2PK9A

Structure of the pho85-pho80 cdk-cyclin complex of the phosphate-responsive signal transduction pathway
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
295
structure length
287
Chain Sequence
FKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLSEEGTPSTAIREISLMKELKHENIVRLYDVIHNKLTLVFEFMDNDLKKYMDSRTRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent protein kinase PHO85
publication title Structure of the Pho85-Pho80 CDK-Cyclin Complex of the Phosphate-Responsive Signal Transduction Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein,transferase/cell cycle
total genus 71
structure length 287
sequence length 295
chains with identical sequence C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pk9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pk9A01
2CKQA 5AMNA 4ACMA 1NY3A 2XNGA 4W4XA 3FXXA 4E1ZA 3C4WA 3EYGA 4E26A 2GNHA 3C7QA 3DLSA 3UG1A 2ONLA 4D4YA 2OJ9A 4ZK5A 1F5QA 4DH7A 4DBNA 4U41A 4BCQA 3FSFA 3CKWA 3QYWA 4RRVA 1GY3A 4NM0A 5AAGA 3A99A 4FTAA 5HE0A 2C3IB 5A4CA 4FX3A 4YZMA 1IRKA 5AUWA 4BCNA 4F0GA 3PPJA 1J7IA 5GZ8A 2OO8X 3VBTA 4RZWA 3RNYA 3V5TA 4QP7A 3L8PA 4QYFA 2IW8A 2XNNA 2GS2A 4FK6A 1L3RE 4DLIA 4EOMA 1OPLA 3UTOA 3HL7A 1FPUA 3LCDA 4IWDA 4PMSA 4ZSEA 3L9NA 5M09A 4EK8A 1O6KA 1A48A 1R0EA 4OR5A 3W10A 3BCEA 4CLIA 4BCFA 4ZSLA 2BFXA 5IEVA 1PXPA 4IM0A 5FP6A 3Q4TA 4MBJA 4ERKA 1KV1A 4M68A 2XM9A 3FE3A 4FVRA 4F09A 5J9ZA 3TUDA 1UNLA 4ANLA 1FVVA 2XIXA 2ZB0A 3QKKA 4P5QA 2VNYA 4ZTRA 5K0KA 3KCKA 3U6IA 4UB7A 1ZOGA 4J96A 3EKKA 3H10A 1OM1A 4AA0A 2YA9A 3UNKA 5KE0A 3H30A 2XUUA 3ORMA 4QNAA 4MD9E 4RIWA 3DA6A 2UZBA 4BCKA 2JKMA 1DI9A 2HZ0A 5D7AA 4C02A 3V5JA 1NVRA 4FEXA 4PDYA 3N4VA 4BTKA 4P5ZA 1WBTA 2RF9A 4S32A 5EYDA 2BRBA 3SOAA 3V6RA 5CF8A 4FKGA 4KB8A 2R5TA 3K3IA 5J5TA 3DT1A 3TL8A 4O7TA 5CY3A 4E7WA 5LCKA 3UPXA 4DYMA 5A14A 5I0BA 3FY0A 2BHHA 3HAVA 4XG8A 3IDBA 3AC8A 3OY1A 3SXFA 2WMTA 5F20A 4IX3A 4OT5A 3H4JA 3B8RA 3SC1A 1F3MC 3R8PA 4FICA 4E4MA 5AV3A 3Q04A 3D7TA 2VTMA 3HP5A 3DB8A 4OLIA 4D55A 2CDZA 2V55A 3TEIA 1YDSE 3WIKA 4Z55A 5CX9A 1UU8A 3SGCA 3FQSA 2NNWB 3NMUF 2GNGA 1EH4A 3FQEA 1OUYA 4FI1A 1P4FA 4PQNA 3VJNA 3KXNA 5JQ5A 4RFYA 4U7ZA 4UBAA 5E8UA 4I0RA 4KIOA 5G1XA 2J0MB 4EH2A 3GQLA 1VYZA 4J99A 5EM8A 2I1MA 4OUCA 4E5AX 5CI6A 4EWQA 4UZHA 5FEEA 2XS0A 3ZUUA 5IQEA 1PMNA 3BPRA 3C4XA 4BICA 4D4SA 3IOPA 3AT2A 4YLKA 3JYAA 4FIEA 5E8YA 2YIRA 2O5KA 4D9UA 5EKOA 3HA6A 5I5ZA 5IMXA 5KUPA 3EQHA 3VF8A 5DT4A 3R02A 4JT3A 4FNYA 3R01A 4YUQA 5HU9A 2P55A 3LXPA 4BYJA 3W2RA 4J8NA 1CKIA 1LUFA 3QC9A 3T8OA 3KN5A 3PSCA 3ZM9A 3RPRA 4YP8A 4ACCA 4I3ZA 5HNBA 3GVUA 5BUJA 2BRGA 5JFSA 3F3TA 4C3PA 2IVTA 1H8FA 1YXXA 3QLGA 2JKOA 2QOKA 4AWIA 3VQUA 4BTJA 3BHYA 3KCFA 2J51A 4RIXB 4F9AA 4AA4A 5E91A 3BHVA 2YN8A 4FV4A 3F9NA 4O91A 3G6HA 1GZKA 5HG9A 1ZYDA 4DINA 4BZOA 2BR1A 3K5UA 3UVPA 2UZTA 2ETRA 2WELA 3NEWA 4BDHA 4IM2A 4O84A 1YVJA 4L01A 5C26A 3KULA 2QOHA 3RAHA 3UYTA 3A7IA 4EBWA 2J0KA 4TWNA 4O1OA 4FT0A 4MF0A 4D28A 3P08A 2O64A 4H3QA 3QRUA 4C4EA 3R9DA 2J6MA 1PY5A 2OJJA 4MCVA 3TNIA 3D4QA 4LGDA 1BLXA 2OBJA 4FSMA 4TRLA 5F1ZA 4FGRA 4YHFA 4C3FA 4IZ5A 3UNZA 4KSQA 5CZIA 4QQ5A 3SLSA 3ZSGA 1SM2A 2QOOA 4FKSA 1ZYCA 2J50A 2VWYA 3ROYA 2XKDA 4Y5HA 1DAWA 3HZTA 4FKUA 3PXRA 4USDA 1FGIA 3VBQA 3F61A 2WQOA 2NO3A 4CXAA 2WAJA 4IWOA 4C4HA 4C62A 3N9XA 3ZZWA 2WB8A 5LJJA 3VO3A 4MBLA 1SVGA 3ZC6A 2PK9A 4BCGA 4D2PA 3QQFA 3KRWA 4I0TA 2X8EA 4FV3A 4H3BA 3LFNA 4RVKA 4XBRA 3DBEA 4FT3A 5DFPA 2YDIA 3OS3A 5DE2A 3D9VA 3SD0A 5H8EA 3WYYA 5BVNA 4MNFA 5HG8A 5H9BA 3SQQA 5HESA 4EQUA 2DWBA 2VZ6A 3R1SA 5HTCA 4RWIA 3EQGA 4WOVA 1OIRA 2NPQA 2VWIA 3LVPA 3PVBA 3ZS5A 4RC4A 4QTEA 2X7GA 3DPKA 3I0QA 3LFCA 3G0FA 4M0YA 2XRWA 4H1MA 2BZHB 4O2ZA 4L8MA 4EUUA 4CKIA 5ANDA 4Y46A 3ZSHA 3CD3A 3LKMA 3ZC5A 3FL4A 3SKCA 2H9VA 4XJ0A 3UIBA 4MXZA 4RPVA 4RWKA 3HKOA 5JZNA 5C8KA 1Z5MA 2XCHA 3UQFA 3D5WA 1ZY5A 4RLKA 5CANA 5J1VA 4FEWA 3HRFA 1O9UA 4EKKA 4O7NA 4CMTA 1JKSA 3OZ6A 2C6OA 2QC6A 2B53A 2BFYA 1FOTA 4YMJA 3RBWA 5JFXA 2Y0AA 4FEUA 1H1RA 1YI3A 2IZRA 1H00A 4TNDA 4KBCA 4TL0A 4QQJA 3PIYA 5EDPA 4ZTLA 2Y6OA 4QPMA 2C3LA 3QUPA 4I5CA 3I5NA 5ETIA 3GU6A 4CFVA 5ANOA 4AZEA 4C37A 5BVKA 2UZWE 3DDPA 4TNBA 3DAEA 2UW8A 3LE6A 4GK3A 4MVFA 1CMKE 3NAYA 2OIDA 3DKGA 3FL5A 3WIGA 2WQMA 4F6SA 4CVAA 2PZPA 4KS7A 2J0IA 2IJMA 4CFUA 1M2RA 4EH8A 4BDEA 1FINA 5HZNA 4O7RA 3O51A 5EOLA 2W99B 1QCFA 2WU6A 4R3CA 2PVLA 5E92A 1URWA 3GUBA 4BCPA 5D7VA 4QMQA 4E6DA 2JD5A 2V22A 5A6OA 4O81A 4GG5A 3EYHA 4JS8A 4D2RA 4F99A 4EK3A 4JR7A 4NM3A 5IMEA 4DFYA 2R3NA 2PUUA 1S9IA 4FV9A 3UJGA 3VHKA 4D2WA 3CPCA 4EHZA 2R7IA 4X3FB 4QMMA 1YRPA 2ITNA 3W55A 3VAPA 2Y4IB 4JXFA 4DCAA 4L46A 4Z9LA 4ZTSA 4HVDA 4CG9A 4RX8A 4M69A 3PP0A 4K1BA 4YZBA 3GU8A 3R9HA 4X2GA 3LQ8A 4G6OA 5AR7A 1JVPP 1V0OA 1AD5A 3NDMA 4QTCA 4I6FA 3NYNA 4OTPA 3QHRA 4DEIA 3Q4CA 2X2LA 2C6LA 3F6XA 4IH8A 2HELA 3TV4A 4V01A 1JPAA 1Y6AA 4GRBA 3QZFA 4Q9SA 2ZMCA 4EHGA 2QOFA 4FTKA 4IB0A 3A7FA 2E9NA 3H3CA 4RVMA 3BV3A 2C30A 3UVRA 4QQTA 3NUPA 4RIYB 5A4QA 4QYGA 4ANQA 4QNYA 1XWSA 3DJ7A 5M4UA 3W1FA 5CI7A 3VRYA 3OVVA 2XKEA 4HYSA 3UBDA 3VUDA 5EYKA 5TOZA 3MDYA 2Z8CA 2EXEA 3KF4A 3FC2A 3OCSA 1BI8A 2OZAA 