1O6LA

Crystal structure of an activated akt/protein kinase b (pkb-pif chimera) ternary complex with amp-pnp and gsk3 peptide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
337
structure length
316
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITQEMFEDFDYIADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Crystal Structure of an Activated Akt/Protein Kinase B Ternary Complex with Gsk-3 Peptide and AMP-Pnp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 316
sequence length 337
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1o6lA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1o6lA02
1ZLTA 4FL2A 4UYNA 4FTNA 5GIPE 2ZV2A 2BCJA 3DAEA 5AUWA 2GFSA 2BROA 2C6DA 2VTIA 3PXKA 5KZIA 4ANBA 5JFSA 5LWNA 4XP3A 3F9NA 2RFDA 3BV2A 3KU2A 3M1SA 3EKNA 3DBQA 3F3WA 1J91A 2QOKA 4YBJA 3R9HA 3OXZA 2AYPA 2PUPA 3HYHA 4FTOA 5DVRA 3ORLA 1H28A 2XNPA 3PP1A 3OUNB 2H9VA 4UYAA 4WUNA 4AZWA 2FSOX 4BCNA 4P90A 5GJFA 2BDWA 2HY81 2C5VA 4LRJA 2WTIA 5AR2A 4UMUA 5LVOA 4TNDA 2Z02A 3BU3A 3H0YA 5TR6A 4IANA 4JIAA 3R9NA 3OF0A 1KV1A 4BB4A 1MRVA 2PZIA 1HCLA 4LG4A 4D4YA 1DI8A 1TKIA 4PMMA 2WD1A 3QWJA 1PF8A 3MH0A 3PVBA 2XKCA 4E93A 3L9LA 4O2PA 2PZ5A 3NDMA 3P7AA 4GU6A 2HWPA 4FIIA 4M97A 4TN6A 3PG1A 3W2QA 1KE5A 2PWLA 3UMWA 1PMUA 2G2IA 3FYJX 2YM5A 5CAOA 3NUYA 4A06A 3I1AA 3ANQA 4HYHA 1CSNA 5JFXA 2OF4A 3MH3A 4HCUA 5CZIA 5GJGA 3LXPA 3GGFA 2Y0AA 5CSPA 4QNAA 5AUZA 1Q8YA 2F4JA 2XK8A 3RJCA 4PDOA 5DIAA 3AD4A 3RMFA 4EH9A 2E9NA 4CFMA 2CKOA 4O7VA 4G3FA 1J7LA 3A99A 4BDFA 3CQUA 3L8XA 2F9GA 4I5CA 1OPLA 4YLJA 3FY2A 2QU6A 3NIZA 5HGIA 2UZNA 1FMKA 4JT3A 4E4LA 3GU8A 4NM0A 3FSFA 5ETFA 2XK9A 4C57A 4O7LA 5CEOA 4V05A 1DS5A 4KD1A 2J6MA 4B8LA 4R78A 3QYWA 5EYMA 3SA0A 5KUPA 3VF8A 4R7IA 3U51A 4X3FA 3OBJA 5T6KA 4JVGA 3IDBA 5FG8A 4G9RA 4KUJA 4J96A 1Q8TA 3OG7A 4ZTSA 4FIEA 5DMZA 3P0MA 4DBXA 3PXQA 4MXYA 4AGWA 2YN8A 3UC3A 4KAOA 4Z55A 5A3XA 1SNXA 3CPBA 3EN7A 5EI6A 5F94A 3MVJA 3EJ1A 3AC8A 3NNWA 2UW6A 2WTCA 3RKBA 3DOGA 4RSSA 2YCSA 1OL5A 3K54A 4K11A 2ACXA 4FV8A 4XV1A 2PVLA 5CWZA 2OSCA 1FVRA 5M44A 5G6VA 4DAWA 4B7TA 4XJ0A 4Q9ZA 1AGWA 2FGIA 4WG3A 4FSQA 2QVSE 4FT0A 4PL3A 3WZKA 4DITA 1O9UA 4EOKA 1ZYLA 5HG5A 2CLQA 2ETKA 4PTCA 2E9PA 4FTAA 5DT3A 3EN6A 3OWKA 1BI8A 2C6IA 1KE6A 1CM8A 2GNGA 4ENXA 1UWJA 5I5ZA 4UWYA 2PMOX 5G1XA 2B1PA 2JFLA 3ZCLA 3FHRA 4CRLA 4FVRA 4YJPA 2W99B 1GIIA 2YA9A 3G6HA 2PU8A 3SXRA 4XG9A 5CT7A 2W5HA 2UZDA 4X21A 3IDPA 1S9IA 3BLRA 3V5LA 5IU2A 4ZS4A 5L8JA 3FI8A 1KWPA 3PRIA 4FG8A 3WILA 3QRKA 4NW5A 4AWIA 4L7SA 4YJSA 3LJ2A 4I4FA 3ATTA 3OP5A 3S1HA 1V1KA 4M7IA 4JLCA 4YTHA 4CSVA 3GU4A 5IMXA 4XV9A 4GRBA 3MPTA 5CTPA 2YJSA 1G8AA 4DFXE 4PWNA 4F9YA 3R63A 3R9DA 1Y91A 4YZNA 5ITAA 4KKHA 5M06A 5LCJA 3BQRA 3BYVA 3NNVA 2W4OA 3OT3A 2FO0A 1OI9A 3KKVA 4K33A 1REKA 5J1WA 5DRDA 2C47A 1CDKA 1VZOA 2GCDA 2VTHA 4GUEA 1U5QA 4ITHA 4L7FA 4IMYA 3CKWA 4EEVA 4M13A 2W96B 1SM2A 1V0BA 3QKMA 5I4NA 1Q62A 5DRBA 3LCOA 4HVGA 3QKLA 2YIYA 4AZEA 4F9WA 2F2UA 4U42A 1LEZA 4BCOA 3TJCA 2YCRA 3UNKA 1XQZA 1ZOEA 2ZDUA 3Q2JA 4XBUA 4IACA 4BICA 4Y85A 4FL3A 4CYIA 4O91A 1ZARA 3C4FA 4PMPA 4E5AX 3VQUA 4S34A 3MW1A 1SYKA 2R3NA 5BVEA 2J50A 4DE4A 3RI1A 4YSMA 3HZTA 3HRFA 4ZTNA 5KE0A 1UNGA 3ORKA 1Y8GA 2YDJA 3V8WA 3VIDA 4FKTA 5AAFA 1M52A 2XRUA 3V5TA 3C4CA 4RJ5A 2ERZE 2X8EA 4Y46A 2X6DA 2F7EE 1OIYA 2V55A 3JVSA 3KY2A 3FHIA 2IO6A 2A27A 2ITNA 3KXNA 5CYIA 5HLPA 4CV9A 4C4GA 2VWBA 4EUUA 4B6LA 5IQIA 5IA2A 4GKHA 3GP0A 4EH7A 1NY3A 2A2AA 4PX6A 1SVGA 2OG8A 4ORKA 5CQUA 5EG3A 3QTZA 4PNIA 3QTWA 4ZLYA 5AUUA 3R7IA 5H8BA 3E93A 2JDTA 5IA0A 2PUNA 2I0HA 4WOVA 2VGOA 4IZYA 4EHGA 1Q3DA 2OW3A 4OBOA 2J90A 4BF2A 2ERKA 5E8YA 4C35A 3ITZA 2P3GX 4RJ4A 3I7CA 4AZVA 2X8DA 3UZTA 4ACHA 3OXIA 4L46A 3P5KA 1R0PA 4BVUA 2UZVA 1M7NA 2X2MA 4MQ1A 4JDIA 3CJFA 3A7JA 2PPQA 2C68A 3DAKA 5EHOA 3C5IA 1XH8A 4JRVA 4LFIA 2VO6A 4EWQA 2OJJA 2C5NA 3MESA 1MQBA 4KBAA 1W82A 1BX6A 4AW2A 3N4TA 3DKCA 4G3GA 2PVFA 5BQ0A 3PSDA 3F3TA 4FZFB 4PTGA 3QA8A 4YJUA 5CASA 1ZWSA 5BMSA 4USFA 2BPMA 4KKGA 3NRMA 4GFMA 1RDQE 5IQDA 4FV5A 2RFSA 3NYOA 4O81A 2LGCA 3KULA 4L67A 4WO5A 2WMAA 4ZZMA 4BI1A 4OTIA 1H4LA 3B8QA 1YWRA 2QNJA 5CAPA 3NPCA 3U4UA 3GCSA 5I9VA 1GZKA 5K4IA 1CKJA 4D5KA 3G2FA 5C27A 3E7VA 2R9SA 3TCPA 3OCTA 3DXPA 3MPMA 3IECA 3Q6UA 2HCKA 4I23A 5GNKA 4ALUA 2A19B 1JSTA 3PJ1A 4QO9A 2QG5A 3VJNA 3NX8A 4D4RA 3F3UA 4CFFA 4ARKA 1JKLA 4FTRA 4BIBA 4X6RA 4OAVB 3ZFMA 2X9EA 3VUIA 3ZEWA 3I0QA 3QAME 4QP1A 4AG8A 3DB8A 4TZRA 3HV6A 2PSQA 5FBOA 2B54A 3Q9ZA 1YRPA 1Q41A 2Y6OA 3F5XA 2ITVA 4FF8A 4RC2A 4IX5A 3TL8A 1BUHA 4FTQA 2PL0A 3FMJA 4FTLA 2WTKC 3RNIA 5D9HA 4GEOA 5IA4A 3SAYA 1Y6AA 4F0GA 3FL4A 1Q24A 3ZBFA 2QO2A 2C4GA 5HO7A 3TIZA 1XKKA 2YZLA 5HVKA 2FB8A 4TYEA 1LUFA 3HV3A 2JKQA 3GOPA 4RT7A 4ZTRA 3NW6A 4E8AA 2PE1A 5AP3A 1ATPE 4UBAA 4GG7A 2RGPA 3HMOA 5CVFA 4FE2A 2OU7A 3WZEA 1L3RE 3I7BA 4MWIA 5B2KA 4F99A 3HKOA 2C5XA 2QR7A 1U54B 5J7HA 4OBQA 4Y5HA 3ZMMA 3LLAA 2W1DA 4E6QA 3F66A 5K0KA 5T68A 1YXSA 3LXNA 3H0ZA 5KMMA 2YHVA 3U8WA 3TTJA 1OGUA 2OICA 3F5GA 4R1VA 5HCZA 4DEBA 5M08A 2ITQA 3KFAA 4HJOA 4TT7A 2O65A 3CTHA 4V01A 5CVHA 5H9BA 3QTIA 5J95A 2I6LA 2I0VA 3QQKA 