2PK9A

Structure of the pho85-pho80 cdk-cyclin complex of the phosphate-responsive signal transduction pathway
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
295
structure length
287
Chain Sequence
FKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLSEEGTPSTAIREISLMKELKHENIVRLYDVIHNKLTLVFEFMDNDLKKYMDSRTRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase/cell cycle
molecule keywords Cyclin-dependent protein kinase PHO85
publication title Structure of the Pho85-Pho80 CDK-Cyclin Complex of the Phosphate-Responsive Signal Transduction Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 71
structure length 287
sequence length 295
chains with identical sequence C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pk9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pk9A01
3EN4A 4WNKA 1H25A 4K0YA 5ANKA 3E92A 1XBCA 3MA3A 4RWKA 3S2PA 3W2OA 5CEPA 4K1BA 4FIEA 3NPCA 4FZFB 5AR4A 3ATTA 1O6LA 2FH9A 2OWBA 2Y4IC 3GCPA 3F2NA 5FBNC 5FGKA 2JBOA 5H8EA 4FNYA 3ORMA 2LGCA 3CD3A 3UC3A 3EQCA 3F2RA 3UZRA 1S9IA 3QTUA 5KE0A 4TPTA 4O0TA 4X7QA 4A9YA 4UMPA 2B9IA 4B9DA 3R02A 3EQIA 5HIDA 2AC5A 5H3QA 3LFCA 4ANOA 4R5SA 4F4PA 5JK3A 2GQGA 2XKEA 4R8QA 5D1JA 2JEDA 5HCYA 5A46A 4HVIA 4PDYA 3TI1A 4PDPA 4RVTA 4BDDA 3BWFA 3U6IA 2RSVA 3E8CA 4NKAA 1JPAA 5J79A 1SVGA 4L67A 4YPDA 2CKOA 5IQCA 2VTQA 1PXNA 3NW7A 2WEVA 4FZAB 1GAGA 2ITPA 3PWDA 2W4JA 4QMWA 3LFBA 3RCDA 2O5KA 2YIWA 2BAKA 3E7VA 3KRRA 4KBAA 4C2VA 4FKWA 2I0VA 2WELA 3O51A 4F63A 4JAIA 1WBOA 4EHGA 1ZY5A 2HWOA 3RPSA 1KV2A 2KULA 3MY0A 4FSQA 5DI1A 2E2BA 2YLFA 1CKIA 3LXPA 4ZTQA 4BF2A 1FMOE 2PY3A 3NEWA 4E20A 2ITXA 5F20A 2O8YA 4QMZA 4ZJJA 2YLEA 3DK3A 4O7TA 4Y83A 3P9JA 4P7EA 4LOOA 2YEXA 3OCTA 3R8MA 2YJRA 4MXXA 3IW8A 3LMIA 2WU6A 1DM2A 3IG7A 3FY0A 1XH8A 2BFYA 3CTQA 2GNHA 4YSMA 3ZO4A 4AW5A 2IVSA 4LM5A 2ZB0A 3NIEA 3T3UA 3BYUA 4IDVA 4RZVA 5ETIA 5HNBA 4CKJA 3MH0A 1Y6BA 3VN9A 4H58A 4BKJA 3AGMA 3DFAA 4FEQA 4X2JA 3WZKA 4O84A 3UP7A 3UIMA 2IVTA 3V5WA 3P86A 4BI0A 4XOYA 1Q61A 4KABA 1XWSA 5KBRA 3KRWA 2X7GA 3DDQA 4AGDA 1OPLA 4YJTA 5C01A 2VAGA 4DF3A 3BU6A 4UN0C 2RL5A 3UGCA 3NUSA 3QCSA 4N70A 5CT0A 2CMWA 4C4IA 5JGAA 3FHRA 2WXVA 3GCVA 4FKUA 4M12A 1RQQA 5LVPA 2B0QA 1DAWA 3EQDA 5KMMA 3HUCA 4L8MA 4EC8A 1ZYLA 3PA4A 2RFDA 4XJ0A 2RIOA 1DI8A 4OW8A 3QLFA 4U97A 3TJDA 5CYIA 3ZU7A 3RMFA 4QYEA 3VBWA 2YCSA 3VRZA 3II5A 5A4EA 3IPHA 4F1MA 5AP5A 3VNTA 5KMIA 4A9SA 4NFMA 3F2AA 5KCVA 3RPRA 4PY1A 4XG2A 2JAMA 1YQJA 3IOPA 2IN6A 2UW4A 1RE8A 4FTAA 4O91A 2HXLA 1YDSE 4DFUA 1TQMA 2IW6A 3BLRA 1OB3A 3PVBA 4L7FA 2ZAZA 4DGLC 3LCTA 1JKLA 2CPKE 2C5YA 2O3PA 3ZH8A 4QMLA 4DEIA 5JGBA 5LVNA 4FTJA 4XX9A 4P2KA 4BDAA 4GS6A 4AACA 4EH9A 1OUKA 2X2KA 5ANGA 4RJ4A 5EHYA 5FTOA 4ZZOA 2W7XA 2V0DA 3AG9A 5A4TA 2YFXA 3TTIA 4EQMA 1W84A 1YI3A 3FMHA 5L8LA 4DH8A 2WMXA 4UALA 5FEDA 2X2LA 4O1OA 3V5PA 4EOQA 4FOCA 4LOPA 3LZBA 4GG7A 4AE6A 5IH5A 3BU5A 2J0IA 5FLFA 4G17A 3ZC6A 2W4OA 2RF9A 2W06A 4I0TA 1W8CA 4AOJA 4ASXA 3R7IA 3W8LA 4BDGA 4P90A 3ZDIA 3ZTXA 3GOPA 2BHHA 5A54A 3Q4ZA 4M15A 2C3KA 3QD2B 4DG2E 3CS9A 3OZ6A 4PMTA 4YBKA 3GCSA 3GQLA 4GK2A 3HRFA 4EK5A 4Z9LA 5LVOA 5HQ0A 4FKJA 3OOGA 3Q32A 2VNWA 3I81A 3VBYA 5EH0A 5H8BA 3R6XA 1OL7A 3VBQA 2OG8A 3ODZX 1CKJA 3Q04A 5L2IA 3S4QA 4IW0A 2R3NA 2YIRA 4I0RA 4YZBA 4AGWA 4RX5A 2ZM1A 5CU6A 5JZJA 3L9MA 2VO3A 5AM7A 5M4CA 1UNHA 4KRCA 5IH6A 5A14A 2GNLA 4QP1A 3NYNA 2C6MA 1T45A 4EH7A 4J95A 4RIOA 3BGZA 3D4QA 1STCE 1H26A 1IRKA 3GBZA 3K5UA 1YXSA 3DNEA 4FL3A 4L68A 4UV0A 3C4EA 4BIDA 4F08A 3AC5A 3S00A 1YI4A 2YDJA 3LJ0A 4J53A 5KKRC 4FIFA 3JPVA 3OTUA 4OTHA 4RSSA 3DKCA 1Q8UA 2PE1A 2XS0A 1R3CA 4ERWA 2W1EA 3C50A 1UU8A 3ORTA 4FTNA 1H1QA 2J5FA 3COMA 2R3IA 2V5QA 3R7GA 2CSNA 3GC0A 2X8IA 3L8VA 3PA3A 3R04A 3MH2A 3ACKA 4X2GA 4AA5A 4ALVA 4TYIA 3S0OA 2JDOA 4IWOA 3D2IA 4RT7A 5ACBC 2YM6A 4BN1A 4FTCA 4NUSA 3RK9A 4EZ5A 3NYVA 4O0RA 1ZOGA 4A9TA 2PZYA 2JIUA 2IZTA 5I9WA 5L6PA 2ZM3A 4W4XA 5HO6A 5KMLA 4D2SA 1OKWA 5DA3A 5JQ5A 2ITYA 4BDKA 3ENHA 5C8NA 5KMKA 3IOKA 3NNUA 3DLZA 3QZHA 2W1HA 4MXOA 4OGRA 3FKOA 1BI7A 3VO3A 4U42A 4F9WA 5I4NA 4FGRA 4QP9A 5DRDA 1V0PA 3BHYA 2XBJA 4GFOA 4TN6A 4GK4A 5C9CA 2YWPA 2XEZA 4S32A 4GH2A 1BMKA 4PMSA 5DT3A 4QQ5A 3CSVA 1LEWA 4FNXA 4CFWA 5KZ0A 1PMNA 3OWPA 4ASEA 4ZTMA 5JFXA 1UNGA 2UV2A 5DRBA 4EHEA 5DEWA 3V5TA 3PXZA 4FG7A 3BRBA 1WVXA 3RGFA 3O7LD 3RHXA 3TL8A 4EBWA 3W18A 3AC2A 4EOJA 4CMUA 3OVVA 4AT5A 3QGWA 4BDFA 4OAUC 3ZLSA 4BL1A 1U4DA 3WF8A 3DBFA 3R22A 4ACMA 5CEKA 1CDKA 4L46A 5CU3A 3G0FA 5DLSA 4D4VA 1YVJA 2QU6A 4I24A 4PMMA 5J87A 4F64A 5BQ0A 4RA5A 3VS2A 5LWMA 4Q5HA 3F3ZA 3H30A 4F9BA 4PP9A 3DCVA 3Q3BA 3F3WA 1ZWSA 2VTIA 1SNUA 3ORKA 2WMQA 3UZTA 2BDJA 1G3NA 3RWQA 4MTAA 2B7AA 4XYFA 2J9MA 3GCQA 5AJQA 3A7HA 4C35A 1ZMUA 3QQUA 5K5NA 1KSWA 2W1CA 3FDNA 3QRIA 5HX8A 4CGAA 3FXXA 2P0CA 4WRSA 3HDMA 2VWIA 4FX3A 4O0XA 2OJ9A 4OTDA 3F5UA 4AP7A 4BC6A 5AV4A 1XO2B 3HA8A 2W1IA 5CY3A 3BGQA 4O96A 2XB7A 4GT4A 3ZO1A 4EH3A 4QPMA 3LM0A 5H8GA 3CY3A 4ITJA 5DHJA 2UZVA 2PVLA 4NEUA 3RKBA 4QQJA 3QKLA 1H8FA 3RP9A 3VQHA 2XNPA 2VUWA 4RIYB 4U5JA 4J96A 3ZRLA 4R3PA 3PJCA 4GKHA 2HY0A 1GZOA 2BALA 2YM4A 4G9RA 4WO5A 3ZO3A 3S1HA 4QTAA 3TXOA 4O0UA 