3QFVA 2R3RA 4UYAA 3FSKA 4FTCA 2QD9A 2PULA 1Q8YA 1YOMA 3ERKA 3P1AA 4NW5A 4BKZA 4DG3E 5DR6A 4D1ZA 2QQ7A 5EW3A 4BF2A 4M3QA 1WZYA 4F7SA 3IS5A 2O63A 2C5NA 2YEXA 3CKXA 4BC6A 4EC9A 3IK3A 3MFTA 3O50A 4RA4A 5HKMA 4RT7A 1V0BA 3AQVA 4O96A 5T3QA 3HMNA 4FG9A 3RJCA 3ZEWA 5LXMA 1DS5A 2O3PA 2C1AA 3IPHA 4XRLA 3W8LA 5IF1A 3VC4A 4LOOA 3LCSA 5DMZA 2WHBA 1YOLA 5HNIX 2X8DA 1SNXA 2UVXA 5AP3A 4A9RA 3MESA 5CTPA 3R9NA 3FHRA 2VTLA 4ACGA 3GGFA 3W33A 4QYHA 3EHAA 1OIQA 3NS9A 3QWKA 4I20A 4IM3A 1ZXEA 5ITAA 3D2KA 2QG5A 4NCTA 3W2CA 4AUAA 2LAVA 2A1AB 2BIYA 1XBBA 3SXRA 4FV8A 2F49A 4V05A 5I9XA 5A6NA 2UV2A 2F7XE 2Z02A 3DB6A 3QRKA 4EI4A 2GSFA 3HVCA 3BWFA 3TV7A 5LWNA 3O8TA 4IWPA 3ZLYA 3HRCA 3I1AA 2BRNA 3IDCA 1O6YA 3KXXA 5IEXA 3DCVA 4X3FC 4H36A 5DEWA 3LFSA 4FL1A 4AW2A 2Y4IC 3RZBA 5IU2A 1H26A 1K3AA 4RX9A 5HX6A 3Q9XA 4IB1A 1GAGA 5E7RA 4AFJA 4J1RA 3LFFA 4YURA 2PUIA 1BMKA 4B4LA 1YDRE 1PXIA 1XH6A 4RFMA 4XG7A 3QD3A 4E4NA 5AJQA 4NIFB 1U4DA 3Q2JA 4CTCA 2W96B 2OKRA 4RBLA 1DAYA 4ZXTA 5L6WL 4F9CA 4FKOA 2C6MA 2BALA 5IH5A 3P9JA 4QQCA 3GCSA 4BY9E 3UYSA 5AM7A 4RG0A 1UA2A 3QUEA 5CYIA 4QP1A 4HNFA 4DA5A 2X2MA 2YLEA 4BCIA 1M2PA 3C4CA 5EHYA 5KHWA 1O6LA 3L1SA 4FSUA 4RVLA 4IZ7A 4TWPA 3LJ1A 2VV9A 4C38A 3BYOA 1UWJA 3FPMA 4AS0A 4C61A 1PKDA 4H05A 3P7CA 1RQQA 1Q3WA 3VS7A 2BDFA 2C0IA 3ULZA 4AXAA 2VWBA 3SW7A 2JDVA 3BIZA 1MRUA 1Y8GA 2UZDA 3HGKA 3IGGA 4TY1A 3EL8A 3BQRA 4F64A 3ZONA 3HRBA 4QMNA 3LMGA 3BELA 3MS9A 1B39A 4YPDA 3EQFA 1YXVA 2A27A 4GV1A 4QYEA 3MTFA 3G2FA 1LPUA 4IC8A 1U59A 2VWZA 4O22A 5IUHA 4TXCA 3TIZA 2VWXA 4FEVA 2UZNA 3W18A 4E4LA 2O8YA 1F0QA 3A4OX 3ZEPA 2XKCA 5JKGA 4WSQA 4GYGA 5AP7A 5CSVA 5AFVA 2B1PA 2VO6A 2PMLX 2R3LA 3RMFA 3ACJA 4OTDA 5M4IA 3ZLWA 1GOLA 2PZIA 2H8HA 2R64A 4FVQA 4HOKA 4CFNA 4NTTA 5IUIA 5KNJA 4S34A 2WXVA 4M8TA 5AP6A 3MFRA 4XNEA 2UZOA 5IQGA 3C5IA 3KGAA 5CXHA 4FSQA 4C59A 5BVWA 3FLYA 4O82A 4IJPA 2ZM4A 3MFSA 3K5VA 2GQSA 5ETAA 4G1WA 4R77A 3OW3A 1MRVA 2O2UA 2W05A 3QQJA 5CVHA 4F9WA 5CAUA 2ZV9A 4Z7GA 5IQAA 4M84A 4U6RA 3VQHA 3R71A 3EN7A 5D41A 2RFEA 3BLHA 3MJ1A 2QVSE 4FKTA 5KMOA 4YJRA 4F65A 4KKEA 5DT3A 4EEVA 1GIHA 1ZYJA 5I9ZA 1UWHA 2JAVA 3WILA 3OG7A 3ZTXA 3A4PA 3DLZA 1ZYSA 3Q32A 2J0LA 5EFQA 5BNJA 2R3GA 3NIZA 3DBFA 4RLLA 3UO4A 3SHEA 5EHLA 1FVTA 5L3AA 4BBMA 5CSWA 2R3HA 3OHTA 2BVAA 4PDPA 3VUGA 1G3NA 4XP3A 3VHEA 2OH0E 2OLCA 3KREA 2CNUA 2R3KA 1NXKA 3PY1A 3AD4A 5IG1A 4NFNA 3E63A 3ENHA 4ZZOA 4I21A 2W7XA 5AX3A 2BRMA 4CFXA 4FG8A 3KVXA 4FODA 4RJ3A 2VWWA 2OXXA 4GKHA 4QMSA 2ITXA 4UWCA 4O7WA 4PX6A 4O0SA 1DM2A 4BB4A 2PTKA 4GVAA 4JBQA 5E9EA 2P2HA 3V8WA 4ANNA 3PVWA 5K0XA 5I9WA 4KA3A 2NP8A 4RGJA 4QYYA 1OL2A 1WFCA 1Q8TA 4IFCA 5F9EA 3TZ7A 4JDHA 4XOZA 3MVMA 3FAAA 3OTVA 2PL0A 2OIQA 5EHOA 5HVYA 4GU9A 4KBAA 2YAKA 3FXZA 4RFZA 2AC5A 4GH2A 4PTCA 4AGWA 3E8EA 4QMVA 1ZZ2A 3CTQA 3VS3A 5EI2A 1H1PA 5M56A 1JWHA 3HECA 3F2AA 5AIKA 3QRTA 3F82A 2HENA 2YIXA 4RC2A 4JQ7A 5HTIA 4BWPA 3RPVA 4USEA 2VX1A 3S95A 2Y6MA 2HCKA 2QOLA 3OMVA 5EYCA 4JQEA 1A06A 4YSJA 3GCVA 3T3VA 3UGCA 4D1SA 1NT2A 2BTSA 2WMVA 3MPAA 5GHVA 3KXZA 3KK9A 3VBVA 3Q96A 3EKNA 3QD0A 4MX9A 4LMUA 4GUEA 2WNTA 2J9MA 5K4JA 3ZHPC 4N4SA 5CEOA 5H2UA 5KZIA 5GZAA 5JGBA 4U80A 1OGUA 3Q6WA 2FUMA 2WIPA 2CCIA 4M0ZA 3UIMA 5TR6A 5EOBA 2OI4X 2EXMA 1E1VA 1PHKA 1ATPE 2WTWA 3AXWA 3HMPA 4FSRA 3PSBA 1YDTE 1T46A 5JFWA 4R7BA 3F88A 2ITPA 3A7JA 2PHKA 2QKRA 2XK4A 3QTXA 4U44A 2ZMDA 5FRIA 5DBXA 4NFMA 4ANBA 1QPEA 3HLLA 3CQUA 3FC1X 2EVAA 4O38A 1LR4A 5BVEA 3R7IA 3TCPA 3UP7A 3QTSA 5FG8A 5GINE 5HE3A 2WOTA 4RC3A 3GNIB 3VIDA 4PNIA 3O2MA 5TE0A 2R3OA 3VS0A 2X9EA 4DTBA 2VRXA 1B6CB 1UKIA 5M51A 5C4KA 1OZ1A 4RQKA 2X6EA 5FGKA 3QTQA 5M4CA 3UO5A 2A4LA 3II5A 2QHMA 4O21A 3QKMA 4MD8E 5HI2A 4K8AA 1I09A 3PLAE 1ND4A 2YHVA 4XV2A 3LFDA 4C35A 4I93A 3QCYA 2XH5A 4ENYA 5BMMA 4DT8A 4PP9A 1OMWA 3PE1A 3OCBA 4MQ1A 5FQDC 1Y91A 1KE5A 3F7ZA 3BI6A 2FH9A 3NNUA 1TQIA 3NX8A 2XRUA 5AV0A 1W84A 4M7IA 3V5LA 2V62A 1OITA 3OOGA 4K6ZA 4F6UA 2CNVA 3U9NA 4QP8A 3SG8A 2FO0A 2Q0NA 5KX8A 4Z16A 3KC3A 5EYMA 1OB3A 3BU5A 2X6DA 2XCKA 4ITIA 3SV0A 2QLUA 2XVDA 3WE4A 3ORPA 5JMSA 4UXQA 3PXFA 3CQEA 4YJVA 4PWNA 3VULA 3BRBA 5BVDA 5FWKK 3OEFX 4YJTA 4OTHA 2EU9A 2W9ZB 4EH7A 4C2WA 3PIXA 3R7OA 4ALUA 5IQBA 3TNHA 4QD6A 4EH5A 3L8VA 3EQIA 4O86A 2OU7A 2C5OA 4U5JA 3OCTA 3NW7A 4BDIA 2GHGA 1NW1A 4D4RA 3IW6A 5FXRA 1H1QA 3C13A 3LOKA 3DDQA 3GFEA 3D15A 4BFMA 4F7JA 5J79A 4M67A 3ZMMA 3OTUA 4PMMA 3R2YA 5TO8A 5AADA 4BBEA 2GTMA 2WZJA 1IAHA 5FD2A 3FDNA 3BX5A 3ZRLA 3KU2A 3UMXA 1H27A 5CEQA 2BHEA 4RSSA 3OXTA 3RKBA 3R9RA 4LG4A 2JKKA 2C6IA 5A4LA 3FMDA 4OBOA 2V7OA 4PRJA 3PY3A 3DK7A 1PYXA 4QP2A 3VVHA 5BUEA 2HXLA 3IQ7A 4ZS0A 2YM6A 5HIBA 2C68A 4NUSA 4QPAA 4AN9A 3D5XA 1XKKA 4WO5A 3L8XA 4E6CA 1Q8WA 5C9CA 1HCKA 1KOAA 3R63A 4U43A 2OICA 3F66A 3ORIA 4CMOA 2QOQA 4YJNA 5EW9A 5DI1A 2VN9A 4QMOA 3EN6A 4IAAA 2WEIA 4FIGA 4PTEA 5JH6A 2P4IA 4KWPA 4K77A 1WCCA 3GEQA 1OBGA 1AGWA 3S0OA 1Y57A 5AV1A 3VS1A 1W0XC 4CV8A 5AR3A 5A9UA 5K9IA 5CEKA 4ASDA 2YLFA 4RJ5A 3V8SA 3RHKA 2VAGA 1WBNA 4U0IA 3OXIA 3DXPA 4B0GA 4DTAA 2I6LA 1KSWA 4YBJA 3VS2A 1FVRA 3ET7A 2XNBA 1YXTA 1U54B 5E8TA 4AX8A 1VZOA 4L6QA 4R3PA 3VUMA 5HX8A 2ZM1A 4U9AA 4KNBA 4O1PA 3QA0A 4RIWB 