5EOLA 2B9HA 2QO9A 2VV9A 3F5PA 2CNQA 4E6CA 4YPSA 1JNKA 2QQ7A 2R3JA 1UKIA 4PF4A 5IKWA 2PVYA 2OJGA 1XH7A 4FV1A 4PPCA 4QTCA 3E8DA 3VUMA 3NUAA 3NS9A 3FMDA 4EC8A 4RRVA 1H27A 4BKJA 2JD5A 4JR3A 4CGAA 2O0UA 2YACA 3Q9XA 3F69A 3FZOA 3ORNA 4WNOA 4MVFA 3U6IA 2VTPA 3GC8A 3R1YA 3DGKA 1U4DA 5DEYA 3H9OA 3MJ2A 2R3HA 3AC3A 3LIJA 4HGTA 3O0GA 4L68A 3NZ0A 3LCTA 4FSRA 4QP2A 4AGUA 4QTEA 2FUMA 3MGYA 1OPKA 2B9IA 4R3PA 5E1SA 4HGEA 3QCYA 4DCAA 4OUCA 5LOHA 2RFEA 2WTJA 2R0IA 4ZJVA 4D2VA 1RJBA 5AIRA 4WNMA 2OZAB 2WO6A 2YM4A 4WSQA 5EFQA 4HZRA 5IUHA 3BHHA 2CMWA 4U79A 5TT7A 2IZTA 4EKLA 5A4EA 3TZ7A 4BY9E 1XH5A 4V0GA 2JBOA 1FVVA 2HW6A 4HPUE 3ELJA 5A6NA 3HA6A 5FGKA 4BBEA 5LARA 2VTJA 3ROYA 4U0IA 3ZXZA 1NA7A 5JQ5A 4FV9A 2G2HA 1PKDA 2BDFA 2HYYA 3BX5A 3C4XA 4L45A 4QMSA 1XBCA 4DBNA 1VYZA 4DFLA 3DLZA 2WZJA 4GL9A 5AM6A 2VNYA 3DBCA 3PIXA 4MF1A 4G3DA 5K0XA 4WA9A 4FYOA 2YCQA 3VJOA 3F88A 3NGAA 2WQMA 2UW3A 1EH4A 3FZPA 3F82A 2QLUA 4KKEA 1OL2A 4DLJA 4F6WA 4FSWA 2VTLA 5HE1A 3O8PA 1H26A 1Z9XA 3FQSA 5EYKA 3ZS5A 3R1NA 3PFQA 5T3QA 3MA6A 3VAPA 4A9SA 3ZLXA 5EOBA 4J98A 4BZDA 3TNPC 1XBBA 4FIHA 5A4CA 3Q60A 3UG2A 2ZJWA 5KBQA 5LMKA 5CLPA 3LQ3A 4RIXA 3O8TA 3I4BA 2R3QA 4MCVA 4TYJA 5AAGA 4YPDA 3C0HA 2VO0A 4FZ7A 5FXRA 2WPAA 2XNEA 4D55A 3D5XA 3KMUA 1Q8WA 1BLXA 2YLEA 4JBPA 3EOCA 3RNYA 4Q9SA 5H8EA 2XJ2A 4BHZA 4EH2A 3A8XA 2O8YA 5CALA 1A48A 4BDAA 4MF0A 1O6LA 5IG1A 4RLKA 1CKPA 3HDNA 4NFMA 4QMZA 3HAMA 3O23A 3HUCA 2V62A 4N4SA 4UZHA 5EDQA 4U5JA 1NVRA 1HOWA 2VTQA 3R2YA 5IH4A 1MP8A 2H96A 2Q0NA 5HOAA 3ZO2A 2VZ6A 4YUQA 1U59A 3CBLA 5M53A 3TV4A 2HAKA 4IX4A 4M15A 3MB6A 4L9IA 4PPAA 4RIOA 1FGKA 4QP6A 2KULA 4RIWB 2XNBA 3FL5A 1E1VA 1JBPE 5F20A 3PIYA 3T8OA 3UO6A 3UIMA 4C34A 4UXLA 5L2QA 3LFFA 4QP4A 4CTBA 2W7XA 4DA5A 4WBOA 4U3ZA 3V5WA 1NVQA 3BGQA 3T9IA 3HX4A 4F08A 1W0XC 3PLSA 3TM0A 5FTQA 5HU3A 3F3VA 3W2CA 2B52A 4FZAB 3E3BX 5EW9A 4ZTLA 4RFZA 2HY0A 3FPMA 3D14A 3IQ7A 3OCSA 4I24A 3EQRA 2UZLA 4ZSLA 4BN1A 4J99A 3L8VA 5EI2A 2JFMA 4M68A 4KRDA 3MTLA 5IQBA 5C8NA 1XO2B 4XOZA 4HYSA 1AD5A 4YJNA 4C61A 2ITWA 4RG0A 4GFOA 4EORA 3GBZA 2BKKA 2OO8X 3C7QA 3QBNA 3WZJA 4Z3VA 1H1RA 2C3LA 3W2SA 2RKUA 4CRSA 1V0OA 1XBAA 4RIYA 4UMTA 1ZMVA 4IB0A 1G5SA 4TWNA 3DNEA 3HECA 3UVPA 4D2SA 4GS6A 5KKRB 1Q4LA 2I0EA 2IVUA 2UVYA 5HNBA 3DFAA 4ZSGA 3RPOA 2O5KA 5J87A 3W10A 4ACGA 4W9WA 1ZY4A 1A9UA 4DH7A 4XRJA 3UIBA 4EOJA 5M4FA 2G01A 5F4NA 4MNEA 4K6ZA 2XYNA 3QD0A 4CFUA 2C6LA 3PPKA 1PXPA 4KS7A 4LM5A 2OFVA 4FEUA 5H8GA 4F1MA 3DK3A 3R21A 4FOCA 3TNWA 2JAMA 2JBPA 4IX3A 4KB8A 2QOBA 2HK5A 4P5QA 5E8VA 3VUGA 2PVJA 4AP7A 5CVGA 3P86A 3KRRA 5E8WA 4IVBA 4XG3A 4Y8DA 4X3FB 4FG9A 4E26A 4E7WA 4QRCA 1H00A 3R9RA 3F5UA 2HZ0A 2PMIA 1WBWA 2IZUA 5AP4A 5B2MA 4ACDA 3VW8A 3PPZA 3PXYA 3Q9WA 4ZS0A 2WTDA 2ZOQA 4TYHA 2NO3A 5E8XA 4NW6A 5AP6A 3VBQA 3K2LA 5M09A 2PVKA 3RP9A 3WF9A 4DCEA 2CSNA 5FLFA 3BLHA 3MIYA 4TTHB 2ZB0A 4CTCA 4E3CA 5KMIA 3OD6X 4C3RA 2RF9A 1TVOA 4X2GA 4M69A 2JEDA 1LEWA 3EYHA 4AZTA 1B6CB 3LFEA 3I60A 3MWUA 5ANDA 2H34A 4FKVA 4RFMA 4DH1A 3RK7A 5K9IA 4QQTA 3HMMA 2ONLA 4II5A 4YHFA 4O0TA 3MA3A 3KGAA 3POOA 3R1SA 4BDJA 4WNPA 1IG1A 4S30A 1XHAA 3A4PA 3F2AA 2GDOA 4JQ8A 2GNLA 4HVSA 2R3FA 1NW1A 4X2NA 2VTMA 4MTAA 4G34A 2CKEA 3VN9A 3Q9YA 4M14A 3ZUUA 5DHJA 4O0XA 3PWYA 1XWSA 2JC6A 2WMWA 5C03A 2VTRA 2PZYA 4O21A 3NYXA 3PVWA 3AT3A 5DT0A 4S32A 2VWZA 4MX9A 3A62A 2WMRA 4HVHA 4EL9A 3D2KA 4C3FA 4HPTE 4JG6A 4FV7A 3O8UA 4JI9A 2EB3A 4R7BA 4TWOA 4PP9A 4RZVA 5LCKA 5L2TA 2PHKA 1CMKE 3ODZX 2ITOA 3ZLYA 5I9ZA 3MS9A 4AOTA 4IZ5A 4NFNA 4DH3A 3LW0A 3H30A 4CKIA 3DS6A 3EQCA 3GQIA 4LUEA 3FQHA 3ZLWA 4W4WA 1ZY5A 5HTIA 4GT3A 2DQ7X 3R22A 2HENA 2QOCA 3QX4A 4JL9A 4TNBA 4J1RA 4BI0A 4BGQA 1FGIA 4YLLA 3Q32A 4W8EA 4DHFA 3C5UA 5D10A 3COMA 3EKKA 3LJ0A 4BL1A 1QPDA 2QLQA 3ZFXA 4BTKA 2OF2A 1YI6A 5AV2A 2CGUA 1GNGA 2BHEA 1GOLA 2QOIA 4A4XA 3UO5A 4I6HA 5CF6A 4RVTA 1JOWB 3PRFA 3DZOA 1YDSE 3TUCA 2BTRA 4XLVA 3JPVA 4O27B 3ACJA 4NT4A 4GIIA 4O7TA 4RMZA 3LMGA 5JSMA 1OPJA 3Q5IA 4O22A 4F7LA 4IWQA 4OBPA 2QKRA 5EW8A 3WBLA 4PDPA 4IM3A 5F95A 3OBGA 3PY0A 3QTUA 3IW4A 4ZTQA 3FZTA 2R3MA 3E8NA 3FZRA 3KF4A 4EC9A 4FTJA 1QPJA 5B0XA 4QMUA 2G2FA 5BVOA 4ZMEA 4NH1A 4AE9A 4NWMA 1J3HA 3R1QA 5HU9A 4C59A 1JSUA 3QRJA 4OTDA 4A9UA 4RVKA 4QQ5A 2VD5A 4AW1A 4EOQA 2YWPA 3ORMA 2BRBA 3DQXA 4BCHA 2JDVA 3EQGA 1W98A 3KXXA 5ACKA 4C2WA 2VAGA 4E5BA 3PYYA 4FA2A 3FMEA 1WBSA 3PE1A 2OXDA 4MXZA 1APME 3HNGA 4F9AA 4FGRA 1JSVA 5DNRA 3E62A 3VUKA 2DUVA 5CT0A 5LVNA 4GU9A 1JLUE 4MWHA 3DQWA 4WG5A 3F6XA 2XM8A 2R3OA 3IONA 3KN5A 2CN8A 4FUYA 4MXCA 1P4FA 2BMCA 3GUBA 4ALVA 4H58A 1GY3A 1Y57A 5C4LA 3HMNA 3IOPA 4E5WA 2P2IA 4FKLA 4C02A 3QA0A 2V7OA 3QL8A 5HG7A 5AR8A 3FKLA 3IPHA 3UIUA 4Y5QA 3TNQB 4TYIA 1JAMA 3OMVA 4EOLA 3DK6A 5IQAA 4O1PA 3GI3A 3KB7A 4IAAA 4IX6A 4BKZA 4O84A 2O3PA 3P08A 4RJ6A 3VBYA 5FDPA 1W8CA 2RSVA 5BPYA 2GPHA 1J7IA 3KRWA 5FEEA 5EHLA 2I1MA 5EQEA 3FC1X 5DI1A 4ANQA 4ANSA 5FXSA 3SC1A 4ZIMA 5F9EA 4J97A 4E4MA 3C0GA 4IFGA 1OIUA 3NMUF 3AT4A 4D1SA 4PP7A 3LMHA 3UZRA 5CF8A 5CI7A 2KTYA 3MFSA 3T9TA 1JPAA 4I20A 4YU2A 3CKXA 1BMKA 3DXQA 4I0SA 4FTCA 5CXHA 2R2PA 3R7EA 3UMXA 5HKMA 1OKZA 3QRIA 4DT9A 2ZV9A 2WELA 