3QHWA 4D4RA 3F3UA 5IZFA 3GU7A 4RMZA 4CTCA 3PP0A 4ERKA 3D14A 2OKRA 4W4WA 2AC3A 3RPVA 4RQVA 2E9UA 2C5VA 4J97A 2EXMA 5BVKA 4J98A 4YLLA 4O86A 5AR7A 4AFEA 4I3ZA 4GYIA 3T3VA 4E6DA 3DJ6A 2HIWA 5KBQA 3P78A 4FV9A 3U6HA 1F3MC 3LQ5A 5TT7A 2XJ2A 2E9PA 4AGUA 5J9ZA 2OI4X 4I93A 4DITA 2JC6A 2UZLA 3D7TA 4MQ2A 4PTEA 3VBTA 3WOWA 3WZJA 4QPSA 3UVPA 4C8BA 2W1DA 2PVFA 3MS9A 4GU9A 3MB7A 4IQ6A 4KBCA 2ERKA 3OG7A 2C0IA 2R7IA 2B55A 5IMEA 2IVVA 2OH0E 3QCXA 4TY1A 3ORLA 3A2CA 3NUPA 4CTBA 3G15A 4M97A 3RNYA 5EOBA 4A4XA 3ODYX 4CG9A 4QNYA 3EYGA 2QOLA 3ANQA 3R8PA 4FSMA 5HIEA 4KBKA 1PXJA 2GMXA 3K3IA 3KCKA 3LCOA 5E91A 4OTIA 1U5QA 2NO3A 3LCKA 4IDTA 1EH4A 5CQUA 4LV8A 2XNNA 2BZHB 3QC4A 4LV5A 3R30A 4MD8E 3WF7A 4YHFA 3VJNA 4APPA 2GDOA 3GFWA 4NM7A 3G5DA 4H3QA 5CAPA 5HLWA 5BYLA 4D58A 2UZWE 3EN9A 3PYYA 5DYJA 5DWRA 4RJ8A 4BBMA 4OAVB 4KS7A 4XG9A 5HCZA 4GIHA 5ETFA 3PSCA 3RAWA 3VHEA 4ALUA 4QMNA 4R3CA 5AR5A 3OWKA 3FPMA 3HECA 3ORNA 4I92A 2GSFA 4LGGA 3MH1A 1L3RE 4FT7A 4MXAA 4YJOA 2ZMCA 3NIZA 3QQHA 3O71A 1H1SA 3ANRA 4QP7A 2GNJA 3P0MA 3NRMA 4YTIA 3F3TA 2PMOX 3CKWA 4RIXB 1H0VA 5KHWA 4EYMA 4XRJA 1WAKA 4JT3A 4MBIA 4G31A 4ZLYA 2WMAA 3NYOA 4EHZA 4NL0A 2C6EA 4A4LA 4OTRA 5KUPA 5TO8A 2XIYA 2CJMA 4NM5A 4JL9A 4CVAA 4W4YA 2AYPA 2W1FA 4F6SA 3UPZA 5DG5A 2ZOQA 2OZAA 3PJ3A 1OPKA 2CKQA 2YITA 2VWYA 3QQLA 5HD7A 3EL8A 4D2PA 2Z8CA 5DR2A 3AT4A 5IEVA 4EJNA 3P08A 1WVYA 2NP8A 1LPUA 4QP4A 5CQWA 5GZAA 3SXFA 4U44A 3FV8A 5DFPA 5M4IA 4FGBA 4ZMFA 2QU5A 2RFEA 4GL9A 4PQNA 1UU7A 5DEYA 5JH6A 3BHTA 4GCJA 4GYGA 2R3QA 3EQHA 3OF0A 3V51A 3ZSIA 5GJDA 5M51A 1WBTA 4HYUA 4O81A 5KZIA 2R4BA 4NH1A 4IBMA 3U4WA 3KQ7A 2BKZA 4FTKA 4UBAA 4ANNA 5ITAA 5IUIA 1PMEA 5D41A 3AQVA 4TT7A 5HVKA 1ATPE 1H4LA 2VU3A 3ALNA 4DYMA 3HGKA 3ZLYA 5DE2A 4QMXA 5D7VA 3LFQA 3ZHPC 4KIOA 3SW4A 1FGIA 2GNIA 3TUDA 4B6LA 2W5BA 3G51A 3VUMA 4YGAA 4KB8A 4LQMA 3EB0A 4QYGA 4B4LA 3IW5A 3E8NA 2C1BA 2O2UA 4USDA 2C6TA 3W10A 2YZLA 4BTMA 2JIVA 3AOXA 3V8WA 3LJ2A 4OTGA 5GJGA 5A4LA 2CGXA 2BRHA 3HV5A 3U8WA 1UWHA 3UZPA 4F9AA 4LFIA 1I44A 4FK6A 4KIKB 3OS3A 3C13A 2WU7A 3H4JA 4GV1A 4JBQA 2W99B 2VWXA 4DEDA 3DPKA 3ZFYA 5HO7A 4NJDA 2WO6A 1Q99A 2IZUA 3OEZA 4G5JA 2BRMA 1WBNA 4ZMEA 1ERKA 3SXSA 3OXTA 4V04A 4XBUA 3TKHA 5HVJA 3VS4A 1OGUA 5I3OA 2JKOA 3ZLXA 4F7NA 4R1YA 3HV6A 4RWLA 4UMQA 2CKPA 4CMOA 2BZJA 2QR8A 3KXMA 4D2TA 2J7TA 4J71A 3P1AA 3R2YA 3GU8A 1OPJA 2OFVA 3FMMA 3VUTA 5DT4A 4I6HA 5JEBA 4QMTA 4EOSA 1OIQA 3N4TA 4IZAA 4RJ5A 4EL9A 2O64A 3O0GA 2YDIA 4JQEA 5A3XA 3WIKA 3ITZA 2XCHA 3R00A 5CU4A 1ZLTA 4I21A 3BGPA 4GT3A 4LRKA 4F1TA 2B9JA 2WTDA 3WYYA 2FSTX 4IX4A 1UA2A 2OXDA 4PDSA 5K4IA 3DK7A 4J7BA 5AV3A 2I1MA 3TM0A 1GOLA 3BCEA 4MXCA 1T46A 5AMNA 3K2LA 3FLNC 2QCSA 4IE9A 3ZRKA 5HKMA 4AZEA 5CAQA 4ANLA 1O9UA 5CSWA 4R5YA 1OL1A 3M42A 3D15A 1UU3A 1PXPA 2P2HA 5I9VA 2WB8A 5HESA 1GZ8A 2REIA 1B6CB 5BVNA 3MTLA 1PMUA 2QKRA 4DH1A 3OROA 4IHPA 2W1GA 3MN3A 1YOMA 2YHVA 3RK5A 1OL6A 4EWHA 5DMZA 5HLNA 1NXKA 3SG9A 2NPQA 3QFVA 3HMNA 5HORA 3NUNA 3TWJA 4BICA 1BL7A 3QYWA 4QTCA 5BVFA 5AR3A 5EI8A 3AGLA 4MVFA 4IFGA 5E8VA 4V0GB 3QYZA 3UVQA 4YTHA 3JS2A 4E93A 3Q9XA 3FLWA 2CHLA 3VBVA 1SMHA 1YHSA 2CGUA 4FT5A 1F5QA 4M13A 3HMOA 1X8BA 3QRJA 4IH8A 5TE0A 4YO4A 5JT2A 2R3MA 3LCDA 4A9UA 4JS8A 2BR1A 4E8AA 4RLKA 4LMUA 4QT1A 3EQPA 5IQBA 4ALWA 5JMSA 1GIJA 4D4SA 2VD5A 3FE3A 5J5TA 1KV1A 1YDTE 2A2AA 4IZ5A 4C4GA 2QQ7A 2Z2WA 3NCGA 1NY3A 2VTRA 1WBVA 1OECA 3DT1A 3L8SA 4TRLA 5BVEA 1ZOHA 3R9NA 3ZO2A 3TNPC 4UMRA 4YZCA 5LMKC 5LCJA 3D7ZA 2VWVA 4QQTA 4IC8A 3I0QA 3WYXA 4EOOA 3R9OA 4MEDA 2ZDTA 4DEBA 5JN2A 4BCNA 1Y6AA 3ATSA 4DEGA 4LG4A 4PMPA 4Z7GA 2P33A 3FLSA 3PXKA 4QQCA 1MRVA 3ID6C 5C4KA 3QWJA 5HO8A 3U55A 3EQFA 4A9RA 5M4FA 4DFXE 4EK4A 3LXNA 5LARA 4QP8A 5HG8A 5CF8A 2X8DA 3SXRA 3VW8A 3SA0A 2WTCA 4PTCA 2PWLA 3C4CA 5HBEA 4CG8A 3LW0A 4BR3A 2CLXA 2B4SB 4F0GA 3WI6A 1OKVA 4APCA 1Y8YA 5L3AA 3QX2A 3IQ7A 4I22A 5HTIA 2IW9A 5GZ9A 3E7OA 2NNWB 3ULIA 3HLLA 1JAMA 4OTQA 3VC4A 5AEPA 5IEYA 1PYEA 3GCUA 3WZUA 4YR8A 4QMOA 3ZZEA 4QP6A 4ZLOA 2B52A 4HCVA 3DOGA 4QRCA 3A7FA 5AX3A 4JQ7A 4A4OA 4AA0A 2OK1A 4C36A 4UB7A 4CRSA 3ZFXA 3BIZA 3NNWA 2ZMDA 1PJKA 2JFLA 4P4CA 3VWAA 2IJMA 2F57A 3CGFA 3O23A 1ZXEA 4ORKA 4D5KA 4QO9A 2J6MA 2YISA 4BY9E 3ZXTA 4JR7A 4M67A 2BTSA 2SRCA 4N6ZA 4RVLA 3QC9A 2CNQA 3AXWA 1BKXA 3I60A 1QPDA 4ZAUA 3FEGA 3D83A 5AUVA 5HTCA 3EFWA 5J9YA 4E5BA 3THBA 3ZSHA 4CFXA 5HD4A 4ZS4A 4L3JA 5CWZA 4KAOA 4U43A 2Y0AA 5CVHA 3I0OA 5ANOA 4D28A 3RAHA 3MTFA 4YJQA 2E9NA 2PMLX 4LUDA 4JLCA 2OIBA 5HG7A 4U7ZA 2GS2A 2X7FA 3AD5A 1E1VA 2IWIA 4JQ8A 4M14A 3DV3A 3UVRA 2WD1A 4KUJA 3A99A 3NZ0A 3TUBA 1VZOA 3R7UA 1Q8WA 4G16A 3VS5A 1KE9A 1XJDA 4WUAA 4C4HA 2Y6OA 3OFMA 4I20A 4U45A 1YXTA 5EYCA 5AIRA 3UQCA 4ZK5A 1NVSA 2VRXA 2JBPA 3PIZA 4AW1A 4ZY4A 5CVGA 5L8KA 1SVEA 4U40A 4AAAA 2A27A 3EZRA 3MVHA 4FV5A 4TYHB 2HCKA 3VF9A 1ZYDA 3PVUA 3OWLA 4FV3A 3VF8A 2W5HA 2OSCA 3G90X 3BYMA 4JG7A 4L53A 3Q5IA 1DI9A 2GCDA 5HE2A 4EK3A 2OBJA 5E92A 5EG3A 5IQAA 4KIPA 1OL5A 4J1RA 4HOKA 4MWHA 5T3QA 5HGIA 4WNMA 3GOKA 3F88A 3FI8A 4YZDA 1P4OA 2R7BA 3GI3A 4CEGA 5J9LA 4DCAA 1YHVA 3L9PA 2V7AA 4KKHA 3OUNB 4LRJA 2Z60A 3SD0A 4O22A 4GVAA 2HWPA 3TNIA 3KK9A 3CY2A 4C38A 3CP9A 2UW9A 