5HGIA 1L8TA 3AMBA 1GZ8A 3Q5IA 3AGMA 1TQPA 4EH9A 2OGVA 4DLJA 4BGHA 3SDJA 5HVKA 4RWLA 4DH8A 1Z57A 4GKIA 2XK9A 3VBXA 4ZJVA 3D0EA 1J1CA 4BDDA 5IKWA 3RPYA 4CZTA 2CGXA 2IZTA 3EWHA 3PWDA 3R83A 4WBBB 4O0UA 3EIDA 2CNQA 4UYNA 2QKWB 5ANEA 4KSPA 5HU3A 4ZZMA 4IEBA 3FUPA 3VUHA 4MXOA 5LOHA 3CBLA 3TT0A 4QMPA 5DT0A 1RDQE 2EXCX 3L8SA 3OUNB 4AW5A 5LMKC 4ZMEA 1IEPA 4HYHA 4A7CA 4F1TA 3NVKI 5HLNA 2C0TA 3D7TB 3PP1A 3E8DA 2C6TA 2J90A 5LWMA 3JUHA 4TYJA 4ZTQA 3W2PA 4ASXA 4XG9A 3IO7A 4MTAA 4X21A 3JPVA 2GFSA 3ORNA 1WBSA 2Y7JA 5E4HA 3ZCLA 4BDKA 2CKPA 2RKUA 5IZFA 3I6UA 4H1JA 2ONLC 3P23A 4UWYA 4BRXA 4MKCA 3QHWA 4D58A 4TW9A 4L00A 4GU6A 3KRJA 3QCQA 1Q5KA 2GFCA 3DK6A 3KRRA 3Q53A 3R7UA 4D0XA 4LYNA 5C1QB 3F2NA 3GC0A 3MH2A 2YIWA 3FY2A 5EQEA 5JRQA 5AR8A 2GU8A 4YO4A 5CU4A 2W4OA 5IQFA 2QLQA 2WD1A 3F69A 4JG8A 5AUXA 3PJ8A 2BILB 1KE9A 3HV3A 4L3PA 2XBAA 3NUNA 5C27A 4ENXA 3R2BA 3UNJA 3IW5A 4IVCA 4AZSA 3F7WA 4D2SA 3MPTA 4C4IA 3FZPA 4BDGA 3AC1A 4W8DA 3LZBA 4A4LA 4XYFA 3GC7A 3DU8A 2OSCA 4QMZA 5K3YA 2Z60A 5M53A 1Q8ZA 1YI4A 4DFNA 4OTWA 1PXLA 2VTRA 3P79A 4GFGA 2GDOA 4W9WA 3TN8A 2R2PA 3FI4A 1YQJA 1Q8UA 4ALVA 2GNJA 2O65A 3QU0A 3RM7A 5JT2A 2JIVA 2WMRA 3A2CA 5G6VA 4NW6A 3MYGA 4A9YA 5JGAA 1H24A 2QU6A 2VTJA 2YACA 4GFOA 4HGLA 1CKPA 3KULB 3D83A 4XG3A 4ZAUA 1Z9XA 3AG9A 3EOCA 4YGAA 4CTBA 3NLBA 4NZWB 3HUBA 1WBWA 2VX3A 2VTHA 3MTLA 4KS8A 1JKLA 3DOGA 4DCEA 2Z7SA 3LCKA 3NUUA 1J7LA 5HOAA 2J7TA 2BROA 1ZOHA 3F5GA 3MFUA 4JQ8A 5DYJA 4I6BA 2CKEA 3GCQA 3JXWA 3VUIA 4XBUA 3I7BA 3MGYA 1NVSA 1V0PA 5IDNA 2J2IB 2GCDA 3ENMA 1FMOE 1XBCA 2F7ZE 2J5EA 2R3PA 3AT3A 5CU3A 4R78A 5CSHA 3NAXA 3E3BX 3NGAA 2RFDA 3PLSA 1UV5A 3EN9A 2UVZA 3PXYA 3E92A 1Q99A 3RZFA 5JFVA 5AEPA 3DAKA 3BHUA 4TN6A 5CSPA 5HEZA 3QKLA 3FMMA 2BKZA 2VTTA 3DZOA 3R8UA 1JQHA 1M7NA 5DNRA 5EI8A 2R0IA 5CWZA 3W8QA 4BWXA 5J7BA 5KBQA 4I5MA 1YOJA 3CXWA 3FV8A 3R8ZA 2C3JA 3D14A 3KMMA 4IANA 4WG4A 5J5SA 4K11A 4BDAA 3KXGA 5E8XA 3RWQA 3RWPA 4LOQA 4XP0A 4A06A 4A07A 4JBVA 5FXSA 3DV3A 3QC4A 3QAME 2IVSA 3ALNA 2BZIB 1TQMA 4IZYA 3TZMA 5L8KA 4IX5A 3PJ3A 2OH4A 2BPMA 2V0DA 3G90X 2YM7A 4FKIA 4WT6A 2REIA 5HD7A 4AOTA 3AMAA 3C0GA 4CYJA 5L4QA 5CZHA 4B8MA 5FBOA 4EH4A 4I4FA 4NH1A 4YR8A 3FZOA 2CJMA 3K3JA 5D9HA 2R4BA 4TTHB 3BGPA 3OXZA 4ZSJA 4AN2A 4AQCA 5IA5A 3PXZA 3RP9A 4AGUA 3TKUA 5KKRC 3DK3A 4V0GA 2C47A 3ZLSA 5KMLA 3R1YA 4C57A 4Q5HA 2HZNA 4N0SA 4DH1A 3GCPA 3GENA 2YM3A 2WU7A 3E64A 4KUJA 4PF4A 4DEHA 3Q60A 3NZ0A 4YZDA 5L2SA 2A0CX 4P4CA 5GNKA 3SX9A 1PXNA 2QI8A 4YC8A 3R7EA 2OF2A 3OF0A 4DGGA 4O7VA 3R8LA 4R5YA 2WQEA 4F1OA 5CF4A 5GZ9A 1WBVA 1YXUA 2VTIA 4QTBA 1ZAOA 5HCYA 2XNOA 4CZUA 3JVSA 3QALE 3FMKA 2IN6A 4ZTMA 2G2HA 5BYYA 4YTFA 2B9FA 3PA5A 3NPCA 2OJIA 2VD5A 5DA3A 2IPXA 4TYEA 3QCSA 4WG3A 2ZV7A 5JZJA 4GT5A 3NIEA 4KIQA 4W4YA 4MYGA 2VTSA 4CRSA 3NCZA 3HMIA 3QGYA 3VF9A 1PMEA 1IG1A 3H9FA 4UZDA 4ZSGA 3KN6A 3TTJA 3EN4A 3JR1A 1R3CA 4QMYA 4OTGA 3SA0A 5AUZA 4JX3A 3IECA 3AMYA 4A9TA 4FA2A 3LMHA 4FTLA 3VBWA 3VS5A 4CFMA 4FOBA 3RAWA 2V5QA 4MXXA 3VS6A 3GC9A 5HBJA 4LQMA 3Q5ZA 4IVBA 4M69B 3W2SA 2W1DA 3MVLA 3ATSA 4NM7A 1HCLA 1Q24A 4HCUA 3REPA 4B99A 2G2FA 2PMIA 3MW1A 3O8UA 2JC6A 1B38A 2XBJA 1R1WA 3KA0A 3H0ZA 4WG5A 4XEYA 2OF4A 4D2TA 4F4PA 4F70A 3EJ1A 1W7HA 2JITA 5LMAA 3G6GA 5F95A 3BU6A 4JDKA 4GK4A 3E62A 4YC3A 1BYGA 1H0WA 3R21A 4Q2AA 3U8WA 3ZYAA 4CYIA 3U55A 2W4JA 2PZYA 2JKQA 2QHNA 5J95A 5L2QA 4FKRA 4MD7E 4MWIA 5LVOA 2BAKA 1FMKA 2B54A 4PV0A 4G9RA 4OBQA 3C0HA 2UZLA 4YPSA 3MH0A 3JY9A 5IH6A 5C03A 3OWPA 4CFWA 4D5HA 4DH3A 3G51A 4DT9A 4IHPA 4UN0C 2OZAB 4II5A 4BCOA 4DGNA 1KWPA 4TYHA 4F1MA 3TG1A 5GJFA 3H9RA 2HY81 3MY5A 4WRGA 3RVGA 3POZA 4FV0A 4EOQA 3PRIA 2BZKB 5IA1A 2ZDTA 4LGHA 1H07A 1KE6A 4AZWA 3E8CA 4G6LA 5E1SA 2Y9QA 4M13A 4GK2A 5CENA 3UQGA 2JDRA 3ZZEA 3UG2A 2XP2A 3DBCA 4XHKB 4NSTA 4IACA 3MB7A 1YHWA 4FTRA 4NJDA 4YJOA 4AFEA 3AGLA 1KUTA 4JX7A 4JDIA 2ZDUA 1OL7A 1OPKA 2XK3A 2WQNA 5C4LA 3QTRA 4B7TA 4FK3A 2QO7A 2HY0A 3EQCA 4GIHA 3CY2A 3KKVA 2G2IA 3BGQA 4XH6A 4YHTA 5CU0A 2ETKA 3S3IA 5KHXA 4GEOA 2YIQA 4BKJA 3KEXA 4O0RA 4J95A 2JFLA 2X2KA 2YM4A 2XIZA 2NRUA 4BI0A 5LARA 1YWVA 4O0WA 5IQDA 4O7YA 5CF6A 4FKVA 5HE1A 3R7GA 4F9YA 2JBOA 1IA8A 2QO9A 2RL5A 1H1WA 4RJ7A 5CASA 4FZDB 3EFJA 4AT5A 4QMWA 4K33A 1OUKA 2YJRA 2JEDA 4FV7A 4IIRA 4R5SA 2GNIA 2ITVA 2QR8A 2PVHA 4W8EA 2BKKA 3LM5A 5HD4A 4D4VA 3DNDA 4PL4A 1QMZA 3OOMA 1CKJA 1OKVA 2UW5A 4GFMA 4LRKA 4ZJJA 4CSVA 4C4FA 3I5ZA 2XK7A 2ZV2A 2B52A 1JNKA 2I40A 3WF6A 4BDFA 3QTWA 3ZUTA 4DGLC 3SRVA 4E73A 5AM6A 2F57A 5E90A 4EOKA 4EQMA 4JIAA 4I41A 2H96A 2RG5A 3L9MA 5ACKA 3HV7A 2IZUA 2CHLA 4EYMA 1U5RA 3C4FA 2PZ5A 2X4ZA 2R0UA 4I0SA 4L53A 1OL1A 2B9JA 4ZSAA 2R3IA 4QP6A 2HIWA 3HV5A 4EJ7A 4FNXA 4S31A 2PVKA 4EOPA 2P3GX 3MWUA 3PE2A 1LEWA 2F2UA 2JDTA 4BHZA 3DFAA 4QMLA 2UW9A 2CN5A 2UW4A 5JN2A 2XF0A 4L7FA 3VUTA 2PYWA 5TKDA 2IVVA 4RX7A 4FKPA 4YJUA 3P7BA 3VW6A 3I81A 4KIPA 4ZTNA 2OIBA 4JOAA 1G5SA 5EH0A 2UUEA 3QGWA 4FYNA 4LL5A 4IAZA 3R8VA 4J98A 4UY9A 4EOOA 3NW5A 5L6OA 3WZUA 3PXQA 3LLTA 1OL6A 4FT7A 4DFLA 4D1XA 3MIYA 4LFIA 4MXCA 3EB0A 3KXHA 3P0MA 4LUEA 5HLPA 3ORTA 3ZFMA 3MVJA 1REJA 2XNMA 3PVGA 4FUXA 4ACHA 4UMRA 5EM6A 3EQRA 2JDOA 1KE7A 3OWJA 5CEMA 