1RE8A 4BCPA 4ZXTA 1GAGA 3VBVA 4IB3A 4M3QA 3GFWA 2XK3A 2YERA 2YM7A 4ZSAA 3ZDUA 4CKJA 3PWDA 5HBEA 4F1OA 2R0UA 3D15A 3QRUA 4FSYA 4HGLA 4AF3A 5J5TA 2UW9A 2RL5A 2YDIA 3AC2A 3MH1A 4FT3A 5AEPA 4A9RA 4EOPA 5FD2A 3R7VA 4ASEA 3QUDA 4EBWA 3V01A 3TTIA 3TZ9A 2QOHA 2R7IA 5D12A 5JGDA 4OAUC 3LAUA 1SZMA 3GC0A 2CPKE 2E9UA 1JQHA 3Q96A 2WEVA 4C4EA 3F2RA 4ZLZA 3WI6A 2R3RA 4X3JA 2J51A 3A7HA 4O82A 3AQVA 1K2PA 3AD6A 4DGMA 1MRUA 2WMXA 3VUDA 5L8LA 4QPMA 3QZIA 4YTFA 4EK5A 3DV3A 4QYHA 3V6SA 3OFMA 4KA3A 5EM5A 4NL0A 1B39A 3OROA 2UZBA 4WSYA 5E9EA 3ZM9A 5BMMA 3MPAA 1KOBA 1FMOE 4GK2A 4O0VA 3VRYA 4C62A 5E8SA 2J9MA 2E9VA 2X7FA 3I6UA 4NZWB 5H2UA 2IJMA 3RVGA 3DJ5A 2WQOA 1MQ4A 3SW7A 4NSTA 1X8BA 4TW9A 3QC9A 4H1JA 4HNIA 4AGCA 2XKEA 4AUAA 2WB8A 2CN5A 2VWIA 1H08A 4XCUA 4IVAA 1PXLA 4FKGA 5HNGA 3NLBA 3UTOA 2Q0BA 3FE3A 3HLLA 4QP8A 3C9WA 3WYYA 2XJ0A 2YITA 1J1BA 5E1EA 3JS2A 3ZUVA 2W5BA 5IQEA 2FYSA 2ZMDA 5DG5A 4AW0A 3GC7A 2Z60A 1P5EA 2C0TA 3F7ZA 3E8CA 4TRLA 5DR2A 4YP8A 4RQKA 2C3KA 2QG7A 1YDTE 3KCFA 2PTKA 2XNMA 3SXSA 4BCMA 5ANJA 2Y6MA 4AN9A 4CZYB 2FSMX 4XG7A 3ZEPA 3E63A 3Q4CA 2DYLA 4PDSA 3W33A 5AV3A 3V04A 2CCHA 2VWVA 4AS0A 4BGHA 4BWPA 3R2BA 5CEIA 2CGXA 3PZEA 5J9ZA 4KWPA 2JKOA 1TQPA 2C1BA 5HX8A 3EN9A 1SVEA 4BFMA 2EXMA 5EYCA 5M57A 2UUEA 3WYXA 3FKOA 2J0IA 1BL7A 5AUXA 3UQCA 3D7ZA 4FC0A 4LOPA 5DE2A 5ANEA 3BEAA 2PZPA 3PG3A 5CS6A 1UU7A 1H1SA 1YOMA 2C3JA 4OTHA 2XKFA 3E3PA 3ZYAA 2PY3A 4ZJJA 3BRBA 2W4JA 4FBXA 5ANIA 3DXNA 4XH6A 4YNOA 3ZUTA 2B9FA 4ZSEA 4L01A 1WCCA 3N51A 4Y83A 4D0XA 5A4LA 1NXKA 4AT5A 4C0TA 3GCQA 4U40A 3R7UA 5LXMA 4NYEA 1WBPA 3GU5A 1JWHA 3TN8A 3LKMA 3P1AA 1M14A 5CEQA 4QTAA 5CX9A 5CNOA 2XK6A 4HW7A 4P4CA 3U6JA 1ZXEA 4FR4A 3BYOA 4JOAA 1WBNA 2W1ZA 2XNOA 5AV1A 3IK3A 3PLAE 4FL1A 4FV6A 3QZGA 3Q4TA 2ETRA 1UV5A 2A1AB 3HP2A 4WIHA 4BHNA 1P4OA 4F70A 3WZDA 1GJOA 4CEGA 4O0WA 4XP2A 4V0GB 3QCSA 2OH4A 2R3IA 3S95A 3SD0A 1Q5KA 5I3RA 3MY1A 2ZM4A 2X6EA 3ALNA 2OXYA 1Y6BA 4MBIA 1G8SA 1VYWA 5J8IA 4E6AA 4KIKB 2OZOA 3QQHA 4AOIA 2XCKA 3OEZA 4G6OA 4UWBA 3QRTA 3C13A 1PKGA 4BCFA 5BVKA 4I6BA 4ANLA 3VS6A 2BRGA 2XEZA 2BALA 4G5PA 4RC3A 3DA6A 2WOUA 5HD7A 5HI2A 4LYNA 4WKQA 3COIA 5EDPA 2QI8A 2JDOA 3FDNA 2WTWA 4LRMA 4IADA 5HCYA 3R8LA 3BELA 4DGNA 5A9UA 4XNEA 4RVLA 2W06A 4O0UA 1IAHA 1WAKA 3RZFA 4DH8A 4FVQA 3CQEA 2IZSA 2FVDA 2WQEA 4Z7GA 2B7AA 4M0ZA 2UW4A 4R3RA 1KUTA 3I81A 4FNXA 3M11A 4DEGA 4NCTC 3SGCA 1QMZA 5CF4A 4RIXB 2YJRA 3FLQA 4G6LA 5M55A 2Z2WA 3BBTB 5ICPA 3IG7A 4X2KA 2LAVA 4GJ2A 4GG5A 3DCVA 4LGHA 4R5YA 3Q4ZA 5JRSA 4EZ5A 5IEXA 5J9YA 3Q5ZA 1WBVA 2E2BA 5TF9A 4ASZA 4Q2AA 4RX8A 3MN3A 2F2CB 3LFNA 4MNFA 4B8MA 2XVDA 2GTMA 5DWRA 5IA1A 3AD5A 3CCNA 4FSUA 4I5PA 4MHAA 5CAUA 5K4JA 5LMBA 3HRCA 1OBDA 2RFNA 3L9PA 4QMYA 4GK4A 4F4PA 5L6PA 3OY3A 3ZOSA 4F64A 3CIKA 3MFTA 4R77A 4DGGA 3VS2A 5HLWA 1WFCA 1MUOA 3D2IA 2BUJA 4BIDA 5LVPA 4IQ6A 2J4ZA 3KXGA 4ERKA 2QHNA 5IEYA 3WZUA 1BL6A 4CQGA 2YZAA 2HOGA 4LL5A 3FMNA 1IA8A 5IDPA 3DKGA 4IZ7A 4OTRA 5E8UA 4DEEA 4Q5HA 3NAYA 5L3AA 2HZIA 4H1MA 3TACA 2W5AA 3FMLA 4GJ3A 5KX8A 5KMJA 5K3YA 3PJ8A 4LV8A 4CLJA 4RBLA 2QOOA 4RWJA 5LQFA 1WVWA 1ZZ2A 5HCXA 4D9UA 4IWDA 4Z16A 1QPCA 4J53A 3FMKA 4X7QA 3HUBA 3QGWA 2WXVA 4FV0A 3GT8A 3PY3A 2P4IA 3LFDA 2W1CA 5I9WA 4W8DA 2P33A 4IM2A 4ONAA 2GNHA 4IAZA 4FSZA 5AP2A 3HMPA 4CYJA 4NM3A 3EFWA 4RWIA 1PY5A 2EXEA 4JX7A 4R3CA 4LUDA 3VS7A 3ZRMA 4ANNA 1PYEA 3OW4A 3NUNA 3BCEA 3BQCA 4IXPA 3RPRA 4ZZOA 3S3IA 3HV4A 1PXOA 2OJ9A 5D7VA 3UODA 2IPXA 3EQBA 3G9NA 4RIYB 4IB1A 1SVHA 3E5AA 3TZ8A 4D4SA 4YC3A 4ZOGA 2F7XE 4E4NA 2GNJA 2UZOA 4D2PA 3TWJA 4AW5A 3EQHA 1QL6A 4IJ9A 2XBJA 4QD6A 3LQ5A 5IZFA 4W4YA 4PRJA 4U9AA 4EQUA 4U80A 4IVCA 4BTJA 5AP0A 2WGJA 5AADA 4D0WA 1L8TA 1T46A 2A0CX 3ERKA 4MNEB 3O7LB 4QMMA 5CQWA 3NNUA 1FVTA 4OT6A 2WEIA 3LLTA 1ZYSA 4O0SA 3VUTA 4F9BA 2Y8OA 3HGKA 4UV0A 1IEPA 2IWIA 3QZHA 3A4OX 2HELA 4WHZA 1URCA 2UZTA 2JGZA 1Q3WA 1H1PA 4Z9LA 4TXCA 3A61A 5HBJA 1PMVA 5GZ9A 4JG7A 1M2PA 4R7HA 4QMQA 2X2LA 4DGLC 2FA2A 2G15A 3A7IA 3QHRA 2PUIA 3QYZA 4QT1A 2R64A 4GV1A 2PE2A 3QQUA 4R8QA 2WMBA 4QYYA 3I79A 3KA0A 3LCDA 3GENA 3TDVA 3UBDA 4K18A 3RM7A 3CE3A 4YNEA 1KE9A 5C1QB 3ZSHA 2HIWA 4TYHB 4O7RA 3V6RA 3KL8A 3R6XA 4RZWA 1STCE 4NKSA 5AUTA 3AOXA 3CTQA 2OKRA 3VVHA 2Z7QA 4FNYA 2UZEA 4WD5A 3LXKA 4JDKA 4M69B 3DZQA 3BLQA 3F3ZA 4IFCA 3R7OA 3QGYA 4BYIA 4MYGA 5CSHA 5HD4A 5BUIA 4W9XA 1VEBA 4CQEA 2XIZA 3FSKA 4CFVA 2BKZA 3KVWA 3MH2A 4IC7A 4IH8A 3GNIB 2YCFA 4QYFA 5H3QA 5CEMA 3R8VA 5E4HA 2ITXA 1ZYCA 4AU8A 3MB7A 5DYJA 4FG7A 3NYNA 3Q53A 4N70A 5KMOA 4IBMA 5HTBA 5GZAA 2WHBA 3WE4A 1IR3A 2GTNA 4JG8A 4MXXA 5AA8A 5JFWA 3MDYA 4FKIA 2UW0A 2WFYA 5HVYA 2UZUE 1Z5MA 4F6SA 4P5ZA 4BTFA 1FBNA 2YIRA 4FEXA 4FK3A 2Y4IB 2OBJA 2QOQA 3VC4A 5HG9A 3ZM4A 4GUBA 4X0MA 3G5DA 4DH5A 4F1TA 3QD4A 2XZSA 5L2WA 4ACCA 2X81A 3QLGA 4FK6A 2QHMA 4HGSA 4UMRA 4XG4A 2BRMA 2YIQA 3GU6A 5IDNA 1ND4A 1OM1A 3CJGA 1ZMUA 1QCFA 2X8IA 3CPCA 3V51A 3NVMB 3FV8A 5BVNA 3VF9A 2XF0A 3H9RA 1WBOA 3D4QA 4XMOA 4BKYA 2R5TA 3OTUA 4YHTA 2GHLA 2J2IB 2EXCX 1OB3A 1PXIA 2VRXA 3C51A 4ITIA 2R3PA 3QD3A 3LM5A 3CC6A 4IWOA 3GVUA 3RAKA 4FTUA 1M7QA 1H0WA 2BHHA 2AC3A 4EK6A 5JEBA 2JDRA 3TEIA 4I0TA 