BDEA 2XEZA 3KULB 3R1YA 3R9DA 3HRBA 3LFNA 4EL9A 3CD3A 4M66A 4C2VA 3ZUUA 4EOPA 4RIXB 3ORZA 2V5QA 3FMNA 3DXNA 2WELA 4WSQA 1HCKA 4I5HA 1OPKA 2F4JA 4CFUA 4PDYA 3HP5A 4DG2E 2R3LA 3A7FA 3AC5A 3NEWA 3HA8A 3ATTA 4RBLA 3H4JA 5AIKA 3UIXA 5AV1A 2VV9A 3OT8A 2NPQA 3FL4A 2NP8A 2W96B 5ICPA 4IADA 4B6LA 3CS9A 3ZEWA 2PK9A 3DFCB 2CKPA 4FEQA 1Q8ZA 2VX3A 4YJUA 2ITQA 3GUBA 3TXOA 2XJ0A 3S3IA 5IEXA 2QHMA 3ORTA 3PG1A 2JIVA 4OTHA 3ZM4A 2JGZA 4C4HA 4R3PA 1MRVA 1RQQA 2OIQA 4ANNA 5BUJA 3MVHA 3C13A 1WBVA 5DT0A 5AV0A 4PTCA 5H3QA 3OVVA 1Q24A 5ANOA 4L01A 3RNIA 3BIZA 5HTIA 3FXZA 4L7FA 5B2LA 3E8EA 3F5UA 1RJBA 4BDFA 2YM3A 2VWZA 3CKXA 4RVTA 3LPBA 2Z2WA 3FLSA 3F3ZA 3KXNA 4RZVA 3G5DA 4KABA 4RQKA 2J2IB 2YM5A 4WT6A 4ZS0A 3C4ZA 1YKRA 2I40A 5K4JA 3VRYA 4D5HA 3DB8A 2PVKA 1JSVA 2VTSA 2UW5A 5FBNC 2B1PA 4OTRA 3QCXA 3FI4A 5B0XA 2B9FA 2WB8A 4W4YA 3CTHA 3GI3A 3HMIA 4RFMA 4JDHA 2HENA 3NX8A 3U4WA 5LJJA 4K77A 4GSBA 2Y6OA 4FR4A 3FKNA 1PW2A 4P2KA 3TIYA 4KKEA 1VJYA 3KB7A 4KIKA 5AUXA 1SVGA 3KXGA 2FUMA 5H8BA 4NZWB 4YC6A 3FMLA 4DGMA 4ANMA 3Q6WA 2OLCA 2BRHA 2GNGA 3QTUA 4FEVA 3F7WA 4YZDA 4GU6A 2R3KA 3R8LA 4DEAA 2QC6A 3PE2A 5CF4A 2Y4PA 4FKLA 2OSCA 3QUDA 5FQDC 3F3UA 2GMXA 2HZIA 4JDIA 2G2HA 1ZARA 3MVMA 4USDA 4FV7A 4C62A 3AC8A 2QNJA 3FDNA 4UMTA 4CMUA 2O3PA 4JIAA 2WXVA 3NYVA 1IRKA 2J4ZA 3V5JA 5HVKA 2BHHA 2YIYA 2YM6A 4EUTA 2UZUE 4G17A 4BDCA 4BDHA 5CAQA 4MXAA 3A4PA 4FEWA 5I9UA 1Y57A 3VC4A 4FIJA 4AN2A 5AA9A 4P5ZA 3R71A 1WVXA 3ZTXA 1WAKA 5HEZA 4BFMA 5HLWA 4RMZA 2X7GA 3HMPA 5KZIA 4CMTA 4BGGA 3MVJA 3MIYA 2GNLA 3F3VA 3NCZA 4CTBA 1I44A 2EVAA 2ITWA 1PXJA 3BPRA 3WARA 5F9EA 3VF9A 3MFTA 3ZLSA 3CCNA 5EG3A 3TEIA 3BYOA 5JQ5A 1O6KA 5F94A 4FSMA 1WBPA 2BUJA 2OH0E 4AU8A 3MA6A 4XLVA 2XIXA 3W55A 3TKUA 5FTQA 3V01A 5KCVA 2I0EA 3KULA 3E88A 3NIEA 3ZHPC 1UNLA 4PTGA 4OTPA 5JFXA 1OKYA 2JKQA 5E7RA 4JG7A 3OUKA 3QXOA 3W2QA 4Z7HA 3A7GA 4FV6A 5FXQA 4O7WA 1OI9A 2OWBA 3I0OA 4LRMA 4IM2A 2XKCA 4FTMA 4JQ8A 4O6EA 3R7GA 1H1WA 5A6OA 3SG9A 4DCEA 2XIZA 4GVAA 4M12A 4YJTA 3C0HA 3R02A 4RX7A 1Y6BA 5EYKA 1H26A 3QQKA 3E8CA 4ANLA 4F9AA 5M4CA 2E9NA 3DKOA 4K2RA 1R1WA 4TWNA 1JPAA 2H96A 3FAAA 5FRIA 5DVRA 4ANOA 4EZ3A 5IQFA 5KMJA 4JVGA 2OFVA 4IW0A 1Y8GA 3C4FA 4ERWA 2CSNA 3FZTA 3UOHA 3ANQA 3LFDA 3QWKA 2OW3A 2XK9A 2XIYA 4U43A 5LMBA 3P7CA 2P55A 2R5TA 3O23A 4HPUE 4X21A 4M84A 3VBWA 3FXXA 4XBRA 4AT3A 3IW7A 4ZK5A 3FMEA 3NNXA 5JZJA 