2B9IA 1KV2A 2WTJA 4GSBA 3V51A 1E1XA 3FZ1A 3F3VA 3GU4A 4L43A 4NU1A 3D5VA 3FI3A 4CCUA 4PTGA 5K5XA 3V5QA 4EHVA 2X81A 3L9LA 3WF5A 4MHAA 4K0YA 3RK7A 3PA3A 4KRDA 2UVYA 3FBVA 5CAVA 4ID7A 1U5QA 4PP7A 3LFEA 3KF7A 3NNWA 1HOWA 4NCTC 3MH3A 2PZRA 3C4EA 5HBHA 4PDSA 2VTOA 4WUAA 5FP5A 5EKNA 2OFUA 4YTCA 4YJQA 5JEBA 3FMJA 3ZOSA 4FE2A 1WAKA 4I5PA 4CG8A 5A3XA 4DITA 3QX2A 1S9JA 4MXAA 5CVFA 3QRJA 2XEZA 2F9GA 3QZHA 2HZIA 3NCGA 3TJCA 4WUNA 3P86A 3KQ7A 4X6QC 4NKAA 4V04A 4EWHA 3NUXA 4IVAA 4N6YA 4EK4A 5HHWA 2ITUA 1ZOEA 4CQGA 4KRCA 1X8BA 3O23A 2XMYA 3CS9A 3DQXA 5KZ0A 2FSOX 3FZTA 3BLQA 4KINA 5EDQA 2BAJA 4G5JA 3V5PA 4UMQA 3SVVA 4Q9ZA 4FV1A 5IISA 4C36A 1XO2B 4EHEA 4MNEB 3IKAA 2X9FA 4IB5A 4CCBA 2HW6A 3QZIA 2B4SB 1H1SA 4JDJA 5EG3A 4XLIA 4DC2A 2YWVA 3CTHA 5BX0A 5HTBA 5L2WA 1WVWA 3FZSA 1DI8A 5D12A 2AC3A 5FTGA 1SVHA 2CLXA 3A7HA 4E4XA 4Z7HA 1OVEA 5C8MA 3QQUA 4XUFA 4I22A 3PWYA 3AC5A 2GQRA 3GU7A 1JOWB 4AG8A 1JSVA 5IQCA 1J7UA 5AUYA 1R78A 3ROCA 5TF9A 1QPDA 2Z7RA 3R30A 3EFKA 2QURA 3EQBA 3GFWA 3RM6A 4EJNA 2GHLA 4LM5A 4IX4A 4IZAA 4X3JA 3GT8A 4HYUA 4ZLYA 4F0IA 2P2IA 3FXWA 2GS6A 4IVDA 4DAWA 2C3KA 3DNEA 1BX6A 3CEKA 3BYSA 3FLZA 1BKXA 3ZO3A 4AA5A 4RX5A 4CLJA 1G8AA 3GOKA 2KTYA 4YSMA 2ESMA 2BRHA 3E8NA 5KMNA 3FLSA 1MQ4A 1E9HA 4KIKA 3QQHA 4TPTA 4F0FA 4YU2A 2Y8OA 2YCRA 1SYKA 4GCJA 4O6EA 3CP9A 5AUVA 4ZEGA 3ZFYA 4N70A 2YDKA 4J8MA 5LVPA 4OAVB 2WMSA 2HXQA 4WNOA 2WTVA 4JBOA 5CF5A 3UZTA 2OJFE 2VTAA 2PMOX 1H08A 4S30A 4FIHA 4IDVA 4U97A 2VU3A 2WTKB 1QPJA 4FZFB 5HE2A 4BIEA 3I0OA 4DHFA 4TYGA 4TWOA 3UC4A 5AR5A 2WFYA 4FZ6A 1APME 4O0VA 5J8IA 5IA2A 1P4OA 2WPAA 3RHXA 2PUNA 3U4UA 2C69A 1Y6BA 2XA4A 3GP0A 3IW4A 1OL5A 4BGQA 5GIPE 4CNHA 2JIIA 1RE8A 3OP5A 4HNIA 3COKA 4KD1A 3IGOA 4Y95A 4FSZA 4LI5A 4DEDA 4GYIA 4IC7A 5E8ZA 2R3MA 5CU6A 2JAMA 3LXLA 3AD5A 2WMWA 3ZO2A 2CN8A 2W17A 4MWHA 2XK8A 3V04A 2I0HA 4PY1A 1FQ1B 4FZ7A 2KULA 4PDOA 3WYXA 4C33A 2W1IA 1XH7A 1ZMUA 2XJ1A 5DR9A 4IW0A 4LMNA 2QU5A 4JG6A 5KBRA 3FEGA 1I44A 4KKHA 5ANGA 2I7QA 3TDWA 3MY0A 4E3CA 3OWLA 4CD0A 2WTIA 4XG4A 3WE8A 1PXMA 5DRDA 3W16A 3PVUA 4A9UA 3HYHA 3QBNA 4DGMA 1M52A 3TIYA 3WZKA 3DGKA 4FMQA 4IAYA 5CAOA 3CTJA 4C8BA 1MUOA 4B8LA 2OZOA 5AUUA 4LOPA 1VEBA 2CPKE 4X2KA 3ULIA 4MH7A 2PMNX 2ITWA 3BU3A 2NRYA 3OWKA 4DEEA 3G33A 4QMXA 2GS7A 3R7YA 1Y8YA 3D94A 2VTQA 5I9VA 3B2WA 1WBOA 3CCNA 2W1HA 2ZYBA 2EUFB 4GG7A 4BVUA 4DGOA 2C1BA 3LAUA 3C0IA 4AP7A 1H28A 1YWNA 4IAIA 3S4QA 4U8ZA 5FBNC 3F5UA 4L7SA 1OKWA 3M11A 2EB2A 4BWKA 2YFXA 3P7AA 3FJQE 5K5NA 4DFBA 4BI1A 2CGVA 3S2PA 4I92A 5GJDA 3UODA 3RTPA 4AE9A 1JLUE 5EQPA 4FKLA 4DEGA 4YZ9A 5BUIA 5AP5A 1ERKA 1W98A 4G16A 3A8XA 4BCJA 1FBNA 3N4UA 4OBPA 3W32A 2W4KA 5AP4A 3BBWA 3QA8A 2I0VA 4ZY6A 4FKQA 3QD4A 2VTPA 3WZDA 5HQ0A 1WBPA 5M4FA 2VWVA 2RIOA 4XS2A 1CTPE 4ASZA 3TXOA 3ORKA 2CSNA 4EOJA 4QPSA 2QOBA 4J71A 4RJ6A 3RALA 2CLQA 2XKFA 4ANMA 3DZQA 5IH4A 1P2AA 2JFMA 3FQHA 4ZY5A 4NM5A 2HZ4A 2WTKC 2OFVA 3PJ1A 5AAFA 5CLPA 5EM7A 4FUYA 3U4WA 2C5VA 2VGPA 4ZLOA 1K9AA 1ZARA 3PJCA 1YWRA 4FSYA 4IWQA 4P90A 4D9TA 4DG2E 2C6KA 3TNPC 2SRCA 4GL9A 3FMHA 4QMTA 3VJOA 5AR2A 3QQKA 1YW2A 3CD8A 3NW6A 4IFGA 3RK5A 5B2LA 3GB2A 3UZRA 3KVWA 5AA8A 3BYVA 4U3YA 5BYZA 2BIKB 3PPZA 3V5WA 5AP0A 4DFZE 1OKYA 2HWPA 4G17A 3V01A 5AR4A 1URCA 4PUZA 2QNJA 3CR0A 4FTQA 4R7HA 4HGSA 5DR2A 2B7AA 2WTDA 4Y8DA 5FEQA 4F7NA 5ICPA 4JRNA 4FL2A 3FLWA 3C9WA 5FLFA 4GT3A 4GJ3A 4JJRA 2IZSA 4OT6A 5D11A 5D1JA 3V6SA 2FA2A 1FGKA 2BMCA 2C5YA 1TVOA 1U54A 4L68A 5M07A 1REKA 4KBKA 4IDTA 1GIJA 3T9TA 1PF8A 3W2QA 2E9PA 3BEAA 2I0YA 3ZLXA 2AYPA 3R8MA 5A54A 2JLDA 2R3FA 3U54A 4FSWA 3DJ5A 3VS4A 5LMBA 2JIUA 4FSNA 3QCXA 2OK1A 1PXJA 5A4TA 3DY7A 4R1YA 3S00A 2XNEA 5E8VA 5GIOE 3FKLA 3R22A 3V8TA 5IPJA 3IDPA 4LGGA 2WMQA 2G15A 1CM8A 3BBTB 3ZUVA 4RIOA 4EC8A 5J7HA 3MVHA 4LV8A 4YNEA 4B6LA 4K9YA 3LPBA 3PY0A 3QYZA 4C34A 4GW8A 3A7GA 3OT3A 5LQFA 3WBLA 3O8PA 4ZY4A 2YZLA 5IUGA 4RJ4A 3UPZA 3TDVA 1SMHA 4X0MA 3NWWA 5BMSA 4XCUA 3R00A 4TT7A 4YHJA 1CDKA 4BL1A 3DBQA 3IOKA 3P4KA 4FTIA 2FYSA 1YHVA 4FNZA 4ZTHA 2C6EA 3FLNC 3C4ZA 3D7ZA 3QZGA 1XH8A 3ZBXA 4ZMFA 1JKTA 3ZFXA 1XH4A 3PZEA 5DRBA 5ANJA 5CT7A 1BL6A 1H25A 3FI2A 1UNHA 1MQBA 1NA7A 3KRXA 4RWJA 5AX9A 2Q0BA 4HPUE 3LHJA 3RAKA 2UW0A 2Z2WA 4I94A 4EOLA 4MK0A 4R3RA 5DWRA 4LRJA 2XYNA 2RG6A 1IA9A 4DFUA 2YITA 3QTZA 5JQ8A 3NYOA 4RZVA 3VBYA 4CZYB 3TJDA 5BVFA 5M57A 4RIXA 2FVDA 2BAQA 4IAFA 4BDCA 3M2WA 4ITJA 2PSQA 2W5AA 3OCGA 5FM3A 4UMPA 3C50A 5A46A 4USFA 3PJ2A 1R0PA 4MEDA 3BHHA 3TI1A 4HVSA 3LQ5A 2J4ZA 3AT4A 2PVMA 2X7OA 3OBJA 4WHZA 4JL9A 5F94A 3RI1A 1RJBA 2BTRA 4XOYA 2CKOA 4YTHA 1JAMA 4JR3A 1VR2A 1SZMA 3H9OA 4U42A 4AZVA 3A60A 2BDWA 3FKNA 4IJ9A 5HO7A 3RINA 1TKIA 2ZVAA 3ZDUA 2PPQA 5KKRB 1KE8A 2C4GA 2PVNA 5K4IA 4M15A 3F3ZA 2G01A 2RSVA 3PRFA 4PL5A 5DIAA 4XX9A 3WZJA 4HGEA 2R9SA 1BL7A 3Q9YA 3CC6A 3TUBA 2J5FA 5CU2A 4GMYA 2YWPA 4YZCA 4UALA 2G9XA 4Q5EA 4EZ3A 5JK3A 1OIYA 1VYWA 1YI6A 3DFCB 2W5HA 1ZZLA 5GJGA 3KFAA 3E87A 4YJSA 5C01A 1T45A 4BCHA 4FKJA 4TWCA 3RGFA 1XHAA 2YISA 4L52A 5LCJA 5B2MA 3ANQA 5L8LA 5DPVA 4C4GA 5EQYA 3QQLA 2BZJA 3QQGA 4O0YA 3TKIA 3IW8A 3WF9A 1XJDA 2VTNA 3HV4A 4QTDA 5FXQA 5AP2A 2IG7A 4B9DA 4FC0A 2B9HA 4WRSA 4PL3A 2CGWA 