2G1TA 1W98A 4LUEA 3OT8A 2B1PA 5JFWA 4K2RA 1Y91A 3BI6A 5EDQA 2X81A 5AP1A 1SVHA 3WARA 5FD2A 3P4KA 2R3GA 2G2FA 5AUYA 3MI9A 4HNIA 4I1ZA 4E7WA 4IIRA 3IW4A 5HE0A 5IA2A 3MY5A 3ORXA 5FQDC 3LFEA 4K77A 3NVMB 2BZIB 3PFQA 4YC6A 4EUUA 4UYNA 5E7RA 4HCTA 4NT4A 4QYFA 1OKYA 1V0OA 4Y46A 1K3AA 3Q2JA 5AADA 3OHTA 2UW3A 2XBAA 4HVGA 2P2IA 3DQXA 3QZIA 4E6CA 1NVRA 3F6XA 2BHEA 3HVCA 2GNFA 3K54A 4DEHA 4JRVA 4EH6A 1BLXA 5E8TA 4FF8A 5C1QB 3HP2A 3W2RA 5JRQA 3PLAE 4HJOA 3ZLWA 4AUAA 3BLQA 3HRCA 1SNXA 3DS6A 4C3RA 5J1VA 4BWXA 2PVNA 3V8SA 4PTGA 2ZV2A 5I9UA 4O7SA 1PKDA 2ETMA 5M4UA 3KREA 2I0EA 4M66A 3QQKA 3EQRA 4BTFA 2UVYA 2HW6A 4FSWA 4BI2A 2WNTA 4BCIA 2QOIA 5HIBA 3ROCA 4AGCA 4FKIA 4CSVA 1WBSA 2OO8X 4BHNA 3B2WA 4Y5HA 4XS2A 4CT1A 2GTNA 4ZXTA 5K0KA 1XH9A 3E62A 1QL6A 1F0QA 4NJ3A 3QXPA 3IO7A 3DLSA 4FSRA 4DLJA 5JRSA 3RAIA 1BI8A 3ZCLA 4BWPA 4Z55A 4CYJA 2WTIA 1A48A 5KHXA 2Q0BA 4D55A 5M53A 4WG4A 5FWKK 4R7BA 3DBEA 4TW9A 3AC3A 3OT3A 4ACHA 5KMOA 3R9HA 4DN5A 3ENMA 4IFCA 5M55A 3R1SA 5J7BA 3ZYAA 4MAOA 1R0EA 2YAKA 4FICA 4Q9SA 4X3FC 5IISA 4FEWA 1UWJA 2PE0A 3QLGA 3ZC5A 4R78A 5HCXA 2R2PA 3QUEA 3WE8A 2UUEA 4EH8A 3FHIA 3V01A 5DH3A 1OL2A 3AT2A 3JVRA 3G9LX 2Z7SA 1CMKE 1YW2A 4RIWA 1U54A 1PHKA 5AP0A 3VULA 4IJPA 3FQHA 4O7ZA 5GIOE 4QMVA 2ITOA 3WZDA 1FVVA 3VS0A 2XJ1A 3JYAA 4D1XA 4B99A 4UWYA 5E1SA 4EH4A 1KWPA 4Q5EA 5CAOA 1KOAA 2CN8A 4NK9A 1WCCA 4MNEB 3DB6A 3GUBA 2OJFE 3GU4A 3UDBA 3B2TA 3QCQA 4HYSA 3EYHA 3U87A 3HRBA 2XNOA 1PKGA 2I6LA 4FZ7A 5HBHA 1UNLA 4XH6A 4AWIA 2PZPA 4JX3A 3COHA 1U46A 3I4BA 3NLBA 4YJRA 3GENA 5T68A 4B0GA 2BCJA 5F1ZA 3FMLA 2OW3A 3F66A 4H05A 3FZ1A 4MX9A 4OT6A 1Z57A 3BX5A 4S31A 4TTHB 3PSDA 4RZWA 4W4VA 1V1KA 3CBLA 3GC9A 3QUDA 2BMCA 4C33A 3T8OA 1FVRA 5M09A 4JAJA 4NYEA 5KMNA 4I41A 5M07A 1JKSA 3WE4A 2VN9A 5IF1A 1Z9XA 2O63A 4J52A 4ANBA 4XHKB 4EOLA 5BVDA 4FTOA 2ACXA 4HZRA 4X3JA 4UEUA 2IG7A 1UVRA 2GTMA 2ITZA 3HMMA 1RDQE 5IA3A 2G15A 4TNDA 3EN5A 5EI6A 5CAUA 2JDTA 3SW7A 2VGOA 5ANJA 4GFGA 1KE8A 2R5TA 4WHZA 3C0GA 3OCGA 3REPA 4FTIA 2ESMA 3BV3A 3VUKA 4PNIA 2OZAB 5CF6A 3W2CA 1GNGA 2J0MB 4UXQA 4H36A 4RVMA 4FKPA 4FV4A 5FRIA 5HVYA 3ET7A 3F5GA 3IW7A 5DIAA 2HXQA 4WG3A 3F7WA 3TKIA 1MRYA 1OIRA 3WF5A 3E3PA 3N4UA 1M2RA 5CEQA 2BILB 4DG3E 2UW5A 4BZNA 5BMMA 5LMKA 4UWBA 2UVXA 3RAKA 2WPAA 3FYKX 3HX4A 2I0YA 3EQGA 4JX7A 5DR9A 5HHWA 2R3KA 2GHGA 5JKGA 5HG9A 1XH7A 3UYTA 3LJ1A 2QOFA 3LFAA 2WEIA 5IU2A 4L7SA 4BDEA 5LXMA 4E5WA 3AT3A 3ZEWA 1QCFA 1OBDA 1MQ4A 3CXWA 3DTWA 2W17A 3R83A 4ENYA 4DFBA 5GZ8A 4O6EA 4QTDA 4J8NA 1J7UA 2VZ6A 2XNMA 3MYGA 4EOIA 2WMVA 3ZFMA 3U6JA 4YURA 3W2PA 3QTZA 4ITIA 4K11A 4D1ZA 4F1OA 3G0EA 4BYIA 1W7HA 4MQ1A 4FKGA 5I9YA 4BTKA 4GG5A 3ORPA 4CCBA 4FYOA 1IR3A 2O0UA 4FR4A 2FA2A 4Y85A 3FI4A 5JZNA 3Q9WA 1IASA 3QCYA 3PG3A 5EW3A 1PYXA 3AMAA 5FEQA 4EKKA 5DVRA 2R9SA 4FVPA 1Q4LA 2X6EA 2C6OA 4LMNA 3WIGA 3BPRA 1REKA 4G3CA 2QOBA 3UNZA 3V5QA 4BBEA 4EORA 3N9XA 4EZ3A 1JNKA 3EMGA 2BRGA 3HA6A 3DNDA 3FUPA 3MIYA 4ASDA 4YHJA 1P2AA 2R64A 4JDHA 4RBLA 2YWVA 3DKOA 3Q4TA 4IAIA 4IM3A 5CNNA 4FKLA 2R0IA 2F2UA 4I5MA 4I6QA 3KXHA 3CGOA 3DTCA 4N0SA 3HNGA 3VW6A 1UKIA 4NCTC 4KWPA 3ALOA 4DE4A 1BL6A 4QMMA 3LQ3A 4G2FA 1GY3A 1MUOA 3RZBA 4WBOA 2FSLX 4GUEA 4BGQA 4MXYA 2C6DA 4GJ2A 5IA5A 4O2PA 4RX9A 3MH3A 5IDPA 4GK3A 2BDWA 2Y4PA 1LR4A 3EKKA 2QOOA 4WG5A 4RVKA 4FV6A 4YU2A 2WFYA 4BBFA 5LJJA 4F7LA 3QTRA 3R21A 4FV1A 3PE1A 1XH5A 3VQUA 2FUMA 3R8LA 3U9NA 3PPZA 4MD7E 3LXLA 4C37A 5J7HA 4U3YA 4HVSA 3I5ZA 3FL4A 4QMYA 1Q5KA 1OIUA 2OU7A 3DAEA 3V3VA 1G5SA 3Q6WA 4RX7A 4S34A 3VS1A 2V22A 5KKRB 3FSKA 2CCIA 3SGCA 2H6DA 3Q52A 3ZM9A 4YMJA 2PUNA 1MQBA 1R1WA 4HPTE 3PJ1A 5IQDA 2P55A 5EFQA 5J1WA 2IVUA 4IZYA 3R9RA 3TN8A 5CEMA 5M57A 2FB8A 3QRUA 2E9OA 3UOLA 3SRVB 1RW8A 2JDSA 4B8LA 2PVYA 4HZSA 3E88A 3LFNA 4G34A 2FYSA 2V55A 4H39A 2V62A 5FXSA 4AS0A 2Z7RA 3H9OA 2XNBA 3P23A 4DGMA 1L8TA 3QUPA 2Q0NA 4F0IA 1OKZA 2WMRA 3BYVA 5EW8A 4I4EA 3EQBA 4PL4A 3KN5A 3D5WA 1M7NA 3IDCA 4II5A 3R8VA 5I5ZA 3F82A 5HNGA 4YJUA 3FXZA 3KU2A 2WZJA 1WZYA 4M69B 4NSTA 3AD6A 2KTYA 3L1SA 3QTSA 4Q2AA 3NSZA 1HCKA 2DUVA 3HMIA 3UE4A 3KULB 1JLUE 2WGJA 3QBNA 2XIKA 4GU6A 3ZUVA 1Q8YA 4DEAA 4BDHA 3AC4A 4L44A 3NUXA 1OUYA 4EOPA 3FI3A 1B38A 4ENXA 1ZZ2A 2VTNA 5EM6A 4XG6A 3A4OX 4ZTRA 4TL0A 3I7CA 4JI9A 4NIFB 2J0KA 1PY5A 4IAZA 3KC3A 3GEQA 1FINA 4XLIA 5EHLA 4K6ZA 2XRUA 4XUFA 3RI1A 4AT3A 4N57A 3RM6A 4DT9A 3EKNA 5AAEA 1NW1A 3LMHA 4AFJA 5L2WA 1B39A 1UV5A 4IVBA 3D9VA 4DGNA 5H9BA 5HX6A 3KXXA 3KB7A 5B2LA 3GGFA 2VO6A 3GNIB 3QTXA 5DGZA 3RK7A 4MHAA 3EN6A 1JQHA 4MD9E 2R3PA 3H10A 1K2PA 2PUUA 3LLTA 2XEYA 4QNAA 2YIQA 2OIDA 2X2MA 2YAAA 3QL8A 3MFUA 3MPAA 3IDPA 3QQFA 4YBJA 3DBDA 4H3PA 5IG1A 1H1PA 3NDMA 3A60A 1IG1A 2CN5A 4I0SA 4N6YA 3VUHA 2PE2A 3CTJA 2BRNA 4O38A 4ZTNA 1YWRA 2P4IA 3A8WA 4NM0A 2UZBA 2YABA 5EM7A 2GPHA 4ZTHA 2C4GA 3C0IA 5AUZA 1JBPE 1BYGA 3F5PA 3HEGA 3R8UA 5JQ8A 5HE3A 4XP0A 3BHHA 4IAFA 5LWNA 4MYGA 2PZRA 4WA9A 2B9FA 1FGKA 3A7JA 1Q97A 2GU8A 2C5NA 5IUHA 3DXQA 4IVCA 2PUIA 3PDTA 3KXGA 4FKSA 1AGWA 4AN3A 4IWDA 3QD0A 1Q8TA 4BI1A 4C58A 2YERA 4HGEA 4FMQA 4V01A 4EBVA 3DY7A 5TR6A 5IDNA 3UNKA 1ZZLA 2YCRA 2XKCA 4X6RA 5AV1A 3TT0A 1P4FA 1XBBA 4MF0A 3QD3A 5I3RA 5CVFA 