3KMMA 4RLLA 4AGDA 3QTSA 3KN6A 5FQDC 2P2HA 4RX5A 1VJYA 3OOGA 5JN2A 3P4KA 5I9UA 4YTIA 5CU0A 4C33A 4JQ7A 2QOLA 2YM8A 3QXOA 5HX6A 2PZRA 3FXXA 3IDCA 1W84A 1UU3A 2VX0A 5JMSA 4BCIA 1YXXA 5AJQA 4KSQA 5IA3A 4YJTA 5FXQA 4DG2E 1YHSA 2GNIA 3K3JA 5TOZA 4PQNA 4YURA 2WMUA 4C37A 5C9CA 5DN3A 5B2LA 3RAWA 5EK7A 2WU7A 1QPEA 3I6WA 3VBWA 4KS8A 3VRZA 3ZONA 4O2ZA 3OWPA 3BEGA 3CXWA 2Z7SA 4EQCA 2UW5A 4DFUA 5LMAA 3U6HA 3CR0A 4NJ3A 3POZA 5DA3A 4F6UA 2GQGA 3ZO1A 1UU9A 1JKKA 2CGVA 3RHKA 5ANGA 3GU7A 4D2RA 4BDKA 3BI6A 3WE8A 3QQLA 4LGGA 2EVAA 2QD9A 2GFCA 5AUYA 4OGRA 4KIPA 3OZ6A 4FVPA 1RQQA 3PSBA 4K8AA 3MVHA 3PA4A 3BPRA 4PMSA 2GS7A 2OIDA 3UYSA 5AV4A 1R0EA 3ZC5A 3BWJA 5HG8A 4H05A 2HXQA 3HV7A 2VTAA 1XJDA 3IW5A 4N6YA 4ZY6A 4AZSA 5AWMA 4UMQA 4ZY5A 1YWNA 2BAKA 1UNHA 2ITZA 4O0RA 3RINA 2XIXA 3PP0A 1R39A 4DEDA 4J71A 4RWLA 2BFYA 1I44A 3ZRKA 3PE2A 3GB2A 1WVXA 2BILB 3PY1A 1SNUA 2VWUA 4JBVA 4QYEA 4IWPA 4UXQA 4GW8A 3VS0A 1ZYDA 2BIYA 4N57A 1U5RA 2FSLX 3LZBA 4NTTA 5K5XA 5CNNA 3TV6A 3D83A 3PDTA 2B9JA 3PJ3A 4QTDA 5AIKA 4OTWA 3GOKA 2OWBA 4BDGA 4DTAA 1CTPE 3W55A 2WIPA 1XH9A 2OK1A 5JH6A 4S33A 4EH5A 3EFKA 3BHTA 5CU4A 5M07A 4RJ8A 4H39A 4O7SA 3WOWA 3FI4A 4DLIA 3DAJA 5CENA 1IAJA 4BCQA 3QTQA 3RPYA 3UO4A 5JFVA 2BVAA 3IGOA 4BDDA 1YI3A 3KK9A 1M2RA 4FIFA 4I3ZA 3A7GA 5L6OA 3LE6A 2H8HA 4D4VA 1NVSA 5KKRC 3EZVA 2I40A 2W9FB 3VW6A 4YO6A 4IAFA 1YQJA 1TQIA 5BX0A 2JKKA 3NUSA 4Y95A 3D7TA 2CJMA 4C7TA 3CS9A 4APCA 3UIXA 4L3JA 3H4JA 4G6NA 1FINA 1IASA 4RJ7A 4C4JA 4CD0A 2W1FA 4BIEA 4ZLOA 2CHLA 4YMJA 3RBWA 4D1ZA 3CEKA 2YFXA 3S2PA 1OUYA 5JRQA 3W8QA 5HE3A 3TI1A 3VBXA 4O7NA 3WARA 1OKVA 4EH3A 4FEQA 3TNIA 3IS5A 4FKWA 4JR7A 4WT6A 2BZKB 4FTKA 5IPJA 1Q8UA 1R3CA 4IAYA 3MY0A 4DEAA 4PTEA 2XMYA 2C0OA 3R0TA 4QMVA 4E6DA 3L8PA 2PVMA 4X3FC 4BDEA 4TY1A 3BHUA 3OC1A 3QZFA 4N0SA 1GZOA 4YJOA 5FTGA 4FKUA 3OHTA 1OL6A 4IDVA 3MY5A 4M12A 2GQRA 3L9MA 4DEHA 5IF1A 2OXXA 4BCGA 1CKIA 2XM9A 5AP5A 4O96A 4EJ7A 4EOOA 1JKTA 4YO4A 1OBGA 3DJ6A 1ZRZA 2DWBA 3AGLA 2R7BA 4RGJA 2WMSA 2NP8A 3G0FA 1Z57A 3V5QA 2C0IA 3NNXA 2BRHA 2VNWA 3MVMA 4YLKA 3QF9A 3CGFA 2GS2A 4GT4A 5KMKA 5EQPA 5IH5A 2AUHA 4RA5A 3HEGA 3JVRA 3R01A 2OJFE 2JIIA 5EYDA 3QCXA 4GH2A 2X4FA 4RJ3A 3V3VA 1JKSA 4PUZA 4ANOA 2C6MA 2WMVA 3D5WA 4O0YA 4U44A 1JVPP 2ESMA 5AX9A 5GHVA 4CCUA 5J1VA 3H3CA 5AM7A 4AQCA 4ANMA 2W1HA 3Q4UA 5J5SA 1W83A 2IW8A 2WQNA 5IH6A 5IUGA 4L00A 1OZ1A 4AFJA 3S00A 1RW8A 3VS5A 2C3IB 4U3YA 4FSMA 5AUVA 4ACMA 1OKYA 3KRJA 2EU9A 4DYMA 3ZBXA 5BYZA 5IQGA 2JAVA 4RA4A 4RX9A 4FX3A 5DT4A 4CV8A 3S0OA 3FC2A 5JKGA 3UVQA 4EH8A 2ZVAA 4WBBB 4XG6A 3FLSA 1WBTA 1S9JA 4LGDA 3GFEA 3MI9A 3BV3A 3PVUA 5KCVA 3ORIA 5L4QA 5CZHA 5C4KA 3NUXA 5CAVA 4IC8A 3ZZEA 2VX3A 2IVVA 5KMLA 4H36A 4C38A 3QFVA 4L6QA 4AXAA 3GEQA 4F65A 5IMEA 3LVPA 2IW9A 2J0KA 1KV2A 5ETCA 3SV0A 3VBTA 4ALWA 4GIHA 1TQMA 3BE2A 5DR9A 3LM0A 4EBVA 3NIEA 4Y73A 2IG7A 4DINA 2G1TA 3EYGA 3HV5A 2F57A 1OUKA 3UNJA 5ETIA 2PYWA 1OL7A 3FBVA 4FIJA 1IRKA 4R1YA 3RWPA 3MV5A 4JRNA 4GVAA 4P7EA 4D28A 1UU8A 4TYGA 4UN0C 5I9YA 3OXTA 5AR4A 4F9CA 3UOJA 3KEXA 1G3NA 3NSZA 4RIWA 3DJ7A 4I41A 5I0BA 3KMWA 3T3VA 1Q99A 3G9LX 5HNIX 3PA5A 5JGAA 4CCBA 3LXLA 1DAYA 1LR4A 3KVXA 3VUHA 2BRNA 2CKPA 4FKJA 5AR3A 4XEYA 4YR8A 3UDBA 1FOTA 2CLXA 3F7WA 4QP7A 4S2ZA 1KOAA 3B2TA 2BZIB 3QLFA 3UGCA 4ERWA 3Q04A 3QQJA 4AAAA 3CGOA 2VN9A 4TKSA 3SOAA 2BAQA 3EL8A 5DLSA 3GCPA 3LJ1A 3R8PA 3SG8A 3HDMA 4O7YA 1ZAOA 4F7JA 1XH4A 2O64A 1DAWA 5E8TA 4L3PA 2IN6A 4XOYA 3PSCA 4TWCA 5KHWA 4O1OA 5EHYA 5D11A 3AT2A 1ZYJA 3H10A 1YHWA 5HEZA 5B7VA 1WVYA 3DTWA 3LFBA 4JQEA 2W9ZB 3N9XA 3KULB 4IVDA 3AXWA 4Z7HA 4NUSA 2ITPA 2HZNA 3DDQA 4KRCA 4E1ZA 4XG2A 4E4XA 2QO7A 3F61A 4HOKA 4EYJA 4F7NA 5JK3A 5AFVA 3SG9A 4X2FA 1I09A 1PJKA 3QKKA 2YEXA 2DS1A 4XLIA 4C8BA 4DG3E 3R04A 3C4EA 2ZMCA 1BKXA 3GC9A 5K5NA 3VHKA 4NU1A 3FUPA 3DDPA 3LCKA 3O71A 3ROCA 5FUTA 4G3EA 2X39A 3DKFA 5CSXA 3V8SA 3EFLA 2H6DA 3REPA 2B0QA 3H9FA 3BZ3A 4JNWA 4C4IA 3G0EA 3DNDA 4HZSA 1ZOGA 4WRGA 3KXHA 3I0OA 3K5UA 3QQFA 5CU2A 4BCJA 1UKHA 2XA4A 4ID7A 3C50A 2X0GA 4UWCA 3RHXA 5CY3A 2HW7A 5CANA 4I21A 4FTMA 2ETMA 3P79A 3ULZA 4F0FA 5DPVA 5F1ZA 4CMTA 1KE8A 3HA8A 4O86A 4LL0A 4YZ9A 4MBLA 2PVNA 2XNNA 4K77A 3I5ZA 3DBDA 5FM2A 2JKMA 4MXAA 3OEFX 5DGZA 4L52A 2HZ4A 4I0RA 5LVLA 4KINA 4E73A 5CU6A 4XX9A 2ZYBA 4NM5A 4ZTMA 4CKRA 4RPVA 3N4VA 5TE0A 2V5QA 2QU5A 4EI4A 4U45A 1PRYA 4TPTA 3ZSIA 4AFEA 4EHZA 3ZDIA 4BDBA 3IKAA 3U9CA 5HLNA 5HICA 3PZHA 3HRBA 4I92A 3IW6A 4FNWA 4QTBA 1AQ1A 3D9VA 3KCKA 3AGMA 5AMNA 2C69A 5AV0A 5KZ0A 2C1AA 4BYJA 2CCIA 4C36A 3G15A 1A06A 4RVMA 3ZHPC 2B55A 4A07A 3EQIA 3Q6WA 3BBWA 4KIOA 3U55A 3QHWA 5D1JA 5HVJA 3OWLA 4KBKA 4CFNA 4FT9A 2UVXA 4XV2A 4G17A 3W2RA 3CY3A 5HIDA 1PHKA 1V0PA 5HO6A 3ZTXA 4U97A 4H3BA 2CNUA 3TJDA 4DT8A 2I0YA 4FGBA 3E87A 4R6VA 3OWJA 2XCHA 4D1XA 4DTBA 3W8LA 3C4ZA 2X7OA 3ACKA 2O63A 4K9YA 2FH9A 3SRVA 5DEWA 2XIYA 3FZ1A 4IJPA 4DTKA 4CNHA 3AMBA 5DOSA 3P23A 3NCGA 4L8MA 4WRSA 4FOBA 3RCJA 4EK8A 2VTSA 3TDWA 2W1GA 2BDJA 4K1BA 3V5JA 3CSVA 1Q97A 2SRCA 3R73A 4EHVA 3FMHA 4BBFA 4ZEGA 4XBRA 1Q61A 3COHA 4TWPA 4L3LA 3RCDA 2B53A 2ITYA 3C4WA 1H8FA 3E64A 4PL4A 4BDCA 5E92A 2VTTA 5HBHA 4GSBA 