5DR6A 3NYXA 3W8LA 4EKKA 4E4LA 5BQ0A 3RK7A 4RWJA 3UG1A 2WMAA 2YCFA 4HGSA 4RA4A 4QMSA 3UOJA 4O0XA 4YC8A 5H2UA 5AP1A 1S9IA 4IX5A 1GZKA 2G2IA 5KMOA 3GOKA 4XS2A 3SVVA 2JC6A 2O2UA 3DJ7A 4TYJA 5CXZA 3IW5A 3MH2A 1FGIA 3R30A 4ID7A 5AUTA 1TKIA 4CNHA 4RX5A 5BMSA 3T9IA 3WZDA 3C4XA 3ZH8A 1X8BA 3QKMA 2CLXA 4ONAA 5E8YA 5EKOA 4WNOA 2AC3A 4I5MA 4E6CA 3VUIA 3GGFA 2ZB1A 4FKJA 4TT7A 3UVRA 3BELA 4CVAA 3PIYA 4JR3A 4K8AA 4KIKB 5KHWA 5ETFA 5IQDA 3CP9A 3GU8A 1SNXA 2B9IA 3S2PA 5IDPA 5M06A 5AP7A 3U51A 4MNFA 2WPAA 4FSTA 2WGJA 3WI6A 4G34A 4TWCA 5JT2A 3QTWA 4G6NA 4HGLA 1OL1A 1XO2B 4F63A 2RG5A 2VNYA 4IVBA 4HCTA 4JX3A 3H9RA 3ORXA 5DLSA 2XNMA 4ASDA 4BC6A 5DWRA 4LG4A 5E8WA 3EFWA 4NIFB 2XIKA 1OM1A 4GUEA 3ZO4A 3LM5A 3NZ0A 3QLFA 4A9YA 4RRVA 4ZTLA 5C01A 4FTNA 3UP2A 1CKIA 3IW4A 2PUIA 2PULA 2YWVA 3H0ZA 4GFMA 1G8AA 3QTSA 5CENA 4K33A 4XV9A 5C4KA 2HIWA 2YIWA 2B9JA 2BZIB 1BKXA 2H8HA 4L3LA 4CV9A 3R2BA 2RKUA 4TYEA 1BL7A 2ITYA 1G8SA 3FBVA 3TNPC 4AZFA 3NCGA 4FBXA 3EKKA 4HYIA 2QLUA 3E8DA 2IWIA 3JY9A 3RTPA 2C5OA 3CEKA 3NUAA 3II5A 4U3ZA 5HO7A 1PXIA 1ZMUA 3FE3A 4NM5A 4I6BA 4FV8A 5HZNA 1OUYA 5E8UA 1JVPP 3SA0A 5BVEA 1H0VA 4O7SA 2GPHA 3OUNB 5GNKA 3LCDA 3QZFA 5BUEA 3O2MA 3IGOA 5CYIA 4D4YA 3QTQA 5F20A 4CFMA 4O21A 2WTIA 2C0IA 1O6YA 2ZJWA 2BFYA 1GZNA 1H4LA 2G15A 4QMVA 4K1BA 4XG9A 4DAWA 5H8GA 4QP1A 1UVRA 3BBTB 1H24A 4BICA 2P0CA 4QP2A 1BI7A 3NR9A 4RQVA 3HGKA 5EM7A 1XR1A 2PVFA 2G1TA 2GFCA 2OKRA 5EDPA 5FWKK 4AN3A 4D2VA 5IA3A 3QQLA 5EYCA 2VWUA 4DH3A 3WYXA 3H3CA 5EFQA 3KXZA 4PMPA 3W10A 3BGZA 4EK6A 3ZBFA 4ZJVA 4C34A 3VHKA 2ZDUA 2CLQA 4IIRA 3BI6A 3FKLA 3GXLA 4CV8A 4D2SA 2GS2A 1Q8YA 4G5JA 3MB6A 5AJQA 4ZTQA 4FT9A 4TYHA 4FOCA 4IFGA 4AE6A 4C35A 4N6YA 4ZTNA 2RFEA 4FF8A 2XS0A 4TWOA 1W7HA 4C4GA 4IAYA 2UZVA 3COHA 3JXWA 2BVAA 4MWIA 5CNNA 4ZSGA 4EC9A 1M14A 4EHZA 3HDMA 3NRMA 4FKGA 4FSRA 3ZMMA 2EB2A 3HEGA 2OU7A 1K2PA 3LFFA 4QOXA 4BI2A 4O2PA 2YIQA 4WBOA 3A2CA 4UWCA 4O7RA 2DQ7X 1PMNA 1OECA 2SRCA 3ALOA 2GS6A 4I41A 2CKOA 1JOWB 2UW6A 4FZDB 5J7HA 4O7TA 1VYWA 3NIZA 3A99A 3IG7A 3LAUA 5A4QA 5A4CA 3DKFA 3PDTA 4ACCA 4W9WA 2R3IA 4RX8A 5CTPA 3BEAA 1OBGA 4BBEA 2CKEA 3HMNA 2PMLX 3D2IA 4FC0A 2WMXA 4I0TA 5DA3A 5B2MA 2OF4A 2ZMCA 4FX3A 2WQNA 2ITOA 1FGKA 4D28A 5FBOA 2VO7A 3FUPA 3NUPA 3I5ZA 4O0UA 4QYYA 4JQ7A 3ZU7A 4WBBB 5DNRA 3OG7A 3F7ZA 4E73A 2YEXA 3IW8A 4H3PA 2BRGA 3W2SA 1YOMA 2V7AA 3V8WA 2PVMA 