3QZGA 4USFA 5FDPA 4RC4A 4YTCA 4GFMA 4ARKA 4X3FA 3FMJA 4FVQA 4JIKA 2HOGA 4PDOA 2EB3A 4RA4A 5HE1A 3T9TA 3QAME 4CZTA 5JFSA 5K4JA 3GC8A 5IH4A 2QVSE 3NW6A 3PXQA 5GNKA 1SYKA 2CLQA 5CALA 4DBXA 5AP4A 4B7TA 3OBJA 2CKEA 4FKQA 2XCKA 3PJ2A 4JBPA 5CI6A 4GRBA 4DG0E 2HZNA 3R28A 1MRUA 3VS7A 4PL3A 2JKKA 3F61A 5ANDA 3R0TA 4GT5A 3UMWA 4FL2A 5LVMA 4FV2A 2C6KA 2VTHA 5EYDA 2BDFA 4B8MA 4BB4A 5DR6A 2GHMA 2QD9A 3FMDA 1J1CA 3DDPA 2PZIA 2FVDA 2EB2A 2CGWA 3MJ2A 4HYIA 5CSVA 1M17A 2CGVA 3LAUA 3BE9A 3D94A 5F95A 3TZ8A 2CDZA 1ZAOA 3F69A 4X2NA 4BKZA 1RJBA 3BYSA 3LHJA 4IC7A 4C4JA 4NFNA 3KMUA 4F70A 5M56A 5C03A 4YUQA 4D0XA 3I6UA 3B8RA 4KIQA 2ITNA 2ZV9A 3KK8A 3VIDA 4IB0A 1R39A 4ACGA 4AU8A 5BYYA 4I94A 4D5HA 3RNIA 5IQEA 4LRMA 2X8EA 3E64A 1YDRE 3NR9A 1P5EA 5FDXA 4FSNA 3V6RA 4BIBA 4DGOA 5IQGA 5M08A 3ORIA 3IKAA 5AFVA 4KSPA 4C3PA 1PXKA 4X21A 3RVGA 1R0PA 4BDCA 2C30A 3VS3A 5HTBA 4PF4A 5E8UA 4C61A 2R3HA 3FXWA 3ROYA 3VUDA 5L2QA 2WMTA 3UOJA 3W2QA 1M2PA 2HZ4A 3JY0A 5CXZA 3KRLA 1XQZA 4KKGA 1JKKA 3OD6X 4G6LA 4BIEA 4Z16A 4RIYA 5CNOA 3PVWA 3QTWA 2XNGA 4C57A 2A19B 4BGGA 2J5EA 3CQWA 4XG3A 2HAKA 4ITHA 4O2ZA 2PTKA 3KA0A 3ZZWA 5AA9A 3ZBFA 4IZ7A 2HK5A 2BAQA 2AUHA 4LOQA 2C6LA 4R3RA 4AZTA 3BELA 3QX4A 3IONA 4O83A 3CPCA 4LGHA 4ZZMA 2VWWA 3GB2A 3Q60A 3EL7A 3UOKA 4G9CA 4BCQA 3OP5A 4EOKA 4CKIA 1KE6A 3F3VA 2Y7JA 3CEKA 5JGDA 5AP3A 4ZSEA 2VV9A 3POZA 3VBXA 4GJ3A 5TKDA 4ANQA 3C4ZA 3CPBA 2X7OA 1OIYA 2IZRA 3PRIA 4KNBA 4RJ7A 5DNRA 4G3EA 3M1SA 4E4LA 4Z7HA 4I4FA 4RX8A 4H1JA 5G1XA 1PW2A 4ZY6A 2QG7A 4H1MA 3SC1A 3KRXA 3DZQA 3QU0A 4ZTSA 1JSUA 4FZDB 2Y6MA 2VTSA 5K9IA 1IAHA 3NCZA 4NZWB 3K5VA 4D4YA 2WTKC 2JDVA 3IK3A 3OCBA 4IX6A 3HZTA 5HEZA 4K8AA 2LAVA 2EUFB 4EH5A 1SZMA 1DAYA 1WBPA 2VGPA 4QMUA 4QMQA 2PL0A 1ZYCA 4GVJA 1LEZA 3GU5A 3P7AA 4ZSAA 2VO7A 4XEYA 2BKKA 3O7LB 5HLPA 1UKHA 4FODA 4BCKA 4EEVA 4BVUA 3DBQA 4DFZE 3R7YA 1QPJA 1LP4A 3FL5A 4UZDA 5EM8A 2W0JA 3TIYA 3RHKA 4OT5A 3QKKA 5IUGA 4M7IA 3O2MA 4CCUA 2PVHA 2QHNA 3A62A 4UXLA 2JKMA 5ICPA 4L42A 4DGGA 4MH7A 2WMWA 3KN6A 5AUUA 3U4UA 1CTPE 3EHAA 2H9VA 2W05A 4LGDA 5EI2A 4E26A 2I40A 4FT9A 4C7TA 3TKUA 4RIXA 3OY3A 2R3OA 4NTTA 4WKQA 3NYXA 4CV8A 2ITUA 3TUCA 3CIKA 3KMWA 2YM8A 5L8JA 1J1BA 5CSXA 4U8ZA 1K9AA 3CLYA 3UIXA 4NCTA 5FTQA 5BVWA 3QTIA 2UZEA 5CLPA 4ONAA 3Q4CA 4X2KA 3R9DA 4ACCA 3P7BA 2XNEA 3PUPA 1FBNA 4KD1A 3ZM4A 5ANEA 1JKTA 3DK6A 1BUHA 4IMYA 2YN8A 4XG7A 1IEPA 3OXIA 2X0GA 3FI2A 3ZBXA 1TKIA 4NWMA 2PMIA 2ITWA 3UNJA 3PP1A 2OJIA 1FMKA 2H8HA 5JSMA 5M44A 3ZUTA 4MK0A 1H1WA 1IA8A 2QO2A 4XNEA 3RTPA 5HU3A 4WNOA 4IXPA 3KVXA 4XRLA 4CFVA 3ZEPA 4IEBA 3PG1A 1M14A 2XYUA 4RIWB 4XCUA 5E8ZA 2PYWA 3LFSA 2DQ7X 3O50A 3PVGA 4IVAA 1JVPP 2DYLA 4FSUA 4WD5A 2BUJA 2X4ZA 4OTFA 2FO0A 3T9IA 1JSTA 3ACJA 2A4LA 3BWJA 4L9IA 3DJ5A 4BRXA 2FSMX 3I7BA 1NT2A 2HYYA 3CC6A 3GU6A 1H27A 3KF7A 3E8EA 1G8SA 2UZNA 3VUIA 4CT2A 2BFXA 2WIPA 3NUYA 4EI4A 4C0TA 3MFTA 2Z7QA 3CJGA 4FTRA 4IAYA 4XP2A 4AQCA 3Q4UA 4AX8A 3HUBA 5DBXA 3I1AA 1DS5A 3UMXA 5C4LA 3FZRA 4FT3A 4FE2A 2ITVA 4JOAA 3PPKA 3TIZA 2UW6A 2J4ZA 4EUTA 2XF0A 3D5VA 5C26A 3SOAA 2EXCX 3WF6A 2XM8A 2P3GX 4PUZA 4YZNA 4MBJA 4C4FA 3BEGA 5FBOA 4D9UA 5FXQA 4O7VA 2XZSA 1ZOEA 3O8PA 5CF5A 4BCOA 2QOHA 4D2RA 3PY0A 5E9EA 1YI6A 3BQRA 3JVSA 3MWUA 4TYEA 3FMKA 4PX6A 4DC2A 3SG8A 4OTWA 4XP3A 3LXKA 5C27A 3FMEA 3PY3A 3Q6UA 4WOVA 4V05A 2XRWA 3CTHA 2YCFA 4FI1A 4K33A 2JD5A 5DT0A 5EK7A 1WMKA 4DTAA 4WSQA 4FSYA 2ZM4A 5E8XA 4AA4A 2PVKA 4K9YA 4P5QA 2R0UA 3VAPA 4AF3A 4D1SA 2C3IB 4ZJVA 1H01A 5BUJA 2XK9A 3MW1A 4CKRA 4ID7A 2XKFA 3OC1A 5HG5A 2J51A 5E1EA 4U9AA 4DCEA 3V6SA 3E87A 4DBNA 2RG6A 3DKGA 3MFRA 4BDBA 4IX5A 4TWPA 5AIKA 3RALA 3QTQA 2XVDA 2WQBA 1YWVA 3EFLA 4FV8A 4XV3A 3AD4A 4FZ6A 4CFMA 4HNFA 5IQIA 5EDPA 2WTVA 1Q3WA 1W82A 3R01A 4CFNA 4NM3A 3G33A 4HVDA 4QOXA 4QD6A 2VTTA 4ANSA 1PMVA 3R1NA 4D2VA 2VTPA 5CAVA 2UZDA 4DH7A 1OI9A 5T6KA 3GFEA 4FV0A 4FEUA 3OMVA 3OW3A 4I5CA 5GHVA 5EDRA 2NRUA 2XYNA 5D9HA 4FIIA 4KSQA 4CZYB 3KVWA 3NGAA 4OUCA 4PP7A 4XLVA 3BKBA 2YIYA 3HMPA 3UO5A 3HAVA 2C1AA 4CQEA 4FIGA 1VYZA 2X39A 3MVLA 1WBWA 4HGTA 2GHLA 3DJ7A 3TV6A 2Q83A 1YXUA 3EOCA 3K3JA 5D11A 3C7QA 3LFFA 4EJ7A 1E9HA 3OXZA 5DPVA 3ZUUA 4BHZA 3D5UA 2PU8A 2BVAA 3ZMMA 3H0YA 4YP8A 4F09A 4IWPA 3QA0A 1JOWB 3UIUA 3KFAA 1V0BA 3E63A 5FTGA 1PF8A 3MB6A 2WOTA 2HZ0A 4ZIMA 5LOHA 2JFMA 4U3ZA 4Y72A 3BYOA 4C3FA 3CQUA 4MXZA 3W33A 4MWIA 2Y8OA 2YJSA 1TQPA 2DWBA 1M2QA 1XKKA 1GIIA 2QOCA 3KRJA 4S30A 4TYGA 1H08A 4Y8DA 5CT7A 3MJ1A 4V0GA 1ZMWA 5KO1A 2UZTA 4F0FA 1BX6A 1H28A 4F65A 3L8PA 4F99A 1WFCA 4CFFA 1GJOA 4RFYA 4CXAA 5K0XA 1H00A 1E1XA 3E93A 3VJOA 3UO4A 4U80A 2G2IA 5CANA 3NS9A 4GSBA 3SLSA 4YC3A 4E6AA 4I5HA 4TYJA 4TZRA 3FLZA 5I0BA 4LI5A 2HENA 5BUIA 3MPMA 2OF2A 4DLIA 4U6RA 4E1ZA 1ZRZA 4BTJA 3KCFA 4BDIA 3Q96A 5FP5A 2UZOA 2YA9A 3A8XA 3V5LA 4CQGA 2PUPA 3PSBA 4GKIA 2VTLA 3QALE 3R1QA 4RRVA 4DINA 5EKNA 3QWKA 5GJFA 4JVGA 2W4KA 4UMUA 2Y4IB 4YJNA 3POOA 1YKRA 1GZNA 5K3YA 4Y5QA 5AUTA 4BCFA 1FVTA 4FA2A 3AMBA 1Q8ZA 1A9UA 1KOBA 2OJGA 4OLIA 3D7TB 3L9LA 3RJCA 4GIIA 3SOCA 4K18A 1YHWA 3VVHA 1P14A 1Y8GA 3HV3A 3PJ8A 2ZV7A 3QA8A 4EZ7A 2A1AB 2GFSA 3LLAA 3LOKA 3FY2A 3FPQA 4ZOGA 3NUUA 3TDWA 2BIYA 4BZDA 2NRYA 