3VWAA 4ZY4A 4EK3A 1FPUA 5C8MA 3ULIA 2RIOA 2X9FA 3DY7A 4I6QA 5AAEA 5IA5A 3DT1A 5KMNA 3ZC6A 4BDIA 4EOIA 3FXWA 2PMNX 4MD7E 3MTFA 4I1ZA 1O6YA 3UOLA 5KBRA 4ZK5A 4JIKA 3COKA 3TNHA 5A6OA 4C2VA 3OUKA 3ZO4A 4LI5A 3LFCA 3FKNA 3FPQA 4L43A 4GT5A 4AZFA 3AC1A 4PY1A 4LV5A 3SOCA 3UOHA 2YAAA 3OCGA 4QMXA 3W1FA 3QALE 1WMKA 4F63A 1OVEA 4B0GA 4EWHA 5IEVA 3SKCA 1B38A 2HXLA 2C5YA 4LOOA 3UQGA 4MKCA 4PPBA 3EQFA 1PXNA 1ZZLA 4NIFA 4FODA 2Q83A 5JGBA 4IW0A 3VNTA 3P7CA 4AT4A 3AMAA 4MBJA 2X4ZA 3AC5A 3ORXA 1YXTA 3EIDA 4EH6A 3NW7A 4HCVA 4CMOA 3BU6A 4G3CA 2C30A 2CKQA 4I5HA 2ZV7A 4OTGA 3A7FA 3BWFA 4BBMA 3EL7A 5E7RA 2IW6A 2WKMA 3RPVA 3NW5A 4YZMA 2PK9A 2CDZA 4PNKA 5HTCA 4QPSA 2J0LA 1YI4A 3QUEA 4JS8A 4UX9A 4V04A 4LMNA 4AACA 5HZNA 5GZ8A 3VQHA 3M2WA 3NCZA 3DKOA 4NM7A 4FV4A 3R8UA 3FY0A 1OL1A 3ENMA 2WTVA 4J7BA 4MXOA 4EOSA 4TL0A 5BYYA 3QU0A 4BDHA 2W1EA 4EYMA 3R7YA 4YGAA 4CZUA 3RK5A 3LPBA 4ZSJA 1LP4A 4U81A 1IA9A 2C5OA 3UQFA 4DC2A 4FKRA 1PXKA 4QNYA 4YZBA 3PPJA 3W32A 2F7ZE 5JQ8A 3R28A 5C26A 4FEWA 3A8WA 4GFGA 2WMQA 3D94A 5ANKA 4A7CA 4EK4A 4AN2A 4WNKA 2OIQA 1ERKA 2UZWE 2XYUA 5C01A 4YJQA 3K5VA 3NR9A 5DBXA 3EFJA 3PTGA 4AA5A 5CSVA 4QMNA 2J5FA 4M67A 3UP2A 1DM2A 4CFWA 5LJJA 5LMKC 3G51A 3ORTA 3P7BA 4BGGA 2QC6A 3MFUA 1UNLA 2GMXA 4L42A 3FAAA 4FMQA 4BRXA 3FEGA 4JDJA 5E8ZA 4G31A 3WF5A 4O83A 3C1XA 3QD2B 4IDTA 4PV0A 3V5PA 4XP0A 3WIGA 2EB2A 3U87A 4FIGA 4UMPA 2QODA 1YWVA 3PVGA 4EHEA 2F49A 2R4BA 3DBEA 2GU8A 4H3PA 4J8MA 4R5SA 4IZAA 1PXJA 5M51A 4RFYA 5AP1A 4EZ3A 3G90X 2WTKB 4ZP5A 5HORA 1P2AA 1E1XA 2X7GA 2YAKA 4GCJA 2JDSA 3SQQA 4JBQA 4L53A 5A54A 5CAQA 3G33A 4QMOA 3LCSA 4BTMA 4PDYA 4N6ZA 3FLZA 1ZOHA 2VUWA 4F09A 1GZ8A 3CD3A 1OMWA 4FKOA 4CMUA 3UYTA 2PMLX 3OW3A 5L2IA 3TKHA 5HE2A 2WAJA 3ZFYA 2BAJA 4CG8A 5IISA 2BIKB 2JIUA 4OTQA 2ZM1A 4WG4A 5AR7A 3U4WA 3R71A 3JY9A 3WF7A 1GIHA 4W4VA 4FTIA 4F7SA 3KK8A 2VWWA 5CI6A 3E88A 3PXFA 4RWKA 3BGPA 2WNTA 3EN5A 3WF8A 2QKWB 2FSTX 4UZDA 3F2NA 4OW8A 4O38A 3QTXA 3KREA 4A4LA 3CTJA 4G1WA 2X1NA 5M4UA 4P2KA 4C3PA 5BVDA 3MJ1A 3BHYA 4AA0A 4AOJA 5BYLA 5EW3A 2YWVA 4OT5A 5J9LA 3L1SA 4NTSA 2XB7A 4YHJA 5FEDA 3Q52A 1MRYA 3ATSA 4K2RA 3SXFA 4J8NA 1YXVA 3ZRLA 5BVFA 1LPUA 2C6TA 4I4EA 2ZM3A 3ID6C 3R9OA 5FP6A 5I3OA 3BHVA 4A9TA 4NK9A 2BFXA 3LOKA 4RC4A 3FXZA 2NNWB 4I93A 4OTFA 4EKKA 2WIHA 2R3GA 3RAHA 4B4LA 3LFSA 2JIVA 3D7TB 5BUEA 4ASDA 4JDHA 1OECA 1E9HA 4DFBA 5KO1A 2VO7A 5A14A 4AT3A 1URWA 1KSWA 3EN4A 4M84A 3FMMA 3JUHA 4ASXA 3TUBA 4IIRA 2OLCA 3DU8A 3TKUA 4YC8A 3QWKA 5FRIA 3RALA 4BZNA 2R3KA 4YC6A 1NT2A 2OIBA 4CXAA 3BYSA 2NRUA 4YTCA 3DB6A 3DFCB 4I22A 5HQ0A 5EM7A 2X2KA 4DFNA 3A2CA 3LQ8A 3W16A 4FSTA 4K0YA 3JYAA 3ZZWA 3RGFA 5AP7A 2XIRA 5CEPA 2YDKA 3SVVA 4XUFA 5CEKA 4GK3A 4CG9A 3OCBA 1GZNA 4M66A 3ZH8A 1K3AA 3EB0A 3S4QA 5CU3A 2E9OA 4BR3A 5IQFA 2VWYA 1VR2A 3TT0A 4UEUA 4MD9E 3FZSA 1YVJA 3O50A 3MIAA 3R02A 3SX9A 3UPZA 5ETAA 3B2WA 3O51A 2W1IA 5D7AA 2CNVA 5M56A 3LFQA 2XP2A 3CD8A 4EJNA 2AC5A 1PYXA 3OS3A 2ONLC 5BVWA 4X6QC 4I94A 4FT5A 4NCTA 3MFRA 2YIWA 3FWQA 3E7OA 3TKIA 2XKDA 4QMTA 3GCVA 4E20A 4RQVA 4EH4A 2EWAA 4QQCA 4KIKA 4XS2A 1J1CA 4D58A 1XH6A 2W4KA 3ZSGA 3CY2A 3II5A 1F5QA 3OT8A 3QXPA 4FZDB 3U54A 4YSJA 5EQYA 2A4LA 5GIOE 1YKRA 3THBA 2XS0A 1PXMA 4MAOA 2I7QA 3EZRA 3FI3A 2OH0E 3RPSA 4DFYA 2V0DA 4U8ZA 2Y4IC 1OITA 3G6GA 4YZDA 4ZAUA 4A9YA 1YOLA 3L8SA 4J95A 4ZJIA 2WOTA 5EKOA 2QR8A 1DI9A 3FQEA 5GJDA 4MK0A 4FV2A 2J0MB 4FTTA 3NYVA 1UWHA 4YBKA 5EI8A 2YABA 3BE9A 4UB7A 2BTSA 4LMUA 2UW7A 3QQGA 2CGWA 3ETAA 4OLIA 4QOXA 5AX3A 3ZO3A 2BZHB 3HVCA 3U9NA 4C4FA 2PULA 4D2TA 2XNGA 5FEQA 3TIYA 4UALA 2J0JA 3R83A 2XUUA 4MD8E 3UG1A 4XRLA 3FYKX 1H1QA 3CLYA 4RX7A 2ITTA 4EZ7A 4GKIA 5LVMA 4O7WA 3W2PA 2QOFA 3K3IA 5IQCA 4HYUA 2VGPA 4MH7A 4XV3A 2ZDTA 4GVJA 3LHJA 3OVVA 4ENYA 3PJCA 2PVHA 3KXMA 2WQBA 3FI2A 4B99A 2GQSA 4HVDA 3ODYX 4QMWA 1H07A 4GYGA 3IW8A 2C6KA 4C58A 4FEVA 3FLNC 3RM6A 3O17A 3QX2A 5C8KA 2OJIA 3QCQA 1U46A 4GYIA 3BKBA 4AE6A 3FLYA 4IE9A 2VO3A 4U6RA 4USDA 2HWOA 5GINE 4KBCA 1UA2A 3P78A 1BI7A 3ZU7A 5BNJA 3IO7A 1KE7A 2W05A 1YHVA 1HCKA 4BWKA 3GXLA 3NWWA 4NKAA 4IEBA 3W18A 4QQJA 2P0CA 4UY9A 4FKQA 4BZOA 3BYMA 2Y4PA 3NAXA 5D41A 1M17A 5DH3A 3OTVA 2XBAA 4G5JA 3PA3A 3ALOA 2P55A 4G2FA 4IHPA 4OR5A 4W4XA 1XR1A 4XHKB 2GHGA 5EH0A 4DEIA 4FKSA 4HVIA 4OTPA 3T3UA 5CF5A 2ZAZA 2XEYA 4WUAA 3RTPA 3C0IA 4HCTA 5LWMA 4J52A 3DK7A 5TKDA 4YJVA 3R8MA 1FQ1B 2PE0A 2YISA 3BIZA 3VS4A 3SHEA 3VS1A 2REIA 3MVLA 2YM3A 3UP7A 1O6KA 4FV3A 3TV7A 5M4CA 3BGZA 3EQDA 3FJQE 3OOMA 5HHWA 3IOKA 3DLSA 5BUJA 4FI1A 2WMTA 2VWXA 3P9JA 5HIEA 2C6OA 3JXWA 5AR5A 1Y8YA 2QCSA 4EOMA 4KNBA 4D2WA 3NEWA 3EQPA 2V7AA 4G9CA 3UC4A 4QMLA 4FSNA 3VO3A 2PVRA 3AG9A 3VS3A 3I5NA 4XYFA 4FYNA 2W0JA 4PL5A 3E8EA 5TO8A 3E92A 1J7UA 1U54A 3KRXA 3D5VA 1H25A 3PXRA 4CT1A 4DF3A 5L6WL 4APPA 3CP9A 3TXOA 2RG5A 3ET7A 2W17A 4D9TA 4KIQA 4H3QA 4IM0A 3LFAA 3HAVA 2ZB1A 4AA4A 3UJGA 4JBOA 2GSFA 3DBFA 5EM8A 3O96A 5E91A 3QUPA 3ZXTA 4AX8A 4D5HA 4ZMFA 3V8TA 3EH9A 3JR1A 3RWQA 3D0EA 4JAIA 4U43A 2XK4A 3M42A 2PUUA 4FUXA 4QP9A 5EDRA 4DFZE 1H1WA 2VU3A 4DG0E 5L8KA 4CLIA 1H0VA 4EUTA 2OI4X 3SLSA 3SDJA 1UVRA 2VX1A 3CQWA 4Q5EA 2VTOA 1H24A 