3D14A 4J71A 3R6XA 3MY5A 2P33A 4DLJA 4FGRA 3FHRA 4X6RA 2UZDA 1O6LA 4FG7A 2CGXA 4RIWA 3WF5A 5FDXA 3A7JA 2CCHA 2P2HA 3ORNA 3DK7A 5J87A 5L2WA 4AOJA 2QOCA 4RGJA 4RLLA 3VUKA 3UQFA 3EQBA 5BVKA 3WILA 2WMVA 4YLLA 4NCTC 4ZOGA 2QU5A 4BKYA 3D94A 4DGGA 4ZY5A 1JKLA 2BKZA 2XCKA 2YCQA 2I0VA 2UZNA 3QBNA 3C0GA 5GZ8A 3CQWA 3TJDA 4YTIA 2X81A 4GIHA 3DBCA 2W99B 4NKSA 4L45A 3TDVA 3LW0A 4UB7A 2FH9A 5ETAA 3LCOA 3R0TA 2YITA 3KGAA 3TDWA 2PVLA 3VS0A 4UX9A 1CDKA 3AXWA 3E64A 3HUCA 3KF7A 2IVSA 3C5IA 2Y8OA 2BZJA 3EFJA 3TV6A
chains in the Genus database with same CATH superfamily
5F95A 4GL9A 5H9BA 5IQIA 4OAUC 2Z8CA 3DY7A 2R3FA 3ENHA 3W2CA 1OUKA 4G9CA 4YZ9A 3DGKA 1GAGA 4X3JA 1XH8A 5ACKA 4Q2AA 2YAKA 3FMJA 3NGAA 5CX9A 3SXRA 3PFYA 4K6ZA 4HYUA 2LAVA 2WMBA 3UDBA 3TWJA 2QHNA 3PP0A 3R73A 3UPXA 5J5TA 1BL6A 4I92A 4N0SA 1WVYA 4U0IA 3CLYA 3EQIA 3U9NA 4QTDA 3W32A 4CLJA 2C30A 4BVUA 4MD7E 4CXAA 3RCDA 4FVPA 3KRJA 2JAVA 4YSMA 3CXWA 5HTCA 3SQQA 2JIUA 1PF8A 4O0TA 4ANBA 5DRBA 4DEEA 2C3IB 2GNHA 1H27A 1Q3WA 3PSBA 3W2RA 4L3PA 4QO9A 5A46A 4JXFA 5FTGA 3AD4A 4YJRA 4EZ7A 2E9OA 5CZIA 4IC7A 2R3OA 5E92A 4BWXA 2WMUA 4IE9A 4RX9A 4NL0A 5DT3A 4R1VA 1RDQE 2Y9QA 1XQZA 1JKKA 3VUDA 4FTKA 5FXRA 3BV3A 4XRLA 2GQSA 3UJGA 4ITIA 1NA7A 3QTRA 3REPA 3ZBXA 5CSPA 5KE0A 5L8LA 4GW8A 3OCGA 5CU2A 3ZO2A 5A6NA 1A48A 3TKIA 1G8JA 1YQJA 4ZSLA 3C9WA 3OY1A 2W7XA 4FKSA 4QYEA 4PNIA 2WOUA 3ZRLA 5ANJA 2VGPA 2GSFA 4F65A 3PY1A 4ACDA 2QURA 4DT9A 3UNZA 4V01A 4AW5A 3U9CA 4EKLA 4IB5A 3QLGA 5I9YA 4EZ5A 1J91A 4MWHA 3VW8A 2ZV7A 2XKEA 3PXRA 3D9VA 4KNBA 1J7UA 4GG7A 4E26A 2C3JA 4EHGA 3ZCLA 3UZPA 4AGCA 3CPCA 4LQMA 2WMWA 5HE1A 3I7CA 5CQWA 3WF6A 4O22A 3T3VA 4D0XA 4K0YA 4FKIA 3ROCA 2HXLA 1ZWSA 3V5WA 4YO4A 5CEOA 4FT5A 1XBAA 3ERKA 1H08A 3R1NA 5BUIA 2Z02A 1Q4LA 2X6EA 3AC3A 3RM7A 3VBQA 4E6DA 5L8KA 4IZ5A 5IU2A 4G3CA 2FSMX 2PZYA 2GQGA 4F6UA 1B39A 2QOQA 1ERKA 3KMMA 4V0GB 2V0DA 1PMEA 3HV7A 4KRDA 3COKA 2HW7A 1J7LA 5CNOA 3C4EA 3VS6A 2R3GA 3PA4A 4O0YA 2CJMA 1GZOA 3R01A 1TZDA 3F5XA 5DEWA 4FL2A 5AA8A 1H1QA 3UO5A 5K4IA 2VWXA 2VX0A 5EDQA 3G51A 5IH5A 3BYVA 2QO2A 4G16A 4R7HA 2C6IA 4WG4A 2VWYA 3TUDA 3LCTA 5I9XA 3O7LD 4RVLA 4BCMA 5A54A 4I21A 3EQPA 3KMUA 5AM6A 3LXLA 4EH5A 3FI3A 4JG8A 2RSVA 4KRCA 3GU7A 3V5QA 1PMUA 3G6HA 4U41A 4F78A 2VTAA 5GJFA 2Z60A 3T9TA 4MXZA 4IEBA 3OS3A 3QQHA 5CAOA 1W84A 4D2PA 4WD5A 3GNIB 2HELA 4IX4A 2Y7JA 3MFSA 