5FDPA 1GZOA 3HEGA 3F2RA 4CV9A 3D5UA 4GT4A 4J53A 2X39A 3BE2A 2QONA 2P0CA 3GI3A 3R04A 4CEGA 4J7BA 4NT4A 3FMEA 2GPHA 4FOCA 4CMUA 4M66A 4DEAA 3P5KA 3UDBA 2YIYA 4U3ZA 2W9FB 1M2QA 3BZ3A 3I4BA 4E6AA 3EL7A 3PTGA 2UW3A 3G15A 2PUPA 4P7EA 1Q97A 2IWIA 3AOXA 4FV5A 3PXKA 4YNOA 4GIIA 4F63A 2ZOQA 4FV2A 5ANIA 3FPQA 3TV6A 3TZ8A 4F9BA 3DTWA 4HZRA 3WF7A 2YABA 3UC3A 2C5XA 1SVEA 1JSUA 2IO6A 4OTQA 5CQWA 2PVRA 1YKRA 4YLLA 4UWBA 5HO8A 2E9UA 4AACA 5BPYA 4RJ8A 1VJYA 4JAIA 3VRZA 4M12A 4PPCA 4TKSA 4R7IA 4IBMA 4ANOA 2YZAA 3QF9A 4O7ZA 4K2RA 3UOJA 3H0YA 3MB6A 4W9XA 5F4NA 1W83A 4PMTA 1GJOA 4KKGA 2XM8A 4XP2A 2RFSA 2H6DA 1V1KA 2VNWA 5HLWA 3TUCA 4R6VA 3GCUA 3ALOA 2CGUA 4XV3A 4YC6A 4KABA 4EZ7A 4PMPA 5KMKA 3ZBFA 3F5XA 4DE4A 3PZHA 4AZFA 4BDBA 4Y5QA 3V3VA 5LVLA 1M7QA 5L8JA 4FL3A 4AGCA 5DVRA 4APPA 4U45A 3C1XA 5AIRA 5ANKA 1UU9A 4HCVA 3MA6A 4C4JA 4BN1A 4D2VA 3EFLA 3LQ3A 4RMZA 4C3RA 2UW6A 3CE3A 4QO9A 4ACDA 2F4JA 4HGTA 4RQVA 3BGZA 1M14A 4WKQA 4X2FA 3ZO1A 1ZWSA 4F7LA 4FNWA 3ORXA 3OY3A 4EH6A 4BIDA 1JBPE 1PKGA 3MN3A 4FIJA 4C58A 4CT2A 5B2KA 3FYKX 4FKWA 3DS6A 4WNMA 4I1ZA 3UQCA 2WIHA 4E5WA 5J9LA 5LVNA 4BBFA 3ZU7A 3MPMA 5BQ0A 3B8QA 3UVQA 1PMVA 3HP2A 4GVJA 3IG7A 1W82A 4X3FA 1OI9A 2QOCA 3O17A 4I5HA 3OW4A 4D0WA 4DTKA 4DH5A 2XIYA 3U51A 1XR1A 1JKKA 4I24A 3PIZA 2W1FA 5B7VA 1OKZA 4EOSA 4BYIA 2HAKA 3OFMA 3QWJA 4NWMA 2QG7A 4Z3VA 3OUKA 2OWBA 2ITQA 2WKMA 4UMTA 5HG7A 2A2AA 3M42A 2PY3A 2PU8A 2Z7QA 3A61A 4OTIA 4V0GB 3VNTA 3NNXA 3ACKA 4JLCA 4CT1A 4X7QA 4C0TA 3LXNA 1WVXA 4EQCA 4HCTA 3ZXZA 3F3UA 2BUJA 4YTIA 3ZDIA 4OTRA 4ZIMA 2QR7A 3TKHA 1MP8A 4FT5A 2OXYA 3QXPA 3HAMA 4G3CA 4RIYA 3NUSA 1SNUA 3Q6UA 4O0TA 5DN3A 4C2VA 3LXKA 4E20A 3TNQB 3LJ0A 4XMOA 3NR9A 4EOIA 3RK9A 4ORKA 2IW9A 3T9IA 4AZTA 1Q3DA 3EZRA 3I6WA 2FB8A 2WEVA 1Q41A 3QTIA 3QUDA 3RNIA 3SXSA 1H01A 3E88A 3HUCA 5KMIA 3U6HA 4BGGA 3ELJA 4I23A 3R1QA 3FI8A 5HNGA 2EWAA 2OW3A 3OEZA 3POOA 1PYEA 3BKBA 3MIAA 4HVHA 2ERZE 3COHA 3FLQA 5DEYA 5HIDA 1LP4A 3ZM4A 4ZJIA 3KRLA 4EBVA 3ZSIA 5B0XA 1IASA 3CQWA 4BTMA 3GOPA 4CQEA 4MF1A 4XV1A 3G9LX 4N57A 3PG3A 3BHTA 3ORLA 2PVJA 3R0TA 5CSXA 4LRMA 5EM5A 4AT3A 3ORZA 4L3JA 2XJ2A 4E93A 3MJ2A 5AAEA 3CGFA 3OD6X 3Q9WA 4H39A 3MSSA 4QRCA 2VWUA 3CPBA 4ARKA 2R3JA 4EKLA 2IVUA 2XYUA 3TTIA 5CXZA 2X1NA 3G9NA 3Q4UA 3UMWA 3PUPA 4PPBA 5KCVA 4E5BA 3LIJA 4YJPA 4FBXA 3BWJA 3Q4ZA 3QLFA 4O2PA 4FG7A 1ZLTA 2PVFA 4AGDA 5L2IA 5L6PA 3K2LA 4BZDA 2B55A 2YJSA 1UKHA 1Q61A 3MH1A 4RVTA 5BVOA 5M08A 1A9UA 4OW8A 4JIKA 3A8WA 3NYXA 1J3HA 3RCDA 2G1TA 4OAUC 4O7SA 3NYVA 4Y72A 3LLAA 5HG5A 3BV2A 4NEUA 3FHIA 3G5DA 4KAOA 3SOCA 4O27B 2WMXA 5ETFA 3OROA 4JRVA 4LL0A 4XLVA 5H8BA 3G0EA 3VN9A 4UMUA 5HVJA 4MAOA 2P33A 4TYHB 5J1WA 3R6XA 5M06A 1UVRA 3DKFA 4FTUA 4NIFA 4I6HA 4HVIA 2CCHA 4ZS4A 2VUWA 2ERKA 3Q3BA 3QTUA 1XQZA 4AOJA 4G2FA 2WMUA 2WMAA 2E9OA 2W1GA 3AD6A 2W0JA 3FWQA 4W4WA 4WA9A 3RCJA 3PA4A 3LM0A 2HYYA 4IAKA 3KB7A 5CQUA 2PWLA 2E9VA 3R28A 3R73A 3GBZA 3WOWA 1ZY4A 2YCQA 4O6LA 3DAJA 4JAJA 3O7LD 4WNPA 1XH5A 2IW6A 3FMNA 1ZMWA 3DKCA 3QL8A 3E93A 5CEIA 4BI2A 1W8CA 1J1BA 4AN3A 1BUHA 3QX4A 5FTQA 2YCSA 4BIBA 3QXOA 3BE9A 5A4EA 4L9IA 4Y73A 2ITOA 4EONA 4U79A 1Q4LA 3CGOA 2ITYA 2XIKA 4EYJA 3N4TA 3GXLA 2E2BA 3LMIA 3FYJX 4I4EA 5DGZA 2YM8A 3BQCA 3JY0A 5IA3A 4L3LA 4BR3A 2Z7LA 4Y85A 3F3WA 4BDJA 5CNOA 2UZUE 4WNKA 2J0JA 4R1VA 3LCTA 3RPSA 4E8AA 3L9PA 4FTTA 4W4VA 2H34A 3I7CA 4LV5A 4G31A 4L44A 3E3PA 3OC1A 4HYIA 3VUKA 2C0OA 4UV0A 4FYOA 5AWMA 4AW1A 3TACA 4NYEA 2YCFA 3ITZA 4ASEA 4C7TA 3GC8A 4EH3A 3EH9A 3MA3A 1STCE 4WD5A 3T3UA 3ODYX 4DBXA 4CFFA 2W1CA 3DTCA 2WTCA 4TYIA 1AQ1A 2RFNA 4IE9A 4WIHA 5KMMA 4YZNA 4D5KA 3E7OA 1ZYLA 3CJGA 4G9CA 3UIXA 3SRVB 1OECA 2F7EE 4TZRA 3CY3A 3KL8A 3Q52A 3KMUA 3SW4A 4EUTA 5FUTA 4ANSA 4J52A 2W1EA 3JS2A 4G5PA 5E8SA 3JVRA 2F2CB 4H3PA 3LW0A 4HPTE 2PE1A 4CKJA 2O0UA 4JG7A 3THBA 1RW8A 2WO6A 4OTFA 2GTNA 5JSMA 4O83A 1PW2A 4G3DA 5D10A 4NTSA 2WMBA 2HOGA 1IR3A 5AA9A 3IW7A 5EW8A 2OG8A 2JBPA 2VO3A 4G6NA 3UOLA 5HORA 1BI7A 1LEZA 4XG6A 3UIUA 1UU3A 5AV2A 5HCZA 1H4LA 3PDTA 3ODZX 3HNGA 3UO6A 3UOHA 3LFBA 2HWOA 4FGBA 5AUTA 2VGOA 3MV5A 2FSMX 2XZSA 4AE6A 5I3OA 4IB3A 2FSTX 3A62A 1QL6A 5J87A 4EK6A 5CS6A 3BLRA 3B2TA 4G3GA 5DOSA 5HICA 5IQHA 1NVQA 4JI9A 4QP9A 2W1ZA 5I4NA 5L2TA 2WQBA 4UX9A 2X8IA 1MRYA 3ZO4A 2YDJA 3NNVA 3KY2A 4GJ2A 4NJ3A 2FSLX 4ZOGA 4DEBA 4EL9A 3DXQA 2GNLA 4HZSA 5FEDA 3NRMA 4QMUA 2ACXA 2X4FA 2DUVA 3HX4A 3RAIA 3DQWA 4BCMA 1WMKA 2GMXA 3KK8A 1WVYA 1OBDA 1Q62A 3COMA 3QRIA 4FTJA 5BYLA 2Y4PA 2YM5A 3MI9A 2AUHA 3N51A 3SG9A 3SAYA 3VW8A 3ETAA 4QP4A 4A9SA 4U81A 4H58A 4IMYA 4ZP5A 3BYUA 4FZAB 3O7LB 5EI6A 1ZMVA 3MY1A 3PPKA 4QTAA 1OPJA 3LJ2A 4NK9A 2W5BA 4U40A 3GQIA 4X2JA 5EDRA 3GU5A 4HW7A 1CSNA 2HK5A 4HVGA 1G8SA 2PVYA 4G34A 4F08A 4DFXE 3UZPA 4AAAA 5H3QA 4NL0A 2GHMA 3FMLA 3LFAA 4XG2A 1GIIA 5DG5A 3COIA 5CNNA 2ITZA 4O0XA 4BZNA 1UNGA 4WSYA 2PE0A 1PMUA 5M55A 3RPOA 4ZZNA 4LUDA 4EZ5A 4MNEA 4IXPA 2EB3A 2QOIA 3HA8A 3LCOA 4XV9A 4EK5A 4Y83A 4BKYA 3TWJA 2RGPA 2XB7A 2BCJA 2X0GA 3CLYA 4PNKA 1PXOA 3O0GA 1U46A 5E1EA 5HO6A 2ZB1A 4FR4A 2ZJWA 4OGRA 3O96A 5ETCA 2X7FA 3O71A 3NSZA 4S2ZA 4FVPA 4ZLZA 5LVMA 3OBGA 4MXYA 4AOIA 2C6DA 3HDNA 1UU7A 2ZAZA 4G3FA 2R7BA 