4AT4A 3FWQA 4CYIA 1O6YA 3WF9A 2OXXA 2WMUA 4FSZA 3KXNA 4W8EA 4AXAA 3BQCA 4F6UA 5B2MA 3RINA 4IANA 3ZDUA 4CMTA 1Q41A 4F6WA 2QHMA 3SHEA 2BTRA 3HV7A 4PRJA 5HICA 4ZJIA 4CLIA 3FC1X 4FNZA 4AOTA 3LKMA 4IAAA 4RQKA 4ASZA 4BCPA 5ANIA 5D10A 1CM8A 1W0XC 2EU9A 2JIIA 4ZSJA 4BCJA 4CV9A 4I6BA 4D9TA 4L43A 4DHFA 3LVPA 2YCQA 3BHUA 2UZUE 3PPJA 4O0SA 2FGIA 3BLHA 5EM5A 5IEXA 2JLDA 3KGAA 3TCPA 4BCGA 4OBQA 4WBBB 4I6FA 4XBRA 2JKQA 2ZJWA 2PULA 4FUYA 2GQSA 4YO6A 3UODA 3Q9ZA 4HGSA 5AM6A 3MV5A 5BNJA 3LMGA 3DKFA 3V5JA 2WQNA 3CJFA 3L8XA 2ETKA 1YOLA 2CNUA 4EK6A 1NA7A 3BBTB 2F9GA 3G6HA 4M8TA 4L6QA 1LUFA 5A4CA 4JXFA 5LCKA 3ZOSA 4D2WA 2WMSA 4ANMA 4TNBA 4E4MA 4O0YA 1OZ1A 4C4EA 1OM1A 3OTVA 5J5SA 1OVEA 2QLQA 3FKNA 3ZSGA 2UVZA 4CZUA 2IW8A 3BBWA 4R77A 5J8IA 5CI7A 4L52A 4FSTA 3F5XA 4L45A 5EYKA 2BROA 4YLJA 4GUBA 3CCNA 2XK7A 3R7OA 3BU3A 4FK3A 3MIAA 3PXYA 2YM7A 2UW7A 3DZOA 3V8TA 3RBWA 1I09A 3RZFA 3GC7A 3NWWA 4TYHA 2W9ZB 3O96A 2WQMA 4O0VA 5CX9A 4DFYA 5FP6A 4CRLA 1NVQA 2J0LA 5HOAA 2HY81 4AW2A 3H0ZA 4FTUA 3KXZA 4N4SA 3W16A 3MBLA 3C1XA 4D0WA 3W55A 3DXNA 4JBOA 3TACA 4FYNA 3O17A 4QTBA 5LVLA 2BIKB 3UTOA 3N4VA 2VX1A 2YM3A 5CEOA 2F4JA 1HCLA 3BEAA 4EOMA 3U9CA 5CS6A 2OZOA 2QLUA 4LYNA 3QGYA 4DH3A 3A61A 5ETAA 5BPYA 3GT8A 3TNQB 1OBGA 1XHAA 4PPBA 2ITTA 4E6QA 2PMNX 3H9FA 4QP2A 3JXWA 2WAJA 5FM3A 2WKMA 3MY1A 2VO0A 4X3FB 3A7IA 3ELJA 4MBLA 4NW5A 3TV7A 3M11A 3ZXZA 4YTFA 3LPBA 4ZP5A 3F9NA 5F9EA 5FUTA 3IDBA 3JY9A 2ONLC 2YM5A 4JDKA 4IX3A 5HZNA 2HW7A 3OWJA 1JWHA 4AZWA 5KNJA 3QF9A 4DFNA 5AV2A 4AN2A 1W83A 3TJCA 4RWJA 5BYZA 3R1YA 4G3GA 3TEIA 1M7QA 4O7NA 3AMYA 4AE9A 5E90A 2F49A 2PPQA 3P7CA 3FZPA 1URCA 2XK3A 3I79A 4YSJA 5KX8A 4WSYA 4XG4A 5AA8A 4RJ6A 4A7CA 1ND4A 4BFMA 4ZZNA 4R7HA 4WIHA 3SAYA 3PE2A 4QPAA 5EQYA 5CEIA 3R8ZA 5B7VA 1WVWA 2F7EE 3CQEA 1YWNA 5CZIA 5LMAA 4AG8A 4O7WA 2W96B 1ZY4A 4RFMA 4FUXA 4PL5A 3Q9YA 5LMBA 1XR1A 3H3CA 2B53A 2J50A 4OBOA 4FEVA 3GXLA 4XV9A 4EKLA 5AP2A 3HV4A 4WT6A 3UP2A 4YLKA 4E73A 3CD8A 4XMOA 3R7VA 4UYAA 4ZLZA 1QPCA 2HZIA 3KEXA 3R2BA 2XUUA 5CASA 2YDKA 4LL5A 2YIXA 4O21A 2Y9QA 5B0XA 5I9ZA 2G2HA 2CNVA 3TDVA 5A4QA 2PVMA 2OIQA 2V7OA 2X1NA 4RC3A 5IMXA 2BAJA 3LE6A 5EQEA 4FKRA 1XH6A 5IA1A 5EQPA 4WNPA 3IGOA 5B2KA 3TV4A 2R3LA 4DTBA 1ZMVA 2IO6A 4FOBA 5FM2A 1JSVA 2F7ZE 2C68A 4O82A 4JG8A 4O7YA 3QD4A 3DQWA 3FSFA 2ETRA 5JFVA 3KY2A 4G5PA 2XMYA 3I6WA 4PV0A 2ERZE 2XP2A 2J2IB 4S2ZA 1G8AA 3E8DA 4FL1A 1KE7A 3UOHA 2XIZA 3NW5A 3ETAA 4JDJA 2X6DA 1APME 2WQOA 2RGPA 2VX0A 2QNJA 3OUKA 3PIYA 1Q24A 4WUNA 4YJVA 4JIAA 4FVRA 5DOSA 2FSOX 4FC0A 4FG9A 4KRDA 4IVDA 3FLYA 3N51A 4QYHA 3L9NA 3FJQE 5F4NA 1YXVA 5BVOA 3NUAA 4I5PA 3DB8A 3WBLA 4NW6A 2VTJA 5TOZA 4E4XA 3ULZA 2OGVA 2QKWB 5ETCA 5KMJA 5EOLA 1CKPA 3TZMA 3PY1A 4Y95A 3PXFA 1ZARA 1QPEA 3PTGA 2PZ5A 4JBVA 4TWCA 5F94A 3NAYA 4W8DA 5AV0A 5A9UA 3HAMA 3PZHA 4RG0A 3MESA 4BCHA 4YNOA 2OXYA 3SDJA 4JJRA 4KINA 4TWOA 4BCMA 4DT8A 4MNEA 4O7RA 3QXOA 4O1PA 3CKXA 3FBVA 3HP5A 4J99A 3UQFA 2CCHA 1H1RA 1FOTA 4DTKA 3MVJA 2GQRA 5I9XA 3EN7A 1UU9A 3I5NA 4IM2A 4E5AX 4UWCA 4MKCA 5J95A 5HU9A 3NX8A 2C6IA 2C5XA 2OLCA 4RFZA 3LFDA 3R73A 4ZSGA 4Q9ZA 3OW4A 4BZOA 2EXEA 4IB3A 4M68A 4O0WA 1IAJA 5CENA 2PVRA 4PPAA 2BRBA 3FKLA 2QO7A 1PXIA 2A0CX 3QQJA 2PHKA 4FNWA 4FT0A 3P79A 4G6OA 4HYHA 4IJ9A 4ZY5A 2WTJA 5FXRA 1U59A 3MDYA 3R63A 4IAKA 2JDRA 2PSQA 5CU0A 4R1VA 4EK8A 2VWZA 4X2FA 4YNEA 1H0WA 1VYWA 4YHTA 3UO6A 5CSPA 2XKDA 4CNHA 4EQUA 3HKOA 3SKCA 1TVOA 4A07A 3NMUF 2GNGA 4JDIA 4EWQA 3MA6A 4UX9A 2WQEA 5HNIX 3JR1A 3AC8A 4CFUA 1H07A 3HYHA 3S95A 1TQIA 2H96A 2Z02A 4WRGA 3FZTA 4DH5A 3FZOA 4AN9A 4W9XA 5L6OA 3GQIA 3UQGA 4BGHA 1KUTA 4M0YA 5A6NA 4UMTA 3TNHA 3ZRMA 4U79A 3W2SA 3COKA 2IPXA 1YXXA 4HGLA 3O8TA 3BZ3A 2C47A 3ERKA 4J8MA 5CTPA 5E8YA 3W32A 5L4QA 4GW8A 3H9RA 4L00A 3BV2A 4YPSA 4F7SA 4M0ZA 4ZEGA 3U54A 3OOMA 1J7LA 3MSSA 3RWPA 2W5AA 2XA4A 4GEOA 5L6WL 2O65A 2EWAA 3A4PA 1IA9A 2WMBA 4YZ9A 5EKOA 5BX0A 5CXHA 3ZONA 4KA3A 4S33A 3UJGA 3P5KA 3KKVA 5AP6A 4FEXA 2VX3A 5E8SA 4W9WA 3LIJA 1URWA 2JITA 4O7LA 4ZS0A 1CSNA 2BPMA 1OITA 2VTOA 4JG6A 4PWNA 3SV0A 2OJJA 4ZTLA 4BWKA 4MF1A 3DA6A 2J90A 1YRPA 2QG5A 3R7EA 3V04A 4C02A 2C0OA 2GS7A 3DAKA 5G6VA 3FQSA 3PWYA 3GP0A 3QRKA 4MNFA 4FKOA 2C5OA 3PIXA 3S3IA 3OBGA 1J91A 1REJA 2JAVA 3IS5A 2J0JA 1XH4A 5CF4A 2ZB1A 3UIBA 4F7JA 4QYYA 3FLQA 4FTMA 2Z7LA 4E3CA 3EIDA 3IW6A 2QO9A 4IADA 4EHVA 2XIRA 4JNWA 3DBCA 4EQCA 1PXMA 3GVUA 5AX9A 3R71A 4NKSA 4PPCA 3D5XA 3DFCB 4X0MA 5E4HA 3M2WA 3KMMA 3PLSA 3SVVA 2QOQA 4IM0A 2OF4A 1VR2A 4RLLA 1YOJA 3VHKA 4O6LA 4L3LA 4BKYA 4YJSA 5AUXA 3QRTA 4FV7A 2C69A 5M06A 3WZEA 2VTMA 2X9FA 5IA4A 2HELA 4AW0A 4XG8A 5AAGA 5AR2A 3D0EA 4BDJA 1J3HA 4G3FA 4O27B 5L2SA 3NNVA 2W9FB 3CE3A 3EFJA 3RCJA 5CSHA 4ACDA 5FG8A 3AC1A 5GINE 3B8QA 1MP8A 2XM9A 4U0IA 5D7AA 3COIA 4IB5A 3C51A 4FIJA 4C2WA 4FBXA 4FIHA 1GZKA 3LQ8A 4QTEA 3QZFA 4G6NA 2R3FA 2RKUA 4A06A 4DAWA 1FPUA 3DU8A 4XOZA 3SRVA 3G9NA 1HOWA 2I0HA 3UG1A 4DFLA 4USEA 5IQFA 4M3QA 4YC8A 4U41A 3F7ZA 3QKMA 2WOUA 3RPOA 1Z5MA 4H3BA 3G6GA 5E8WA 3UPXA 4NU1A 3C5IA 1A06A 2X9EA 2XK6A 5K5XA 4PNKA 1PRYA 2QODA 2VTAA 2XIXA 3FYJX 3W1FA 4XV2A 1FQ1B 3WILA 1KE5A 5H2UA 5ACKA 5AWMA 3C4FA 3FQEA 4Y73A 3D2KA 3W8QA 