1U46A 3OCTA 5D41A 2IVTA 1OGUA 3P0MA 5TR6A 3FYJX 1KV2A 3TZ7A 4C57A 4DC2A 1DS5A 1U4DA 2O0UA 2CGVA 2JFLA 3PXQA 4IAZA 3R7IA 2J0JA 4YJSA 1QL6A 4C38A 4M14A 4S2ZA 1QPDA 5C4LA 3VS7A 3BLHA 5HESA 3V6SA 5DGZA 2W1ZA 1ZXEA 2X4FA 3F2NA 1YDRE 3Q9WA 5L6OA 5M53A 4EOKA 1PJKA 5HICA 4ZP5A 3OBJA 2O64A 5J95A 2WQMA 4AQCA 2JAMA 4QQTA 2HY0A 4FSNA 3FKOA 2EUFB 1HOWA 3AD6A 4MNEB 3HX4A 3OXTA 3BU3A 2BAKA 1H01A 2XNNA 3Q9YA 2OXYA 3UIBA 3KRWA 3UP7A 5EOLA 2BIKB 4O4CA 4PL3A 4AT4A 1SM2A 4MYGA 2YIRA 5H8EA 1CMKE 3ZONA 3SRVB 3UNKA 4BGHA 1ZOHA 3DZOA 4DEIA 5KHXA 2WIHA 5CQUA 3E63A 4F9WA 4X7QA 3IOPA 5B2KA 5HD4A 1KSWA 3GC0A 3ORMA 2X0GA 4YHTA 4B99A 4ARKA 5KBRA 1S9JA 4R77A 4Y85A 1V1KA 3W0PA 4FTAA 3SKCA 4CSVA 4U97A 5D1JA 1Q62A 4JRVA 3R7OA 3EN5A 4EORA 3UGCA 4CFFA 3VF8A 4EQCA 3PVUA 4WG3A 3KU2A 3RJCA 2VTRA 2PSQA 4OBOA 4E3CA 4PQNA 4C4IA 4AT5A 3RZBA 2OF2A 4UMRA 5E4HA 3U6IA 1RE8A 4UALA 5BVFA 3FZOA 3EZVA 2YAAA 4IB3A 5L6WL 3H0YA 5IQBA 4YO6A 3OD6X 2CGUA 3FQEA 4DINA 1OL2A 4PY1A 2VN9A 1UU3A 2IW6A 4M3QA 4CZUA 3TUCA 5LMKA 3PY0A 5CEKA 3MIAA 4PPAA 4IVCA 1IASA 1OIYA 3PWYA 2JDOA 2YJSA 5AM7A 4BTMA 3C50A 4F08A 3Q04A 3TN8A 2GTMA 2X2KA 2BHEA 3OTUA 3COMA 5KMKA 2A19B 2EU9A 4I5PA 4YBKA 3EJ1A 2VWIA 3TCPA 3IS5A 3HV4A 5AEPA 4FVQA 3HA6A 5E1SA 4FT3A 4F0GA 5I9VA 1V0BA 3EQCA 2ITXA 2R3JA 4I6HA 4OTDA 5D7VA 4F1OA 3N4VA 3ZFYA 4EHEA 2C5VA 5CU4A 5DRDA 3ZC6A 4XJ0A 4AW1A 1YHSA 1ZYDA 2ONLA 4QMZA 2AYPA 4HCVA 2J0LA 4J1RA 1XHAA 4PUZA 3V51A 5BPYA 5HVJA 2Q0NA 4NM0A 4C61A 3V3VA 4AFJA 1OKZA 2IVVA 5EW8A 5C26A 1XBCA 3SAYA 2PYWA 3UIUA 4O7NA 1JQHA 2JEDA 4YR8A 5IMEA 4A07A 1H07A 4NYEA 3HRFA 5IA0A 4BJJA 4FK6A 5D12A 1KE5A 2XK6A 5DHJA 3PZHA 5CEIA 4LOPA 3SLSA 3LCKA 3ORKA 3BV2A 3P9JA 4JAJA 4BTJA 1YI6A 5I4NA 2RL5A 4E5BA 3ML1A 2J5FA 3KREA 2ZM1A 4DT8A 3OC1A 3PXZA 3GU4A 3W8QA 4YZBA 5JMSA 1URCA 4ENXA 2BRMA 3MWUA 2YFXA 3OOGA 4GS6A 2WQOA 3MW1A 4QPMA 4MD9E 4WKQA 1E1VA 4GK2A 5AP0A 3Q5IA 4LGGA 1UU8A 4DHZA 5IQHA 1GOLA 4UYNA 2PE0A 2WHBA 2DYLA 4W4XA 4ZJIA 4U6RA 3MA3A 4EQUA 5DI1A 5JFWA 4D1SA 3IPHA 2FGIA 4FIEA 2VO6A 3OFMA 5ANEA 1ZYSA 3O51A 5FM3A 2V55A 3QUEA 4WG5A 5IDNA 2PMNX 2R64A 2WMTA 3QX2A 4YLJA 4BIDA 2IJMA 4WUNA 4CMOA 4J52A 5IF1A 3CC6A 3E8NA 4WNPA 3IDBA 3R8ZA 4AOTA 3A7IA 4ALWA 1CSNA 2PMOX 3E92A 3HZTA 4FG9A 4I20A 5CEQA 3GCQA 5L2SA 2PU8A 2X1NA 2QCSA 4B8MA 5IMXA 3UDTA 5JGBA 2F49A 4PPCA 4U42A 4EEVA 5I5ZA 4GCJA 4A9TA 3M2WA 