1YHSA 4FIFA 4GUBA 4ALWA 1P5EA 3CSVA 5KMJA 4DG0E 4NKSA 4HJOA 3BEGA 2JGZA 4N6ZA 5I3RA 5I9YA 3EZVA 3TNWA 4EORA 4J97A 2BDJA 3R7VA 3ATTA 2GNFA 4E6QA 3HMMA 4FIIA 3TM0A 3WZEA 2CMWA 2OJGA 4YO6A 4ITHA 4BHNA 4G3EA 4WBOA 4IX6A 5IQIA 4BTFA 2YAAA 3C5UA 4F6WA 5IEYA 2QODA 4UEUA 1GZNA 1PRYA 3UOKA 1QPCA 3ZRKA 5CAQA 4FT9A 3EQDA 5HCXA 3M1SA 3I79A 3PG1A 2Q83A 5H8GA 2VX0A 4AW0A 3HMOA 3Q9ZA 3U6JA 3EFWA 2XK6A 4FEQA 3Q2MA 3UE4A 2B0QA 3ID6C 4K18A 4M14A 5HIEA 3K54A 3WI6A 3EQPA 5JRSA 5AV4A 3DBDA 4PPAA 4L45A 2V7AA 4APCA 3IONA 3OT8A 4AU8A 2I0EA 1XH9A 1H0VA 4MQ2A 3DXNA 4CRLA 1K2PA 1YXSA 4S33A 4UXLA 4FTOA 5CVGA 3FZRA 4XRJA 4L42A 2XIRA 3UP2A 2DS1A 2DYLA 2XNPA 2R3QA 3LFQA 4JVGA 2UW7A 4R8QA 4KIKB 4CGAA 1J91A 1P14A 2HW7A 4L67A 5J9YA 4JNWA 2VO0A 4IQ6A 4M97A 5ACBC 3S1HA 3R9OA 2DQ7X 2ITTA 2FGIA 3R1NA 4DN5A 4A4OA 1GNGA 1PJKA 5I9UA 3TZ9A 1JSTA 4QOXA 3NUYA 2JDSA 5IA0A 1KOBA 3U87A 4X6RA 3WF8A 3ZH8A 4FF8A 4JBPA 2QCSA 4ONAA 4YLJA 3C51A 5DLSA 5T6KA 3QD2B 4RA5A 2YERA 1M17A 5KO1A 3AC4A 3MBLA 3NVMB 4O7LA 4AT4A 1IAJA 4FV6A 4MBIA 5FDXA 5M44A 5JGDA 2VO7A 2QO2A 5EK7A 2OXDA 3PFQA 2WOUA 5CT0A 3CIKA 5FTOA 3ZRMA 3WARA 2XJ0A 1OIUA 2UZEA 2XEYA 3FKOA 4I6QA 3ZXTA 2ETMA 4DF3A 3I60A 5T68A 5DH3A 2A19B 1R39A 4FTNA 3F5PA 3KXMA 4P2KA 5FM2A 4A4XA 2ZM3A 4ERWA 5TT7A 3AC3A 5CALA 4FTMA 4CKRA 5CEPA 3BYMA 3KMWA 2UZVA 5DHJA 5IDPA 2WGJA 4QP3A 2PE2A 5HBEA 3E7VA 5C8NA 1XBAA 3HDMA 5IA4A 3CJFA 3AC2A 3E5AA 3P78A 3NUAA 4QT1A 5LMKA 4IADA 4X2NA 4FSTA 5CAPA 3DJ6A 3U9CA 1ZRZA 1PXKA 3EN5A 3W2OA 2W06A 2ZV8A 4GS6A 5E8WA 3ANRA 3HV6A 5AP1A 4YBKA 4AF3A 3D2IA 2GQGA 3PSDA 3PYYA 3DKOA 3VWAA 2LGCA 3EMGA
chains in the Genus database with same CATH superfamily
1G8JA 2CKQA 5AMNA 4ACMA 1NY3A 2XNGA 4W4XA 3FXXA 4E1ZA 3C4WA 3EYGA 4E26A 2GNHA 3C7QA 3DLSA 3UG1A 2ONLA 4D4YA 2OJ9A 4ZK5A 1F5QA 4DH7A 4DBNA 4U41A 4BCQA 3FSFA 3CKWA 3QYWA 4RRVA 1GY3A 4NM0A 5AAGA 3A99A 4FTAA 5HE0A 2C3IB 5A4CA 4FX3A 4YZMA 1IRKA 5AUWA 4BCNA 4F0GA 3PPJA 1J7IA 5GZ8A 2OO8X 3VBTA 4RZWA 3RNYA 3V5TA 4QP7A 3L8PA 4QYFA 2IW8A 2XNNA 2GS2A 4FK6A 1L3RE 4DLIA 4EOMA 1OPLA 3UTOA 3HL7A 1FPUA 3LCDA 4IWDA 4PMSA 4ZSEA 3L9NA 5M09A 4EK8A 1O6KA 1A48A 1R0EA 4OR5A 3W10A 3BCEA 4CLIA 4BCFA 4ZSLA 2BFXA 5IEVA 1PXPA 4IM0A 5FP6A 3Q4TA 4MBJA 4ERKA 1KV1A 4M68A 2XM9A 3FE3A 4FVRA 4F09A 5J9ZA 3TUDA 1UNLA 4ANLA 1FVVA 2XIXA 2ZB0A 3QKKA 4O4BB 4P5QA 2VNYA 4ZTRA 5K0KA 3KCKA 3U6IA 4UB7A 1ZOGA 4J96A 3EKKA 3H10A 1OM1A 4AA0A 2YA9A 3UNKA 5KE0A 3H30A 2XUUA 3ORMA 4QNAA 4MD9E 4RIWA 3DA6A 2UZBA 4BCKA 2JKMA 1DI9A 2HZ0A 5D7AA 4C02A 3V5JA 1NVRA 4FEXA 4PDYA 3N4VA 4BTKA 4P5ZA 1WBTA 2RF9A 4S32A 5EYDA 2BRBA 3SOAA 3V6RA 1XMLA 5CF8A 4FKGA 4KB8A 2R5TA 3K3IA 5J5TA 3DT1A 3TL8A 4O7TA 5CY3A 4E7WA 5LCKA 3UPXA 4DYMA 5A14A 5I0BA 3FY0A 2BHHA 3HAVA 4XG8A 3IDBA 3AC8A 3OY1A 3SXFA 2WMTA 5F20A 4IX3A 4OT5A 3H4JA 3B8RA 3SC1A 1F3MC 3R8PA 4FICA 4E4MA 5AV3A 3Q04A 3D7TA 2VTMA 3HP5A 3DB8A 4OLIA 4D55A 2CDZA 2V55A 3TEIA 1YDSE 3WIKA 4Z55A 5CX9A 1UU8A 3SGCA 3FQSA 2NNWB 3NMUF 2GNGA 1EH4A 3FQEA 1OUYA 4FI1A 1P4FA 4PQNA 3VJNA 3KXNA 5JQ5A 4RFYA 4U7ZA 4UBAA 5E8UA 4I0RA 4KIOA 5G1XA 2J0MB 4EH2A 3GQLA 1VYZA 4J99A 4LV7A 5EM8A 2I1MA 4OUCA 4E5AX 5CI6A 4EWQA 4UZHA 5FEEA 2XS0A 3ZUUA 5IQEA 1PMNA 3BPRA 3C4XA 4BICA 4D4SA 3IOPA 3AT2A 4YLKA 3JYAA 4FIEA 5E8YA 2YIRA 2O5KA 4D9UA 5EKOA 3HA6A 5I5ZA 5IMXA 5KUPA 3EQHA 3VF8A 5DT4A 3R02A 4JT3A 4FNYA 3R01A 4YUQA 5HU9A 2P55A 3LXPA 4BYJA 3W2RA 4J8NA 1CKIA 1LUFA 3QC9A 3T8OA 3KN5A 3PSCA 3ZM9A 3RPRA 4YP8A 4ACCA 4I3ZA 5HNBA 3GVUA 5BUJA 2BRGA 5JFSA 3F3TA 4C3PA 2IVTA 1H8FA 1YXXA 3QLGA 2JKOA 2QOKA 4AWIA 3VQUA 4BTJA 3BHYA 3KCFA 2J51A 4RIXB 4F9AA 4AA4A 5E91A 3BHVA 2YN8A 4FV4A 3F9NA 4O91A 3G6HA 1GZKA 5HG9A 1ZYDA 4DINA 4BZOA 2BR1A 3K5UA 3UVPA 2UZTA 2ETRA 2WELA 3NEWA 4BDHA 4IM2A 4O84A 1YVJA 4L01A 5C26A 3KULA 2QOHA 3RAHA 3UYTA 3A7IA 4EBWA 2J0KA 4TWNA 4O1OA 4FT0A 4MF0A 4D28A 3P08A 2O64A 4H3QA 3QRUA 4C4EA 3R9DA 2J6MA 1PY5A 2OJJA 4BJJA 4MCVA 3TNIA 3D4QA 4LGDA 1BLXA 2OBJA 4FSMA 4TRLA 5F1ZA 4FGRA 4YHFA 4C3FA 4IZ5A 3UNZA 4KSQA 5CZIA 4QQ5A 3SLSA 3ZSGA 1SM2A 2QOOA 4FKSA 1ZYCA 2J50A 2VWYA 3ROYA 2XKDA 4Y5HA 1DAWA 3HZTA 4FKUA 3PXRA 4USDA 1FGIA 3VBQA 3F61A 2WQOA 2NO3A 4CXAA 2WAJA 4IWOA 4C4HA 4C62A 3N9XA 3ZZWA 3W0MA 2WB8A 5LJJA 3VO3A 4MBLA 1SVGA 3ZC6A 2PK9A 4BCGA 4D2PA 3QQFA 3KRWA 4I0TA 2X8EA 4FV3A 4H3BA 3LFNA 4RVKA 4XBRA 3DBEA 4FT3A 5DFPA 2YDIA 3OS3A 5DE2A 3D9VA 3SD0A 5H8EA 3WYYA 5BVNA 4MNFA 5HG8A 5H9BA 3SQQA 5HESA 4EQUA 2DWBA 2VZ6A 3R1SA 5HTCA 4RWIA 3EQGA 4WOVA 1OIRA 2NPQA 2VWIA 3LVPA 3PVBA 3ZS5A 4RC4A 4QTEA 2X7GA 3DPKA 3I0QA 3LFCA 3G0FA 4M0YA 2XRWA 4H1MA 2BZHB 4O2ZA 4L8MA 4EUUA 4CKIA 5ANDA 4Y46A 3ZSHA 3CD3A 3LKMA 3ZC5A 3FL4A 2XAOA 3SKCA 2H9VA 4XJ0A 3UIBA 4MXZA 4RPVA 4RWKA 3HKOA 5JZNA 5C8KA 1Z5MA 2XCHA 3UQFA 3D5WA 1ZY5A 4RLKA 5CANA 5J1VA 4FEWA 3HRFA 1O9UA 4EKKA 4O7NA 4CMTA 1JKSA 3OZ6A 2C6OA 2QC6A 2B53A 2BFYA 1FOTA 4YMJA 3RBWA 5JFXA 2Y0AA 4FEUA 1H1RA 1YI3A 2IZRA 1H00A 4TNDA 4KBCA 4TL0A 4QQJA 3PIYA 5EDPA 4ZTLA 2Y6OA 4QPMA 2C3LA 3QUPA 4I5CA 3I5NA 5ETIA 3GU6A 4CFVA 5ANOA 4AZEA 4C37A 5BVKA 2UZWE 3DDPA 4TNBA 3DAEA 3AKLA 2UW8A 3LE6A 4GK3A 4MVFA 1CMKE 3NAYA 2OIDA 3DKGA 3FL5A 