2OICA 1AQ1A 2VWBA 4HPUE 4M69A 3EJ1A 4HVHA 2OFUA 3MGYA 2R3RA 2EVAA 1O6KA 2F2CB 4F9YA 2PVJA 4AOIA 2UW8A 3KULA 4HCUA 4RJ3A 4KKEA 3Q2MA 2ONLA 4TWNA 4RWIA 3SQQA 5A6OA 2C3LA 4C62A 3ORZA 4FG8A 2XJ0A 2XK4A 4G1WA 4UZHA 3IECA 3UYSA 3O8UA 3DGKA 3EZVA 3VRYA 2G9XA 3TNWA 3C4XA 4JR3A 4OTPA 4AZSA 2I7QA 4NIFA 1PXOA 2B54A 2RG5A 3EH9A 1ZYSA 1AD5A 3MPTA 3EFKA 1J7IA 4QMSA 1R78A 4TKSA 3KF4A 4F9CA 3NNXA 3LM5A 1SM2A 4C34A 5IKWA 3PXRA 1H24A 2VNYA 4G3DA 1PXLA 2RFSA 2WTWA 3G2FA 4P5ZA 5DN3A 5FEEA 2ZV8A 4NTSA 3OCSA 3NVKI 2X4FA 3NAXA 2W1ZA 3VUGA 4FTTA 2OH4A 2VWUA 2QC6A 2ZDUA 4YJPA 4EYJA 5LQFA 3TZ9A 2BZKB 5EW9A 3E3BX 3U51A 4BYJA 3QQGA 2QI8A 3UG2A 1M52A 2ZYBA 5HBJA 3OY1A 3PRFA 4GMYA 5CZHA 4RC2A 2WHBA 3HL7A 3Q53A 4DEEA 5EYMA 4EH2A 2ITQA 2B9HA 3MFSA 3Q5ZA 1U54B 2E9VA 2YACA 3A7GA 3PZEA 4FTLA 3FAAA 4KS8A 3BE2A 4ZSLA 2DS1A 2QONA 3IGGA 4C59A 4EC9A 3RM7A 3UBDA 3VS6A 1Q62A 4L01A 5AP7A 4IWQA 3FC2A 4MCVA 1U5RA 3C4WA 2JGZA 2GS6A 2UW0A 4JRNA 5BMSA 2QOKA 2H34A 3UC4A 1VJYA 5IPJA 1XBAA 2QR7A 5GIPE 2PK9A 4YZMA 4QMPA 3RPYA 2YZAA 3TTJA 5D12A 4OBPA 4LL0A 4M84A 3BHVA 3TG1A 4FTQA 1OMWA 3JUHA 4RGJA 1S9JA 4RPVA 2R3JA 3C5UA 3HDNA 4UY9A 5IA0A 1VEBA 4HW7A 5L2TA 3LCSA 3C9WA 2IZSA 1ZYJA 2ZVAA 4R7IA 4XV1A 5TF9A 4QP3A 5CU2A 4E4NA 5EHOA 2WIHA 3DXPA 3E5AA 3KL8A 4IACA 4OR5A 5C8KA 3FMNA 4FKTA 4X6QC 1QMZA 2F7XE 2GFCA 4CD0A 2G01A 5BUEA 3PA5A 3EWHA 5AAFA 4AZFA 3DAJA 2RFNA 4FKVA 5HI2A 4KIKA 3SX9A 3TZ7A 3ZS5A 4R6VA 2C3JA 3OEFX 4AZVA 4I23A 4DA5A 2XH5A 5IQHA 4EONA 3FZSA 2WTKB 5AR8A 1Y57A 1Q3DA 4IB1A 3C0HA 3MVMA 4U81A 2QURA 3QHRA 4TXCA 5C8MA 1GIHA 4Z3VA 2C0TA 4L3PA 3CR0A 2XK8A 5AUWA 4CLJA
chains in the Genus database with same CATH superfamily
3EN4A 4WNKA 1H25A 4K0YA 5ANKA 1W2FA 1XBCA 3E92A 3MA3A 4RWKA 3S2PA 3W2OA 4K1BA 5CEPA 4FIEA 3P5JC 3NPCA 4FZFB 5AR4A 3ATTA 1O6LA 2FH9A 2OWBA 2Y4IC 3GCPA 3F2NA 5FBNC 5FGKA 2JBOA 5H8EA 1G8KA 4FNYA 3ORMA 2LGCA 3CD3A 3UC3A 3EQCA 3F2RA 3UZRA 1S9IA 3QTUA 5KE0A 4TPTA 4O0TA 4X7QA 4A9YA 4UMPA 2B9IA 4B9DA 3R02A 3EQIA 5HIDA 2AC5A 5H3QA 3LFCA 4ANOA 4R5SA 4F4PA 5JK3A 2GQGA 2XKEA 4R8QA 5D1JA 2JEDA 5HCYA 5A46A 4HVIA 3AKKA 4PDYA 3TI1A 4PDPA 4RVTA 4BDDA 3BWFA 3U6IA 2RSVA 3E8CA 4NKAA 1JPAA 5J79A 1SVGA 4L67A 4YPDA 2CKOA 5IQCA 2VTQA 1PXNA 3NW7A 2WEVA 4FZAB 1GAGA 2ITPA 3PWDA 2W4JA 4QMWA 3LFBA 3RCDA 2O5KA 2YIWA 2BAKA 3E7VA 3KRRA 4KBAA 4C2VA 4FKWA 2I0VA 2WELA 3O51A 4F63A 4JAIA 1WBOA 4EHGA 1ZY5A 2HWOA 3RPSA 1KV2A 2KULA 3MY0A 4FSQA 5DI1A 2E2BA 2YLFA 1CKIA 3LXPA 4ZTQA 4BF2A 1FMOE 2PY3A 3NEWA 4E20A 2ITXA 5F20A 2O8YA 4QMZA 4ZJJA 2X0QA 2YLEA 3DK3A 4O7TA 4Y83A 3P9JA 4P7EA 4LOOA 2YEXA 3OCTA 3R8MA 2YJRA 4MXXA 3IW8A 3LMIA 2WU6A 1DM2A 3IG7A 3FY0A 1XH8A 2BFYA 3CTQA 2GNHA 4YSMA 3ZO4A 4AW5A 2IVSA 4LM5A 2ZB0A 3NIEA 3T3UA 3BYUA 4IDVA 4RZVA 5ETIA 5HNBA 4CKJA 3MH0A 1Y6BA 3VN9A 4H58A 4BKJA 3AGMA 3DFAA 4FEQA 4X2JA 3WZKA 4O84A 3UP7A 3UIMA 2IVTA 3V5WA 4DDGA 3P86A 4BI0A 4XOYA 1Q61A 4KABA 1XWSA 5KBRA 3KRWA 2X7GA 3DDQA 4AGDA 1OPLA 4YJTA 5C01A 2VAGA 4DF3A 3BU6A 4UN0C 2RL5A 3UGCA 3NUSA 3QCSA 4N70A 5CT0A 2CMWA 4C4IA 5JGAA 3FHRA 2WXVA 3GCVA 4FKUA 4M12A 1RQQA 5LVPA 2B0QA 1DAWA 3EQDA 5KMMA 3HUCA 4L8MA 4EC8A 1ZYLA 3PA4A 2RFDA 4XJ0A 2RIOA 1DI8A 4OW8A 3QLFA 4U97A 3TJDA 5CYIA 3ZU7A 3RMFA 4QYEA 3VBWA 2XAOA 2YCSA 3W0PA 3VRZA 3II5A 5A4EA 3IPHA 4F1MA 5AP5A 3VNTA 5KMIA 4A9SA 4NFMA 3F2AA 5KCVA 3RPRA 4PY1A 4XG2A 2JAMA 1YQJA 3IOPA 2IN6A 2UW4A 1RE8A 4FTAA 4O91A 2HXLA 1YDSE 4DFUA 1TQMA 2IW6A 3BLRA 1OB3A 3PVBA 4L7FA 2ZAZA 2IEWA 3LCTA 4DGLC 1JKLA 2CPKE 2C5YA 2O3PA 3ZH8A 4QMLA 4DEIA 5JGBA 5LVNA 4FTJA 4XX9A 4P2KA 4BDAA 4GS6A 4AACA 4EH9A 1OUKA 2X2KA 5ANGA 4RJ4A 5EHYA 5FTOA 4ZZOA 2W7XA 2V0DA 2X0OA 3AG9A 2YFXA 5A4TA 3TTIA 4EQMA 1W84A 1YI3A 3FMHA 5L8LA 4DH8A 2WMXA 4UALA 5FEDA 2X2LA 4O1OA 3V5PA 4EOQA 4FOCA 4LOPA 3LZBA 4GG7A 4AE6A 5IH5A 3BU5A 2J0IA 5FLFA 4G17A 3ZC6A 2W4OA 2RF9A 2W06A 4I0TA 1W8CA 4AOJA 4ASXA 3R7IA 3W8LA 4BDGA 4P90A 3ZDIA 3ZTXA 3GOPA 2BHHA 5A54A 3Q4ZA 4M15A 2C3KA 3QD2B 4DG2E 3CS9A 3OZ6A 4PMTA 4YBKA 3GCSA 3GQLA 4GK2A 3HRFA 4EK5A 4Z9LA 5LVOA 5HQ0A 4FKJA 3OOGA 3Q32A 2VNWA 3I81A 3VBYA 5EH0A 5H8BA 3R6XA 1OL7A 3VBQA 2OG8A 3ODZX 1CKJA 3Q04A 5L2IA 3S4QA 4IW0A 2R3NA 2YIRA 4I0RA 4YZBA 4AGWA 4RX5A 2ZM1A 5CU6A 5JZJA 3L9MA 2VO3A 5AM7A 5M4CA 1UNHA 4KRCA 5IH6A 5A14A 2GNLA 4QP1A 3PFYA 3NYNA 2C6MA 1T45A 4EH7A 4J95A 4RIOA 3BGZA 3D4QA 1STCE 1H26A 1IRKA 3GBZA 3K5UA 1YXSA 3DNEA 4FL3A 4L68A 4UV0A 3C4EA 4BIDA 4F08A 3AC5A 3S00A 1YI4A 2YDJA 3LJ0A 4J53A 5KKRC 4FIFA 3JPVA 3OTUA 4OTHA 4RSSA 3DKCA 1Q8UA 2PE1A 2XS0A 1R3CA 4ERWA 2W1EA 3C50A 1UU8A 3ORTA 5BV3A 4FTNA 1H1QA 2J5FA 3COMA 2R3IA 2V5QA 3R7GA 2CSNA 3GC0A 2X8IA 3L8VA 3PA3A 3R04A 3MH2A 3ACKA 4X2GA 4AA5A 4ALVA 4TYIA 3S0OA 2JDOA 4IWOA 3D2IA 4RT7A 5ACBC 2YM6A 4BN1A 4FTCA 4NUSA 3RK9A 4EZ5A 3NYVA 4O0RA 1ZOGA 4A9TA 2PZYA 2JIUA 2IZTA 5I9WA 5L6PA 2ZM3A 4W4XA 5HO6A 5KMLA 4D2SA 1OKWA 5DA3A 5JQ5A 2ITYA 4BDKA 3ENHA 5C8NA 5KMKA 3IOKA 3NNUA 3DLZA 3QZHA 2W1HA 4MXOA 4OGRA 3FKOA 1BI7A 3VO3A 4U42A 4F9WA 5I4NA 4FGRA 4QP9A 5DRDA 2XARA 1V0PA 3BHYA 2XBJA 4GFOA 4TN6A 4GK4A 5C9CA 2YWPA 2XEZA 4S32A 4GH2A 1BMKA 4PMSA 5DT3A 4QQ5A 3CSVA 1LEWA 4FNXA 4CFWA 