4DTAA 4R7IA 5J9ZA 4O4EA 3NFGB 4H05A 1WFCA 4IC8A 5A4EA 5KUPA 3AC4A 3RPYA 4IWPA 5EOBA 2YERA 5TE0A 3BKBA 3HP2A 3R1SA 4ASXA 4QMQA 2QOKA 2B54A 3DOGA 4FE2A 1QPCA 2YM8A 4IANA 5HOAA 2R0IA 2I0YA 5LVNA 2B52A 3IECA 5FEQA 3POZA 3IDPA 3ZFXA 3ZLXA 5LWNA 1UKHA 3M11A 3PIZA 4QYFA 4V05A 4GK4A 4XEYA 2WU6A 2QO7A 4XG6A 4L44A 4S32A 4WO5A 1YHVA 5LVMA 5AFVA 3HAMA 2DWBA 2CN8A 3FSFA 4I4EA 3MPMA 1LUFA 1U54B 1APME 4JDJA 1MQ4A 2PUNA 4GEOA 3V04A 5IUGA 1TQIA 3NS9A 3ZRMA 3K3JA 2HXQA 4FZFB 4BDJA 4TNDA 1YWVA 2XH5A 3D5UA 2R3RA 5HBEA 3A8WA 3R8PA 1U59A 3C4CA 2P3GX 4KIPA 1RW8A 4UWYA 3KN6A 3DU8A 1QMZA 2QQ7A 3P86A 1ZY4A 4QMNA 2HYYA 2QD9A 4YMJA 4JBQA 2XJ1A 1YDSE 3R2YA 5DH3A 4QP7A 2W9ZB 1J1BA 4EHVA 4EONA 2GU8A 4PDSA 3NVMB 1UNGA 3TT0A 2BRNA 4AXFA 3DZQA 4I22A 4FTIA 4QQ5A 2B4SB 4W8EA 4G6OA 1NVQA 3F9NA 3KK8A 3TKHA 4M0ZA 3N4TA 1R0EA 3RCJA 3ZUTA 2C1BA 4F7NA 3DA6A 3EL8A 4NW5A 5AUYA 5HU9A 4O7ZA 3QC9A 4F6WA 3DK6A 5JRQA 4RFZA 4E5WA 1G8KA 3ATSA 5IUHA 3BL7A 4U44A 3L1SA 3GFWA 3MH3A 3NAYA 2XEYA 2QR7A 1VZOA 3GU5A 5EM8A 4C3RA 3IO7A 2XBAA 5DBXA 5BVDA 5IEYA 5L6PA 2ETRA 3VUMA 4CZYB 3O71A 4F9BA 5EW9A 5HBJA 1T46A 3G6GA 2H34A 3QD2B 2ZDTA 3QKLA 4HNFA 3UYTA 3VBXA 3I79A 4R5YA 1REJA 5IA2A 3S00A 3MJ1A 2B53A 3WE8A 2ZYBA 4YC3A 4O2ZA 4BCOA 5BX0A 4FVRA 4IMYA 2JDTA 3VVHA 2IO6A 5AP2A 2WNTA 3MGYA 2FSLX 3FWQA 3KXHA 4CQEA 4Y8DA 3O8TA 4OGRA 3ZSIA 3CPBA 4EYJA 3EFLA 1OMWA 2QKWB 4F9CA 4FYOA 2W05A 5CF8A 3OP5A 3TTIA 3FI8A 2ITVA 3EQHA 3GEQA 3FQSA 1ZOEA 1BUHA 1IA8A 4I0RA 4NFMA 4BZNA 4D1ZA 5AAEA 1GIHA 4O7LA 2W4OA 2F7EE 3ORIA 2YZAA 4Y5HA 2NRYA 2UZBA 1W2FA 2WD1A 3PVWA 3AD5A 4BCQA 4DH5A 2R7IA 3SXSA 4ALUA 4ZTMA 1AD5A 1JKSA 4MK0A 1B38A 4QP4A 4MAOA 4XG2A 4J99A 5DPVA 4CKIA 3O7LB 3UQCA 2OJJA 3OTVA 4O96A 4QMYA 2GNIA 4QPSA 2FO0A 3DT1A 5HNIX 2XP2A 1OITA 2CGWA 2W5HA 3KFAA 4FRFA 4G2FA 1GY3A 4N70A 1SYKA 4X0MA 3FZ1A 5CSHA 5FEDA 5FUTA 1ZMVA 4C36A 2QOOA 2PVHA 5HQ0A 1ZZLA 1PXPA 2BPMA 4H3QA 4O27B 4R3CA 3TYKA 5DN3A 4K18A 3NFFB 3GQIA 4QMUA 5M09A 4LRKA 4YP8A 3D2KA 1OBDA 4ZMFA 3O17A 3KC3A 5KMIA 3FL5A 2HWPA 5BMMA 4DGLC 4CCBA 4AW2A 3W0SA 1H8FA 3PJCA 3CGFA 3GB2A 3SXFA 3ZO1A 3R22A 5HORA 5K9IA 2IZUA 3PFQA 5E1EA 3GT8A 3BRBA 4IX6A 5FP5A 4KSPA 3DV3A 4EOOA 3D5VA 4A4LA 2IZSA 3EWHA 4FOBA 4BGQA 1Y91A 4QQJA 4X3FB 1PKDA 5HX8A 2PE1A 2C0OA 4BCKA 4PPBA 4TL0A 2VRXA 4XOYA 2GS7A 3FEGA 3ZM9A 3FY2A 3BYMA 2RG6A 2XAOA 4EWHA 5HKMA 