3WIGA 2WQMA 4F6SA 4CVAA 2PZPA 4KS7A 2J0IA 2IJMA 4CFUA 1M2RA 4EH8A 4BDEA 1FINA 5HZNA 4O7RA 3O51A 5EOLA 2W99B 1QCFA 2WU6A 4R3CA 2PVLA 5E92A 1URWA 3GUBA 4BCPA 5D7VA 4QMQA 4E6DA 2JD5A 2V22A 5A6OA 4O81A 4GG5A 3EYHA 4JS8A 4D2RA 4F99A 4EK3A 4JR7A 4NM3A 5IMEA 4DFYA 2R3NA 2PUUA 1S9IA 4FV9A 3UJGA 3VHKA 4D2WA 3CPCA 4EHZA 2R7IA 4X3FB 4QMMA 1YRPA 2ITNA 3W55A 3VAPA 2Y4IB 4JXFA 4DCAA 4L46A 4Z9LA 4ZTSA 4HVDA 4CG9A 4RX8A 4M69A 3PP0A 4K1BA 4YZBA 3GU8A 3R9HA 4X2GA 3LQ8A 4G6OA 5AR7A 1JVPP 1V0OA 1AD5A 3NDMA 4QTCA 4I6FA 3NYNA 4OTPA 3QHRA 4DEIA 3Q4CA 2X2LA 2C6LA 3F6XA 4IH8A 2HELA 3TV4A 4V01A 1JPAA 1Y6AA 4GRBA 3QZFA 4Q9SA 2ZMCA 4EHGA 2QOFA 4FTKA 4IB0A 3A7FA 2E9NA 3H3CA 4RVMA 3BV3A 2C30A 3UVRA 4QQTA 3NUPA 4RIYB 5A4QA 4QYGA 4ANQA 4QNYA 1XWSA 3DJ7A 5M4UA 3W1FA 5CI7A 3VRYA 3OVVA 3W0OA 2XKEA 4HYSA 3UBDA 3VUDA 5EYKA 5TOZA 3MDYA 2Z8CA 2EXEA 3KF4A 3FC2A 3OCSA 1BI8A 2OZAA 3QFVA 2R3RA 4UYAA 3FSKA 4FTCA 2QD9A 2PULA 1Q8YA 1YOMA 3ERKA 3P1AA 4NW5A 4BKZA 4DG3E 5DR6A 4D1ZA 2QQ7A 5EW3A 4BF2A 4M3QA 1WZYA 4F7SA 3IS5A 2O63A 2C5NA 2YEXA 3CKXA 4BC6A 4EC9A 3IK3A 3MFTA 3O50A 4RA4A 5HKMA 4RT7A 1V0BA 3AQVA 4O96A 5T3QA 3HMNA 4FG9A 3RJCA 3ZEWA 5LXMA 1DS5A 2O3PA 2C1AA 3IPHA 4XRLA 3W8LA 5IF1A 3VC4A 4LOOA 3LCSA 5DMZA 2WHBA 1YOLA 5HNIX 2X8DA 1SNXA 2UVXA 5AP3A 4A9RA 3MESA 5CTPA 3R9NA 3FHRA 2VTLA 4ACGA 3GGFA 3W33A 4QYHA 3EHAA 1OIQA 3NS9A 3QWKA 4I20A 4IM3A 1ZXEA 5ITAA 3D2KA 2QG5A 4NCTA 3W2CA 4AUAA 2LAVA 2A1AB 2BIYA 1XBBA 3SXRA 4FV8A 2F49A 4V05A 5I9XA 5A6NA 4DDIA 2UV2A 2F7XE 2Z02A 3DB6A 3QRKA 4EI4A 2GSFA 3HVCA 3BWFA 3TV7A 5LWNA 3O8TA 4IWPA 3ZLYA 3HRCA 3I1AA 2BRNA 3IDCA 1O6YA 3KXXA 5IEXA 3DCVA 4X3FC 4H36A 5DEWA 3LFSA 4FL1A 4AW2A 2Y4IC 3RZBA 5IU2A 1H26A 1K3AA 4RX9A 5HX6A 3Q9XA 4IB1A 1GAGA 5E7RA 4AFJA 4J1RA 3LFFA 4YURA 2PUIA 1BMKA 4B4LA 4DHZA 1YDRE 1PXIA 1XH6A 4RFMA 4XG7A 3QD3A 4E4NA 4AAYA 5AJQA 4NIFB 1U4DA 3Q2JA 4CTCA 2W96B 2OKRA 4RBLA 1DAYA 4ZXTA 5L6WL 4F9CA 4FKOA 2C6MA 2BALA 5IH5A 3P9JA 4QQCA 3GCSA 4BY9E 3UYSA 5AM7A 4RG0A 1UA2A 3QUEA 5CYIA 4QP1A 4HNFA 4DA5A 2X2MA 2YLEA 4BCIA 1M2PA 3C4CA 5EHYA 5KHWA 2IF8A 1O6LA 3L1SA 4FSUA 4RVLA 4IZ7A 4TWPA 3LJ1A 2VV9A 4C38A 3BYOA 1UWJA 3FPMA 4AS0A 4C61A 1PKDA 4H05A 3P7CA 1RQQA 1Q3WA 3VS7A 2BDFA 2C0IA 3ULZA 4AXAA 2VWBA 3SW7A 2JDVA 3BIZA 1MRUA 1Y8GA 2UZDA 3HGKA 3IGGA 4TY1A 3EL8A 3BQRA 4F64A 3ZONA 3HRBA 4QMNA 3LMGA 3BELA 3MS9A 1B39A 4YPDA 3EQFA 1YXVA 2A27A 4GV1A 4QYEA 3MTFA 3G2FA 1LPUA 4IC8A 1U59A 2VWZA 4O22A 5IUHA 4TXCA 3TIZA 2VWXA 4FEVA 2UZNA 3W18A 4E4LA 2O8YA 1F0QA 3A4OX 3ZEPA 2XKCA 5JKGA 4WSQA 4GYGA 3PUFC 5AP7A 5CSVA 5AFVA 2B1PA 2VO6A 2PMLX 2R3LA 3RMFA 3ACJA 4OTDA 5M4IA 3ZLWA 1GOLA 2PZIA 2H8HA 2R64A 4FVQA 4HOKA 4CFNA 4NTTA 5IUIA 5KNJA 4S34A 2WXVA 4M8TA 5AP6A 2XAMA 3MFRA 4XNEA 2UZOA 5IQGA 3C5IA 3P5JC 3KGAA 5CXHA 4FSQA 4C59A 5BVWA 3FLYA 4O82A 4IJPA 2ZM4A 3MFSA 3K5VA 2GQSA 5ETAA 4G1WA 4R77A 3OW3A 1MRVA 2O2UA 2W05A 3QQJA 5CVHA 4F9WA 5CAUA 2ZV9A 4Z7GA 5IQAA 4M84A 4U6RA 3VQHA 3R71A 3EN7A 5D41A 2RFEA 3BLHA 3MJ1A 2QVSE 4FKTA 5KMOA 4YJRA 4F65A 4KKEA 5DT3A 4EEVA 1GIHA 1ZYJA 5I9ZA 1UWHA 2JAVA 3WILA 3OG7A 3ZTXA 3A4PA 3DLZA 1ZYSA 3Q32A 2J0LA 5EFQA 5BNJA 2R3GA 3NIZA 3DBFA 4RLLA 3UO4A 3SHEA 5EHLA 1FVTA 5L3AA 4BBMA 5CSWA 2R3HA 3OHTA 2BVAA 4PDPA 3VUGA 1G3NA 4XP3A 3VHEA 2OH0E 2OLCA 3KREA 2CNUA 2R3KA 1NXKA 3PY1A 3AD4A 5IG1A 4NFNA 3E63A 3ENHA 4ZZOA 4I21A 2W7XA 5AX3A 2BRMA 4CFXA 4FG8A 3KVXA 4FODA 4RJ3A 2VWWA 2OXXA 4GKHA 4QMSA 2ITXA 4UWCA 4O7WA 4PX6A 4O0SA 1DM2A 4BB4A 2PTKA 4GVAA 4JBQA 5E9EA 2P2HA 3V8WA 4ANNA 3PVWA 5K0XA 5I9WA 4KA3A 2NP8A 4RGJA 4QYYA 1OL2A 1WFCA 1Q8TA 4IFCA 5F9EA 3TZ7A 4JDHA 4XOZA 3MVMA 3FAAA 3OTVA 2PL0A 2OIQA 5EHOA 5HVYA 4GU9A 4KBAA 2YAKA 3FXZA 4RFZA 2AC5A 4GH2A 4PTCA 4AGWA 3E8EA 4QMVA 1ZZ2A 3CTQA 3VS3A 5EI2A 1H1PA 5M56A 1JWHA 3HECA 3F2AA 5AIKA 3QRTA 3F82A 2HENA 2YIXA 4RC2A 4JQ7A 5HTIA 4BWPA 3RPVA 4USEA 2VX1A 3S95A 2Y6MA 2HCKA 2QOLA 3OMVA 5EYCA 4JQEA 1A06A 4YSJA 3GCVA 3T3VA 3UGCA 4D1SA 1NT2A 2BTSA 2WMVA 3MPAA 5GHVA 3KXZA 3KK9A 3VBVA 3Q96A 3EKNA 3QD0A 4MX9A 4LMUA 4GUEA 2WNTA 2J9MA 5K4JA 3ZHPC 4N4SA 5CEOA 5H2UA 5KZIA 5GZAA 5JGBA 4U80A 1OGUA 3Q6WA 2FUMA 2WIPA 2CCIA 4M0ZA 3UIMA 5TR6A 5EOBA 2OI4X 2EXMA 1E1VA 1PHKA 1ST0A 1ATPE 2WTWA 3AXWA 3HMPA 4FSRA 3PSBA 1YDTE 4QDEA 1T46A 5JFWA 4R7BA 3F88A 2ITPA 3A7JA 2PHKA 2QKRA 2XK4A 3QTXA 4U44A 2ZMDA 5FRIA 5DBXA 4NFMA 4ANBA 1QPEA 3HLLA 3CQUA 3FC1X 2EVAA 4O38A 1LR4A 5BVEA 3R7IA 3TCPA 3UP7A 3QTSA 5FG8A 5GINE 4I6LA 5HE3A 2WOTA 4RC3A 3GNIB 3VIDA 4PNIA 3O2MA 5TE0A 2R3OA 3VS0A 2X9EA 4DTBA 2VRXA 1B6CB 1UKIA 5M51A 5C4KA 1OZ1A 4RQKA 2X6EA 5FGKA 3QTQA 5M4CA 3UO5A 2A4LA 3II5A 2QHMA 4O21A 3QKMA 4MD8E 5HI2A 4K8AA 1I09A 3PLAE 1ND4A 2YHVA 4XV2A 3LFDA 4C35A 4I93A 3QCYA 2XH5A 4ENYA 5BMMA 4DT8A 4PP9A 1OMWA 3PE1A 3OCBA 4MQ1A 5FQDC 1Y91A 1KE5A 3F7ZA 3BI6A 2FH9A 3NNUA 1TQIA 3NX8A 2XRUA 5AV0A 1W84A 4M7IA 3V5LA 2V62A 1OITA 3OOGA 4K6ZA 4F6UA 2CNVA 3U9NA 4QP8A 3SG8A 2FO0A 2Q0NA 5KX8A 4Z16A 3KC3A 5EYMA 1OB3A 3BU5A 2X6DA 2XCKA 4ITIA 3SV0A 2QLUA 2XVDA 3WE4A 3ORPA 5JMSA 4UXQA 3PXFA 3CQEA 4YJVA 4PWNA 3VULA 3BRBA 5BVDA 5FWKK 3OEFX 4YJTA 4OTHA 2EU9A 2W9ZB 4EH7A 4C2WA 3PIXA 3R7OA 