5L2SA 3TUDA 2Y9QA 4CFXA 4KSPA 4I6FA 5E90A 4A4OA 2XRWA 4CVAA 2UVZA 1T45A 3EHAA 2J7TA 1R78A 3R00A 2XJ1A 1OIQA 4FNZA 3KRLA 4QYGA 2VTNA 4QP3A 3KF7A 4XG8A 5CXZA 1Q8ZA 3PXZA 4YJRA 4LQMA 3Q2MA 3QTRA 3BU5A 4QPAA 5J79A 4LOQA 3NVKI 3AMYA 3R8ZA 1W7HA 5J7BA 1OKWA 4IB5A 1GIJA 3EWHA 4PMTA 1YDRE 4BI2A 5AA9A 4FZ6A 5EM6A 3HP5A 5IUIA 3PJ2A 3UOKA 3MBLA 4BC6A 1YW2A 4JJRA 3IGGA 2QURA 1M2QA 2GHMA 2OZAA 2ZV8A 4F0IA 3KC3A 3FLWA 3KQ7A 5DFPA 2GNFA 3NUUA 3DTCA 3AC4A 5FWKK 2C6EA 2ITUA 2OFUA 4HYIA 5CSWA 3RAIA 5JT2A 5JZNA 4JXFA 2BZJA 4M0YA 2YM6A 4IAIA 2EUFB 3KXZA 3UVRA 3D5UA 5ANOA 3SRVB 1YOJA 2GS6A 5KNJA 1H01A 2YLFA 2UW8A 4BWXA 3UE4A 2NRYA 3B8RA 5A46A 3W2OA 4CT2A 4M8TA 1R1WA 4DGOA 2Z7LA 3EMGA 5FTOA 3SW4A 3R30A 4FKPA 4O6EA 5FM3A 5M4IA 2G9XA 2OGVA 4O7ZA 5HO8A 4QMPA 1WZYA 3ENHA 2IVSA 3HL7A 1ZMWA 3HMIA 4C4HA 3TZMA 5HESA 4ZTHA 4JX3A 5JZJA 2B4SB 3LMIA 3TG1A 2XIKA 3O2MA 4USEA 2RG6A 3ANRA 4YZCA 2YIXA 3MSSA 2J5EA 2XK7A 2Z8CA 3PUPA 4DN5A 2IVTA 2JITA 4O6LA 5A4TA 1K9AA 3VULA 4X2JA 1F3MC 1SMHA 4CZTA 1P14A 2V22A 4EONA 3IW7A 4FT7A 1PMEA 3ORPA 5FP5A 3L9NA 4Y72A 5I9XA 2JLDA 4MEDA 1PMNA 2WU6A 3JY0A 3RZBA 2R3LA 4KABA 4ITJA 4L44A 3UNZA 1F0QA 4HNFA 3BYUA 3QC4A 2Y7JA 5FDXA 4G16A 4B9DA 2IZRA 1YXUA 2NPQA 5HIBA 4ZZNA 4NEUA 3UZPA 5EKNA 4JAJA 5FBNC 3GCUA 3Q3BA 3O7LD 4U41A 5HE0A 4FICA 4GMYA 4MQ2A 3VHEA 1OIRA 4I5MA 4NIFB 3ORZA 4S31A 5DR6A 5KHXA 3N4UA 2QONA 3GQLA 5IQHA 2O2UA 3PIZA 3ZLSA 3NUPA 3UPXA 4U7ZA 2XH5A 3MYGA 2Z7RA 3R7GA 3DPKA 5A4QA 1BYGA 3OY1A 3WF6A 4LRKA 4IAKA 2UV2A 5ACBC 1REJA 3A60A 2BR1A 1PW2A 3WIKA 4AN3A 3RK9A 4EQMA 4NJDA 4BCKA
chains in the Genus database with same CATH superfamily
1ZLTA 4FL2A 4UYNA 4FTNA 5GIPE 2ZV2A 2BCJA 3DAEA 5AUWA 2GFSA 2BROA 2C6DA 2VTIA 3PXKA 5KZIA 4ANBA 5JFSA 5LWNA 4XP3A 3F9NA 2RFDA 3BV2A 3KU2A 3M1SA 3EKNA 3DBQA 3F3WA 4DDGA 1J91A 2QOKA 4YBJA 3R9HA 3OXZA 2AYPA 2PUPA 3HYHA 4FTOA 5DVRA 3ORLA 1H28A 2XNPA 3PP1A 3OUNB 2H9VA 4UYAA 4WUNA 4AZWA 2FSOX 4BCNA 4P90A 5GJFA 2BDWA 2HY81 2C5VA 4LRJA 2WTIA 5AR2A 4UMUA 5LVOA 4TNDA 2Z02A 3BU3A 3H0YA 5TR6A 4IANA 4JIAA 3R9NA 3OF0A 1KV1A 4BB4A 1MRVA 2PZIA 1HCLA 4LG4A 4D4YA 1DI8A 1TKIA 4PMMA 2WD1A 3QWJA 1PF8A 3MH0A 3PVBA 2XKCA 4E93A 3L9LA 4O2PA 2PZ5A 3NDMA 3P7AA 4GU6A 2HWPA 4FIIA 4M97A 4TN6A 3PG1A 3W2QA 1KE5A 2PWLA 3UMWA 1PMUA 2G2IA 3FYJX 2YM5A 5CAOA 3NUYA 4A06A 3I1AA 3ANQA 4HYHA 1CSNA 5JFXA 2OF4A 3MH3A 4HCUA 5CZIA 5GJGA 3LXPA 3GGFA 2Y0AA 5CSPA 4QNAA 5AUZA 1Q8YA 2F4JA 2XK8A 3RJCA 4PDOA 5DIAA 3AD4A 3RMFA 4EH9A 2E9NA 4CFMA 2CKOA 4O7VA 4G3FA 1J7LA 3A99A 4BDFA 3CQUA 3L8XA 2F9GA 4I5CA 1OPLA 4YLJA 3FY2A 2QU6A 3NIZA 5HGIA 2UZNA 1FMKA 4JT3A 4E4LA 3GU8A 4NM0A 3FSFA 5ETFA 2XK9A 4C57A 4O7LA 5CEOA 1G8KA 4V05A 1DS5A 4KD1A 2J6MA 4B8LA 4R78A 3QYWA 5EYMA 3SA0A 5KUPA 3VF8A 4R7IA 3U51A 4X3FA 3OBJA 5T6KA 4JVGA 3IDBA 5FG8A 4G9RA 4KUJA 4J96A 1Q8TA 3OG7A 4ZTSA 4FIEA 5DMZA 3P0MA 4DBXA 3PXQA 4MXYA 4AGWA 2YN8A 3UC3A 4KAOA 4Z55A 5A3XA 1SNXA 3CPBA 3EN7A 5EI6A 5F94A 3MVJA 3EJ1A 3AC8A 3NNWA 2UW6A 2WTCA 3RKBA 3DOGA 4RSSA 2YCSA 1OL5A 4AXCA 3K54A 4K11A 2ACXA 4FV8A 4XV1A 2PVLA 5CWZA 2OSCA 1FVRA 5M44A 5G6VA 4DAWA 4B7TA 4XJ0A 4Q9ZA 1AGWA 2FGIA 4WG3A 3P5JC 4FSQA 2QVSE 4FT0A 4PL3A 3WZKA 4DITA 1O9UA 4EOKA 1ZYLA 5HG5A 2CLQA 2ETKA 4PTCA 2E9PA 4FTAA 5DT3A 3EN6A 3OWKA 1BI8A 2C6IA 1KE6A 1CM8A 2GNGA 4ENXA 1UWJA 5I5ZA 4UWYA 2PMOX 5G1XA 2B1PA 2JFLA 3ZCLA 3FHRA 4CRLA 4FVRA 4YJPA 2W99B 1GIIA 2YA9A 3G6HA 2PU8A 3SXRA 4XG9A 5CT7A 2W5HA 2UZDA 4X21A 3IDPA 1S9IA 3BLRA 3V5LA 5IU2A 4ZS4A 3AKKA 5L8JA 3FI8A 1KWPA 3PRIA 4FG8A 3WILA 3QRKA 4NW5A 4AWIA 4L7SA 4YJSA 3LJ2A 4I4FA 3ATTA 3OP5A 3S1HA 1V1KA 4M7IA 4JLCA 4YTHA 4CSVA 2X0QA 3GU4A 5IMXA 4XV9A 4GRBA 3MPTA 5CTPA 2YJSA 1G8AA 4DFXE 4PWNA 4F9YA 3R63A 3R9DA 1Y91A 4YZNA 5ITAA 4KKHA 5M06A 5LCJA 3BQRA 3BYVA 3NNVA 2W4OA 3OT3A 2FO0A 1OI9A 3KKVA 4K33A 1REKA 5J1WA 5DRDA 2C47A 1CDKA 1VZOA 2GCDA 2VTHA 4GUEA 1U5QA 4ITHA 4L7FA 4IMYA 3CKWA 4EEVA 4M13A 2W96B 1SM2A 1V0BA 3QKMA 5I4NA 1Q62A 5DRBA 3LCOA 4HVGA 3QKLA 2YIYA 4AZEA 4F9WA 2F2UA 4U42A 1LEZA 4BCOA 3TJCA 2YCRA 3UNKA 1XQZA 1ZOEA 2ZDUA 3Q2JA 4XBUA 4IACA 4BICA 4Y85A 4FL3A 4CYIA 4O91A 1ZARA 3C4FA 4PMPA 4E5AX 3VQUA 4S34A 3MW1A 1SYKA 2R3NA 5BVEA 2J50A 4DE4A 3RI1A 2X0PA 4YSMA 3HZTA 3HRFA 4ZTNA 5KE0A 1UNGA 3ORKA 1Y8GA 2YDJA 3V8WA 3VIDA 4FKTA 5AAFA 1M52A 2XRUA 3V5TA 3C4CA 4RJ5A 2ERZE 2X8EA 4Y46A 2X6DA 2F7EE 1OIYA 2V55A 3JVSA 3KY2A 3FHIA 2IO6A 2A27A 2ITNA 3KXNA 5CYIA 5HLPA 4CV9A 4C4GA 2VWBA 4EUUA 4B6LA 5IQIA 5IA2A 4GKHA 3GP0A 4EH7A 1NY3A 2A2AA 4PX6A 1SVGA 2OG8A 4ORKA 5CQUA 5EG3A 3QTZA 4PNIA 3QTWA 4ZLYA 5AUUA 3R7IA 5H8BA 3E93A 2JDTA 5IA0A 2PUNA 2I0HA 4WOVA 2VGOA 4IZYA 4EHGA 1Q3DA 2OW3A 4OBOA 2J90A 4BF2A 2ERKA 5E8YA 4C35A 3ITZA 2P3GX 4RJ4A 3I7CA 4AZVA 2X8DA 3UZTA 4ACHA 3OXIA 4L46A 3P5KA 1R0PA 4BVUA 2UZVA 1M7NA 2X2MA 4MQ1A 4JDIA 3CJFA 3A7JA 2PPQA 2C68A 3DAKA 5EHOA 3C5IA 1XH8A 4JRVA 4LFIA 3W0RA 2VO6A 4EWQA 2OJJA 2C5NA 3MESA 1MQBA 4KBAA 1W82A 1BX6A 4AW2A 3N4TA 3DKCA 4G3GA 2PVFA 4F78A 5BQ0A 3PSDA 3F3TA 4FZFB 4PTGA 3QA8A 4YJUA 5CASA 1ZWSA 5BMSA 3ML1A 4USFA 2BPMA 4KKGA 3NRMA 4GFMA 1RDQE 5IQDA 4FV5A 2RFSA 3NYOA 4O81A 