4LGHA 5CF5A 2QG7A 2IN6A 3FQHA 5IA1A 3LHJA 3OOMA 4WNKA 3SX9A 4FSYA 4GH2A 4YZMA 4L00A 4BR3A 4KKGA 4IVAA 4ZJJA 4F70A 4O82A 2FVDA 2O8YA 1IA9A 5ANGA 2J50A 2QOIA 4RVMA 5HGIA 3R63A 4G3DA 5L2QA 5AP3A 4MBLA 3DTWA 5EHYA 4USFA 2RF9A 3F6XA 3Q52A 3HMOA 4AS0A 1JLUE 3RAIA 3EQRA 4DH7A 3KCFA 3I1AA 3O5AA 3NSZA 3RPRA 5CEMA 3WYYA 4DF3A 3MTFA 2WTCA 4NH1A 3LQ3A 3FPMA 5HCXA 4C3FA 2WZJA 3KXMA 2XYNA 4NUSA 1KE6A 4O81A 5KMMA 4XG7A 4FI1A 4BN1A 5CANA 3IGGA 1BYGA 1STCE 5JQ8A 4EH9A 3R21A 4RG0A 1UKIA 2X9FA 1R39A 1DI9A 3F66A 3E93A 2R2PA 3PUFC 5HLNA 2WQEA 2PUUA 4ZAUA 5EYMA 3CBLA 4JS8A 4L42A 2YN8A 3F69A 3V5TA 4EWQA 3TZ8A 4I1ZA 1OL5A 4KIQA 4YJVA 5AX9A 5TKDA 5JGDA 3H10A 5DOSA 3S0OA 5HO6A 4GJ2A 3QC4A 3E3BX 3QHRA 5EDRA 4QQCA 5CXHA 4D5KA 4TN6A 1KE9A 4ACHA 4ORKA 1FINA 2BFXA 4GKHA 3R7EA 4BTKA 2GTNA 2B9HA 3E62A 4FTTA 4BYJA 4JT3A 3TL8A 3ZUVA 1UNHA 4ENYA 3LJ0A 3QL8A 2G9XA 4QMTA 4LV7A 2YACA 2ZM3A 3K54A 2Q0BA 2RFNA 1TQPA 3UMXA 3MH1A 2GQRA 3OWKA 4O84A 2HCKA 5J7BA 4OR5A 1W98A 4XP2A 3I5NA 2E9PA 3SDJA 3ZXTA 2PE2A 3BHTA 1PXNA 3EZRA 2UW4A 3EHAA 3KA0A 2O63A 5IA5A 4WUAA 3BWJA 4L53A 4KAOA 5JZNA 3WZUA 1ZLTA 3GVUA 3Q4ZA 1GJOA 2QODA 4JLCA 1H28A 3POOA 4BKJA 3DAEA 1NVRA 4WRGA 2WMQA 1XH7A 3G90X 4MF0A 4YGAA 2BCJA 4XP3A 5JH6A 3UZTA 4GKIA 3GENA 3FV8A 5EK7A 2ERKA 3LQ5A 1P4FA 2XCHA 2JFMA 4YBJA 3PA5A 1NXKA 3SW7A 4WSYA 2YDKA 3L9LA 4C2WA 2C3LA 1OPLA 1OZ1A 4EUUA 1IAHA 3LKMA 2QG5A 4YJPA 4KKHA 1CKPA 3JY0A 4FNYA 4YNOA 1KV1A 5LWMA 3QZGA 1M7QA 1V0PA 2C5NA 3MI9A 3TTJA 3OY3A 3PSDA 4GIIA 5CS6A 5HIDA 4GT3A 4LL0A 3E7VA 3RINA 4R78A 4NM3A 1KWPA 3Q2JA 3GOPA 3BBWA 4XYFA 3QCSA 4RIWB 2AC5A 4DITA 4IHPA 3CJFA 3Q53A 2JD5A 3VHEA 3QRTA 3CE3A 4GV1A 1E1XA 3SW4A 4BHZA 2CDZA 3VS2A 4O83A 4APCA 4V04A 4ZIMA 2GFSA 3PSCA 3EN6A 4BZDA 4DDGA 4D9TA 5AR4A 4TNBA 4RC2A 2X4ZA 3AMYA 3GCPA 4JBPA 2OICA 5EW3A 5AWMA 3KN5A 2EXCX 2Y4IC 4Y83A 3LFAA 5DMZA 4ZLOA 4EH6A 2ITUA 1OIUA 4LI5A 3MJ2A 2WO6A 3G9LX 2RIOA 3I0QA 4MTAA 4C37A 4Q5EA 3PPKA 4DFNA 4BCHA 2BZHB 4FT7A 3KRLA 4E1ZA 4AG8A 4G6LA 4IACA 4CEGA 3BGPA 1XH4A 2VZ6A 1YXUA 1PY5A 4DBXA 4IM0A 2GNFA 2QOFA 2Y0AA 3EIDA 3O50A 4EOIA 3AMAA 4PNKA 3DXQA 3HAVA 1SMHA 3D5XA 3LE6A 5AUVA 3RPVA 4AF3A 3HECA 4EOJA 2VTPA 1JNKA 3EQGA 2BAQA 4DG0E 5FGKA 2UW7A 4M8TA 1ZRZA 4F6SA 5LVPA 3D0EA 2FSOX 4E6AA 4E4MA 1IG1A 2WFYA 3UO4A 3TG1A 1IAJA 3AOXA 4F7LA 3N51A 3QCQA 3TM0A 1G3NA 2XNOA 2BAJA 4H3BA 4FSUA 