5KZ0A 1PMNA 3OWPA 4ASEA 4ZTMA 5JFXA 1UNGA 2UV2A 5DRBA 4EHEA 5DEWA 3V5TA 3PXZA 4FG7A 3BRBA 1WVXA 3RGFA 3O7LD 3RHXA 3TL8A 4EBWA 3W18A 3AC2A 4EOJA 4CMUA 3OVVA 4AT5A 3QGWA 4BDFA 4OAUC 3ZLSA 4BL1A 1U4DA 3WF8A 3DBFA 3R22A 4ACMA 5CEKA 1CDKA 4L46A 5CU3A 3G0FA 5DLSA 4D4VA 1YVJA 2QU6A 4I24A 4PMMA 5J87A 4F64A 5BQ0A 4RA5A 3VS2A 5LWMA 4Q5HA 3F3ZA 3H30A 4F9BA 4QDVA 4PP9A 3DCVA 3Q3BA 3F3WA 1ZWSA 2VTIA 1SNUA 3ORKA 2WMQA 3UZTA 2BDJA 1G3NA 3RWQA 4MTAA 2B7AA 4XYFA 2J9MA 3GCQA 5AJQA 3A7HA 4C35A 1ZMUA 3QQUA 5K5NA 1KSWA 2W1CA 3FDNA 3QRIA 5HX8A 4CGAA 3FXXA 2P0CA 4WRSA 3HDMA 2VWIA 4FX3A 4O0XA 2OJ9A 4OTDA 3F5UA 4AP7A 4BC6A 5AV4A 1XO2B 3HA8A 2W1IA 5CY3A 3BGQA 4O96A 2XB7A 4GT4A 3ZO1A 4EH3A 4QPMA 3LM0A 5H8GA 3CY3A 4ITJA 5DHJA 2UZVA 2PVLA 4NEUA 3RKBA 4QQJA 3QKLA 1H8FA 3RP9A 3VQHA 2XNPA 2VUWA 4RIYB 4U5JA 4J96A 3ZRLA 4R3PA 3PJCA 4GKHA 2HY0A 3W0MA 1GZOA 2BALA 2YM4A 4G9RA 4WO5A 3ZO3A 3S1HA 4QTAA 3TXOA 4DHZA 4O0UA 3QHWA 4D4RA 3F3UA 5IZFA 3GU7A 4RMZA 4CTCA 3PP0A 4ERKA 3D14A 2OKRA 4W4WA 2AC3A 3RPVA 4RQVA 2E9UA 3BLAA 2C5VA 1ST4A 4J97A 2EXMA 5BVKA 4J98A 4YLLA 4O86A 5AR7A 4AFEA 4I3ZA 4GYIA 3T3VA 4E6DA 3DJ6A 2HIWA 5KBQA 3P78A 4FV9A 3U6HA 1F3MC 3LQ5A 5TT7A 2XJ2A 2E9PA 4AGUA 5J9ZA 2OI4X 4I93A 4DITA 2JC6A 2UZLA 3D7TA 4MQ2A 4PTEA 3VBTA 3WOWA 3WZJA 4QPSA 3UVPA 4C8BA 2W1DA 2PVFA 3MS9A 4GU9A 3MB7A 4IQ6A 4KBCA 2ERKA 3OG7A 2C0IA 2R7IA 2B55A 5IMEA 2IVVA 2OH0E 3QCXA 4TY1A 3ORLA 3A2CA 3NUPA 4CTBA 3G15A 4M97A 2NYAA 3RNYA 5EOBA 4A4XA 3ODYX 4CG9A 4QNYA 3EYGA 2QOLA 3ANQA 3R8PA 4FSMA 5HIEA 4KBKA 1PXJA 2GMXA 3K3IA 3KCKA 3LCOA 5E91A 4OTIA 1U5QA 2NO3A 3LCKA 4IDTA 1EH4A 5CQUA 4LV8A 2XNNA 2BZHB 3QC4A 4LV5A 3R30A 4MD8E 3WF7A 4YHFA 3VJNA 4APPA 2GDOA 3GFWA 4NM7A 3G5DA 4H3QA 5CAPA 5HLWA 5BYLA 4D58A 2UZWE 3EN9A 3PYYA 3PUFC 5DWRA 4RJ8A 4BBMA 4OAVB 4KS7A 4XG9A 5DYJA 5HCZA 4GIHA 5ETFA 3PSCA 3RAWA 3VHEA 4ALUA 4QMNA 4R3CA 5AR5A 3OWKA 3FPMA 3HECA 3ORNA 4I92A 2GSFA 4LGGA 3MH1A 1L3RE 4FT7A 4MXAA 4YJOA 2ZMCA 3NIZA 3QQHA 3O71A 1H1SA 3ANRA 4QP7A 2GNJA 3P0MA 3NRMA 4YTIA 3F3TA 2PMOX 3CKWA 4RIXB 1H0VA 5KHWA 4EYMA 4XRJA 1WAKA 4JT3A 4MBIA 4G31A 4ZLYA 2WMAA 3NYOA 4EHZA 4NL0A 2C6EA 4O4CA 4A4LA 4OTRA 5KUPA 5TO8A 2XIYA 2CJMA 4NM5A 4JL9A 4CVAA 4W4YA 2AYPA 2W1FA 4F6SA 3UPZA 5DG5A 2ZOQA 2OZAA 3PJ3A 1OPKA 2CKQA 2YITA 2VWYA 3QQLA 5HD7A 3EL8A 4D2PA 2Z8CA 5DR2A 3AT4A 5IEVA 4EJNA 3P08A 1WVYA 2NP8A 1LPUA 4QP4A 5CQWA 5GZAA 3SXFA 4U44A 3FV8A 5DFPA 5M4IA 4FGBA 4ZMFA 2QU5A 2RFEA 4GL9A 4PQNA 1UU7A 5DEYA 5JH6A 3BHTA 4GCJA 4GYGA 2R3QA 3EQHA 3OF0A 3V51A 3ZSIA 5GJDA 5M51A 1WBTA 4HYUA 4O81A 5KZIA 2R4BA 4NH1A 4IBMA 3U4WA 3KQ7A 2BKZA 4FTKA 4UBAA 4ANNA 5ITAA 5IUIA 1PMEA 5D41A 3AQVA 4TT7A 5HVKA 1ATPE 1H4LA 2VU3A 3ALNA 4DYMA 3HGKA 3ZLYA 5DE2A 4QMXA 5D7VA 3LFQA 3ZHPC 4KIOA 3SW4A 1FGIA 2GNIA 3TUDA 4B6LA 2W5BA 3G51A 3VUMA 4YGAA 4KB8A 4LQMA 3EB0A 4QYGA 4B4LA 3IW5A 3E8NA 2C1BA 2O2UA 4USDA 2C6TA 3W10A 2YZLA 4BTMA 2JIVA 3AOXA 3V8WA 3LJ2A 4OTGA 5GJGA 5A4LA 3ML1A 4F78A 2CGXA 2BRHA 3HV5A 3U8WA 1UWHA 3UZPA 4F9AA 4LFIA 1I44A 4FK6A 4KIKB 3OS3A 3C13A 2WU7A 3H4JA 4GV1A 4JBQA 2W99B 2VWXA 4DEDA 3DPKA 3ZFYA 5HO7A 4NJDA 2WO6A 1Q99A 2IZUA 3OEZA 4G5JA 2BRMA 1WBNA 4ZMEA 1ERKA 3SXSA 3OXTA 4V04A 4XBUA 3TKHA 5HVJA 3VS4A 1OGUA 5I3OA 2JKOA 3ZLXA 4F7NA 4R1YA 3HV6A 4RWLA 4UMQA 2CKPA 4CMOA 2BZJA 2QR8A 3KXMA 4D2TA 2J7TA 4J71A 3P1AA 3R2YA 3GU8A 1OPJA 2OFVA 3FMMA 3VUTA 5DT4A 4I6HA 5JEBA 4QMTA 4EOSA 1OIQA 3N4TA 4IZAA 4RJ5A 4EL9A 2O64A 3O0GA 2YDIA 4JQEA 5A3XA 3WIKA 3ITZA 2XCHA 3R00A 5CU4A 1ZLTA 4I21A 3BGPA 4GT3A 4LRKA 4F1TA 2B9JA 2WTDA 3WYYA 2FSTX 4IX4A 1UA2A 2OXDA 4PDSA 5K4IA 3DK7A 4J7BA 5AV3A 2I1MA 3TM0A 1GOLA 3BCEA 4MXCA 1T46A 5AMNA 3K2LA 3FLNC 2QCSA 4IE9A 3ZRKA 5HKMA 4AZEA 5CAQA 4ANLA 1O9UA 5CSWA 4R5YA 1TFFA 1OL1A 3M42A 3D15A 1UU3A 1PXPA 2P2HA 5I9VA 2WB8A 5HESA 1GZ8A 2REIA 1B6CB 5BVNA 3MTLA 1PMUA 2QKRA 3UDTA 4DH1A 3OROA 4IHPA 2W1GA 3MN3A 1YOMA 2YHVA 3RK5A 1OL6A 4EWHA 5DMZA 5HLNA 1NXKA 3SG9A 2NPQA 3QFVA 3HMNA 5HORA 3NUNA 3TWJA 4BICA 1BL7A 3QYWA 4QTCA 5BVFA 5AR3A 5EI8A 3AGLA 4MVFA 4IFGA 5E8VA 4V0GB 3QYZA 3UVQA 4YTHA 3JS2A 4E93A 3Q9XA 3FLWA 2CHLA 3VBVA 1SMHA 1YHSA 2CGUA 4FT5A 1F5QA 4M13A 3HMOA 1X8BA 3QRJA 4IH8A 5TE0A 4YO4A 5JT2A 2R3MA 3LCDA 4A9UA 4JS8A 2BR1A 4E8AA 4RLKA 4LMUA 4QT1A 3EQPA 5IQBA 4ALWA 5JMSA 1GIJA 4D4SA 2VD5A 3FE3A 5J5TA 1KV1A 1YDTE 2A2AA 4IZ5A 4C4GA 2QQ7A 2Z2WA 3NCGA 1NY3A 2VTRA 1WBVA 1OECA 3DT1A 3L8SA 4TRLA 5BVEA 1ZOHA 3R9NA 3ZO2A 3TNPC 4UMRA 4YZCA 5LMKC 5LCJA 3D7ZA 2VWVA 4QQTA 4IC8A 3I0QA 3WYXA 4AAYA 4EOOA 3R9OA 4MEDA 2ZDTA 4DEBA 5JN2A 4BCNA 1Y6AA 3ATSA 4DEGA 4LG4A 4PMPA 4Z7GA 2P33A 3FLSA 3PXKA 4QQCA 1MRVA 3ID6C 5C4KA 3QWJA 5HO8A 3U55A 3EQFA 4A9RA 5M4FA 4DFXE 4EK4A 3LXNA 5LARA 4QP8A 5HG8A 5CF8A 2X8DA 3SXRA 3VW8A 3SA0A 2WTCA 4PTCA 2PWLA 3C4CA 5HBEA 4CG8A 3LW0A 4BR3A 2CLXA 2B4SB 4F0GA 3WI6A 1OKVA 4APCA 1Y8YA 5L3AA 3QX2A 3IQ7A 4I22A 5HTIA 2IW9A 5GZ9A 3E7OA 2NNWB 3ULIA 3HLLA 1JAMA 4OTQA 3VC4A 5AEPA 5IEYA 1PYEA 3GCUA 3WZUA 4YR8A 4QMOA 3ZZEA 4QP6A 4ZLOA 2B52A 4HCVA 3DOGA 4QRCA 3A7FA 5AX3A 4JQ7A 4A4OA 4AA0A 2OK1A 4C36A 4UB7A 4CRSA 3ZFXA 3BIZA 3NNWA 2ZMDA 1PJKA 2JFLA 4P4CA 3VWAA 2IJMA 