2LGCA 3KULA 4L67A 4WO5A 2WMAA 4ZZMA 4BI1A 4OTIA 1H4LA 3B8QA 1YWRA 2QNJA 5CAPA 3NPCA 3U4UA 3GCSA 5I9VA 1GZKA 5K4IA 1CKJA 4D5KA 2X0OA 3G2FA 5C27A 3E7VA 2R9SA 3TCPA 3OCTA 3DXPA 3MPMA 3IECA 3Q6UA 2HCKA 4I23A 5GNKA 4ALUA 2A19B 1JSTA 3PJ1A 4QO9A 2QG5A 3VJNA 3NX8A 4D4RA 3F3UA 4CFFA 4ARKA 1JKLA 4FTRA 4BIBA 4X6RA 4OAVB 3ZFMA 2X9EA 3VUIA 3ZEWA 3I0QA 3QAME 4QP1A 4AG8A 3DB8A 4TZRA 3HV6A 2PSQA 5FBOA 2B54A 3Q9ZA 1YRPA 1Q41A 2Y6OA 3F5XA 2ITVA 4FF8A 4RC2A 4IX5A 3TL8A 1BUHA 4FTQA 2PL0A 3FMJA 4FTLA 2WTKC 3RNIA 5D9HA 4GEOA 5IA4A 3SAYA 1Y6AA 4F0GA 3FL4A 1Q24A 3ZBFA 2QO2A 2C4GA 5HO7A 3TIZA 1XKKA 2YZLA 5HVKA 2FB8A 4TYEA 1LUFA 3HV3A 2JKQA 3GOPA 4RT7A 4ZTRA 3NW6A 4E8AA 2PE1A 5AP3A 1ATPE 4UBAA 4GG7A 2RGPA 3HMOA 5CVFA 4FE2A 2OU7A 3WZEA 1L3RE 3I7BA 4MWIA 5B2KA 4F99A 3HKOA 2C5XA 3TYKA 2QR7A 3O5AA 1U54B 5J7HA 4OBQA 4Y5HA 3ZMMA 3LLAA 2W1DA 4E6QA 3F66A 5K0KA 5T68A 1YXSA 3LXNA 3H0ZA 5KMMA 2YHVA 3U8WA 1XMMA 3TTJA 1OGUA 2OICA 3F5GA 4R1VA 5HCZA 4DEBA 5M08A 2ITQA 3KFAA 4HJOA 4TT7A 2O65A 3CTHA 4V01A 5CVHA 5H9BA 3QTIA 5J95A 2I6LA 2I0VA 3QQKA 5EOLA 2B9HA 2QO9A 2VV9A 3F5PA 2CNQA 4E6CA 4YPSA 1JNKA 2QQ7A 2R3JA 1UKIA 4PF4A 5IKWA 2PVYA 2OJGA 1XH7A 4FV1A 4PPCA 4QTCA 3E8DA 3VUMA 3NUAA 3NS9A 3FMDA 4EC8A 4RRVA 1H27A 4BKJA 2JD5A 4JR3A 4CGAA 2O0UA 2YACA 3Q9XA 3F69A 3FZOA 3ORNA 4WNOA 4MVFA 3U6IA 2VTPA 3GC8A 3R1YA 3DGKA 1U4DA 5DEYA 3H9OA 3MJ2A 2R3HA 3AC3A 3LIJA 4HGTA 3O0GA 4L68A 3NZ0A 3LCTA 4FSRA 4QP2A 4AGUA 4QTEA 2FUMA 3MGYA 1OPKA 2B9IA 4R3PA 5E1SA 4HGEA 3QCYA 4DCAA 4OUCA 5LOHA 2RFEA 2WTJA 2R0IA 2XANA 4ZJVA 4D2VA 1RJBA 5AIRA 4WNMA 2OZAB 2WO6A 2YM4A 4WSQA 5EFQA 4HZRA 5IUHA 3BHHA 2CMWA 4U79A 5TT7A 2IZTA 4EKLA 5A4EA 3TZ7A 4BY9E 1XH5A 4V0GA 2JBOA 1FVVA 2HW6A 4HPUE 3ELJA 5A6NA 3HA6A 5FGKA 4BBEA 5LARA 2VTJA 3ROYA 4U0IA 3ZXZA 1NA7A 5JQ5A 4FV9A 2G2HA 1PKDA 2BDFA 2HYYA 3BX5A 3C4XA 4L45A 4QMSA 1XBCA 4DBNA 1VYZA 4DFLA 3DLZA 2WZJA 4GL9A 5AM6A 2VNYA 3DBCA 3PIXA 4MF1A 4G3DA 5K0XA 4WA9A 4FYOA 2YCQA 3VJOA 3F88A 3NGAA 2WQMA 2UW3A 1EH4A 3FZPA 3F82A 2QLUA 4KKEA 1OL2A 4DLJA 4F6WA 4FSWA 2VTLA 5HE1A 3O8PA 1H26A 1Z9XA 3FQSA 5EYKA 3ZS5A 3R1NA 3PFQA 5T3QA 3MA6A 3VAPA 4A9SA 3ZLXA 5EOBA 4J98A 4BZDA 3TNPC 1XBBA 4FIHA 5A4CA 3Q60A 3UG2A 2ZJWA 5KBQA 5LMKA 5CLPA 3LQ3A 4RIXA 3O8TA 3I4BA 2R3QA 4MCVA 4TYJA 5AAGA 4YPDA 3C0HA 2VO0A 4FZ7A 5FXRA 2WPAA 2XNEA 4D55A 3D5XA 3KMUA 1Q8WA 1BLXA 2YLEA 4JBPA 3EOCA 3RNYA 4Q9SA 5H8EA 2XJ2A 4BHZA 4EH2A 3A8XA 2O8YA 5CALA 1A48A 4BDAA 4MF0A 1O6LA 5IG1A 4RLKA 1CKPA 3HDNA 4NFMA 4QMZA 3HAMA 3O23A 3HUCA 2V62A 4N4SA 4UZHA 5EDQA 4U5JA 1NVRA 1HOWA 2VTQA 3R2YA 5IH4A 1MP8A 2H96A 2Q0NA 5HOAA 3ZO2A 2VZ6A 4YUQA 1U59A 3CBLA 5M53A 3TV4A 2HAKA 4IX4A 4M15A 3MB6A 4L9IA 4PPAA 4RIOA 1FGKA 4QP6A 2KULA 4RIWB 2XNBA 3FL5A 1E1VA 1JBPE 5F20A 3PIYA 3T8OA 3UO6A 3UIMA 4C34A 4UXLA 5L2QA 3LFFA 4QP4A 4CTBA 2W7XA 4DA5A 4WBOA 4U3ZA 3V5WA 1NVQA 3BGQA 3T9IA 3HX4A 4F08A 1W0XC 3PLSA 3TM0A 5FTQA 5HU3A 3F3VA 3W2CA 2B52A 4FZAB 3E3BX 5EW9A 4ZTLA 4RFZA 2HY0A 3FPMA 3D14A 3IQ7A 3OCSA 4I24A 3EQRA 2UZLA 4ZSLA 4BN1A 4J99A 3L8VA 5EI2A 2JFMA 4M68A 4KRDA 3MTLA 5IQBA 5C8NA 1XO2B 4XOZA 4HYSA 1AD5A 4YJNA 4C61A 2ITWA 4RG0A 4GFOA 4EORA 3GBZA 2BKKA 2OO8X 3C7QA 3QBNA 3WZJA 4Z3VA 1H1RA 2C3LA 3W2SA 2RKUA 4CRSA 1V0OA 1XBAA 4RIYA 4UMTA 1ZMVA 4IB0A 1G5SA 4TWNA 3DNEA 3HECA 3UVPA 4D2SA 4GS6A 5KKRB 1Q4LA 2I0EA 2IVUA 2UVYA 5HNBA 3DFAA 4ZSGA 3RPOA 2O5KA 5J87A 3W10A 4ACGA 4W9WA 1ZY4A 1A9UA 4DH7A 4XRJA 3UIBA 4EOJA 5M4FA 2G01A 5F4NA 4MNEA 4K6ZA 2XYNA 3QD0A 4CFUA 2C6LA 3PPKA 1PXPA 4KS7A 4LM5A 2OFVA 4FEUA 5H8GA 4F1MA 3DK3A 3R21A 4FOCA 3TNWA 2JAMA 2JBPA 4IX3A 4KB8A 2QOBA 2HK5A 4P5QA 5E8VA 3VUGA 2PVJA 4AP7A 5CVGA 3P86A 3KRRA 5E8WA 4IVBA 4XG3A 4Y8DA 4X3FB 4FG9A 4E26A 4E7WA 4QRCA 1H00A 4DHJA 3R9RA 3F5UA 2HZ0A 2PMIA 1WBWA 2IZUA 5AP4A 5B2MA 4ACDA 3VW8A 4O4FA 3PPZA 3PXYA 3Q9WA 4ZS0A 2WTDA 2ZOQA 4TYHA 2NO3A 5E8XA 4NW6A 5AP6A 3VBQA 3K2LA 5M09A 2PVKA 3RP9A 3WF9A 4DCEA 2CSNA 5FLFA 3BLHA 3MIYA 4TTHB 2ZB0A 4CTCA 4E3CA 5KMIA 3OD6X 4C3RA 2RF9A 1TVOA 4X2GA 4M69A 2JEDA 1LEWA 3EYHA 4AZTA 1B6CB 3LFEA 3I60A 3MWUA 5ANDA 2H34A 4FKVA 4RFMA 4DH1A 3RK7A 5K9IA 4QQTA 3HMMA 2ONLA 4II5A 4YHFA 4O0TA 3MA3A 3KGAA 3POOA 3R1SA 4BDJA 4WNPA 1IG1A 4S30A 1XHAA 3A4PA 3F2AA 2GDOA 4JQ8A 2GNLA 4HVSA 2R3FA 1NW1A 4X2NA 2VTMA 4MTAA 4G34A 2CKEA 3VN9A 3Q9YA 4M14A 3ZUUA 5DHJA 4O0XA 3PWYA 1XWSA 2JC6A 2WMWA 5C03A 2VTRA 2PZYA 4O21A 3NYXA 3PVWA 3AT3A 5DT0A 4S32A 2VWZA 4MX9A 3A62A 2WMRA 4HVHA 4EL9A 3D2KA 4C3FA 4HPTE 4JG6A 4FV7A 3O8UA 4JI9A 2EB3A 4R7BA 4TWOA 4PP9A 4RZVA 5LCKA 5L2TA 2PHKA 1CMKE 3ODZX 2ITOA 3ZLYA 5I9ZA 3MS9A 4AOTA 4IZ5A 4NFNA 4DH3A 3LW0A 3H30A 4CKIA 3DS6A 3EQCA 3GQIA 4LUEA 3FQHA 3ZLWA 4W4WA 1ZY5A 5HTIA 4GT3A 2DQ7X 3R22A 2HENA 2QOCA 3QX4A 4JL9A 4TNBA 4J1RA 4BI0A 4BGQA 1FGIA 4YLLA 3Q32A 4W8EA 4DHFA 3C5UA 5D10A 3COMA 3EKKA 3LJ0A 4BL1A 1QPDA 2QLQA 3ZFXA 4BTKA 2OF2A 1YI6A 5AV2A 2CGUA 1GNGA 2BHEA 1GOLA 2QOIA 4A4XA 3UO5A 4I6HA 5CF6A 4RVTA 1JOWB 3PRFA 3DZOA 1YDSE 3TUCA 2BTRA 4XLVA 3JPVA 4O27B 3ACJA 4NT4A 4GIIA 4O7TA 4RMZA 3LMGA 5JSMA 1OPJA 3Q5IA 4O22A 4F7LA 4IWQA 4OBPA 2QKRA 5EW8A 3WBLA 4PDPA 4IM3A 