4I93A 3FMDA 4NIFA 4TYGA 4LV5A 5AMNA 3RI1A 4EK5A 4RC4A 1NT2A 5B7VA 3FC2A 1UA2A 4O0SA 3FC1X 1YXTA 3G0EA 3OEZA 4FZ7A 4F4PA 4JIKA 4AUAA 4Q9ZA 1OL6A 1H1SA 5FM2A 4NKAA 3WIKA 4UXQA 1UU9A 1UU7A 5CAVA 5KO1A 4BDDA 4F0IA 2YLFA 4DEBA 4DYMA 1FMOE 5IQGA 5CU0A 2ZVAA 4IB1A 4QP9A 3U54A 1QPEA 4GMYA 3GC8A 3ET7A 4AW0A 5LQFA 2B0QA 3LJ1A 3PXYA 4I6QA 5AUUA 2OZAA 5LXMA 5J1VA 4PMSA 2JDVA 5LCKA 1FQ1B 4FT0A 5HBHA 4CFXA 5I9ZA 4ZXTA 3I60A 2PTKA 3FPQA 4IDTA 4ZY4A 2PWLA 3QQUA 4KBKA 3GCVA 4OT5A 1M17A 2E2BA 1HCLA 2PMIA 2QOBA 4HJOA 4S34A 3LMIA 2XA4A 4YTHA 2VWVA 4QD6A 4I24A 2X6DA 3CY3A 4AGUA 5HCYA 2FA2A 3EOCA 4B7TA 4C59A 4FJVA 3R28A 4JR7A 4BWKA 4QYHA 5HE0A 3EYHA 3LFCA 4YHJA 1WZYA 2VTOA 5K3YA 4U9AA 4G3FA 3JVRA 4NSTA 2V22A 4KWPA 3ZZWA 5KBQA 5KMNA 2VO0A 2IW8A 2OIBA 3D15A 3VQHA 3PJ2A 3LOKA 4A4OA 2BROA 2FYSA 3OW4A 4FTCA 1JBPE 1GIIA 4O38A 3AGLA 4QMWA 3OXZA 4FA2A 4AXDA 1KE7A 3FLNC 1XMLA 2JBPA 2NNWB 5HE2A 4M67A 2VX1A 4NJDA 3RKBA 4APPA 3LVPA 4BDKA 3PE1A 4JX7A 3QZHA 3D7ZA 3QGWA 2WMRA 4EQMA 4FGBA 4TPTA 2PUPA 2ZV2A 3ACKA 3AT3A 1PXKA 3EN7A 2UW0A 4U5JA 3R9NA 5M55A 1Q8TA 3ZSHA 3BU6A 3FMMA 3GCSA 3PA3A 4NT4A 3UTOA 1GZ8A 4BCFA 4BCGA 4BDGA 3ZSGA 4S30A 1DI8A 2A27A 3QRIA 3UOKA 3BE9A 3HNGA 3ZXZA 3U6HA 2GCDA 2ZFYA 3G0FA 4EC8A 1ZZ2A 1KOBA 5CVGA 3V5PA 4K11A 4L8MA 2DUVA 4XH6A 4Z3VA 5CI7A 3OCSA 5FD2A 3PLAE 4HPTE 5AV4A 5FP6A 2C6KA 5KKRC 3MESA 1L8TA 5ITAA 4BCPA 3ULIA 4MXCA 4O7VA 3THBA 5EQYA 1YWRA 3KXXA 2CHLA 2I6LA 1JSUA 2GHLA 2HAKA 3JS2A 4FTLA 3P5JC 1Z57A 3P08A 2FSTX 4AQKA 3LQ8A 5T68A 2R4BA 1Q8UA 1ZY5A 3DNEA 3MH0A 3RM6A 5EI2A 1DM2A 3DLZA 3P79A 2JBOA 3RPOA 1NVSA 4C0TA 5JFSA 1PXMA 1WCCA 1F5QA 4YNEA 3RWQA 3PLSA 4PMMA 4WRSA 4ZTRA 4BI0A 3OXIA 2ETKA 4YHFA 5GJDA 5BYZA 2YDIA 2OH4A 3Q4CA 4W4VA 3I6UA 3ZLWA 2EXEA 3CTQA 2W1DA 4WOVA 4BZOA 2ITNA 3QUPA 1URWA 4KBAA 3RK5A 4TYIA 3PXFA 3EL7A 3TUBA 4JNWA 2I0HA 3NNVA 5LCJA 3O8PA 4H58A 5AR2A 4Z7GA 3U55A 1KOAA 4C58A 4N4SA 4GFOA 3S95A 4I6LA 4IZ7A 4U81A 2IPXA 1KE8A 2VWBA 4JMQA 3FLZA 4HVIA 3FY0A 4F7SA 3Q6UA 1J1CA 1VLRA 4C4JA 5FXSA 4IH8A 4CZTA 1OKWA 3C7QA 2W17A 3DFAA 2W1FA 4I94A 3R9HA 1SVHA 3QRUA 2FB8A 3VO3A 4LUEA 4BBFA 4CFWA 1XH9A 2WKMA 4FSQA 4I6FA 3D7TB 3WZKA 3B8QA 5BNJA 2WTDA 2VO3A 4BF2A 4B4LA 3R9OA 2QOLA 4FTOA 4O91A 3VUGA 3UDZA 2X7OA 1IR3A 4QMLA 4ALVA 4FKUA 4FSWA 3W33A 3MFRA 3GQLA 4H1MA 5DG5A 3TV4A 5EHLA 3DXPA 4PDPA 2R7BA 2PY3A 4LM5A 