4ALUA 5IQBA 3TNHA 4QD6A 4EH5A 3L8VA 3EQIA 4O86A 2OU7A 2C5OA 4U5JA 3OCTA 3NW7A 4BDIA 2GHGA 1NW1A 4D4RA 3IW6A 5FXRA 2AEGA 4FJVA 1H1QA 3C13A 3LOKA 3DDQA 3GFEA 3D15A 4BFMA 4F7JA 5J79A 4M67A 3ZMMA 3OTUA 4PMMA 3R2YA 5TO8A 5AADA 4BBEA 2GTMA 2WZJA 1IAHA 5FD2A 3FDNA 3BX5A 3ZRLA 3KU2A 3UMXA 1H27A 5CEQA 2BHEA 4RSSA 3OXTA 3RKBA 1OGYA 2NYAA 4LG4A 2JKKA 2C6IA 5A4LA 4JMQA 3FMDA 4OBOA 2V7OA 4PRJA 4AXFA 3PY3A 3DK7A 1PYXA 4QP2A 3VVHA 5BUEA 2HXLA 3IQ7A 3UDTA 4ZS0A 2YM6A 5HIBA 2C68A 4NUSA 4QPAA 4AN9A 3W0QA 3D5XA 1XKKA 4WO5A 3L8XA 4E6CA 1Q8WA 5C9CA 1HCKA 1KOAA 3R63A 4U43A 2OICA 3F66A 3ORIA 4CMOA 2QOQA 4YJNA 5EW9A 5DI1A 2VN9A 4QMOA 3EN6A 4IAAA 2WEIA 4FIGA 4PTEA 5JH6A 2P4IA 4KWPA 4K77A 1WCCA 3GEQA 1OBGA 1AGWA 3S0OA 1Y57A 5AV1A 3VS1A 1W0XC 4CV8A 3BL7A 5AR3A 5A9UA 5K9IA 5CEKA 4ASDA 2YLFA 4RJ5A 3V8SA 3RHKA 2VAGA 1WBNA 4U0IA 3OXIA 3DXPA 4B0GA 4DTAA 2I6LA 1KSWA 4YBJA 3VS2A 1FVRA 3ET7A 2XNBA 1YXTA 1U54B 5E8TA 4AX8A 1VZOA 4L6QA 4R3PA 3VUMA 5HX8A 2ZM1A 4U9AA 4KNBA 4O1PA 3QA0A 4RIWB 5HGIA 1L8TA 3AMBA 1GZ8A 3Q5IA 3AGMA 1TQPA 4EH9A 2OGVA 4DLJA 4BGHA 3SDJA 5HVKA 4RWLA 4DH8A 1Z57A 4GKIA 2XK9A 3VBXA 4ZJVA 3D0EA 1J1CA 4BDDA 5IKWA 3RPYA 4CZTA 3NFFB 2CGXA 2IZTA 3EWHA 3PWDA 3R83A 4WBBB 4O0UA 3EIDA 2CNQA 3R9RA 4UYNA 2QKWB 5ANEA 4KSPA 5HU3A 4ZZMA 4IEBA 3FUPA 3VUHA 4MXOA 5LOHA 3CBLA 3TT0A 4QMPA 5DT0A 1RDQE 2EXCX 3L8SA 3OUNB 4AW5A 5LMKC 4ZMEA 1IEPA 4HYHA 4A7CA 4F1TA 3NVKI 5HLNA 2C0TA 2AQXA 3D7TB 3PP1A 3E8DA 2C6TA 2J90A 5LWMA 3JUHA 4TYJA 1XMMA 4ZTQA 3W2PA 4ASXA 4XG9A 3IO7A 4MTAA 4X21A 3JPVA 2GFSA 3ORNA 1WBSA 2Y7JA 5E4HA 3W0PA 3ZCLA 4BDKA 2CKPA 2RKUA 1ST4A 5IZFA 3I6UA 4H1JA 2ONLC 3P23A 4UWYA 4BRXA 4MKCA 3QHWA 4D58A 4TW9A 4L00A 4GU6A 3KRJA 3QCQA 1Q5KA 2GFCA 3DK6A 3KRRA 3Q53A 3R7UA 4D0XA 4LYNA 5C1QB 3F2NA 3GC0A 3MH2A 2YIWA 3FY2A 5EQEA 5JRQA 5AR8A 2GU8A 4YO4A 5CU4A 2W4OA 5IQFA 2QLQA 2WD1A 3F69A 4JG8A 5AUXA 3PJ8A 2BILB 1KE9A 3HV3A 4L3PA 2XBAA 3NUNA 5C27A 4ENXA 3R2BA 3UNJA 3IW5A 4IVCA 4AZSA 3F7WA 4D2SA 3MPTA 4C4IA 3FZPA 4BDGA 3AC1A 4W8DA 3LZBA 4A4LA 4XYFA 3GC7A 3DU8A 2OSCA 4QMZA 5K3YA 2Z60A 5M53A 1Q8ZA 1YI4A 4DFNA 4OTWA 1PXLA 2VTRA 3P79A 4GFGA 2GDOA 4W9WA 3TN8A 2R2PA 3FI4A 1YQJA 1Q8UA 4ALVA 2GNJA 2O65A 2X0QA 3QU0A 3RM7A 5JT2A 2JIVA 2WMRA 3A2CA 5G6VA 4NW6A 3MYGA 4A9YA 5JGAA 1H24A 2QU6A 2VTJA 2YACA 4GFOA 4HGLA 1CKPA 3KULB 3D83A 4XG3A 4ZAUA 1Z9XA 3AG9A 3EOCA 4YGAA 4CTBA 3NLBA 4NZWB 3HUBA 1WBWA 2VX3A 2VTHA 3MTLA 4KS8A 1JKLA 3DOGA 4DCEA 2Z7SA 3LCKA 3NUUA 1J7LA 5HOAA 2J7TA 2BROA 1ZOHA 3F5GA 3MFUA 4JQ8A 5DYJA 4BJJB 4I6BA 2CKEA 3GCQA 3JXWA 4O4DA 3VUIA 4XBUA 3I7BA 3MGYA 1NVSA 1V0PA 5IDNA 2J2IB 2GCDA 3ENMA 1FMOE 1XBCA 2F7ZE 2J5EA 2R3PA 3AT3A 5CU3A 4R78A 5CSHA 3NAXA 3E3BX 3NGAA 2RFDA 3PLSA 1UV5A 3EN9A 2UVZA 3PXYA 3PFYA 3E92A 1Q99A 1G8KA 3RZFA 5JFVA 5AEPA 3DAKA 3BHUA 4TN6A 5CSPA 5HEZA 3QKLA 3FMMA 2BKZA 2VTTA 3DZOA 3R8UA 1JQHA 1M7NA 5DNRA 5EI8A 2R0IA 5CWZA 2X0OA 3W8QA 4BWXA 5J7BA 5KBQA 4I5MA 1YOJA 3CXWA 3FV8A 3R8ZA 2C3JA 3D14A 3KMMA 4IANA 4WG4A 5J5SA 4K11A 4BDAA 3KXGA 5E8XA 3RWQA 3RWPA 4LOQA 4XP0A 4A06A 4A07A 4JBVA 5FXSA 3DV3A 3QC4A 3QAME 2IVSA 3ALNA 2BZIB 1TQMA 4IZYA 3TZMA 5L8KA 4IX5A 3PJ3A 2OH4A 2BPMA 2V0DA 3G90X 2YM7A 4FKIA 4WT6A 2REIA 5HD7A 4AOTA 3AMAA 3C0GA 3O5AA 4CYJA 5L4QA 5CZHA 4B8MA 5FBOA 4EH4A 4I4FA 4NH1A 4YR8A 3FZOA 3W0RA 2CJMA 3K3JA 5D9HA 2R4BA 4TTHB 3BGPA 3OXZA 4ZSJA 4AN2A 4AQCA 5IA5A 3PXZA 3RP9A 4AGUA 3TKUA 5KKRC 3NFGB 3DK3A 4V0GA 2C47A 3ZLSA 5KMLA 3R1YA 4C57A 1W2CA 4Q5HA 2HZNA 4N0SA 4DH1A 3GCPA 3GENA 2YM3A 2WU7A 3E64A 4KUJA 4PF4A 4DEHA 3Q60A 3NZ0A 4YZDA 5L2SA 2A0CX 4P4CA 5GNKA 2XALA 3SX9A 1PXNA 2QI8A 4YC8A 3R7EA 2OF2A 3OF0A 4DGGA 4O7VA 3R8LA 3W0SA 4R5YA 2WQEA 4F1OA 5CF4A 5GZ9A 1WBVA 1YXUA 2VTIA 4QTBA 1ZAOA 5HCYA 2XNOA 4CZUA 3JVSA 3QALE 3FMKA 2IN6A 4ZTMA 2G2HA 5BYYA 4YTFA 2B9FA 3PA5A 3NPCA 2OJIA 2VD5A 5DA3A 2IPXA 4TYEA 3QCSA 3AKJA 4WG3A 2ZV7A 5JZJA 4GT5A 3NIEA 4KIQA 4W4YA 2XANA 4MYGA 2VTSA 4CRSA 3NCZA 3HMIA 3QGYA 3VF9A 1PMEA 1IG1A 3H9FA 4UZDA 4ZSGA 3KN6A 3TTJA 3BLAA 3EN4A 3JR1A 1R3CA 4QMYA 4OTGA 3SA0A 5AUZA 4JX3A 3IECA 3AMYA 4A9TA 4FA2A 3LMHA 4FTLA 3VBWA 3VS5A 4CFMA 4FOBA 3RAWA 2V5QA 4MXXA 3VS6A 3GC9A 5HBJA 4AXCA 4LQMA 3Q5ZA 4IVBA 4M69B 3W2SA 2W1DA 3MVLA 3ATSA 4NM7A 1HCLA 1Q24A 4HCUA 3REPA 4B99A 2G2FA 2PMIA 3MW1A 3O8UA 2JC6A 1B38A 2XBJA 1R1WA 3KA0A 3H0ZA 4WG5A 4XEYA 2OF4A 4D2TA 4F4PA 4F70A 3EJ1A 1W7HA 2JITA 5LMAA 3G6GA 5F95A 3BU6A 4JDKA 4GK4A 3E62A 4YC3A 1BYGA 1H0WA 3R21A 4Q2AA 3U8WA 3ZYAA 4CYIA 3U55A 2W4JA 2PZYA 2JKQA 2QHNA 5J95A 5L2QA 4FKRA 4MD7E 4MWIA 5LVOA 2BAKA 1FMKA 2B54A 4PV0A 4G9RA 4OBQA 3C0HA 2UZLA 4YPSA 3MH0A 3JY9A 5IH6A 5C03A 3OWPA 4CFWA 4D5HA 4DH3A 3G51A 4DT9A 4IHPA 4UN0C 2OZAB 4II5A 4BCOA 4DGNA 3VONA 1KWPA 4TYHA 4F1MA 3TG1A 5GJFA 3H9RA 2HY81 3MY5A 4WRGA 3RVGA 3POZA 4FV0A 4EOQA 3PRIA 2BZKB 5IA1A 2ZDTA 4LGHA 1H07A 1KE6A 4AZWA 3E8CA 4G6LA 5E1SA 2Y9QA 4M13A 4GK2A 5CENA 3UQGA 2JDRA 3ZZEA 3UG2A 2XP2A 3DBCA 4DHJA 4XHKB 4NSTA 4IACA 3MB7A 1YHWA 4FTRA 4NJDA 4YJOA 4AFEA 3AGLA 1KUTA 4JX7A 4JDIA 2ZDUA 1OL7A 1OPKA 2XK3A 2WQNA 5C4LA 3QTRA 4B7TA 4FK3A 2QO7A 2HY0A 3EQCA 4GIHA 3CY2A 3KKVA 2G2IA 3BGQA 4XH6A <