5F95A 3OBGA 3PY0A 3QTUA 3IW4A 4ZTQA 3FZTA 2R3MA 3E8NA 3FZRA 3KF4A 4EC9A 4FTJA 1QPJA 5B0XA 4QMUA 2G2FA 5BVOA 4ZMEA 4NH1A 4AE9A 4NWMA 1J3HA 3R1QA 5HU9A 4C59A 1JSUA 3QRJA 4OTDA 4A9UA 4RVKA 4QQ5A 2VD5A 4AW1A 4EOQA 2YWPA 3ORMA 2BRBA 3DQXA 4BCHA 2JDVA 3EQGA 1W98A 3KXXA 5ACKA 4C2WA 2VAGA 4E5BA 3PYYA 4FA2A 3FMEA 3UDSA 1WBSA 3PE1A 2OXDA 4MXZA 1APME 3HNGA 4F9AA 4FGRA 1JSVA 5DNRA 3E62A 3VUKA 2DUVA 5CT0A 5LVNA 4GU9A 3BL7A 1JLUE 4MWHA 3DQWA 4WG5A 3F6XA 2XM8A 2R3OA 3IONA 3KN5A 2CN8A 4FUYA 4MXCA 1P4FA 2BMCA 3GUBA 4ALVA 4H58A 1GY3A 1Y57A 5C4LA 3HMNA 3IOPA 4E5WA 2P2IA 4FKLA 4C02A 3QA0A 2V7OA 3QL8A 5HG7A 5AR8A 3FKLA 3IPHA 3UIUA 4Y5QA 3TNQB 4TYIA 1JAMA 3OMVA 4EOLA 3DK6A 5IQAA 4O1PA 3GI3A 3KB7A 4IAAA 4IX6A 4BKZA 4O84A 2O3PA 3P08A 4RJ6A 3VBYA 5FDPA 1W8CA 2RSVA 5BPYA 2GPHA 1J7IA 3KRWA 5FEEA 5EHLA 2I1MA 5EQEA 3FC1X 4O4DA 5DI1A 4ANQA 4ANSA 5FXSA 3SC1A 4ZIMA 5F9EA 4J97A 4E4MA 3C0GA 4IFGA 1OIUA 3NMUF 3AT4A 4D1SA 4PP7A 3LMHA 3UZRA 5CF8A 5CI7A 2KTYA 3MFSA 3T9TA 1JPAA 4I20A 4YU2A 3CKXA 1BMKA 3DXQA 4I0SA 4FTCA 5CXHA 2R2PA 3R7EA 3UMXA 5HKMA 1OKZA 3QRIA 4O4BB 4DT9A 2ZV9A 2WELA 1RE8A 4BCPA 4ZXTA 1GAGA 3VBVA 4IB3A 4M3QA 3GFWA 1TZDA 2XK3A 2YERA 2YM7A 4ZSAA 3ZDUA 4CKJA 3PWDA 5HBEA 4F1OA 2R0UA 3D15A 3QRUA 4FSYA 4HGLA 4AF3A 1VLRA 5J5TA 2UW9A 2RL5A 2YDIA 3AC2A 3MH1A 4FT3A 5AEPA 4A9RA 4EOPA 5FD2A 3R7VA 4ASEA 3QUDA 4EBWA 3V01A 3TTIA 3TZ9A 2QOHA 2R7IA 4DDIA 5D12A 5JGDA 4OAUC 3LAUA 1SZMA 3GC0A 2CPKE 2E9UA 1JQHA 3Q96A 2WEVA 4C4EA 3F2RA 4ZLZA 3WI6A 2R3RA 4X3JA 2J51A 3A7HA 4O82A 3AQVA 1K2PA 3AD6A 4DGMA 1MRUA 2WMXA 3VUDA 5L8LA 4QPMA 3QZIA 4YTFA 4EK5A 3DV3A 4QYHA 3V6SA 3OFMA 4KA3A 5EM5A 4NL0A 1B39A 3OROA 2UZBA 4WSYA 5E9EA 3ZM9A 5BMMA 3MPAA 1KOBA 1FMOE 4GK2A 4O0VA 3VRYA 4C62A 5E8SA 2J9MA 2E9VA 2X7FA 3I6UA 4NZWB 5H2UA 2IJMA 3RVGA 3DJ5A 2WQOA 1MQ4A 4O4EA 3SW7A 4NSTA 1X8BA 4TW9A 3QC9A 4H1JA 4HNIA 4AGCA 2XKEA 4AUAA 2WB8A 2CN5A 2VWIA 1H08A 4XCUA 4IVAA 1PXLA 4FKGA 5HNGA 3NLBA 3UTOA 2Q0BA 3FE3A 3HLLA 4QP8A 3C9WA 3WYYA 2XJ0A 2YITA 1J1BA 5E1EA 3JS2A 3ZUVA 2W5BA 5IQEA 2FYSA 2ZMDA 5DG5A 4AW0A 3GC7A 2Z60A 1P5EA 2C0TA 3F7ZA 3E8CA 4TRLA 5DR2A 4YP8A 4RQKA 2C3KA 2QG7A 1YDTE 3KCFA 2PTKA 1G8JA 2XNMA 3SXSA 1XMLA 4BCMA 5ANJA 2Y6MA 4AN9A 4CZYB 2FSMX 4XG7A 3ZEPA 3E63A 3Q4CA 2DYLA 4PDSA 3W0PA 3W33A 5AV3A 4AXDA 3V04A 2CCHA 2VWVA 4AS0A 4BGHA 4BWPA 3R2BA 5CEIA 2CGXA 3PZEA 5J9ZA 4KWPA 2JKOA 1TQPA 2C1BA 5HX8A 3EN9A 1SVEA 4BFMA 2EXMA 5EYCA 5M57A 2UUEA 3WYXA 3FKOA 2J0IA 1BL7A 5AUXA 3UQCA 3D7ZA 2A98A 4FC0A 4LOPA 5DE2A 5ANEA 3BEAA 2PZPA 3PG3A 5CS6A 1UU7A 1H1SA 1YOMA 2C3JA 4OTHA 2XKFA 3E3PA 3ZYAA 2PY3A 4ZJJA 3BRBA 2W4JA 4FBXA 5ANIA 3DXNA 4XH6A 4YNOA 3ZUTA 2B9FA 4ZSEA 4L01A 1WCCA 3N51A 4Y83A 4D0XA 5A4LA 1NXKA 4AT5A 4C0TA 3GCQA 4U40A 3R7UA 5LXMA 4NYEA 1WBPA 3GU5A 1JWHA 3TN8A 3LKMA 3P1AA 1M14A 5CEQA 4QTAA 5CX9A 5CNOA 2XK6A 4HW7A 4P4CA 3KIOC 3U6JA 1ZXEA 4FR4A 3BYOA 4JOAA 1WBNA 2W1ZA 2XNOA 5AV1A 3IK3A 3PLAE 4FL1A 4FV6A 3QZGA 3Q4TA 2ETRA 1UV5A 2A1AB 3HP2A 4WIHA 4BHNA 1P4OA 4F70A 3WZDA 1GJOA 4CEGA 4O0WA 1TFFA 4XP2A 3UDZA 4V0GB 3QCSA 2OH4A 2R3IA 3S95A 3SD0A 1Q5KA 5I3RA 4MUQA 3MY1A 2ZM4A 2X6EA 3ALNA 2OXYA 4AAYA 1Y6BA 4MBIA 1G8SA 1VYWA 5J8IA 4E6AA 4KIKB 2OZOA 3QQHA 4AOIA 2XCKA 3OEZA 4G6OA 4UWBA 3QRTA 3C13A 1PKGA 4BCFA 5BVKA 4I6BA 4ANLA 3VS6A 2BRGA 2XEZA 2BALA 4G5PA 4RC3A 3DA6A 2WOUA 5HD7A 5HI2A 4LYNA 4WKQA 3COIA 5EDPA 2QI8A 2JDOA 3FDNA 2WTWA 4LRMA 4IADA 5HCYA 3R8LA 3BELA 4DGNA 5A9UA 4XNEA 4RVLA 2W06A 4O0UA 1IAHA 1WAKA 3RZFA 4DH8A 4FVQA 3CQEA 2IZSA 2FVDA 2WQEA 4Z7GA 2B7AA 4M0ZA 2UW4A 4R3RA 1KUTA 3I81A 4FNXA 3M11A 4DEGA 4NCTC 3SGCA 1QMZA 5CF4A 4RIXB 2YJRA 3FLQA 4G6LA 5M55A 2Z2WA 3BBTB 5ICPA 3IG7A 4X2KA 2LAVA 4GJ2A 4GG5A 3DCVA 4LGHA 4R5YA 3Q4ZA 5JRSA 4EZ5A 5IEXA 5J9YA 3Q5ZA 1WBVA 4FJVA 2E2BA 5TF9A 4ASZA 4Q2AA 4RX8A 3MN3A 2F2CB 3LFNA 4MNFA 4B8MA 2XVDA 2GTMA 5DWRA 5IA1A 3AD5A 3CCNA 4FSUA 4I5PA 4MHAA 5CAUA 5K4JA 5LMBA 3HRCA 1OBDA 1W2CA 2RFNA 3L9PA 4QMYA 4GK4A 4F4PA 5L6PA 3OY3A 3ZOSA 4F64A 3CIKA 3MFTA 1ST0A 4R77A 4DGGA 3VS2A 5HLWA 1WFCA 1MUOA 3D2IA 2BUJA 4BIDA 5LVPA 4IQ6A 2J4ZA 3KXGA 4ERKA 2QHNA 5IEYA 3WZUA 1BL6A 4CQGA 2YZAA 2HOGA 4LL5A 3FMNA 1IA8A 5IDPA 3DKGA 4IZ7A 4OTRA 5E8UA 4DEEA 4Q5HA 3NAYA 5L3AA 2HZIA 4H1MA 3TACA 2W5AA 3FMLA 4GJ3A 5KX8A 5KMJA 5K3YA 3PJ8A 4LV8A 4CLJA 4RBLA 2QOOA 4RWJA 5LQFA 1WVWA 1ZZ2A 5HCXA 4D9UA 4IWDA 4Z16A 1QPCA 4J53A 3FMKA 4X7QA 3HUBA 3QGWA 2WXVA 4FV0A 3GT8A 3PY3A 2P4IA 3LFDA 2W1CA 5I9WA 4W8DA 2P33A 4IM2A 4ONAA 2GNHA 4IAZA 4FSZA 5AP2A 3HMPA 4CYJA 4NM3A 3EFWA 2XAOA 4RWIA 1PY5A 2EXEA 4JX7A 4R3CA 4LUDA 3VS7A 3ZRMA 4ANNA 1PYEA 3OW4A 3NUNA 3BCEA 3BQCA 4IXPA 3RPRA 4ZZOA 3S3IA 3HV4A 1PXOA 2OJ9A 5D7VA 3UODA 2IPXA 3EQBA 3G9NA 4RIYB 4IB1A 1SVHA 3E5AA 3TZ8A 4D4SA 4YC3A 4ZOGA 2F7XE 4LV7A 4E4NA 3W0NA 2GNJA 2UZOA 4D2PA 4BJJA 3TWJA 4AW5A 3EQHA 1QL6A 4IJ9A 2XBJA 4QD6A 3LQ5A 5IZFA 4W4YA 4PRJA 4U9AA 4EQUA 4U80A 4IVCA 4BTJA 5AP0A 2WGJA 5AADA 4D0WA 1L8TA 1T46A 2A0CX 3ERKA 4MNEB 3O7LB 4QMMA 5CQWA 3NNUA 1FVTA 4OT6A 2WEIA 3LLTA 1ZYSA 4O0SA 3VUTA 4F9BA 2Y8OA 3HGKA 4UV0A 1IEPA 2IWIA 3QZHA 3A4OX 2HELA 4WHZA 1URCA 2UZTA 2JGZ