3U8WA 3WF7A 4J53A 3N4UA 2XNBA 4RJ5A 1YVJA 5CY3A 4HYSA 2J0KA 4ACMA 1XH5A 3BL9A 1WBSA 2F2UA 3OF0A 2XK3A 3QYWA 4FNXA 1K3AA 1P2AA 2C4GA 3FZPA 4KSQA 4TKSA 2W1CA 1P14A 2BIYA 3GBZA 4E93A 3WOWA 4IAKA 2PZPA 2VNWA 4A7CA 4EK8A 3PVGA 4M69A 4C7TA 5J9YA 3KRRA 1R78A 5BVWA 3UMWA 3QALE 4C8BA 4P4CA 4EH2A 4BDAA 2VTIA 4XV1A 4L46A 4F64A 5A9UA 4R1YA 3HYHA 2YHVA 3DBDA 5D10A 3TNWA 4QEBA 3Q60A 4EH8A 2XRWA 4NTSA 3RHXA 4HVSA 2J6MA 3L8VA 4U79A 1OIRA 5E91A 4B8LA 5DIAA 2C6TA 3BHUA 3EYGA 4CT1A 4E20A 4GUBA 3MDYA 3LFBA 2REIA 5DT4A 5ETIA 2IG7A 5IUIA 1F0QA 5EHOA 3LFQA 4DHFA 3QA8A 3PY3A 4BRXA 5A4TA 5IZFA 4YPSA 5M08A 3Q4UA 4FKRA 4UMQA 4UXLA 3O0GA 4ASEA 2XM8A 2R3HA 3QHWA 2OIDA 3PUPA 3DJ6A 3PPZA 4FTUA 4XBUA 3BGQA 3LJ2A 2C6LA 3CKWA 3CTJA 3L8PA 5CT0A 3MY1A 3TNHA 5C8MA 4M15A 4BCJA 5KNJA 3BU5A 1MP8A 1F3MC 2LGCA 2WIPA 3H9OA 3PTGA 5HG9A 3Q2MA 2WTVA 3PVBA 4DG3E 3DKGA 2UW9A 1T45A 4J98A 5D9HA 1IEPA 3CIKA 4O0RA 3CGOA 5CEPA 3AMBA 4EOQA 2HZ4A 2IZTA 4FKPA 3I4BA 2BTSA 4Y95A 4DFYA 3BHVA 4AZVA 1NY3A 1Q99A 2WTKB 2CNQA 4AXAA 1WVWA 4IAAA 3QD0A 4RJ3A 4A9SA 1Q97A 2XRUA 4Z55A 3DAKA 1OIQA 2XNPA 4TWPA 1XBBA 4XMOA 5JRSA 2G2FA 3BYSA 5LMAA 3RBWA 4CTCA 3MSSA 4GG5A 3O8UA 4DH1A 4YURA 2X39A 5EQEA 5AX3A 3KF4A 4L67A 4DEDA 4BTFA 4F1MA 3AG9A 3UPZA 5HI2A 3DK3A 3E87A 3F5PA 3O96A 3Q9ZA 2A0CX 4GVJA 3PPJA 4L7SA 2C6DA 1PHKA 2CN5A 2WEVA 3NYOA 3CY2A 4G31A 5CT7A 5HCZA 1DAWA 4BKZA 4ZLYA 2C3KA 4FV4A 4OBPA 4XV3A 1OKVA 2ZB0A 2VTLA 3MPAA 4GRBA 4MCVA 3F3TA 2C6MA 3QTIA 4FTQA 4WNMA 5J1WA 5T6KA 3VIDA 2RFDA 4H39A 4CT2A 4WA9A 3R8MA 1PKGA 4GYIA 3UIMA 4C02A 3CD8A 2OBJA 3M1SA 1Y6AA 5CAUA 4R6VA 5HO8A 4AZEA 2ACXA 4FV5A 4YUQA 3G15A 1M2RA 2Z7LA 3NW6A 4G3EA 3ZLYA 3L9MA 5IG1A 2XK4A 2W06A 4ZY6A 3AKLA 4G1WA 1U5QA 2P4IA 1PMVA 3BYUA 2PVYA 4L3JA 2B7AA 2JITA 3A8XA 4AGDA 4MQ2A 3ELJA 3DLSA 3W18A 2HOGA 1VYZA 2A98A 1Q8WA 2QOHA 2UW3A 4JOAA 2GDOA 4FZ6A 3ODZX 2W1EA 3V8SA 4J95A 4DFLA 3GP0A 4MXOA 2E9VA 3D7TA 4EK3A 3OEFX 5HG8A 5CZHA 3ID6C 3FMHA 2X9EA 2ONLC 1GIJA 4BBMA 2YCRA 1I09A 5HIEA 3DDPA 3DQWA 3R00A 4RA5A 2JIIA 1H1RA 5HNBA 4IWDA 4RLKA 3PJ1A 4HNIA 4RJ4A 5ACBC 4NK9A 4Y72A 4BJJB 3BHYA 4A06A 4E4NA 3P5KA 4C33A 4RVKA 3M42A 3SOCA 3DB6A 2R3PA 1JKTA 5KZ0A 2W1IA 4CYIA 5HU3A 3KL8A 2PZRA 5CF6A 4FNZA 2HZNA 3MB7A 5E8ZA 4BYIA 4XHKB 3PXKA 3C0IA 2JDRA 3Q5ZA 4JAIA 4LFIA 4OTFA 3HKOA 2OGVA 3FLYA 3CSVA 4F9YA 1WBNA 1LEWA 2ZMDA 3QWJA 1WBWA