2F57A 3CGFA 3O23A 1ZXEA 4ORKA 4D5KA 4QO9A 2J6MA 2YISA 4BY9E 3ZXTA 4JR7A 4M67A 2BTSA 2SRCA 4N6ZA 4RVLA 3QC9A 2CNQA 3AXWA 1BKXA 3I60A 1QPDA 4ZAUA 3FEGA 3D83A 5AUVA 5HTCA 3EFWA 5J9YA 4E5BA 3THBA 3ZSHA 4CFXA 5HD4A 4ZS4A 4L3JA 5CWZA 4KAOA 4U43A 2Y0AA 5CVHA 3I0OA 5ANOA 4D28A 3RAHA 3MTFA 4YJQA 2E9NA 2PMLX 4LUDA 4JLCA 2OIBA 5HG7A 4U7ZA 2GS2A 2X7FA 3AD5A 1E1VA 2IWIA 4JQ8A 4M14A 3DV3A 3UVRA 2WD1A 4KUJA 3A99A 3NZ0A 3TUBA 1VZOA 3R7UA 1Q8WA 4G16A 3VS5A 1KE9A 1XJDA 4WUAA 4C4HA 2Y6OA 3OFMA 4I20A 4U45A 1YXTA 5EYCA 5AIRA 3UQCA 4ZK5A 1NVSA 2VRXA 2JBPA 3PIZA 4AW1A 4ZY4A 5CVGA 5L8KA 1SVEA 4U40A 4AAAA 2A27A 3EZRA 3MVHA 4FV5A 4TYHB 2HCKA 3VF9A 1ZYDA 3PVUA 3OWLA 4FV3A 3VF8A 2W5HA 2OSCA 3G90X 3BYMA 4JG7A 4L53A 3Q5IA 1DI9A 2GCDA 5HE2A 4EK3A 2OBJA 5E92A 5EG3A 5IQAA 4KIPA 1OL5A 4J1RA 4HOKA 4MWHA 5T3QA 5HGIA 4WNMA 3GOKA 3F88A 3FI8A 4YZDA 1P4OA 2R7BA 3GI3A 4CEGA 5J9LA 4DCAA 1YHVA 3L9PA 2V7AA 4KKHA 3OUNB 4LRJA 2Z60A 3SD0A 4O22A 4GVAA 2HWPA 3TNIA 3KK9A 2AQXA 3CY2A 4C38A 3CP9A 2UW9A 2G1TA 1W98A 4LUEA 3OT8A 2B1PA 5JFWA 4K2RA 1Y91A 3BI6A 5EDQA 2X81A 2AEGA 5AP1A 3UDSA 1SVHA 3WARA 5FD2A 3P4KA 2R3GA 2G2FA 5AUYA 3MI9A 4HNIA 4I1ZA 4E7WA 4IIRA 3IW4A 5HE0A 5IA2A 3MY5A 3ORXA 5FQDC 3LFEA 4K77A 3NVMB 2BZIB 3PFQA 4YC6A 4EUUA 4UYNA 5E7RA 4HCTA 4NT4A 4QYFA 1OKYA 1V0OA 4Y46A 1K3AA 3Q2JA 5AADA 3OHTA 2UW3A 2XBAA 4HVGA 2P2IA 3DQXA 3QZIA 4E6CA 1NVRA 3F6XA 2BHEA 3HVCA 2GNFA 3K54A 4DEHA 4JRVA 4EH6A 1BLXA 5E8TA 4FF8A 5C1QB 3HP2A 3W2RA 5JRQA 3PLAE 4HJOA 3ZLWA 4AUAA 3BLQA 3HRCA 1SNXA 3DS6A 4C3RA 5J1VA 4BWXA 2PVNA 3V8SA 4PTGA 2ZV2A 5I9UA 4O7SA 1PKDA 2ETMA 5M4UA 3KREA 2I0EA 4M66A 3QQKA 3EQRA 1XMMA 4BTFA 2UVYA 2HW6A 4FSWA 4BI2A 2WNTA 4BCIA 2QOIA 5HIBA 3ROCA 4AGCA 4FKIA 4CSVA 1WBSA 2OO8X 4BHNA 3B2WA 4Y5HA 4XS2A 4CT1A 2GTNA 4ZXTA 5K0KA 1XH9A 3E62A 1QL6A 1F0QA 4NJ3A 3QXPA 3IO7A 3DLSA 4FSRA 4DLJA 3BL9A 5JRSA 3RAIA 1BI8A 3ZCLA 4BWPA 4Z55A 4CYJA 2WTIA 1A48A 5KHXA 2Q0BA 4D55A 5M53A 4WG4A 5FWKK 4R7BA 3DBEA 4TW9A 3AC3A 3OT3A 4ACHA 5KMOA 3R9HA 4DN5A 3ENMA 4IFCA 5M55A 3R1SA 5J7BA 3ZYAA 4MAOA 1R0EA 2YAKA 4FICA 4Q9SA 4X3FC 5IISA 4FEWA 1UWJA 2PE0A 3QLGA 3ZC5A 4R78A 5HCXA 2R2PA 3QUEA 3WE8A 2UUEA 4EH8A 3FHIA 3V01A 5DH3A 1OL2A 3AT2A 3JVRA 3G9LX 2Z7SA 1CMKE 1YW2A 2A98A 4RIWA 1U54A 1PHKA 5AP0A 3VULA 4IJPA 3FQHA 4O7ZA 5GIOE 4QMVA 2ITOA 3WZDA 1FVVA 3VS0A 2XJ1A 3JYAA 4D1XA 4B99A 4UWYA 5E1SA 4EH4A 1KWPA 4Q5EA 5CAOA 1KOAA 2CN8A 4NK9A 1WCCA 4MNEB 3DB6A 3GUBA 2OJFE 3GU4A 3UDBA 3B2TA 3QCQA 4HYSA 3EYHA 3U87A 3HRBA 2XNOA 1PKGA 2I6LA 4FZ7A 5HBHA 1UNLA 4XH6A 4AWIA 2PZPA 4JX3A 3COHA 1U46A 3I4BA 3NLBA 4YJRA 3GENA 5T68A 4B0GA 2BCJA 5F1ZA 3FMLA 2OW3A 3F66A 4H05A 3FZ1A 4MX9A 4OT6A 1Z57A 3BX5A 4S31A 4TTHB 3PSDA 4RZWA 4W4VA 1V1KA 3CBLA 3GC9A 3QUDA 2BMCA 4C33A 3T8OA 1FVRA 5M09A 4JAJA 4NYEA 5KMNA 4I41A 5M07A 1JKSA 3WE4A 2VN9A 5IF1A 1Z9XA 2O63A 4J52A 4ANBA 4XHKB 4EOLA 5BVDA 4FTOA 2ACXA 4HZRA 4X3JA 4UEUA 2IG7A 1UVRA 2GTMA 2ITZA 3HMMA 1RDQE 5IA3A 2G15A 4TNDA 3EN5A 5EI6A 5CAUA 2JDTA 3SW7A 2VGOA 5ANJA 4GFGA 4QEBA 1KE8A 2R5TA 4WHZA 3C0GA 3OCGA 3REPA 4FTIA 2ESMA 3BV3A 3VUKA 4PNIA 2OZAB 5CF6A 3W2CA 1GNGA 2J0MB 4UXQA 4H36A 4RVMA 4FKPA 4FV4A 5FRIA 5HVYA 3ET7A 3F5GA 3IW7A 5DIAA 2HXQA 4WG3A 3F7WA 3TKIA 1MRYA 1OIRA 3WF5A 3E3PA 3N4UA 1M2RA 5CEQA 2BILB 4DG3E 2UW5A 4BZNA 5BMMA 5LMKA 4AXDA 1OGYA 4UWBA 2UVXA 3RAKA 2WPAA 3FYKX 3HX4A 2I0YA 3EQGA 4JX7A 5DR9A 5HHWA 2R3KA 2GHGA 5JKGA 5HG9A 1XH7A 3UYTA 3LJ1A 2QOFA 3LFAA 2WEIA 5IU2A 4L7SA 4BDEA 5LXMA 4AXCA 4E5WA 3AT3A 3ZEWA 1QCFA 1OBDA 1MQ4A 3CXWA 3DTWA 2W17A 3R83A 4ENYA 4DFBA 5GZ8A 4O6EA 4QTDA 4J8NA 1J7UA 2VZ6A 2XNMA 3MYGA 4EOIA 2WMVA 3ZFMA 3U6JA 4YURA 3W2PA 3QTZA 4ITIA 4K11A 4D1ZA 4F1OA 3G0EA 4BYIA 1W7HA 4MQ1A 4FKGA 5I9YA 4BTKA 4GG5A 3ORPA 4CCBA 4FYOA 1IR3A 2O0UA 4FR4A 2FA2A 4Y85A 3FI4A 5JZNA 3Q9WA 1IASA 3QCYA 3PG3A 5EW3A 1PYXA 3AMAA 5FEQA 4EKKA 5DVRA 2R9SA 4FVPA 1Q4LA 2X6EA 2C6OA 4LMNA 3WIGA 3BPRA 1REKA 4G3CA 2QOBA 3UNZA 3V5QA 4BBEA 4EORA 3N9XA 4EZ3A 1JNKA 3EMGA 2BRGA 3HA6A 3DNDA 3FUPA 3MIYA 4ASDA 4YHJA 1P2AA 2R64A 4JDHA 4RBLA 2YWVA 3DKOA 3Q4TA 4IAIA 4IM3A 5CNNA 4FKLA 2R0IA 2F2UA 4I5MA 4I6QA 3KXHA 3CGOA 3DTCA 4N0SA 3HNGA 3VW6A 1UKIA 4NCTC 4KWPA 3ALOA 4DE4A 1BL6A 4QMMA 3LQ3A 4G2FA 1GY3A 1MUOA 3RZBA 4WBOA 2FSLX 4GUEA 4BGQA 4MXYA 2C6DA 4GJ2A 5IA5A 4O2PA 4RX9A 3MH3A 5IDPA 4GK3A 2BDWA 2Y4PA 1LR4A 4AXFA 3EKKA 2QOOA 4WG5A 4RVKA 4FV6A 4YU2A 2WFYA 4BBFA 5LJJA 4F7LA 3QTRA 3R21A 4FV1A 3PE1A 1XH5A 3NFFB 3VQUA 2FUMA 3R8LA 3U9NA 3PPZA 4MD7E 3LXLA 4C37A 5J7HA 4U3YA 4HVSA 3I5ZA 3FL4A 4QMYA 1Q5KA 1OIUA 2OU7A 3DAEA 3V3VA 1G5SA 3Q6WA 4RX7A 4S34A 3VS1A 2V22A 5KKRB 3FSKA 2CCIA 3SGCA 2H6DA 3Q52A 3ZM9A 4YMJA 2PUNA 1MQBA 1R1WA 4HPTE 3PJ1A 5IQDA 2P55A 5EFQA 5J1WA 2IVUA 4IZYA 3R9RA 3TN8A 5CEMA 5M57A 2FB8A 3QRUA 2E9OA 3UOLA 3SRVB 1RW8A 2JDSA 4B8LA 2PVYA 4HZSA 3E88A 3LFNA 4G34A 2FYSA 2V55A 4H39A 3W0SA 2V62A 5FXSA 4AS0A 2Z7RA 3H9OA 4BJJB 2XNBA 3P23A 4DGMA 1L8TA 3QUPA 2Q0NA 4F0IA 1OKZA 2WMRA 3BYVA 5EW8A 4I4EA 3EQBA 4PL4A 3KN5A 3D5WA 1M7NA 3IDCA 4II5A 3R8VA 5I5ZA 3F82A 5HNGA 4YJUA 3FXZA 3KU2A 2WZJA 1WZYA 4M69B 4NSTA 3AD6A 2KTYA 3L1SA 3QTSA 4Q2AA 3NSZA 1HCKA